F490162

General Info

Members Datasets Scaffolds Average Seq Length
1106 634 2212 251

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_126973_c1|nmdc:mga0yw44_126973_c1_265_1026
Length 232
Sequence MPDAIRQIRTVVTAVGGDFGRTRADMRSDDMHRWLGAEATGSVGLKSSQFQLTDAERQLRDLAYPMIEPPLSRPAWKSVFGDYKALPSPWQQKVVFDRTMYGRTLIDEPHRSHSSRYAQLIEDVRNDITRFEPFFGSAIRVIDLDRKRDASMARVSELSPREQENSLIIQWVQQCLEQRVSSYRWALERLVIQAPDGMAADADRLIGELAAQTANPPVAAQPPYGRAVVTKG

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
82 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
83 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
112 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
113 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
114 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
181 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
182 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
183 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
184 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
190 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
191 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
192 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
193 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
194 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
199 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
200 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
216 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
217 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
218 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
219 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
220 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
221 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
247 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
248 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
249 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
250 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
251 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
252 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
253 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
254 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
255 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
256 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
257 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
258 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
259 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
260 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
261 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
266 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
277 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
285 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
286 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
289 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
290 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
291 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
292 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
293 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
294 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
295 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
304 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
323 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
324 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
330 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
333 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
334 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
335 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
336 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
337 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
338 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
339 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
340 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
341 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
359 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
360 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
361 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
362 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
365 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
366 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
367 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
368 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
369 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
377 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
378 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
379 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
380 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
381 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
382 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
383 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
384 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
385 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
386 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
387 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
390 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
391 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
392 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
393 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
394 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
395 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
396 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
397 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
398 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
399 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
400 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
401 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
402 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
403 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
404 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
405 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
406 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
407 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
408 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
409 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
410 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
411 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
412 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
413 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
414 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
415 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
416 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
417 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
418 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
419 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
422 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
423 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
424 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
425 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
426 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
427 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
428 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
429 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
430 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
431 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
432 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
433 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
434 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
435 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
436 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
437 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
438 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
439 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
440 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
441 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
442 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
443 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
444 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
445 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
446 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
447 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
448 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
449 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
450 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
451 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
452 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
453 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
454 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
455 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
456 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
457 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
458 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
459 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
460 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
461 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
462 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
463 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
464 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
465 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
466 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
467 2791355199
468 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
469 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
470 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
471 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
472 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
473 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
474 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
475 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
476 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
477 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
478 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
479 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
480 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
481 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
482 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
483 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
484 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
485 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
486 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
487 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
488 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
489 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
490 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
491 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
492 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
493 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
494 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
495 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
496 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
497 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
498 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
499 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
500 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
501 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
502 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
503 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
504 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
505 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
506 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
507 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
508 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
509 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
510 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
511 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
