F490117
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1104 | 459 | 1072 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300003659|JGI25404J52841_10004221|JGI25404J52841_100042212 |
| Length | 343 |
| Sequence | MALARGRRDRGIDYWPGFVDALSTLILGIIFLLTVFVVVQFFLSQEVAGKDTALSRLNAQIQQLTDLLSLEKTGKTTLEEQIAQLRANLSAAEGERDRLRGQVTAPGGLDAGAAQGRINDLSTTLTEERKISARALAQVEVLNQQXAALRRQLSALXAALDVSEKXDKESQTRIADLGQRLNVALAQRVQELSRYRSDFFGRLREILGNRPDIRVVGDRFVFQSEVFFDSGSAVVRPEGRIELDKLAAALLELDKSIPTEIAWVLRIDGHTDVRPITTSLQYKSNWELSSARAISVVQYLIAKGVSPQRLVAAGFGEFQPLDPDRTEEAFRRNRRIELKLTER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 4 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 7 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 8 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 9 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 10 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 11 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 12 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 13 | 2791355199 | |||
| 14 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 15 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 16 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 17 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 18 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 19 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 20 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 21 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 22 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 23 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 24 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 25 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 26 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 27 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 28 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 29 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 30 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 31 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 32 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 33 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 34 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 35 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 36 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 37 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 38 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 109 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 113 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 114 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 115 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 119 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 120 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 121 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 122 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 124 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 125 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 126 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 127 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 128 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 129 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 130 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 135 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 136 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 137 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 151 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 154 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 166 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 171 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 172 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 173 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 174 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 238 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 239 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 246 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 249 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 250 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 252 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 253 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 254 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 255 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 256 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 258 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 259 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 260 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 263 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 264 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 265 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 266 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 267 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 268 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 269 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 270 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 271 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 272 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 273 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 275 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 276 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 277 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 278 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 