512 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
513 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
514 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
515 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
516 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
517 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
518 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
519 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
520 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
521 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
522 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
523 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
524 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
525 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
526 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
527 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
528 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
529 2904699407
530 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
531 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
532 2906610324
533 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
534 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
535 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
536 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
537 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
538 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
539 2922368715
540 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
541 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
542 2922425934
543 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
544 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
545 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
546 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
547 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
548 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
549 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
550 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
551 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
552 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
553 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
554 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
555 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
556 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
557 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
558 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
559 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
560 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
561 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
562 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
563 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
564 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
565 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
566 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
567 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
568 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
569 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
570 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
571 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
572 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
573 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
574 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
575 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
576 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
577 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
578 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
579 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
580 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
581 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
582 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
583 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
584 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
585 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
586 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
587 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
588 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
589 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
590 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
591 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
592 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
593 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
594 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
595 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
596 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
597 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
598 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
599 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
600 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
601 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
602 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
603 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
604 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
605 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
606 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
607 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
608 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
609 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
610 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
611 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
612 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
613 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
614 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
615 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
616 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
617 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
618 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
619 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
620 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
621 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
622 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
623 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
624 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
625 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
626 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
627 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
628 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
629 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
630 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
631 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
632 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
633 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
634 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.65
Metatranscriptomes 0.09
Isolates 17.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.66
Nodule 13.47
Rhizoplane 6.96
Rhizosphere 54.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_126973_c1 3300050492 Bacteria 1648
2 JGI24740J21852_10018161 3300001979 Bacteria 2502
3 JGI24735J21928_10044060 3300002067 Bacteria 1296
4 JGI25153J46596_10000493 3300003215 Bacteria 25100
5 JGI25153J46596_10000524 3300003215 Bacteria 24116
6 JGI25160J50197_1002408 3300003354 Bacteria 8720
7 JGI25404J52841_10012808 3300003659 Bacteria 1819
8 Ga0055539_1002633 3300003752 Bacteria 2680
9 Ga0055539_1002753 3300003752 Bacteria 2589
10 Ga0055531_10008823 3300003794 Bacteria 5248
11 Ga0065165_1001742 3300005262 Bacteria 21704
12 Ga0065165_1006522 3300005262 Bacteria 6087
13 Ga0070658_10035694 3300005327 Bacteria 4006
14 Ga0070658_10101572 3300005327 Bacteria 2378
15 Ga0070683_100004896 3300005329 Bacteria 11103
16 Ga0070683_100020769 3300005329 Bacteria 5850
17 Ga0070690_100137146 3300005330 Bacteria 1658
18 Ga0070670_100182387 3300005331 Bacteria 1823
19 Ga0070670_100188440 3300005331 Bacteria 1791
20 Ga0068869_100135118 3300005334 Bacteria 1899
21 Ga0068869_100415083 3300005334 Bacteria 1110
22 Ga0070680_100005549 3300005336 Bacteria 9548
23 Ga0070680_100075775 3300005336 Bacteria 2769
24 Ga0070682_100090396 3300005337 Bacteria 2002
25 Ga0068868_100025809 3300005338 Bacteria 4473
26 Ga0068868_100077925 3300005338 Bacteria 2652
27 Ga0070660_100059699 3300005339 Bacteria 2958
28 Ga0070660_100158454 3300005339 Bacteria 1823
29 Ga0070660_100500665 3300005339 Bacteria 1011
30 Ga0070689_100458702 3300005340 Bacteria 1085
31 Ga0070691_10033220 3300005341 Bacteria 2427
32 Ga0070661_100254682 3300005344 Bacteria 1355
33 Ga0070668_100075466 3300005347 Bacteria 2632
34 Ga0070668_100113322 3300005347 Bacteria 2160
35 Ga0070675_100530817 3300005354 Bacteria 1063
36 Ga0070671_100018845 3300005355 Bacteria 5610
37 Ga0070674_100032222 3300005356 Bacteria 3479
38 Ga0070659_100070608 3300005366 Bacteria 2775
39 Ga0070659_100222825 3300005366 Bacteria 1557
40 Ga0070667_100046842 3300005367 Bacteria 3638
41 Ga0070667_100361621 3300005367 Bacteria 1315
42 Ga0070709_10001565 3300005434 Bacteria 12350
43 Ga0070709_10021481 3300005434 Bacteria 3760
44 Ga0070714_100006692 3300005435 Bacteria 8923
45 Ga0070714_100045700 3300005435 Bacteria 3712
46 Ga0070713_100021879 3300005436 Bacteria 4930
47 Ga0070713_100239042 3300005436 Bacteria 1653
48 Ga0070710_10021394 3300005437 Bacteria 3370
49 Ga0070701_10061417 3300005438 Bacteria 1982
50 Ga0070711_100002918 3300005439 Bacteria 9851
51 Ga0070711_100028567 3300005439 Bacteria 3671
52 Ga0070700_100338336 3300005441 Bacteria 1111
53 Ga0070694_100169414 3300005444 Bacteria 1608
54 Ga0070663_100030433 3300005455 Bacteria 3699
55 Ga0070663_100066258 3300005455 Bacteria 2616
56 Ga0070663_100098278 3300005455 Bacteria 2180
57 Ga0070663_100113407 3300005455 Bacteria 2040
58 Ga0070678_100064696 3300005456 Bacteria 2711
59 Ga0070678_100116396 3300005456 Bacteria 2100
60 Ga0070678_100140386 3300005456 Bacteria 1932
61 Ga0070662_100164668 3300005457 Bacteria 1737
62 Ga0070662_100238399 3300005457 Bacteria 1458
63 Ga0070681_10132001 3300005458 Bacteria 2430
64 Ga0070681_10283521 3300005458 Bacteria 1567
65 Ga0070681_10452776 3300005458 Bacteria 1196
66 Ga0068867_100061310 3300005459 Bacteria 2792
67 Ga0070698_100188937 3300005471 Bacteria 1998
68 Ga0070679_100034939 3300005530 Bacteria 4985
69 Ga0070679_100055882 3300005530 Bacteria 3932
70 Ga0070679_100058880 3300005530 Bacteria 3828
71 Ga0070684_100011247 3300005535 Bacteria 7125
72 Ga0070684_100011751 3300005535 Bacteria 6984
73 Ga0070684_100128369 3300005535 Bacteria 2286
74 Ga0070697_100024320 3300005536 Bacteria 4821
75 Ga0068853_100009591 3300005539 Bacteria 7801
76 Ga0068853_100016388 3300005539 Bacteria 6098
77 Ga0068853_100018276 3300005539 Bacteria 5801
78 Ga0068853_100034597 3300005539 Bacteria 4289
79 Ga0070693_100495026 3300005547 Bacteria 866
80 Ga0070665_100175959 3300005548 Bacteria 2141
81 Ga0070665_100192583 3300005548 Bacteria 2039
82 Ga0070665_100330627 3300005548 Bacteria 1529
83 Ga0068855_100027258 3300005563 Bacteria 6836
84 Ga0068855_100090586 3300005563 Bacteria 3529
85 Ga0068855_100094570 3300005563 Bacteria 3445
86 Ga0068855_100149185 3300005563 Bacteria 2659
87 Ga0068857_100005613 3300005577 Bacteria 10723
88 Ga0068857_100012550 3300005577 Bacteria 7378
89 Ga0068857_100092843 3300005577 Bacteria 2702
90 Ga0068857_100162223 3300005577 Bacteria 2029
91 Ga0068854_100058673 3300005578 Bacteria 2779
92 Ga0068854_100352830 3300005578 Bacteria 1204
93 Ga0068856_100011604 3300005614 Bacteria 8546
94 Ga0068856_100045010 3300005614 Bacteria 4344
95 Ga0068856_100092522 3300005614 Bacteria 3009
96 Ga0068856_100245271 3300005614 Bacteria 1806
97 Ga0068856_100678693 3300005614 Bacteria 1051
98 Ga0070702_100230629 3300005615 Bacteria 1244
99 Ga0068852_100013998 3300005616 Bacteria 6155
100 Ga0068852_100159005 3300005616 Bacteria 2108
101 Ga0068852_100184620 3300005616 Bacteria 1963
102 Ga0068852_100192567 3300005616 Bacteria 1925
103 Ga0068859_100876290 3300005617 Bacteria 983
104 Ga0068864_100104685 3300005618 Bacteria 2514
105 Ga0068861_100065011 3300005719 Bacteria 2808
106 Ga0068861_100221384 3300005719 Bacteria 1600
107 Ga0068851_10003388 3300005834 Bacteria 7093
108 Ga0068851_10054245 3300005834 Bacteria 2042
109 Ga0068863_100223550 3300005841 Bacteria 1814
110 Ga0068858_100311171 3300005842 Bacteria 1504
111 Ga0068858_100986907 3300005842 Bacteria 825
112 Ga0068860_100001690 3300005843 Bacteria 23583
113 Ga0068860_100090838 3300005843 Bacteria 2909
114 Ga0068860_100273302 3300005843 Bacteria 1650
115 Ga0068860_100366317 3300005843 Bacteria 1421
116 Ga0068862_100138400 3300005844 Bacteria 2159
117 Ga0068862_100417479 3300005844 Bacteria 1258
118 Ga0081455_10020606 3300005937 Bacteria 6202
119 Ga0081455_10059791 3300005937 Bacteria 3216
120 Ga0081540_1002443 3300005983 Bacteria 15130
121 Ga0081540_1022677 3300005983 Bacteria 3703
122 Ga0081540_1058597 3300005983 Bacteria 1854
123 Ga0070717_10004653 3300006028 Bacteria 9951
124 Ga0070717_10005909 3300006028 Bacteria 8961
125 Ga0070717_10324239 3300006028 Bacteria 1373
126 Ga0075365_10013338 3300006038 Bacteria 4910
127 Ga0075365_10025171 3300006038 Bacteria 3765
128 Ga0075365_10060538 3300006038 Bacteria 2526
129 Ga0075365_10104918 3300006038 Bacteria 1938
130 Ga0075365_10147160 3300006038 Bacteria 1637
131 Ga0075368_10001735 3300006042 Bacteria 7020
132 Ga0075363_100001069 3300006048 Bacteria 9905
133 Ga0075364_10019008 3300006051 Bacteria 4310
134 Ga0075364_10087191 3300006051 Bacteria 2068
135 Ga0070715_10049815 3300006163 Bacteria 1796
136 Ga0070716_100006356 3300006173 Bacteria 5768
137 Ga0070712_100012950 3300006175 Bacteria 5316
138 Ga0070712_100034498 3300006175 Bacteria 3430
139 Ga0075362_10015697 3300006177 Bacteria 3086
140 Ga0075367_10231802 3300006178 Bacteria 1156
141 Ga0075369_10040374 3300006186 Bacteria 1994
142 Ga0075366_10084541 3300006195 Bacteria 1897
143 Ga0075366_10089410 3300006195 Bacteria 1844
144 Ga0097621_100458934 3300006237 Bacteria 1149
145 Ga0075370_10048966 3300006353 Bacteria 2395
146 Ga0075370_10051477 3300006353 Bacteria 2336
147 Ga0068871_100176536 3300006358 Bacteria 1834
148 Ga0075434_100190984 3300006871 Bacteria 2068
149 Ga0097620_100876401 3300006931 Bacteria 983
150 Ga0099825_1025638 3300006941 Bacteria 3252
151 Ga0099824_1007426 3300006942 Bacteria 14523
152 Ga0099822_1000695 3300006943 Bacteria 34127
153 Ga0099794_10016007 3300007265 Bacteria 3319
154 Ga0099794_10039334 3300007265 Bacteria 2244
155 Ga0099794_10144006 3300007265 Bacteria 1208
156 Ga0099795_10004696 3300007788 Bacteria 3555
157 Ga0099795_10018025 3300007788 Bacteria 2261
158 Ga0099795_10073919 3300007788 Bacteria 1291
159 Ga0105240_10004423 3300009093 Bacteria 21429
160 Ga0105240_10011106 3300009093 Bacteria 12589
161 Ga0105240_10017597 3300009093 Bacteria 9629
162 Ga0105240_10204460 3300009093 Bacteria 2312
163 Ga0105245_10045862 3300009098 Bacteria 3905
164 Ga0105247_10008016 3300009101 Bacteria 6455
165 Ga0105247_10029326 3300009101 Bacteria 3333
166 Ga0105247_10040580 3300009101 Bacteria 2845
167 Ga0105247_10237887 3300009101 Bacteria 1239
168 Ga0105247_10285886 3300009101 Bacteria 1139
169 Ga0105243_10028084 3300009148 Bacteria 4316
170 Ga0105243_10230185 3300009148 Bacteria 1644
171 Ga0105241_10010224 3300009174 Bacteria 6892
172 Ga0105241_10068354 3300009174 Bacteria 2753
173 Ga0105248_10064109 3300009177 Bacteria 4125
174 Ga0105248_10313853 3300009177 Bacteria 1766
175 Ga0105248_10509148 3300009177 Bacteria 1357
176 Ga0105237_10002625 3300009545 Bacteria 22120
177 Ga0105237_10011695 3300009545 Bacteria 9283
178 Ga0105237_10019836 3300009545 Bacteria 6941
179 Ga0105237_10020040 3300009545 Bacteria 6903
180 Ga0105237_10159685 3300009545 Bacteria 2252
181 Ga0105237_10210893 3300009545 Bacteria 1942
182 Ga0105237_10245005 3300009545 Bacteria 1794
183 Ga0105237_10330903 3300009545 Bacteria 1527
184 Ga0105237_10508048 3300009545 Bacteria 1212
185 Ga0105238_10007238 3300009551 Bacteria 11108
186 Ga0105238_10012675 3300009551 Bacteria 8509
187 Ga0105238_10107961 3300009551 Bacteria 2764
188 Ga0105238_10122645 3300009551 Bacteria 2578
189 Ga0105238_10319597 3300009551 Bacteria 1538
190 Ga0105238_10520229 3300009551 Bacteria 1192
191 Ga0105238_10661647 3300009551 Bacteria 1055
192 Ga0105249_10272165 3300009553 Bacteria 1688
193 Ga0099796_10019850 3300010159 Bacteria 2044
194 Ga0105239_10017364 3300010375 Bacteria 7959
195 Ga0105239_10032630 3300010375 Bacteria 5722
196 Ga0105239_10081556 3300010375 Bacteria 3560
197 Ga0105239_10116938 3300010375 Bacteria 2959
198 Ga0105239_10151068 3300010375 Bacteria 2592
199 Ga0105239_10205621 3300010375 Bacteria 2206
200 Ga0105239_10210904 3300010375 Bacteria 2177
201 Ga0105239_10313742 3300010375 Bacteria 1767
202 Ga0105239_10453998 3300010375 Bacteria 1454
203 Ga0105239_10619523 3300010375 Bacteria 1235
204 Ga0105246_10031447 3300011119 Bacteria 3513
205 Ga0157369_10019317 3300013105 Bacteria 7626
206 Ga0157374_10021649 3300013296 Bacteria 5725
207 Ga0157374_10033052 3300013296 Bacteria 4717
208 Ga0157378_10013138 3300013297 Bacteria 7245
209 Ga0157378_10379595 3300013297 Bacteria 1388
210 Ga0157378_10842799 3300013297 Bacteria 945
211 Ga0157378_10945682 3300013297 Bacteria 894
212 Ga0163162_10221800 3300013306 Bacteria 2020
213 Ga0157372_10174691 3300013307 Bacteria 2486
214 Ga0157372_10684273 3300013307 Bacteria 1194
215 Ga0157375_10042178 3300013308 Bacteria 4414
216 Ga0157375_10178117 3300013308 Bacteria 2277
217 Ga0157375_10211749 3300013308 Bacteria 2096
218 Ga0157375_10258971 3300013308 Bacteria 1901
219 Ga0163163_10010549 3300014325 Bacteria 8315
220 Ga0163163_10212317 3300014325 Bacteria 1984
221 Ga0163163_10388735 3300014325 Bacteria 1453
222 Ga0157380_10928742 3300014326 Bacteria 898
223 Ga0157377_10280311 3300014745 Bacteria 1092
224 Ga0157379_10179644 3300014968 Bacteria 1912
225 Ga0157379_10505077 3300014968 Bacteria 1121
226 Ga0157376_10016354 3300014969 Bacteria 5630
227 Ga0157376_10046230 3300014969 Bacteria 3589
228 Ga0163161_10022935 3300017792 Bacteria 4398
229 Ga0163161_10309413 3300017792 Bacteria 1246
230 Ga0206356_11911267 3300020070 Bacteria 1320
231 Ga0214542_1000442 3300021321 Bacteria 74244
232 Ga0214545_1000001 3300021324 Bacteria 1092817
233 Ga0214543_1000006 3300021327 Bacteria 443395
234 Ga0213873_10004210 3300021358 Bacteria 2664
235 Ga0213876_10000775 3300021384 Bacteria 21906
236 Ga0213875_10048107 3300021388 Bacteria 2001
237 Ga0209563_103021 3300025230 Bacteria 3604
238 Ga0207425_1020160 3300025245 Bacteria 1429
239 Ga0209677_101733 3300025253 Bacteria 9087
240 Ga0209677_102599 3300025253 Bacteria 6597
241 Ga0209148_1000505 3300025254 Bacteria 39613
242 Ga0209233_1001832 3300025261 Bacteria 8163
243 Ga0209233_1020586 3300025261 Bacteria 1726
244 Ga0209233_1021383 3300025261 Bacteria 1676
245 Ga0209455_1003223 3300025272 Bacteria 5893
246 Ga0209455_1004508 3300025272 Bacteria 4530
247 Ga0209564_1006998 3300025295 Bacteria 5916
248 Ga0209564_1010770 3300025295 Bacteria 4170
249 Ga0209758_1000011 3300025297 Bacteria 1049685
250 Ga0209758_1000359 3300025297 Bacteria 81559
251 Ga0209758_1000365 3300025297 Bacteria 80645
252 Ga0209758_1005289 3300025297 Bacteria 10084
253 Ga0209758_1006509 3300025297 Bacteria 8344
254 Ga0209758_1009818 3300025297 Bacteria 5858
255 Ga0209758_1011214 3300025297 Bacteria 5227
256 Ga0209758_1012729 3300025297 Bacteria 4668
257 Ga0209256_1004821 3300025299 Bacteria 8181
258 Ga0209256_1030025 3300025299 Bacteria 1505
259 Ga0207426_1000325 3300025302 Bacteria 91634
260 Ga0207426_1001581 3300025302 Bacteria 18301
261 Ga0207426_1076664 3300025302 Bacteria 917
262 Ga0209257_1001035 3300025304 Bacteria 37155
263 Ga0209257_1018942 3300025304 Bacteria 2617
264 Ga0207656_10018154 3300025321 Bacteria 2765
265 Ga0207653_10021473 3300025885 Bacteria 2048
266 Ga0207682_10146488 3300025893 Bacteria 1063
267 Ga0207692_10026869 3300025898 Bacteria 2704
268 Ga0207692_10054731 3300025898 Bacteria 2039
269 Ga0207692_10107893 3300025898 Bacteria 1540
270 Ga0207642_10027841 3300025899 Bacteria 2319
271 Ga0207688_10100317 3300025901 Bacteria 1671
272 Ga0207647_10064840 3300025904 Bacteria 2219
273 Ga0207699_10030759 3300025906 Bacteria 3008
274 Ga0207699_10083397 3300025906 Bacteria 1988
275 Ga0207699_10137953 3300025906 Bacteria 1599
276 Ga0207643_10073490 3300025908 Bacteria 1971
277 Ga0207705_10039725 3300025909 Bacteria 3373
278 Ga0207705_10116889 3300025909 Bacteria 1975
279 Ga0207654_10077916 3300025911 Bacteria 1988
280 Ga0207654_10087291 3300025911 Bacteria 1893
281 Ga0207707_10007729 3300025912 Bacteria 9359
282 Ga0207695_10000008 3300025913 Bacteria 1058268
283 Ga0207695_10004288 3300025913 Bacteria 19554
284 Ga0207695_10048296 3300025913 Bacteria 4496
285 Ga0207695_10115598 3300025913 Bacteria 2657
286 Ga0207695_10506900 3300025913 Bacteria 1089
287 Ga0207671_10004144 3300025914 Bacteria 14017
288 Ga0207671_10014923 3300025914 Bacteria 6109
289 Ga0207671_10039392 3300025914 Bacteria 3500
290 Ga0207671_10053722 3300025914 Bacteria 2985
291 Ga0207671_10087744 3300025914 Bacteria 2340
292 Ga0207671_10090732 3300025914 Bacteria 2302
293 Ga0207671_10110715 3300025914 Bacteria 2089
294 Ga0207671_10370199 3300025914 Bacteria 1138
295 Ga0207671_10426544 3300025914 Bacteria 1055
296 Ga0207693_10011065 3300025915 Bacteria 7312
297 Ga0207693_10030780 3300025915 Bacteria 4238
298 Ga0207693_10090370 3300025915 Bacteria 2400
299 Ga0207663_10011043 3300025916 Bacteria 4832
300 Ga0207663_10134024 3300025916 Bacteria 1716
301 Ga0207660_10002854 3300025917 Bacteria 11294
302 Ga0207660_10041167 3300025917 Bacteria 3237
303 Ga0207660_10274998 3300025917 Bacteria 1335
304 Ga0207657_10021237 3300025919 Bacteria 6115
305 Ga0207657_10055693 3300025919 Bacteria 3415
306 Ga0207649_10047102 3300025920 Bacteria 2652
307 Ga0207649_10083882 3300025920 Bacteria 2069
308 Ga0207652_10002796 3300025921 Bacteria 14640
309 Ga0207652_10040130 3300025921 Bacteria 3974
310 Ga0207652_10077000 3300025921 Bacteria 2909
311 Ga0207646_10045245 3300025922 Bacteria 3951
312 Ga0207694_10000050 3300025924 Bacteria 159920
313 Ga0207694_10065611 3300025924 Bacteria 2830
314 Ga0207694_10214543 3300025924 Bacteria 1568
315 Ga0207694_10545198 3300025924 Bacteria 973
316 Ga0207659_10667987 3300025926 Bacteria 889
317 Ga0207687_10018538 3300025927 Bacteria 4597
318 Ga0207687_10024493 3300025927 Bacteria 4033
319 Ga0207700_10005863 3300025928 Bacteria 7385
320 Ga0207700_10013718 3300025928 Bacteria 5284
321 Ga0207700_10066402 3300025928 Bacteria 2757
322 Ga0207700_10379900 3300025928 Bacteria 1235
323 Ga0207664_10049494 3300025929 Bacteria 3309
324 Ga0207664_10226604 3300025929 Bacteria 1623
325 Ga0207690_10049098 3300025932 Bacteria 2811
326 Ga0207706_10028051 3300025933 Bacteria 5030
327 Ga0207706_10088708 3300025933 Bacteria 2719
328 Ga0207706_10121618 3300025933 Bacteria 2295
329 Ga0207709_10039609 3300025935 Bacteria 2816
330 Ga0207709_10191201 3300025935 Bacteria 1454
331 Ga0207670_10397745 3300025936 Bacteria 1101
332 Ga0207704_10037422 3300025938 Bacteria 2803
333 Ga0207665_10005171 3300025939 Bacteria 8712
334 Ga0207665_10036306 3300025939 Bacteria 3277
335 Ga0207665_10053807 3300025939 Bacteria 2713
336 Ga0207665_10231497 3300025939 Bacteria 1358
337 Ga0207711_10126816 3300025941 Bacteria 2284
338 Ga0207711_10387259 3300025941 Bacteria 1298
339 Ga0207689_10012478 3300025942 Bacteria 7259
340 Ga0207689_10132995 3300025942 Bacteria 2048
341 Ga0207689_10334772 3300025942 Bacteria 1257
342 Ga0207661_10001004 3300025944 Bacteria 18641
343 Ga0207661_10004383 3300025944 Bacteria 9894
344 Ga0207667_10006495 3300025949 Bacteria 14146
345 Ga0207667_10063578 3300025949 Bacteria 3856
346 Ga0207667_10079766 3300025949 Bacteria 3392
347 Ga0207667_10079839 3300025949 Bacteria 3390
348 Ga0207651_10055829 3300025960 Bacteria 2715
349 Ga0207712_10154146 3300025961 Bacteria 1778
350 Ga0207668_10022003 3300025972 Bacteria 4074
351 Ga0207668_10061822 3300025972 Bacteria 2635
352 Ga0207668_10117503 3300025972 Bacteria 2007
353 Ga0207640_10042961 3300025981 Bacteria 2885
354 Ga0207677_10219116 3300026023 Bacteria 1525
355 Ga0207677_10335032 3300026023 Bacteria 1262
356 Ga0207703_10318629 3300026035 Bacteria 1423
357 Ga0207703_10323384 3300026035 Bacteria 1413