280 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 283 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 284 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 290 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 291 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 292 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 293 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 294 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 295 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 296 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 298 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 299 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 301 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 302 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 303 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 304 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 305 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 306 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 307 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 308 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 309 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 310 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 311 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 312 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 313 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 314 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 315 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 316 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 317 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 318 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 370 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 371 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 372 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 373 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 374 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 377 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 378 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 379 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 380 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 381 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 382 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 383 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 384 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 385 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 386 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 420 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 421 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 422 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 423 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 424 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 434 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 440 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 441 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 442 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 443 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 444 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 445 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 446 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 447 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 448 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 449 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 450 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 451 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 452 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 453 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 456 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 457 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 458 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 459 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.1 |
| Metatranscriptomes | 0.09 |
| Isolates | 2.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.26 |
| Nodule | 1.81 |
| Rhizoplane | 7.88 |
| Rhizosphere | 81.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10004327 | 3300001990 | Bacteria | 4956 |
| 2 | JGI24737J22298_10007387 | 3300001990 | Bacteria | 3713 |
| 3 | JGI24735J21928_10037568 | 3300002067 | Bacteria | 1419 |
| 4 | JGI24749J21850_1001685 | 3300002076 | Bacteria | 3133 |
| 5 | JGI24744J21845_10017503 | 3300002077 | Bacteria | 1424 |
| 6 | JGI24742J22300_10011595 | 3300002244 | Bacteria | 1465 |
| 7 | JGI24751J29686_10005136 | 3300002459 | Bacteria | 2662 |
| 8 | JGI25153J46596_10007775 | 3300003215 | Bacteria | 5212 |
| 9 | JGI25404J52841_10004221 | 3300003659 | Bacteria | 2894 |
| 10 | Ga0058692_1004883 | 3300003856 | Bacteria | 3899 |
| 11 | Ga0070658_10002492 | 3300005327 | Bacteria | 15376 |
| 12 | Ga0070658_10127049 | 3300005327 | Bacteria | 2123 |
| 13 | Ga0070676_10000987 | 3300005328 | Bacteria | 14130 |
| 14 | Ga0070683_100021229 | 3300005329 | Bacteria | 5792 |
| 15 | Ga0070683_100410740 | 3300005329 | Bacteria | 1291 |
| 16 | Ga0070690_100000506 | 3300005330 | Bacteria | 19537 |
| 17 | Ga0070670_100001094 | 3300005331 | Bacteria | 21528 |
| 18 | Ga0068869_100037466 | 3300005334 | Bacteria | 3448 |
| 19 | Ga0068869_100093831 | 3300005334 | Bacteria | 2261 |
| 20 | Ga0070666_10002984 | 3300005335 | Bacteria | 10257 |
| 21 | Ga0070666_10058040 | 3300005335 | Bacteria | 2616 |
| 22 | Ga0070666_10101212 | 3300005335 | Bacteria | 1986 |