358 Ga0207639_10027521 3300026041 Bacteria 4143
359 Ga0207639_10033198 3300026041 Bacteria 3805
360 Ga0207639_10040580 3300026041 Bacteria 3475
361 Ga0207639_10071723 3300026041 Bacteria 2710
362 Ga0207639_10079198 3300026041 Bacteria 2596
363 Ga0207678_10015339 3300026067 Bacteria 6739
364 Ga0207678_10017723 3300026067 Bacteria 6253
365 Ga0207678_10023667 3300026067 Bacteria 5371
366 Ga0207678_10033448 3300026067 Bacteria 4479
367 Ga0207678_10068996 3300026067 Bacteria 3032
368 Ga0207678_10145973 3300026067 Bacteria 2019
369 Ga0207678_10367898 3300026067 Bacteria 1242
370 Ga0207708_10026762 3300026075 Bacteria 4367
371 Ga0207708_10037515 3300026075 Bacteria 3692
372 Ga0207702_10000002 3300026078 Bacteria 491507
373 Ga0207702_10047629 3300026078 Bacteria 3613
374 Ga0207702_10089379 3300026078 Bacteria 2694
375 Ga0207648_10022493 3300026089 Bacteria 5658
376 Ga0207648_10030101 3300026089 Bacteria 4812
377 Ga0207676_10050927 3300026095 Bacteria 3231
378 Ga0207676_10141664 3300026095 Bacteria 2059
379 Ga0207676_10247225 3300026095 Bacteria 1604
380 Ga0207674_10005330 3300026116 Bacteria 15297
381 Ga0207674_10020302 3300026116 Bacteria 7181
382 Ga0207674_10072264 3300026116 Bacteria 3465
383 Ga0207674_10171950 3300026116 Bacteria 2120
384 Ga0207675_100129709 3300026118 Bacteria 2390
385 Ga0207683_10122144 3300026121 Bacteria 2339
386 Ga0207683_10151462 3300026121 Bacteria 2093
387 Ga0207683_10162607 3300026121 Bacteria 2019
388 Ga0207698_10211534 3300026142 Bacteria 1745
389 Ga0207698_10246998 3300026142 Bacteria 1630
390 Ga0207698_10331671 3300026142 Bacteria 1429
391 Ga0209389_1000001 3300027296 Bacteria 463799
392 Ga0209389_1000546 3300027296 Bacteria 22899
393 Ga0209589_1000014 3300027357 Bacteria 227996
394 Ga0209589_1004919 3300027357 Bacteria 22899
395 Ga0209489_100014 3300027361 Bacteria 227996
396 Ga0209489_100040 3300027361 Bacteria 164986
397 Ga0209700_100007 3300027363 Bacteria 454608
398 Ga0209700_100024 3300027363 Bacteria 227996
399 Ga0209179_1002624 3300027512 Bacteria 2463
400 Ga0209179_1024600 3300027512 Bacteria 1195
401 Ga0209588_1008360 3300027671 Bacteria 3066
402 Ga0209588_1044094 3300027671 Bacteria 1442
403 Ga0268266_10025654 3300028379 Bacteria 5013
404 Ga0268266_10170686 3300028379 Bacteria 1974
405 Ga0268266_10311840 3300028379 Bacteria 1470
406 Ga0268266_10345044 3300028379 Bacteria 1398
407 Ga0268266_10461849 3300028379 Bacteria 1208
408 Ga0268265_10304422 3300028380 Bacteria 1436
409 Ga0268265_10437992 3300028380 Bacteria 1218
410 Ga0268264_10000048 3300028381 Bacteria 334457
411 Ga0268264_10063299 3300028381 Bacteria 3109
412 Ga0268264_10166894 3300028381 Bacteria 1988
413 Ga0265337_1004398 3300028556 Bacteria 5851
414 Ga0265326_10010130 3300028558 Bacteria 2804
415 Ga0265319_1002602 3300028563 Bacteria 9719
416 Ga0265334_10001927 3300028573 Bacteria 9850
417 Ga0265322_10004979 3300028654 Bacteria 3939
418 Ga0265336_10000588 3300028666 Bacteria 20447
419 Ga0307517_10003796 3300028786 Bacteria 23466
420 Ga0307517_10300805 3300028786 Bacteria 900
421 Ga0307515_10058433 3300028794 Bacteria 5554
422 Ga0265338_10000034 3300028800 Bacteria 244623
423 Ga0265324_10005063 3300029957 Bacteria 5771
424 Ga0265330_10042545 3300031235 Bacteria 2013
425 Ga0265332_10010143 3300031238 Bacteria 4193
426 Ga0265325_10074845 3300031241 Bacteria 1693
427 Ga0265339_10172562 3300031249 Bacteria 1081
428 Ga0307513_10236774 3300031456 Bacteria 1634
429 Ga0307509_10117333 3300031507 Bacteria 2648
430 Ga0307509_10342408 3300031507 Bacteria 1222
431 Ga0307509_10462367 3300031507 Bacteria 960
432 Ga0265313_10082590 3300031595 Bacteria 1456
433 Ga0307508_10000249 3300031616 Bacteria 65482
434 Ga0307508_10021355 3300031616 Bacteria 5886
435 Ga0265314_10023567 3300031711 Bacteria 4690
436 Ga0265314_10080754 3300031711 Bacteria 2146
437 Ga0265314_10099289 3300031711 Bacteria 1876
438 Ga0265342_10007820 3300031712 Bacteria 7768
439 Ga0265342_10058141 3300031712 Bacteria 2286
440 Ga0265342_10190859 3300031712 Bacteria 1118
441 Ga0307516_10088336 3300031730 Bacteria 2932
442 Ga0307516_10153293 3300031730 Bacteria 2062
443 Ga0307413_10186339 3300031824 Bacteria 1485
444 Ga0307413_10341204 3300031824 Bacteria 1152
445 Ga0307410_10189009 3300031852 Bacteria 1565
446 Ga0307406_10042388 3300031901 Bacteria 2841
447 Ga0307409_100257774 3300031995 Bacteria 1598
448 Ga0307415_100073962 3300032126 Bacteria 2406
449 Ga0307415_100239999 3300032126 Bacteria 1465
450 Ga0307507_10096352 3300033179 Bacteria 2503
451 Ga0307510_10000923 3300033180 Bacteria 31137
452 Ga0307510_10114422 3300033180 Bacteria 2427
453 Ga0307510_10200608 3300033180 Bacteria 1530
454 Ga0307510_10284947 3300033180 Bacteria 1120
455 Ga0315911_1000002 3300033442 Bacteria 926833
456 Ga0373926_0065076 3300035083 Bacteria 1333
457 Ga0373929_0036445 3300035085 Bacteria 1075
458 Ga0373949_0015382 3300035090 Bacteria 1709
459 Ga0373952_0010490 3300035092 Bacteria 1792
460 Ga0373936_0007741 3300035113 Bacteria 4034
461 Ga0373945_0012335 3300035116 Bacteria 2837
462 Ga0373953_0002005 3300035117 Bacteria 6052
463 Ga0373954_0012542 3300035118 Bacteria 3769
464 Ga0373954_0060030 3300035118 Bacteria 1793
465 Ga0373943_0009393 3300035170 Bacteria 4382
466 Ga0373943_0403344 3300035170 Bacteria 790
467 Ga0373946_0004971 3300035171 Bacteria 4788
468 Ga0373955_0031966 3300035172 Bacteria 2759
469 Ga0373942_0015643 3300035207 Bacteria 1852
470 Ga0373962_0114787 3300035242 Bacteria 853
471 Ga0373924_0062098 3300035410 Bacteria 1564
472 Ga0373931_0004151 3300035691 Bacteria 6579
473 Ga0373935_0004402 3300035692 Bacteria 8271
474 Ga0373935_0044444 3300035692 Bacteria 2799
475 Ga0373935_0056980 3300035692 Bacteria 2492
476 Ga0373935_0208833 3300035692 Bacteria 1352
477 Ga0373935_0534289 3300035692 Bacteria 854
478 Ga0373927_0001631 3300035695 Bacteria 16813
479 Ga0373927_0001997 3300035695 Bacteria 15042
480 Ga0373927_0027021 3300035695 Bacteria 3750
481 Ga0373927_0243692 3300035695 Bacteria 1181
482 Ga0373933_0000062 3300035724 Bacteria 64991
483 Ga0373933_0108766 3300035724 Bacteria 1727
484 Ga0373933_0151176 3300035724 Bacteria 1470
485 Ga0373947_0002775 3300035725 Bacteria 10472
486 Ga0373947_0039784 3300035725 Bacteria 2799
487 Ga0373937_0006410 3300036401 Bacteria 10154
488 Ga0373937_0043209 3300036401 Bacteria 4112
489 Ga0373937_0083596 3300036401 Bacteria 2953
490 Ga0373925_0030941 3300037068 Bacteria 3931
491 Ga0373925_0039820 3300037068 Bacteria 3478
492 Ga0373925_0382576 3300037068 Bacteria 1146
493 Ga0395899_0086606 3300037312 Bacteria 2275
494 Ga0395900_0001786 3300037418 Bacteria 24649
495 Ga0395900_0190517 3300037418 Bacteria 2080
496 Ga0395898_0009522 3300037466 Bacteria 10200
497 Ga0395898_0123913 3300037466 Bacteria 2476
498 Ga0395905_0123705 3300037471 Bacteria 2432
499 Ga0436364_0209550 3300037853 Bacteria 7718
500 Ga0395901_0012729 3300038443 Bacteria 8534
501 Ga0395901_0091412 3300038443 Bacteria 3186
502 Ga0395901_0097473 3300038443 Bacteria 3082
503 Ga0395901_1013279 3300038443 Bacteria 806
504 Ga0436365_0103019 3300039437 Bacteria 15753
505 Ga0436365_1088907 3300039437 Bacteria 1205
506 Ga0436365_1204061 3300039437 Bacteria 1510
507 Ga0436361_0524312 3300039447 Bacteria 880
508 Ga0436363_1557803 3300039450 Bacteria 1207
509 Ga0436362_0478151 3300039453 Bacteria 7751
510 Ga0451789_1189284 3300041443 Bacteria 774
511 Ga0451791_1550973 3300041451 Bacteria 1049
512 Ga0451795_0833275 3300041456 Bacteria 1128
513 Ga0451833_0551207 3300041491 Bacteria 814
514 Ga0451837_0594709 3300041494 Bacteria 889
515 Ga0451841_0446677 3300041498 Bacteria 1252
516 Ga0451849_0579101 3300041505 Bacteria 974
517 Ga0451843_0380754 3300041509 Bacteria 1067
518 Ga0439455_0096054 3300042012 Bacteria 816
519 Ga0439459_0030343 3300042438 Bacteria 1096
520 Ga0439464_0102993 3300042439 Bacteria 869
521 Ga0466969_0005482 3300044656 Bacteria 6751
522 Ga0466969_0080551 3300044656 Bacteria 1555
523 Ga0466972_0056853 3300044658 Bacteria 1880
524 Ga0466966_0021812 3300044684 Bacteria 4204
525 Ga0466966_0209104 3300044684 Bacteria 1179
526 Ga0466961_0000539 3300044693 Bacteria 24127
527 Ga0466963_0039622 3300044694 Bacteria 3086
528 Ga0466963_0186247 3300044694 Bacteria 1450
529 Ga0466971_0039016 3300044719 Bacteria 2132
530 Ga0466968_0015419 3300044735 Bacteria 3029
531 Ga0466968_0057238 3300044735 Bacteria 1676
532 Ga0466968_0104938 3300044735 Bacteria 1265
533 Ga0466957_0019778 3300044842 Bacteria 3963
534 Ga0466957_0206207 3300044842 Bacteria 1293
535 Ga0466957_0219029 3300044842 Bacteria 1256
536 Ga0466960_0036515 3300044901 Bacteria 2301
537 Ga0466959_0018133 3300045049 Bacteria 5165
538 Ga0466967_0015723 3300045976 Bacteria 5943
539 Ga0466967_0250809 3300045976 Bacteria 1691
540 Ga0466967_0778454 3300045976 Bacteria 950
541 Ga0495617_027358 3300046452 Bacteria 1918
542 Ga0495592_0007626 3300046454 Bacteria 8103
543 Ga0495603_0001689 3300046455 Bacteria 12972
544 Ga0495603_0013972 3300046455 Bacteria 4856
545 Ga0495603_0019223 3300046455 Bacteria 4136
546 Ga0495603_0154257 3300046455 Bacteria 1333
547 Ga0495590_0054970 3300046457 Bacteria 1391
548 Ga0495629_0002784 3300046459 Bacteria 13349
549 Ga0495629_0009469 3300046459 Bacteria 7124
550 Ga0495629_0323237 3300046459 Bacteria 1054
551 Ga0495638_0003859 3300046460 Bacteria 11628
552 Ga0495638_0057018 3300046460 Bacteria 2423
553 Ga0495641_0015327 3300046461 Bacteria 4098
554 Ga0495641_0050932 3300046461 Bacteria 1892
555 Ga0495651_0018811 3300046462 Bacteria 5351
556 Ga0495651_0033911 3300046462 Bacteria 3980
557 Ga0495651_0149193 3300046462 Bacteria 1687
558 Ga0495651_0249325 3300046462 Bacteria 1213
559 Ga0495653_0053042 3300046463 Bacteria 3104
560 Ga0495653_0168660 3300046463 Bacteria 1513
561 Ga0495653_0278953 3300046463 Bacteria 1097
562 Ga0495650_0042735 3300046471 Bacteria 1928
563 Ga0495580_0005616 3300046472 Bacteria 10331
564 Ga0495580_0151979 3300046472 Bacteria 1604
565 Ga0495582_0000228 3300046473 Bacteria 31086
566 Ga0495582_0042985 3300046473 Bacteria 2488
567 Ga0495639_0000261 3300046475 Bacteria 26039
568 Ga0495639_0067198 3300046475 Bacteria 1651
569 Ga0495639_0087685 3300046475 Bacteria 1457
570 Ga0495662_0001403 3300046476 Bacteria 11950
571 Ga0495664_0009409 3300046477 Bacteria 5467
572 Ga0495664_0035329 3300046477 Bacteria 2942
573 Ga0495664_0055560 3300046477 Bacteria 2356
574 Ga0495664_0056486 3300046477 Bacteria 2335
575 Ga0495585_0065368 3300046492 Bacteria 1993
576 Ga0495585_0141187 3300046492 Bacteria 1261
577 Ga0495585_0186808 3300046492 Bacteria 1062
578 Ga0495594_0010814 3300046499 Bacteria 4741
579 Ga0495583_0051712 3300046506 Bacteria 1872
580 Ga0495606_0010114 3300046507 Bacteria 7877
581 Ga0495606_0017203 3300046507 Bacteria 5476
582 Ga0495606_0107351 3300046507 Bacteria 1689
583 Ga0495606_0203820 3300046507 Bacteria 1125
584 Ga0495608_0005477 3300046511 Bacteria 9073
585 Ga0495608_0223352 3300046511 Bacteria 1181
586 Ga0495608_0273776 3300046511 Bacteria 1049
587 Ga0495616_0045271 3300046513 Bacteria 2228
588 Ga0495618_0024844 3300046514 Bacteria 3714
589 Ga0495618_0103105 3300046514 Bacteria 1826
590 Ga0495628_0011105 3300046516 Bacteria 7623
591 Ga0495628_0175475 3300046516 Bacteria 1623
592 Ga0495630_0001773 3300046517 Bacteria 15102
593 Ga0495631_0099015 3300046518 Bacteria 1255
594 Ga0495631_0177407 3300046518 Bacteria 913
595 Ga0495648_0003345 3300046524 Bacteria 14142
596 Ga0495648_0065075 3300046524 Bacteria 2145
597 Ga0495666_0073957 3300046526 Bacteria 1617
598 Ga0495666_0155606 3300046526 Bacteria 1061
599 Ga0495666_0165805 3300046526 Bacteria 1023
600 Ga0495652_0023429 3300046529 Bacteria 5471
601 Ga0495652_0038900 3300046529 Bacteria 4116
602 Ga0495665_0096405 3300046531 Bacteria 1553
603 Ga0495640_0007929 3300046533 Bacteria 8351
604 Ga0495640_0018338 3300046533 Bacteria 5195
605 Ga0495586_0077506 3300046535 Bacteria 1822
606 Ga0495645_0071072 3300046543 Bacteria 2510
607 Ga0495645_0446440 3300046543 Bacteria 816
608 Ga0495622_0005107 3300046557 Bacteria 6080
609 Ga0495622_0005725 3300046557 Bacteria 5760
610 Ga0495622_0157178 3300046557 Bacteria 1026
611 Ga0495633_0060297 3300046558 Bacteria 1778
612 Ga0495667_0019161 3300046559 Bacteria 4618
613 Ga0495667_0442407 3300046559 Bacteria 817
614 Ga0495668_0137661 3300046616 Bacteria 1336
615 Ga0495668_0367575 3300046616 Bacteria 790
616 Ga0495634_0003006 3300046642 Bacteria 13727
617 Ga0495634_0030251 3300046642 Bacteria 3741
618 Ga0495611_0069527 3300046648 Bacteria 1609
619 Ga0495611_0174568 3300046648 Bacteria 1004
620 Ga0495625_0066380 3300046660 Bacteria 2541
621 Ga0495635_0002773 3300046663 Bacteria 12015
622 Ga0495635_0008380 3300046663 Bacteria 7215
623 Ga0495659_0010660 3300046664 Bacteria 2955
624 Ga0495588_0007973 3300046674 Bacteria 4841
625 Ga0495588_0023568 3300046674 Bacteria 3049
626 Ga0495588_0084015 3300046674 Bacteria 1663
627 Ga0495657_0045053 3300046675 Bacteria 2995
628 Ga0495657_0152961 3300046675 Bacteria 1431
629 Ga0495657_0311292 3300046675 Bacteria 937
630 Ga0495599_0015121 3300046678 Bacteria 4784
631 Ga0495599_0050298 3300046678 Bacteria 2611
632 Ga0495599_0097376 3300046678 Bacteria 1834
633 Ga0495623_0009506 3300046679 Bacteria 6313
634 Ga0495623_0148326 3300046679 Bacteria 1389
635 Ga0495646_0051368 3300046680 Bacteria 2495
636 Ga0495647_0001733 3300046681 Bacteria 6766
637 Ga0495658_0000941 3300046683 Bacteria 15502
638 Ga0495669_0006028 3300046684 Bacteria 5056
639 Ga0495669_0063925 3300046684 Bacteria 1670
640 Ga0495613_0023147 3300046689 Bacteria 4629
641 Ga0495613_0055480 3300046689 Bacteria 2911
642 Ga0495613_0057266 3300046689 Bacteria 2862
643 Ga0495624_0001434 3300046690 Bacteria 18540
644 Ga0495624_0015606 3300046690 Bacteria 5124
645 Ga0495671_0200255 3300046692 Bacteria 968
646 Ga0495649_0006595 3300046694 Bacteria 7216
647 Ga0495589_0243720 3300046794 Bacteria 841
648 Ga0495600_0001030 3300046809 Bacteria 15062
649 Ga0495600_0121385 3300046809 Bacteria 1699
650 Ga0495600_0407069 3300046809 Bacteria 846
651 Ga0495581_0001142 3300047315 Bacteria 14513
652 Ga0495581_0054882 3300047315 Bacteria 2300
653 Ga0495604_0002639 3300047317 Bacteria 14394
654 Ga0495604_0041266 3300047317 Bacteria 3619
655 Ga0495674_0001977 3300047319 Bacteria 20157
656 Ga0495674_0068279 3300047319 Bacteria 3077
657 Ga0495672_0010283 3300047320 Bacteria 6684
658 Ga0495672_0101600 3300047320 Bacteria 1558
659 Ga0495676_0015850 3300047321 Bacteria 6699
660 Ga0495676_0122013 3300047321 Bacteria 1894
661 Ga0495680_0066841 3300047322 Bacteria 2750
662 Ga0495683_0021683 3300047323 Bacteria 3309
663 Ga0495683_0045801 3300047323 Bacteria 2197
664 Ga0495683_0139924 3300047323 Bacteria 1135
665 Ga0495687_007116 3300047443 Bacteria 6670
666 Ga0495675_0009532 3300047444 Bacteria 6049
667 Ga0495673_0021531 3300047469 Bacteria 3181
668 Ga0495673_0034017 3300047469 Bacteria 2359
669 Ga0495684_0030022 3300047471 Bacteria 4174
670 Ga0495686_0030223 3300047472 Bacteria 3520
671 Ga0495686_0070075 3300047472 Bacteria 2161
672 Ga0495686_0123169 3300047472 Bacteria 1543
673 Ga0495686_0155064 3300047472 Bacteria 1342
674 Ga0495686_0373267 3300047472 Bacteria 771
675 Ga0495593_0002128 3300047673 Bacteria 11830
676 Ga0495593_0023793 3300047673 Bacteria 3400
677 Ga0495602_0019615 3300048088 Bacteria 6709
678 Ga0495602_0040943 3300048088 Bacteria 4237
679 Ga0495614_0024733 3300048089 Bacteria 2592
680 Ga0495626_0190011 3300048091 Bacteria 847
681 Ga0496100_0002855 3300048903 Bacteria 8848
682 Ga0496100_0240246 3300048903 Bacteria 1336
683 Ga0496101_0015791 3300048904 Bacteria 5095
684 Ga0496101_0016053 3300048904 Bacteria 5055
685 Ga0496101_0047894 3300048904 Bacteria 3070
686 Ga0496101_0130181 3300048904 Bacteria 1910
687 Ga0496101_0235214 3300048904 Bacteria 1425
688 Ga0496102_0007639 3300048905 Bacteria 9235
689 Ga0496102_0026494 3300048905 Bacteria 5171
690 Ga0496102_0069908 3300048905 Bacteria 3223
691 Ga0496102_0104002 3300048905 Bacteria 2641
692 Ga0496102_0224685 3300048905 Bacteria 1770
693 Ga0496103_0069064 3300048906 Bacteria 2208
694 Ga0496103_0108148 3300048906 Bacteria 1764
695 Ga0496103_0158944 3300048906 Bacteria 1449
696 Ga0496104_0005151 3300048907 Bacteria 11419
697 Ga0496104_0007365 3300048907 Bacteria 9722
698 Ga0496104_0037573 3300048907 Bacteria 4528
699 Ga0496104_0093136 3300048907 Bacteria 2881
700 Ga0496104_0264771 3300048907 Bacteria 1631
701 Ga0496104_0361943 3300048907 Bacteria 1363
702 Ga0496104_0545604 3300048907 Bacteria 1070
703 Ga0496105_0008068 3300048908 Bacteria 8184
704 Ga0496105_0011031 3300048908 Bacteria 7122
705 Ga0496105_0118341 3300048908 Bacteria 2185
706 Ga0496105_0149469 3300048908 Bacteria 1920
707 Ga0496105_0236441 3300048908 Bacteria 1483
708 Ga0496105_0303281 3300048908 Bacteria 1283
709 Ga0496105_0366848 3300048908 Bacteria 1148
710 Ga0496106_0005044 3300048909 Bacteria 9768
711 Ga0496106_0039463 3300048909 Bacteria 3536
712 Ga0496106_0040831 3300048909 Bacteria 3476
713 Ga0496106_0052392 3300048909 Bacteria 3079
714 Ga0496106_0129964 3300048909 Bacteria 1975
715 Ga0496107_0003265 3300048910 Bacteria 10806
716 Ga0496107_0007983 3300048910 Bacteria 7305
717 Ga0496107_0248690 3300048910 Bacteria 1323
718 Ga0496108_0016710 3300048911 Bacteria 5994
719 Ga0496108_0079489 3300048911 Bacteria 2777
720 Ga0496108_0433434 3300048911 Bacteria 1148
721 Ga0496108_0906659 3300048911 Bacteria 756
722 Ga0496109_0012219 3300048912 Bacteria 7408
723 Ga0496109_0083699 3300048912 Bacteria 2942
724 Ga0496109_0329685 3300048912 Bacteria 1441
725 Ga0496110_0011522 3300048913 Bacteria 7242
726 Ga0496110_0018639 3300048913 Bacteria 5822
727 Ga0496110_0059515 3300048913 Bacteria 3367
728 Ga0496110_0123537 3300048913 Bacteria 2334
729 Ga0496110_0135369 3300048913 Bacteria 2226
730 Ga0496110_0237310 3300048913 Bacteria 1659
731 Ga0496110_0408116 3300048913 Bacteria 1238
732 Ga0496111_0040423 3300048914 Bacteria 3345
733 Ga0496111_0064252 3300048914 Bacteria 2662
734 Ga0496111_0515491 3300048914 Bacteria 879
735 Ga0496112_0000395 3300048915 Bacteria 28497
736 Ga0496112_0007941 3300048915 Bacteria 9461
737 Ga0496112_0026148 3300048915 Bacteria 5612
738 Ga0496112_0034003 3300048915 Bacteria 4959
739 Ga0496112_0039576 3300048915 Bacteria 4608
740 Ga0496112_0180951 3300048915 Bacteria 2072
741 Ga0496112_0247957 3300048915 Bacteria 1732
742 Ga0496112_0592487 3300048915 Bacteria 1041
743 Ga0496113_0014638 3300048916 Bacteria 5360
744 Ga0496113_0071846 3300048916 Bacteria 2632
745 Ga0496113_0204690 3300048916 Bacteria 1569
746 Ga0496113_0405966 3300048916 Bacteria 1094
747 Ga0496114_0024690 3300048917 Bacteria 4907
748 Ga0496114_0057160 3300048917 Bacteria 3256
749 Ga0496115_0018252 3300048918 Bacteria 5382
750 Ga0496115_0062527 3300048918 Bacteria 3003
751 Ga0496115_0096198 3300048918 Bacteria 2424
752 Ga0496115_0160388 3300048918 Bacteria 1858
753 Ga0496115_0298536 3300048918 Bacteria 1320
754 Ga0496116_0010996 3300048919 Bacteria 7532
755 Ga0496116_0113318 3300048919 Bacteria 1587
756 Ga0496117_0011530 3300048920 Bacteria 7910
757 Ga0496117_0074573 3300048920 Bacteria 2258
758 Ga0496118_0002114 3300048921 Bacteria 27831
759 Ga0496118_0030816 3300048921 Bacteria 4464
760 Ga0496118_0046355 3300048921 Bacteria 3383
761 Ga0496118_0063350 3300048921 Bacteria 2721
762 Ga0496119_0002144 3300048922 Bacteria 22179
763 Ga0496119_0028349 3300048922 Bacteria 3822
764 Ga0496119_0045981 3300048922 Bacteria 2731
765 Ga0496119_0084470 3300048922 Bacteria 1820
766 Ga0496120_0011010 3300048923 Bacteria 6248
767 Ga0496121_0000757 3300048924 Bacteria 59348
768 Ga0496121_0008568 3300048924 Bacteria 11981
769 Ga0496121_0027091 3300048924 Bacteria 5374
770 Ga0496121_0031249 3300048924 Bacteria 4868
771 Ga0496121_0108499 3300048924 Bacteria 2123
772 Ga0496121_0117645 3300048924 Bacteria 2013
773 Ga0496121_0168300 3300048924 Bacteria 1595
774 Ga0496121_0182767 3300048924 Bacteria 1511
775 Ga0496121_0366216 3300048924 Bacteria 955
776 Ga0496121_0374190 3300048924 Bacteria 941
777 Ga0496123_0096972 3300048926 Bacteria 1729
778 Ga0496124_0003589 3300048927 Bacteria 18856
779 Ga0496124_0054668 3300048927 Bacteria 3378
780 Ga0496124_0088195 3300048927 Bacteria 2536
781 Ga0496124_0168375 3300048927 Bacteria 1700
782 Ga0496124_0239890 3300048927 Bacteria 1349
783 Ga0496124_0392718 3300048927 Bacteria 966
784 Ga0496125_0010347 3300048928 Bacteria 9437
785 Ga0496125_0021673 3300048928 Bacteria 5984
786 Ga0496125_0044063 3300048928 Bacteria 3779
787 Ga0496125_0059339 3300048928 Bacteria 3084
788 Ga0496125_0195958 3300048928 Bacteria 1328
789 Ga0496125_0216738 3300048928 Bacteria 1237
790 Ga0496126_0003396 3300048929 Bacteria 20150
791 Ga0496126_0020776 3300048929 Bacteria 6427
792 Ga0496126_0024357 3300048929 Bacteria 5844
793 Ga0496126_0035100 3300048929 Bacteria 4703
794 Ga0496126_0140836 3300048929 Bacteria 2076
795 Ga0496126_0173210 3300048929 Bacteria 1837
796 Ga0496126_0181886 3300048929 Bacteria 1785
797 Ga0496126_0319702 3300048929 Bacteria 1276
798 Ga0496126_0695180 3300048929 Bacteria 791
799 Ga0495682_0031101 3300049460 Bacteria 1974
800 Ga0495682_0039266 3300049460 Bacteria 1738
801 Ga0501033_0060162 3300049570 Bacteria 2803
802 Ga0501034_0168055 3300049571 Bacteria 2161
803 Ga0501036_0022830 3300049572 Bacteria 5268
804 Ga0501037_0206110 3300049573 Bacteria 1388
805 Ga0501041_0228480 3300049577 Bacteria 1168
806 Ga0501043_0042357 3300049579 Bacteria 3578
807 Ga0501046_0034778 3300049580 Bacteria 4064
808 Ga0501067_0095198 3300049583 Bacteria 1653
809 Ga0501068_0092448 3300049584 Bacteria 1868
810 Ga0501044_0210734 3300049823 Bacteria 1897
811 Ga0501044_0577667 3300049823 Bacteria 1019
812 nmdc:mga03683_113408_c1 3300050489 Bacteria 1200
813 nmdc:mga00v17_114936_c1 3300050491 Bacteria 1710
814 nmdc:mga00v17_243693_c1 3300050491 Bacteria 1166
815 nmdc:mga0yw44_11776_c1 3300050492 Bacteria 4533
816 nmdc:mga0yw44_15270_c1 3300050492 Bacteria 4107
817 nmdc:mga0yw44_41677_c1 3300050492 Bacteria 2734
818 nmdc:mga0yw44_65594_c1 3300050492 Bacteria 2238
819 nmdc:mga0k408_15811_c1 3300050493 Bacteria 4178
820 nmdc:mga06z11_100082_c1 3300050494 Bacteria 1589
821 nmdc:mga07m45_25466_c1 3300050496 Bacteria 3244
822 nmdc:mga0qj67_792429_c1 3300050509 Bacteria 750
823 nmdc:mga0n895_197719_c1 3300050512 Bacteria 2042
824 nmdc:mga0rr50_231767_c1 3300050513 Bacteria 1528
825 nmdc:mga0sz30_31231_c1 3300050516 Bacteria 2204
826 nmdc:mga0sz30_45622_c1 3300050516 Bacteria 1849
827 Ga0495601_0028181 3300053077 Bacteria 3477
828 Ga0495601_0039332 3300053077 Bacteria 2961
829 Ga0495612_0003593 3300053078 Bacteria 6427
830 Ga0500610_0148938 3300053079 Bacteria 1175
831 Ga0500610_0224084 3300053079 Bacteria 887
832 Ga0500635_0000944 3300053080 Bacteria 7020
833 Ga0500635_0170183 3300053080 Bacteria 839
834 Ga0495595_0014428 3300053084 Bacteria 3352
835 Ga0495595_0043440 3300053084 Bacteria 2061
836 Ga0495619_0016517 3300053085 Bacteria 4674
837 Ga0495619_0034063 3300053085 Bacteria 3310
838 Ga0500643_000046 3300053087 Bacteria 150388
839 Ga0500646_0035225 3300053090 Bacteria 1390
840 Ga0500646_0042512 3300053090 Bacteria 1284
841 Ga0500647_0194661 3300053091 Bacteria 923
842 Ga0500651_0041079 3300053093 Bacteria 2915
843 Ga0500566_0000048 3300053094 Bacteria 58542
844 Ga0500566_0011872 3300053094 Bacteria 5131
845 Ga0500566_0032219 3300053094 Bacteria 3056
846 Ga0500566_0125818 3300053094 Bacteria 1377
847 Ga0500640_032464 3300053095 Bacteria 2292
848 Ga0500641_0024524 3300053096 Bacteria 2326
849 Ga0500641_0025637 3300053096 Bacteria 2282
850 Ga0500641_0073184 3300053096 Bacteria 1445
851 Ga0500648_254061 3300053097 Bacteria 823
852 Ga0500554_005519 3300053102 Bacteria 2766
853 Ga0500554_010002 3300053102 Bacteria 2292
854 Ga0500555_002736 3300053103 Bacteria 5066
855 Ga0500555_068118 3300053103 Bacteria 944
856 Ga0500556_0060030 3300053104 Bacteria 1398
857 Ga0500557_000020 3300053105 Bacteria 91933
858 Ga0500572_000352 3300053111 Bacteria 16420
859 Ga0500595_000494 3300053119 Bacteria 24038
860 Ga0500595_011389 3300053119 Bacteria 3485
861 Ga0500608_186425 3300053122 Bacteria 872
862 Ga0500614_006445 3300053123 Bacteria 2469
863 Ga0500614_026077 3300053123 Bacteria 1394
864 Ga0500621_079585 3300053126 Bacteria 1315
865 Ga0500621_113545 3300053126 Bacteria 1056
866 Ga0500642_0000057 3300053130 Bacteria 67011
867 Ga0500642_0069785 3300053130 Bacteria 1596
868 Ga0500655_006315 3300053133 Bacteria 2134
869 Ga0500559_0001516 3300053136 Bacteria 13020
870 Ga0500559_0007361 3300053136 Bacteria 4881
871 Ga0500559_0014275 3300053136 Bacteria 3356
872 Ga0500559_0016085 3300053136 Bacteria 3159
873 Ga0500559_0074873 3300053136 Bacteria 1530
874 Ga0500559_0083816 3300053136 Bacteria 1452
875 Ga0500564_093347 3300053138 Bacteria 1337
876 Ga0500564_096895 3300053138 Bacteria 1308
877 Ga0500568_0043558 3300053139 Bacteria 1793
878 Ga0500573_0028789 3300053140 Bacteria 3200
879 Ga0500589_017802 3300053147 Bacteria 3207
880 Ga0500590_067855 3300053148 Bacteria 1779
881 Ga0500590_164063 3300053148 Bacteria 985
882 Ga0500603_000041 3300053150 Bacteria 30524
883 Ga0500603_000138 3300053150 Bacteria 17480
884 Ga0500603_007223 3300053150 Bacteria 2435
885 Ga0500616_0027991 3300053153 Bacteria 3109
886 Ga0500619_038323 3300053154 Bacteria 1501
887 Ga0500620_008335 3300053155 Bacteria 2612
888 Ga0500622_0006107 3300053156 Bacteria 7070
889 Ga0500630_001433 3300053159 Bacteria 11319
890 Ga0500638_004267 3300053162 Bacteria 5471
891 Ga0500639_000228 3300053163 Bacteria 27840
892 Ga0500639_007270 3300053163 Bacteria 5757
893 Ga0500636_0000173 3300053177 Bacteria 34092
894 Ga0500636_0092115 3300053177 Bacteria 1734
895 Ga0500636_0222696 3300053177 Bacteria 981
896 Ga0500637_0000162 3300053178 Bacteria 24729
897 Ga0500576_132220 3300053725 Bacteria 964
898 Ga0500625_000568 3300053729 Bacteria 10420
899 Ga0500645_012439 3300053730 Bacteria 2749
900 Ga0500552_001722 3300053733 Bacteria 2092
901 Ga0500596_000465 3300053735 Bacteria 7540
902 Ga0500596_003290 3300053735 Bacteria 3093
903 Ga0500596_006241 3300053735 Bacteria 2033
904 Ga0500596_014667 3300053735 Bacteria 1177
905 Ga0500599_000186 3300053736 Bacteria 5762
906 Ga0500601_000125 3300053737 Bacteria 15831
907 Ga0500601_002147 3300053737 Bacteria 2117
908 Ga0500587_007015 3300053739 Bacteria 1477
909 Ga0500661_006887 3300055283 Bacteria 2108
910 Ga0501082_0672737 3300060353 Bacteria 906
911 Ga0466962_0241683 3300061719 Bacteria 886
912 2507507783 2507262055 Bacteria 8048963
913 2508541907 2508501009 Bacteria 7784016
914 2509153342 2508501128 Bacteria 8613869
915 2511397345 2511231028 Bacteria 8046582
916 2513622931 2513237092 Bacteria 8341956
917 2513639250 2513237094 Bacteria 8789602
918 2513647390 2513237095 Bacteria 8976980
919 2513653955 2513237096 Bacteria 8722461
920 2513676225 2513237098 Bacteria 9902361
921 2513695775 2513237101 Bacteria 7952346
922 2513719361 2513237104 Bacteria 10034502
923 2513856389 2513237137 Bacteria 9558895
924 2513878176 2513237139 Bacteria 8737671
925 2513891405 2513237141 Bacteria 8496279
926 2513918295 2513237145 Bacteria 8979722
927 2514009556 2513237161 Bacteria 8871253
928 2517891475 2517572143 Bacteria 9484767
929 2524470317 2524023210 Bacteria 9029266
930 2528852644 2528768022 Bacteria 10457665
931 2617346673 2617270735 Bacteria 9163226
932 2617372600 2617270741 Bacteria 8201522
933 2671118759 2667528175 Bacteria 7532676
934 2723847240 2721755755 Bacteria 8322773
935 2728754854 2728368998 Bacteria 8720350
936 2745080636 2744054633 Bacteria 8678936
937 2793064478 2791355196 Bacteria 7323613
938 2793066843 2791355197 Bacteria 8420563
939 2793084171
940 2805919181 2802429603 Bacteria 8777136
941 2818236426 2816332527 Bacteria 8933356
942 2824605385 2824600985 Bacteria 8488197
943 2824613587 2824609381 Bacteria 8672835
944 2824626256 2824617872 Bacteria 8814715
945 2824634699 2824626560 Bacteria 8813858
946 2824643310 2824635225 Bacteria 8785348
947 2824651592 2824644064 Bacteria 8743947
948 2824657605 2824653114 Bacteria 8493680
949 2824670657 2824661429 Bacteria 9877870
950 2824675905 2824671348 Bacteria 8369588
951 2824683020 2824679649 Bacteria 8248951
952 2824692100 2824687955 Bacteria 8360029
953 2824700455 2824696289 Bacteria 8335049
954 2824710333 2824704595 Bacteria 9667483
955 2824722106 2824714736 Bacteria 8717648
956 2824731583 2824723954 Bacteria 8758240
957 2824735826 2824732956 Bacteria 7810675
958 2824746981 2824746037 Bacteria 7911610
959 2824755597 2824753945 Bacteria 9787441
960 2824766260 2824763712 Bacteria 9792355
961 2824777416 2824773399 Bacteria 8360218
962 2838128925 2838122688 Bacteria 8803140
963 2841944927 2841941048 Bacteria 8688029
964 2841953352 2841949485 Bacteria 8680857
965 2841959820 2841957949 Bacteria 8652217
966 2841972176 2841966195 Bacteria 8673214
967 2841978077 2841974524 Bacteria 8931498
968 2841986300 2841983080 Bacteria 8395090
969 2842040527 2842038055 Bacteria 8002051
970 2842046527 2842045827 Bacteria 8006841
971 2844319893 2844315083 Bacteria 8138177
972 2847937201 2847930680 Bacteria 9342022
973 2847947614 2847939898 Bacteria 8606328
974 2874598890 2874590934 Bacteria 8299676
975 2874607256 2874604998 Bacteria 7834745
976 2874614703 2874612657 Bacteria 8252029
977 2874622214 2874620515 Bacteria 8290088
978 2874635158 2874628541 Bacteria 8630250
979 2874650662 2874645413 Bacteria 8214782
980 2876764160 2876761206 Bacteria 10111113
981 2876778929 2876771140 Bacteria 8287509
982 2876824176 2876818435 Bacteria 8274608
983 2879082722 2879074833 Bacteria 8279565
984 2879089134 2879083081 Bacteria 8587928
985 2879105589 2879099564 Bacteria 10442239
986 2879114592 2879110137 Bacteria 8907982
987 2881364817 2881364244 Bacteria 7710352
988 2881671878 2881665667 Bacteria 8175609
989 2885369845 2885366525 Bacteria 8326213
990 2885377821 2885374607 Bacteria 8927485
991 2885390306 2885383462 Bacteria 9473874
992 2885412317 2885409591 Bacteria 9235467
993 2888385325 2888378607 Bacteria 9652610
994 2888392925 2888388044 Bacteria 7304136
995 2888425463 2888419890 Bacteria 7857137
996 2889038148 2889033259 Bacteria 9099371
997 2903730434 2903727486 Bacteria 8281579
998 2903758743 2903748898 Bacteria 9972761
999 2903772999 2903768456 Bacteria 9749579
1000 2904667826 2904666416 Bacteria 8226587
1001 2904704826
1002 2904712111 2904711408 Bacteria 9771557
1003 2906609764 2906602504 Bacteria 8295279
1004 2906616651
1005 2906632087 2906626472 Bacteria 8826946
1006 2906638231 2906635258 Bacteria 8601019
1007 2906646986 2906643746 Bacteria 8722424
1008 2906666978 2906660503 Bacteria 8595048
1009 2908741816 2908739725 Bacteria 8628932
1010 2908781048 2908775508 Bacteria 8092255
1011 2922372556
1012 2922387473 2922386360 Bacteria 7017218
1013 2922397194 2922393267 Bacteria 8285685
1014 2922431326
1015 2929620895 2929615660 Bacteria 9193770
1016 2929626274 2929624759 Bacteria 9339455
1017 2932784849 2932784394 Bacteria 9704911
1018 2932805810 2932801729 Bacteria 7987968
1019 2932809883 2932809354 Bacteria 9135765
1020 2932818374 2932818245 Bacteria 9955613
1021 2932828686 2932828146 Bacteria 9745859
1022 2933583235 2933577622 Bacteria 9116884
1023 2935609706 2935608549 Bacteria 8203142
1024 2935619894 2935616580 Bacteria 9032984
1025 2935633919 2935630451 Bacteria 8169952
1026 2935638876 2935638405 Bacteria 10015038
1027 2935666274 2935665750 Bacteria 9571747
1028 2935676681 2935675223 Bacteria 9928132
1029 2935685064 2935684952 Bacteria 9590419
1030 2935694759 2935694250 Bacteria 9291695
1031 2935703881 2935703347 Bacteria 10242284
1032 2935713617 2935713505 Bacteria 9608509
1033 2935724237 2935722832 Bacteria 9608746
1034 2935733405 2935732158 Bacteria 9706831
1035 2935742784 2935741537 Bacteria 9707219
1036 2935751029 2935750917 Bacteria 9590372
1037 2935760442 2935760218 Bacteria 9817913
1038 2935772065 2935769743 Bacteria 7878163
1039 2935784242 2935777560 Bacteria 8077691
1040 2935787547 2935785616 Bacteria 7962367
1041 2935796179 2935793552 Bacteria 8012592
1042 2935802018 2935801545 Bacteria 9301974
1043 2935810787 2935810662 Bacteria 9401221
1044 2935822868 2935819856 Bacteria 8261050
1045 2935828370 2935827899 Bacteria 10038562
1046 2935839785 2935837841 Bacteria 9454360
1047 2935848450 2935847175 Bacteria 8228321
1048 2935857791 2935855204 Bacteria 9035059
1049 2935868867 2935864058 Bacteria 9784707
1050 2935874282 2935873716 Bacteria 9632195
1051 2935883821 2935883170 Bacteria 7964738
1052 2935909746 2935908558 Bacteria 8568796
1053 2935917470 2935916978 Bacteria 9113783
1054 2935927227 2935926038 Bacteria 8601059
1055 2935936929 2935934488 Bacteria 8602579
1056 2935944768 2935942939 Bacteria 8599779
1057 2935953205 2935951376 Bacteria 8602333
1058 2935970045 2935967501 Bacteria 8603075
1059 2935980330 2935975950 Bacteria 8347125
1060 2935992792 2935992306 Bacteria 9802711
1061 2936002706 2936002035 Bacteria 9362176
1062 2936037793 2936037263 Bacteria 9446081
1063 2940558168 2940556831 Bacteria 9590747
1064 2941510778 2941507105 Bacteria 8166816
1065 2941518162 2941515067 Bacteria 8166720
1066 2941526967 2941523033 Bacteria 8169134
1067 2941540874 2941538514 Bacteria 9402094
1068 3005484922 3005483717 Bacteria 7877331
1069 3005508541 3005506211 Bacteria 6943378
1070 3005587197 3005587118 Bacteria 7794411
1071 3005600172 3005594810 Bacteria 8716512
1072 3005715684 3005710791 Bacteria 7622528
1073 3005723034 3005718088 Bacteria 8283608
1074 8006928782 8006926726 Bacteria 6749210
1075 8006939589 8006933436 Bacteria 10410654
1076 8006968398 8006964411 Bacteria 8966052
1077 8006979340 8006973647 Bacteria 10679141
1078 8006989234 8006984368 Bacteria 9651211
1079 8006994844 8006994254 Bacteria 8309700
1080 8016520797 8016511872 Bacteria 9921665
1081 8016534009 8016530956 Bacteria 8155261
1082 8016547234 8016539877 Bacteria 8155419
1083 8016554899 8016548790 Bacteria 8155074
1084 8016563263 8016557553 Bacteria 8154380
1085 8016572350 8016566248 Bacteria 8158151
1086 8016576528 8016575299 Bacteria 8154085
1087 8016601017 8016595262 Bacteria 8149947
1088 8016615466 8016613128 Bacteria 8794220
1089 8016625750 8016622563 Bacteria 7999408
1090 8017064793 8017057580 Bacteria 10023680
1091 8019533776 8019530166 Bacteria 8155624
1092 8019545889 8019538911 Bacteria 7872763
1093 8019552837 8019547302 Bacteria 7996444
1094 8019565482 8019555841 Bacteria 9642137
1095 8019575575 8019565922 Bacteria 9639779
1096 8019591923 8019586578 Bacteria 10212056
1097 8019599361 8019597564 Bacteria 10041141
1098 8019608997 8019608314 Bacteria 10042931
1099 8019649216 8019648815 Bacteria 10014479
1100 8019661311 8019659431 Bacteria 8577854
1101 8019690937 8019687851 Bacteria 8712826
1102 8055745242 8055742211 Bacteria 9226248
1103 8056679412 8056673599 Bacteria 7871253
1104 8056684933 8056681323 Bacteria 8472857
1105 8056693438 8056689827 Bacteria 6712655
1106 8056968913 8056967851 Bacteria 9038162
1107 nmdc:mga0yw44_126973_c1
1108 JGI24740J21852_10018161
1109 JGI24735J21928_10044060
1110 JGI25153J46596_10000493
1111 JGI25153J46596_10000524
1112 JGI25160J50197_1002408
1113 JGI25404J52841_10012808
1114 Ga0055539_1002633
1115 Ga0055539_1002753
1116 Ga0055531_10008823
1117 Ga0065165_1001742
1118 Ga0065165_1006522
1119 Ga0070658_10035694
1120 Ga0070658_10101572
1121 Ga0070683_100004896
1122 Ga0070683_100020769
1123 Ga0070690_100137146
1124 Ga0070670_100182387
1125 Ga0070670_100188440
1126 Ga0068869_100135118
1127 Ga0068869_100415083
1128 Ga0070680_100005549
1129 Ga0070680_100075775
1130 Ga0070682_100090396
1131 Ga0068868_100025809
1132 Ga0068868_100077925
1133 Ga0070660_100059699
1134 Ga0070660_100158454
1135 Ga0070660_100500665
1136 Ga0070689_100458702
1137 Ga0070691_10033220
1138 Ga0070661_100254682
1139 Ga0070668_100075466
1140 Ga0070668_100113322
1141 Ga0070675_100530817
1142 Ga0070671_100018845
1143 Ga0070674_100032222
1144 Ga0070659_100070608
1145 Ga0070659_100222825
1146 Ga0070667_100046842
1147 Ga0070667_100361621
1148 Ga0070709_10001565
1149 Ga0070709_10021481
1150 Ga0070714_100006692
1151 Ga0070714_100045700
1152 Ga0070713_100021879
1153 Ga0070713_100239042
1154 Ga0070710_10021394
1155 Ga0070701_10061417
1156 Ga0070711_100002918
1157 Ga0070711_100028567
1158 Ga0070700_100338336
1159 Ga0070694_100169414
1160 Ga0070663_100030433
1161 Ga0070663_100066258
1162 Ga0070663_100098278
1163 Ga0070663_100113407
1164 Ga0070678_100064696
1165 Ga0070678_100116396
1166 Ga0070678_100140386
1167 Ga0070662_100164668
1168 Ga0070662_100238399
1169 Ga0070681_10132001
1170 Ga0070681_10283521
1171 Ga0070681_10452776
1172 Ga0068867_100061310
1173 Ga0070698_100188937
1174 Ga0070679_100034939
1175 Ga0070679_100055882
1176 Ga0070679_100058880
1177 Ga0070684_100011247
1178 Ga0070684_100011751
1179 Ga0070684_100128369
1180 Ga0070697_100024320
1181 Ga0068853_100009591
1182 Ga0068853_100016388
1183 Ga0068853_100018276
1184 Ga0068853_100034597
1185 Ga0070693_100495026
1186 Ga0070665_100175959
1187 Ga0070665_100192583
1188 Ga0070665_100330627
1189 Ga0068855_100027258
1190 Ga0068855_100090586
1191 Ga0068855_100094570
1192 Ga0068855_100149185
1193 Ga0068857_100005613
1194 Ga0068857_100012550
1195 Ga0068857_100092843
1196 Ga0068857_100162223
1197 Ga0068854_100058673
1198 Ga0068854_100352830
1199 Ga0068856_100011604
1200 Ga0068856_100045010
1201 Ga0068856_100092522
1202 Ga0068856_100245271
1203 Ga0068856_100678693
1204 Ga0070702_100230629
1205 Ga0068852_100013998
1206 Ga0068852_100159005
1207 Ga0068852_100184620
1208 Ga0068852_100192567
1209 Ga0068859_100876290
1210 Ga0068864_100104685
1211 Ga0068861_100065011
1212 Ga0068861_100221384
1213 Ga0068851_10003388
1214 Ga0068851_10054245
1215 Ga0068863_100223550
1216 Ga0068858_100311171
1217 Ga0068858_100986907
1218 Ga0068860_100001690
1219 Ga0068860_100090838
1220 Ga0068860_100273302
1221 Ga0068860_100366317
1222 Ga0068862_100138400
1223 Ga0068862_100417479
1224 Ga0081455_10020606
1225 Ga0081455_10059791
1226 Ga0081540_1002443
1227 Ga0081540_1022677
1228 Ga0081540_1058597
1229 Ga0070717_10004653
1230 Ga0070717_10005909
1231 Ga0070717_10324239
1232 Ga0075365_10013338
1233 Ga0075365_10025171
1234 Ga0075365_10060538
1235 Ga0075365_10104918
1236 Ga0075365_10147160
1237 Ga0075368_10001735
1238 Ga0075363_100001069
1239 Ga0075364_10019008
1240 Ga0075364_10087191
1241 Ga0070715_10049815
1242 Ga0070716_100006356
1243 Ga0070712_100012950
1244 Ga0070712_100034498
1245 Ga0075362_10015697
1246 Ga0075367_10231802
1247 Ga0075369_10040374
1248 Ga0075366_10084541
1249 Ga0075366_10089410
1250 Ga0097621_100458934
1251 Ga0075370_10048966
1252 Ga0075370_10051477
1253 Ga0068871_100176536
1254 Ga0075434_100190984
1255 Ga0097620_100876401
1256 Ga0099825_1025638
1257 Ga0099824_1007426
1258 Ga0099822_1000695
1259 Ga0099794_10016007
1260 Ga0099794_10039334
1261 Ga0099794_10144006
1262 Ga0099795_10004696
1263 Ga0099795_10018025
1264 Ga0099795_10073919
1265 Ga0105240_10004423
1266 Ga0105240_10011106
1267 Ga0105240_10017597
1268 Ga0105240_10204460
1269 Ga0105245_10045862
1270 Ga0105247_10008016
1271 Ga0105247_10029326
1272 Ga0105247_10040580
1273 Ga0105247_10237887
1274 Ga0105247_10285886
1275 Ga0105243_10028084
1276 Ga0105243_10230185
1277 Ga0105241_10010224
1278 Ga0105241_10068354
1279 Ga0105248_10064109
1280 Ga0105248_10313853
1281 Ga0105248_10509148
1282 Ga0105237_10002625
1283 Ga0105237_10011695
1284 Ga0105237_10019836
1285 Ga0105237_10020040
1286 Ga0105237_10159685
1287 Ga0105237_10210893
1288 Ga0105237_10245005
1289 Ga0105237_10330903
1290 Ga0105237_10508048
1291 Ga0105238_10007238
1292 Ga0105238_10012675
1293 Ga0105238_10107961
1294 Ga0105238_10122645
1295 Ga0105238_10319597
1296 Ga0105238_10520229
1297 Ga0105238_10661647
1298 Ga0105249_10272165
1299 Ga0099796_10019850
1300 Ga0105239_10017364
1301 Ga0105239_10032630
1302 Ga0105239_10081556
1303 Ga0105239_10116938
1304 Ga0105239_10151068
1305 Ga0105239_10205621
1306 Ga0105239_10210904
1307 Ga0105239_10313742
1308 Ga0105239_10453998
1309 Ga0105239_10619523
1310 Ga0105246_10031447
1311 Ga0157369_10019317
1312 Ga0157374_10021649
1313 Ga0157374_10033052
1314 Ga0157378_10013138
1315 Ga0157378_10379595
1316 Ga0157378_10842799
1317 Ga0157378_10945682
1318 Ga0163162_10221800
1319 Ga0157372_10174691
1320 Ga0157372_10684273
1321 Ga0157375_10042178
1322 Ga0157375_10178117
1323 Ga0157375_10211749
1324 Ga0157375_10258971
1325 Ga0163163_10010549
1326 Ga0163163_10212317
1327 Ga0163163_10388735
1328 Ga0157380_10928742
1329 Ga0157377_10280311
1330 Ga0157379_10179644
1331 Ga0157379_10505077
1332 Ga0157376_10016354
1333 Ga0157376_10046230
1334 Ga0163161_10022935
1335 Ga0163161_10309413
1336 Ga0206356_11911267
1337 Ga0214542_1000442
1338 Ga0214545_1000001
1339 Ga0214543_1000006
1340 Ga0213873_10004210
1341 Ga0213876_10000775
1342 Ga0213875_10048107
1343 Ga0209563_103021
1344 Ga0207425_1020160
1345 Ga0209677_101733
1346 Ga0209677_102599
1347 Ga0209148_1000505
1348 Ga0209233_1001832
1349 Ga0209233_1020586
1350 Ga0209233_1021383
1351 Ga0209455_1003223
1352 Ga0209455_1004508
1353 Ga0209564_1006998
1354 Ga0209564_1010770
1355 Ga0209758_1000011
1356 Ga0209758_1000359
1357 Ga0209758_1000365
1358 Ga0209758_1005289
1359 Ga0209758_1006509
1360 Ga0209758_1009818
1361 Ga0209758_1011214
1362 Ga0209758_1012729
1363 Ga0209256_1004821
1364 Ga0209256_1030025
1365 Ga0207426_1000325
1366 Ga0207426_1001581
1367 Ga0207426_1076664
1368 Ga0209257_1001035
1369 Ga0209257_1018942
1370 Ga0207656_10018154
1371 Ga0207653_10021473
1372 Ga0207682_10146488
1373 Ga0207692_10026869
1374 Ga0207692_10054731
1375 Ga0207692_10107893
1376 Ga0207642_10027841
1377 Ga0207688_10100317
1378 Ga0207647_10064840
1379 Ga0207699_10030759
1380 Ga0207699_10083397
1381 Ga0207699_10137953
1382 Ga0207643_10073490
1383 Ga0207705_10039725
1384 Ga0207705_10116889
1385 Ga0207654_10077916
1386 Ga0207654_10087291
1387 Ga0207707_10007729
1388 Ga0207695_10000008
1389 Ga0207695_10004288
1390 Ga0207695_10048296
1391 Ga0207695_10115598
1392 Ga0207695_10506900
1393 Ga0207671_10004144
1394 Ga0207671_10014923
1395 Ga0207671_10039392
1396 Ga0207671_10053722
1397 Ga0207671_10087744
1398 Ga0207671_10090732
1399 Ga0207671_10110715
1400 Ga0207671_10370199
1401 Ga0207671_10426544
1402 Ga0207693_10011065
1403 Ga0207693_10030780
1404 Ga0207693_10090370
1405 Ga0207663_10011043
1406 Ga0207663_10134024
1407 Ga0207660_10002854
1408 Ga0207660_10041167
1409 Ga0207660_10274998
1410 Ga0207657_10021237
1411 Ga0207657_10055693
1412 Ga0207649_10047102
1413 Ga0207649_10083882
1414 Ga0207652_10002796
1415 Ga0207652_10040130
1416 Ga0207652_10077000
1417 Ga0207646_10045245
1418 Ga0207694_10000050
1419 Ga0207694_10065611
1420 Ga0207694_10214543
1421 Ga0207694_10545198
1422 Ga0207659_10667987
1423 Ga0207687_10018538
1424 Ga0207687_10024493
1425 Ga0207700_10005863
1426 Ga0207700_10013718
1427 Ga0207700_10066402
1428 Ga0207700_10379900
1429 Ga0207664_10049494
1430 Ga0207664_10226604
1431 Ga0207690_10049098
1432 Ga0207706_10028051
1433 Ga0207706_10088708
1434 Ga0207706_10121618
1435 Ga0207709_10039609
1436 Ga0207709_10191201
1437 Ga0207670_10397745
1438 Ga0207704_10037422
1439 Ga0207665_10005171
1440 Ga0207665_10036306
1441 Ga0207665_10053807
1442 Ga0207665_10231497
1443 Ga0207711_10126816
1444 Ga0207711_10387259
1445 Ga0207689_10012478
1446 Ga0207689_10132995
1447 Ga0207689_10334772
1448 Ga0207661_10001004
1449 Ga0207661_10004383
1450 Ga0207667_10006495
1451 Ga0207667_10063578
1452 Ga0207667_10079766
1453 Ga0207667_10079839
1454 Ga0207651_10055829
1455 Ga0207712_10154146
1456 Ga0207668_10022003
1457 Ga0207668_10061822
1458 Ga0207668_10117503
1459 Ga0207640_10042961
1460 Ga0207677_10219116
1461 Ga0207677_10335032
1462 Ga0207703_10318629
1463 Ga0207703_10323384
1464 Ga0207639_10027521
1465 Ga0207639_10033198
1466 Ga0207639_10040580
1467 Ga0207639_10071723
1468 Ga0207639_10079198
1469 Ga0207678_10015339
1470 Ga0207678_10017723
1471 Ga0207678_10023667
1472 Ga0207678_10033448
1473 Ga0207678_10068996
1474 Ga0207678_10145973
1475 Ga0207678_10367898
1476 Ga0207708_10026762
1477 Ga0207708_10037515
1478 Ga0207702_10000002
1479 Ga0207702_10047629
1480 Ga0207702_10089379
1481 Ga0207648_10022493
1482 Ga0207648_10030101
1483 Ga0207676_10050927
1484 Ga0207676_10141664
1485 Ga0207676_10247225
1486 Ga0207674_10005330
1487 Ga0207674_10020302
1488 Ga0207674_10072264
1489 Ga0207674_10171950
1490 Ga0207675_100129709
1491 Ga0207683_10122144
1492 Ga0207683_10151462
1493 Ga0207683_10162607
1494 Ga0207698_10211534
1495 Ga0207698_10246998
1496 Ga0207698_10331671
1497 Ga0209389_1000001
1498 Ga0209389_1000546
1499 Ga0209589_1000014
1500 Ga0209589_1004919
1501 Ga0209489_100014
1502 Ga0209489_100040
1503 Ga0209700_100007
1504 Ga0209700_100024
1505 Ga0209179_1002624
1506 Ga0209179_1024600
1507 Ga0209588_1008360
1508 Ga0209588_1044094
1509 Ga0268266_10025654
1510 Ga0268266_10170686
1511 Ga0268266_10311840
1512 Ga0268266_10345044
1513 Ga0268266_10461849
1514 Ga0268265_10304422
1515 Ga0268265_10437992
1516 Ga0268264_10000048
1517 Ga0268264_10063299
1518 Ga0268264_10166894
1519 Ga0265337_1004398
1520 Ga0265326_10010130
1521 Ga0265319_1002602
1522 Ga0265334_10001927
1523 Ga0265322_10004979
1524 Ga0265336_10000588
1525 Ga0307517_10003796
1526 Ga0307517_10300805
1527 Ga0307515_10058433
1528 Ga0265338_10000034
1529 Ga0265324_10005063
1530 Ga0265330_10042545
1531 Ga0265332_10010143
1532 Ga0265325_10074845
1533 Ga0265339_10172562
1534 Ga0307513_10236774
1535 Ga0307509_10117333
1536 Ga0307509_10342408
1537 Ga0307509_10462367
1538 Ga0265313_10082590
1539 Ga0307508_10000249
1540 Ga0307508_10021355
1541 Ga0265314_10023567
1542 Ga0265314_10080754
1543 Ga0265314_10099289
1544 Ga0265342_10007820
1545 Ga0265342_10058141
1546 Ga0265342_10190859
1547 Ga0307516_10088336
1548 Ga0307516_10153293
1549 Ga0307413_10186339
1550 Ga0307413_10341204
1551 Ga0307410_10189009
1552 Ga0307406_10042388
1553 Ga0307409_100257774
1554 Ga0307415_100073962
1555 Ga0307415_100239999
1556 Ga0307507_10096352
1557 Ga0307510_10000923
1558 Ga0307510_10114422
1559 Ga0307510_10200608
1560 Ga0307510_10284947
1561 Ga0315911_1000002
1562 Ga0373926_0065076
1563 Ga0373929_0036445
1564 Ga0373949_0015382
1565 Ga0373952_0010490
1566 Ga0373936_0007741
1567 Ga0373945_0012335
1568 Ga0373953_0002005
1569 Ga0373954_0012542
1570 Ga0373954_0060030
1571 Ga0373943_0009393
1572 Ga0373943_0403344
1573 Ga0373946_0004971
1574 Ga0373955_0031966
1575 Ga0373942_0015643
1576 Ga0373962_0114787
1577 Ga0373924_0062098
1578 Ga0373931_0004151
1579 Ga0373935_0004402
1580 Ga0373935_0044444
1581 Ga0373935_0056980
1582 Ga0373935_0208833
1583 Ga0373935_0534289
1584 Ga0373927_0001631
1585 Ga0373927_0001997
1586 Ga0373927_0027021
1587 Ga0373927_0243692
1588 Ga0373933_0000062
1589 Ga0373933_0108766
1590 Ga0373933_0151176
1591 Ga0373947_0002775
1592 Ga0373947_0039784
1593 Ga0373937_0006410
1594 Ga0373937_0043209
1595 Ga0373937_0083596
1596 Ga0373925_0030941
1597 Ga0373925_0039820
1598 Ga0373925_0382576
1599 Ga0395899_0086606
1600 Ga0395900_0001786
1601 Ga0395900_0190517
1602 Ga0395898_0009522
1603 Ga0395898_0123913
1604 Ga0395905_0123705
1605 Ga0436364_0209550
1606 Ga0395901_0012729
1607 Ga0395901_0091412
1608 Ga0395901_0097473
1609 Ga0395901_1013279
1610 Ga0436365_0103019
1611 Ga0436365_1088907
1612 Ga0436365_1204061
1613 Ga0436361_0524312
1614 Ga0436363_1557803
1615 Ga0436362_0478151
1616 Ga0451789_1189284
1617 Ga0451791_1550973
1618 Ga0451795_0833275
1619 Ga0451833_0551207
1620 Ga0451837_0594709
1621 Ga0451841_0446677
1622 Ga0451849_0579101
1623 Ga0451843_0380754
1624 Ga0439455_0096054
1625 Ga0439459_0030343
1626 Ga0439464_0102993
1627 Ga0466969_0005482
1628 Ga0466969_0080551
1629 Ga0466972_0056853
1630 Ga0466966_0021812
1631 Ga0466966_0209104
1632 Ga0466961_0000539
1633 Ga0466963_0039622
1634 Ga0466963_0186247
1635 Ga0466971_0039016
1636 Ga0466968_0015419
1637 Ga0466968_0057238
1638 Ga0466968_0104938
1639 Ga0466957_0019778
1640 Ga0466957_0206207
1641 Ga0466957_0219029
1642 Ga0466960_0036515
1643 Ga0466959_0018133
1644 Ga0466967_0015723
1645 Ga0466967_0250809
1646 Ga0466967_0778454
1647 Ga0495617_027358
1648 Ga0495592_0007626
1649 Ga0495603_0001689
1650 Ga0495603_0013972
1651 Ga0495603_0019223
1652 Ga0495603_0154257
1653 Ga0495590_0054970
1654 Ga0495629_0002784
1655 Ga0495629_0009469
1656 Ga0495629_0323237
1657 Ga0495638_0003859
1658 Ga0495638_0057018
1659 Ga0495641_0015327
1660 Ga0495641_0050932
1661 Ga0495651_0018811
1662 Ga0495651_0033911
1663 Ga0495651_0149193
1664 Ga0495651_0249325
1665 Ga0495653_0053042
1666 Ga0495653_0168660
1667 Ga0495653_0278953
1668 Ga0495650_0042735
1669 Ga0495580_0005616
1670 Ga0495580_0151979
1671 Ga0495582_0000228
1672 Ga0495582_0042985
1673 Ga0495639_0000261
1674 Ga0495639_0067198
1675 Ga0495639_0087685
1676 Ga0495662_0001403
1677 Ga0495664_0009409
1678 Ga0495664_0035329
1679 Ga0495664_0055560
1680 Ga0495664_0056486
1681 Ga0495585_0065368
1682 Ga0495585_0141187
1683 Ga0495585_0186808
1684 Ga0495594_0010814
1685 Ga0495583_0051712
1686 Ga0495606_0010114
1687 Ga0495606_0017203
1688 Ga0495606_0107351
1689 Ga0495606_0203820
1690 Ga0495608_0005477
1691 Ga0495608_0223352
1692 Ga0495608_0273776
1693 Ga0495616_0045271
1694 Ga0495618_0024844
1695 Ga0495618_0103105
1696 Ga0495628_0011105
1697 Ga0495628_0175475
1698 Ga0495630_0001773
1699 Ga0495631_0099015
1700 Ga0495631_0177407
1701 Ga0495648_0003345
1702 Ga0495648_0065075
1703 Ga0495666_0073957
1704 Ga0495666_0155606
1705 Ga0495666_0165805
1706 Ga0495652_0023429
1707 Ga0495652_0038900
1708 Ga0495665_0096405
1709 Ga0495640_0007929
1710 Ga0495640_0018338
1711 Ga0495586_0077506
1712 Ga0495645_0071072
1713 Ga0495645_0446440
1714 Ga0495622_0005107
1715 Ga0495622_0005725
1716 Ga0495622_0157178
1717 Ga0495633_0060297
1718 Ga0495667_0019161
1719 Ga0495667_0442407
1720 Ga0495668_0137661
1721 Ga0495668_0367575
1722 Ga0495634_0003006
1723 Ga0495634_0030251
1724 Ga0495611_0069527
1725 Ga0495611_0174568
1726 Ga0495625_0066380
1727 Ga0495635_0002773
1728 Ga0495635_0008380
1729 Ga0495659_0010660
1730 Ga0495588_0007973
1731 Ga0495588_0023568
1732 Ga0495588_0084015
1733 Ga0495657_0045053
1734 Ga0495657_0152961
1735 Ga0495657_0311292
1736 Ga0495599_0015121
1737 Ga0495599_0050298
1738 Ga0495599_0097376
1739 Ga0495623_0009506
1740 Ga0495623_0148326
1741 Ga0495646_0051368
1742 Ga0495647_0001733
1743 Ga0495658_0000941
1744 Ga0495669_0006028
1745 Ga0495669_0063925
1746 Ga0495613_0023147
1747 Ga0495613_0055480
1748 Ga0495613_0057266
1749 Ga0495624_0001434
1750 Ga0495624_0015606
1751 Ga0495671_0200255
1752 Ga0495649_0006595
1753 Ga0495589_0243720
1754 Ga0495600_0001030
1755 Ga0495600_0121385
1756 Ga0495600_0407069
1757 Ga0495581_0001142
1758 Ga0495581_0054882
1759 Ga0495604_0002639
1760 Ga0495604_0041266
1761 Ga0495674_0001977
1762 Ga0495674_0068279
1763 Ga0495672_0010283
1764 Ga0495672_0101600
1765 Ga0495676_0015850
1766 Ga0495676_0122013
1767 Ga0495680_0066841
1768 Ga0495683_0021683
1769 Ga0495683_0045801
1770 Ga0495683_0139924
1771 Ga0495687_007116
1772 Ga0495675_0009532
1773 Ga0495673_0021531
1774 Ga0495673_0034017
1775 Ga0495684_0030022
1776 Ga0495686_0030223
1777 Ga0495686_0070075
1778 Ga0495686_0123169
1779 Ga0495686_0155064
1780 Ga0495686_0373267
1781 Ga0495593_0002128
1782 Ga0495593_0023793
1783 Ga0495602_0019615
1784 Ga0495602_0040943
1785 Ga0495614_0024733
1786 Ga0495626_0190011
1787 Ga0496100_0002855
1788 Ga0496100_0240246
1789 Ga0496101_0015791
1790 Ga0496101_0016053
1791 Ga0496101_0047894
1792 Ga0496101_0130181
1793 Ga0496101_0235214
1794 Ga0496102_0007639
1795 Ga0496102_0026494
1796 Ga0496102_0069908
1797 Ga0496102_0104002
1798 Ga0496102_0224685
1799 Ga0496103_0069064
1800 Ga0496103_0108148
1801 Ga0496103_0158944
1802 Ga0496104_0005151
1803 Ga0496104_0007365
1804 Ga0496104_0037573
1805 Ga0496104_0093136
1806 Ga0496104_0264771
1807 Ga0496104_0361943
1808 Ga0496104_0545604
1809 Ga0496105_0008068
1810 Ga0496105_0011031
1811 Ga0496105_0118341
1812 Ga0496105_0149469
1813 Ga0496105_0236441
1814 Ga0496105_0303281
1815 Ga0496105_0366848
1816 Ga0496106_0005044
1817 Ga0496106_0039463
1818 Ga0496106_0040831
1819 Ga0496106_0052392
1820 Ga0496106_0129964
1821 Ga0496107_0003265
1822 Ga0496107_0007983
1823 Ga0496107_0248690
1824 Ga0496108_0016710
1825 Ga0496108_0079489
1826 Ga0496108_0433434
1827 Ga0496108_0906659
1828 Ga0496109_0012219
1829 Ga0496109_0083699
1830 Ga0496109_0329685
1831 Ga0496110_0011522
1832 Ga0496110_0018639
1833 Ga0496110_0059515
1834 Ga0496110_0123537
1835 Ga0496110_0135369
1836 Ga0496110_0237310
1837 Ga0496110_0408116
1838 Ga0496111_0040423
1839 Ga0496111_0064252
1840 Ga0496111_0515491
1841 Ga0496112_0000395
1842 Ga0496112_0007941
1843 Ga0496112_0026148
1844 Ga0496112_0034003
1845 Ga0496112_0039576
1846 Ga0496112_0180951
1847 Ga0496112_0247957
1848 Ga0496112_0592487
1849 Ga0496113_0014638
1850 Ga0496113_0071846
1851 Ga0496113_0204690
1852 Ga0496113_0405966
1853 Ga0496114_0024690
1854 Ga0496114_0057160
1855 Ga0496115_0018252
1856 Ga0496115_0062527
1857 Ga0496115_0096198
1858 Ga0496115_0160388
1859 Ga0496115_0298536
1860 Ga0496116_0010996
1861 Ga0496116_0113318
1862 Ga0496117_0011530
1863 Ga0496117_0074573
1864 Ga0496118_0002114
1865 Ga0496118_0030816
1866 Ga0496118_0046355
1867 Ga0496118_0063350
1868 Ga0496119_0002144
1869 Ga0496119_0028349
1870 Ga0496119_0045981
1871 Ga0496119_0084470
1872 Ga0496120_0011010
1873 Ga0496121_0000757
1874 Ga0496121_0008568
1875 Ga0496121_0027091
1876 Ga0496121_0031249
1877 Ga0496121_0108499
1878 Ga0496121_0117645
1879 Ga0496121_0168300
1880 Ga0496121_0182767
1881 Ga0496121_0366216
1882 Ga0496121_0374190
1883 Ga0496123_0096972
1884 Ga0496124_0003589
1885 Ga0496124_0054668
1886 Ga0496124_0088195
1887 Ga0496124_0168375
1888 Ga0496124_0239890
1889 Ga0496124_0392718
1890 Ga0496125_0010347
1891 Ga0496125_0021673
1892 Ga0496125_0044063
1893 Ga0496125_0059339
1894 Ga0496125_0195958
1895 Ga0496125_0216738
1896 Ga0496126_0003396
1897 Ga0496126_0020776
1898 Ga0496126_0024357
1899 Ga0496126_0035100
1900 Ga0496126_0140836
1901 Ga0496126_0173210
1902 Ga0496126_0181886
1903 Ga0496126_0319702
1904 Ga0496126_0695180
1905 Ga0495682_0031101
1906 Ga0495682_0039266
1907 Ga0501033_0060162
1908 Ga0501034_0168055
1909 Ga0501036_0022830
1910 Ga0501037_0206110
1911 Ga0501041_0228480
1912 Ga0501043_0042357
1913 Ga0501046_0034778
1914 Ga0501067_0095198
1915 Ga0501068_0092448
1916 Ga0501044_0210734
1917 Ga0501044_0577667
1918 nmdc:mga03683_113408_c1
1919 nmdc:mga00v17_114936_c1
1920 nmdc:mga00v17_243693_c1
1921 nmdc:mga0yw44_11776_c1
1922 nmdc:mga0yw44_15270_c1
1923 nmdc:mga0yw44_41677_c1
1924 nmdc:mga0yw44_65594_c1
1925 nmdc:mga0k408_15811_c1
1926 nmdc:mga06z11_100082_c1
1927 nmdc:mga07m45_25466_c1
1928 nmdc:mga0qj67_792429_c1
1929 nmdc:mga0n895_197719_c1
1930 nmdc:mga0rr50_231767_c1
1931 nmdc:mga0sz30_31231_c1
1932 nmdc:mga0sz30_45622_c1
1933 Ga0495601_0028181
1934 Ga0495601_0039332
1935 Ga0495612_0003593
1936 Ga0500610_0148938
1937 Ga0500610_0224084
1938 Ga0500635_0000944
1939 Ga0500635_0170183
1940 Ga0495595_0014428
1941 Ga0495595_0043440
1942 Ga0495619_0016517
1943 Ga0495619_0034063
1944 Ga0500643_000046
1945 Ga0500646_0035225
1946 Ga0500646_0042512
1947 Ga0500647_0194661
1948 Ga0500651_0041079
1949 Ga0500566_0000048
1950 Ga0500566_0011872
1951 Ga0500566_0032219
1952 Ga0500566_0125818
1953 Ga0500640_032464
1954 Ga0500641_0024524
1955 Ga0500641_0025637
1956 Ga0500641_0073184
1957 Ga0500648_254061
1958 Ga0500554_005519
1959 Ga0500554_010002
1960 Ga0500555_002736
1961 Ga0500555_068118
1962 Ga0500556_0060030
1963 Ga0500557_000020
1964 Ga0500572_000352
1965 Ga0500595_000494
1966 Ga0500595_011389
1967 Ga0500608_186425
1968 Ga0500614_006445
1969 Ga0500614_026077
1970 Ga0500621_079585
1971 Ga0500621_113545
1972 Ga0500642_0000057
1973 Ga0500642_0069785
1974 Ga0500655_006315
1975 Ga0500559_0001516
1976 Ga0500559_0007361
1977 Ga0500559_0014275
1978 Ga0500559_0016085
1979 Ga0500559_0074873
1980 Ga0500559_0083816
1981 Ga0500564_093347
1982 Ga0500564_096895
1983 Ga0500568_0043558
1984 Ga0500573_0028789
1985 Ga0500589_017802
1986 Ga0500590_067855
1987 Ga0500590_164063
1988 Ga0500603_000041
1989 Ga0500603_000138
1990 Ga0500603_007223
1991 Ga0500616_0027991
1992 Ga0500619_038323
1993 Ga0500620_008335
1994 Ga0500622_0006107
1995 Ga0500630_001433
1996 Ga0500638_004267
1997 Ga0500639_000228
1998 Ga0500639_007270
1999 Ga0500636_0000173
2000 Ga0500636_0092115
2001 Ga0500636_0222696
2002 Ga0500637_0000162
2003 Ga0500576_132220
2004 Ga0500625_000568
2005 Ga0500645_012439
2006 Ga0500552_001722
2007 Ga0500596_000465
2008 Ga0500596_003290
2009 Ga0500596_006241
2010 Ga0500596_014667
2011 Ga0500599_000186
2012 Ga0500601_000125
2013 Ga0500601_002147
2014 Ga0500587_007015
2015 Ga0500661_006887
2016 Ga0501082_0672737
2017 Ga0466962_0241683
2018 2507507783
2019 2508541907
2020 2509153342
2021 2511397345
2022 2513622931
2023 2513639250
2024 2513647390
2025 2513653955
2026 2513676225
2027 2513695775
2028 2513719361
2029 2513856389
2030 2513878176
2031 2513891405
2032 2513918295
2033 2514009556
2034 2517891475
2035 2524470317
2036 2528852644
2037 2617346673
2038 2617372600
2039 2671118759
2040 2723847240
2041 2728754854
2042 2745080636
2043 2793064478
2044 2793066843
2045 2793084171
2046 2805919181
2047 2818236426
2048 2824605385
2049 2824613587
2050 2824626256
2051 2824634699
2052 2824643310
2053 2824651592
2054 2824657605
2055 2824670657
2056 2824675905
2057 2824683020
2058 2824692100
2059 2824700455
2060 2824710333
2061 2824722106
2062 2824731583
2063 2824735826
2064 2824746981
2065 2824755597
2066 2824766260
2067 2824777416
2068 2838128925
2069 2841944927
2070 2841953352
2071 2841959820
2072 2841972176
2073 2841978077
2074 2841986300
2075 2842040527
2076 2842046527
2077 2844319893
2078 2847937201
2079 2847947614
2080 2874598890
2081 2874607256
2082 2874614703
2083 2874622214
2084 2874635158
2085 2874650662
2086 2876764160
2087 2876778929
2088 2876824176
2089 2879082722
2090 2879089134
2091 2879105589
2092 2879114592
2093 2881364817
2094 2881671878
2095 2885369845
2096 2885377821
2097 2885390306
2098 2885412317
2099 2888385325
2100 2888392925
2101 2888425463
2102 2889038148
2103 2903730434
2104 2903758743
2105 2903772999
2106 2904667826
2107 2904704826
2108 2904712111
2109 2906609764
2110 2906616651
2111 2906632087
2112 2906638231
2113 2906646986
2114 2906666978
2115 2908741816
2116 2908781048
2117 2922372556
2118 2922387473
2119 2922397194
2120 2922431326
2121 2929620895
2122 2929626274
2123 2932784849
2124 2932805810
2125 2932809883
2126 2932818374
2127 2932828686
2128 2933583235
2129 2935609706
2130 2935619894
2131 2935633919
2132 2935638876
2133 2935666274
2134 2935676681
2135 2935685064
2136 2935694759
2137 2935703881
2138 2935713617
2139 2935724237
2140 2935733405
2141 2935742784
2142 2935751029
2143 2935760442
2144 2935772065
2145 2935784242
2146 2935787547
2147 2935796179
2148 2935802018
2149 2935810787
2150 2935822868
2151 2935828370
2152 2935839785
2153 2935848450
2154 2935857791
2155 2935868867
2156 2935874282
2157 2935883821
2158 2935909746
2159 2935917470
2160 2935927227
2161 2935936929
2162 2935944768
2163 2935953205
2164 2935970045
2165 2935980330
2166 2935992792
2167 2936002706
2168 2936037793
2169 2940558168
2170 2941510778
2171 2941518162
2172 2941526967
2173 2941540874
2174 3005484922
2175 3005508541
2176 3005587197
2177 3005600172
2178 3005715684
2179 3005723034
2180 8006928782
2181 8006939589
2182 8006968398
2183 8006979340
2184 8006989234
2185 8006994844
2186 8016520797
2187 8016534009
2188 8016547234
2189 8016554899
2190 8016563263
2191 8016572350
2192 8016576528
2193 8016601017
2194 8016615466
2195 8016625750
2196 8017064793
2197 8019533776
2198 8019545889
2199 8019552837
2200 8019565482
2201 8019575575
2202 8019591923
2203 8019599361
2204 8019608997
2205 8019649216
2206 8019661311
2207 8019690937
2208 8055745242
2209 8056679412
2210 8056684933
2211 8056693438
2212 8056968913

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r2g-assembly1.cif.gz_A crystal structure of a single-chain protein mimetic of the gp41 nhr trimer in complex with the synthetic chr peptide c34 0.6673 136 241
2f1m-assembly2.cif.gz_D conformational flexibility in the multidrug efflux system protein acra 0.6326 136 213
1h7c-assembly1.cif.gz_A human tubulin chaperone cofactor a 0.5929 131 237
1h7c-assembly1.cif.gz_A human tubulin chaperone cofactor a 0.5846 131 237
6m6z-assembly1.cif.gz_D a de novo designed transmembrane nanopore, tmh4c4 0.5492 117 241
ID Description Score Start End Superfamily
af_Q03001_5172_5283_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6633 124 220 1.20.58.60
af_A4I8B9_19_125_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.655 127 240 1.20.58.90
af_A0A0R0KZ25_17_139_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6525 136 242 1.20.58.70
af_A4I8B9_19_125_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6457 127 240 1.20.58.90
af_Q24509_192_430_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.639 131 241 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A537UWP2-F1-model_v4 Uncharacterized protein 0.9271 120 258
AF-A0A537UWP2-F1-model_v4 Uncharacterized protein 0.9207 120 258
AF-A0A1I3CHR7-F1-model_v4 Uncharacterized protein 0.9076 33 259
AF-A0A3B0U5E6-F1-model_v4 Uncharacterized protein 0.888 69 241
AF-A0A7W6X4N4-F1-model_v4 Uncharacterized protein 0.8809 33 259

Map