| 23 | Ga0070680_100014072 | 3300005336 | Bacteria | 6247 |
| 24 | Ga0070680_100027539 | 3300005336 | Bacteria | 4551 |
| 25 | Ga0070680_100041348 | 3300005336 | Bacteria | 3738 |
| 26 | Ga0070680_100129620 | 3300005336 | Bacteria | 2109 |
| 27 | Ga0070682_100004821 | 3300005337 | Bacteria | 7489 |
| 28 | Ga0070682_100010302 | 3300005337 | Bacteria | 5305 |
| 29 | Ga0068868_100000904 | 3300005338 | Bacteria | 20173 |
| 30 | Ga0070660_100001178 | 3300005339 | Bacteria | 17696 |
| 31 | Ga0070660_100003958 | 3300005339 | Bacteria | 10234 |
| 32 | Ga0070660_100003975 | 3300005339 | Bacteria | 10218 |
| 33 | Ga0070660_100017321 | 3300005339 | Bacteria | 5250 |
| 34 | Ga0070660_100051545 | 3300005339 | Bacteria | 3170 |
| 35 | Ga0070660_100087257 | 3300005339 | Bacteria | 2456 |
| 36 | Ga0070689_100002505 | 3300005340 | Bacteria | 12016 |
| 37 | Ga0070689_100004127 | 3300005340 | Bacteria | 9782 |
| 38 | Ga0070691_10000155 | 3300005341 | Bacteria | 22187 |
| 39 | Ga0070687_100001299 | 3300005343 | Bacteria | 8717 |
| 40 | Ga0070687_100098019 | 3300005343 | Bacteria | 1636 |
| 41 | Ga0070661_100001464 | 3300005344 | Bacteria | 16401 |
| 42 | Ga0070692_10000912 | 3300005345 | Bacteria | 10006 |
| 43 | Ga0070668_100000692 | 3300005347 | Bacteria | 22968 |
| 44 | Ga0070668_100025445 | 3300005347 | Bacteria | 4487 |
| 45 | Ga0070669_100000807 | 3300005353 | Bacteria | 22765 |
| 46 | Ga0070675_100001608 | 3300005354 | Bacteria | 16654 |
| 47 | Ga0070675_100431566 | 3300005354 | Bacteria | 1179 |
| 48 | Ga0070671_100001121 | 3300005355 | Bacteria | 19883 |
| 49 | Ga0070671_100072200 | 3300005355 | Bacteria | 2882 |
| 50 | Ga0070674_100001386 | 3300005356 | Bacteria | 12805 |
| 51 | Ga0070674_100054253 | 3300005356 | Bacteria | 2771 |
| 52 | Ga0070674_100072160 | 3300005356 | Bacteria | 2444 |
| 53 | Ga0070673_100000626 | 3300005364 | Bacteria | 19353 |
| 54 | Ga0070673_100037774 | 3300005364 | Bacteria | 3682 |
| 55 | Ga0070673_100329786 | 3300005364 | Bacteria | 1350 |
| 56 | Ga0070688_100000139 | 3300005365 | Bacteria | 39353 |
| 57 | Ga0070688_100009945 | 3300005365 | Bacteria | 5226 |
| 58 | Ga0070659_100042178 | 3300005366 | Bacteria | 3567 |
| 59 | Ga0070659_100330878 | 3300005366 | Bacteria | 1275 |
| 60 | Ga0070667_100005155 | 3300005367 | Bacteria | 10931 |
| 61 | Ga0070667_100016467 | 3300005367 | Bacteria | 6118 |
| 62 | Ga0070667_100023204 | 3300005367 | Bacteria | 5147 |
| 63 | Ga0070703_10035502 | 3300005406 | Bacteria | 1527 |
| 64 | Ga0070709_10001924 | 3300005434 | Bacteria | 11284 |
| 65 | Ga0070709_10003157 | 3300005434 | Bacteria | 8838 |
| 66 | Ga0070709_10101995 | 3300005434 | Bacteria | 1913 |
| 67 | Ga0070714_100002022 | 3300005435 | Bacteria | 14858 |
| 68 | Ga0070714_100002527 | 3300005435 | Bacteria | 13488 |
| 69 | Ga0070714_100042896 | 3300005435 | Bacteria | 3823 |
| 70 | Ga0070714_100245359 | 3300005435 | Bacteria | 1654 |
| 71 | Ga0070714_100446665 | 3300005435 | Bacteria | 1228 |
| 72 | Ga0070713_100007833 | 3300005436 | Bacteria | 7531 |
| 73 | Ga0070713_100012977 | 3300005436 | Bacteria | 6135 |
| 74 | Ga0070713_100234538 | 3300005436 | Bacteria | 1669 |
| 75 | Ga0070713_100347326 | 3300005436 | Bacteria | 1376 |
| 76 | Ga0070710_10013755 | 3300005437 | Bacteria | 4060 |
| 77 | Ga0070710_10053330 | 3300005437 | Bacteria | 2277 |
| 78 | Ga0070701_10001747 | 3300005438 | Bacteria | 8179 |
| 79 | Ga0070711_100002491 | 3300005439 | Bacteria | 10512 |
| 80 | Ga0070711_100003965 | 3300005439 | Bacteria | 8698 |
| 81 | Ga0070711_100053341 | 3300005439 | Bacteria | 2786 |
| 82 | Ga0070711_100059511 | 3300005439 | Bacteria | 2652 |
| 83 | Ga0070711_100131646 | 3300005439 | Bacteria | 1863 |
| 84 | Ga0070711_100151895 | 3300005439 | Bacteria | 1747 |
| 85 | Ga0070711_100196848 | 3300005439 | Bacteria | 1552 |
| 86 | Ga0070705_100000298 | 3300005440 | Bacteria | 29561 |
| 87 | Ga0070700_100000648 | 3300005441 | Bacteria | 17205 |
| 88 | Ga0070700_100069729 | 3300005441 | Bacteria | 2239 |
| 89 | Ga0070700_100198047 | 3300005441 | Bacteria | 1409 |
| 90 | Ga0070700_100200866 | 3300005441 | Bacteria | 1400 |
| 91 | Ga0070694_100004154 | 3300005444 | Bacteria | 8699 |
| 92 | Ga0070694_100127321 | 3300005444 | Bacteria | 1835 |
| 93 | Ga0070678_100000734 | 3300005456 | Bacteria | 16335 |
| 94 | Ga0070678_100046092 | 3300005456 | Bacteria | 3123 |
| 95 | Ga0070678_100057176 | 3300005456 | Bacteria | 2856 |
| 96 | Ga0070662_100001979 | 3300005457 | Bacteria | 12572 |
| 97 | Ga0070662_100044231 | 3300005457 | Bacteria | 3189 |
| 98 | Ga0070662_100092216 | 3300005457 | Bacteria | 2276 |
| 99 | Ga0070681_10006054 | 3300005458 | Bacteria | 11729 |
| 100 | Ga0070681_10054547 | 3300005458 | Bacteria | 3983 |
| 101 | Ga0070681_10061808 | 3300005458 | Bacteria | 3719 |
| 102 | Ga0070681_10074337 | 3300005458 | Bacteria | 3360 |
| 103 | Ga0070681_10096980 | 3300005458 | Bacteria | 2896 |
| 104 | Ga0068867_100012592 | 3300005459 | Bacteria | 5982 |
| 105 | Ga0068867_100047834 | 3300005459 | Bacteria | 3145 |
| 106 | Ga0068867_100048863 | 3300005459 | Bacteria | 3113 |
| 107 | Ga0070685_10002499 | 3300005466 | Bacteria | 9438 |
| 108 | Ga0070698_100044278 | 3300005471 | Bacteria | 4559 |
| 109 | Ga0070699_100007777 | 3300005518 | Bacteria | 9318 |
| 110 | Ga0070679_100020169 | 3300005530 | Bacteria | 6496 |
| 111 | Ga0070679_100036159 | 3300005530 | Bacteria | 4900 |
| 112 | Ga0070679_100128056 | 3300005530 | Bacteria | 2520 |
| 113 | Ga0070679_100383868 | 3300005530 | Bacteria | 1351 |
| 114 | Ga0070684_100017742 | 3300005535 | Bacteria | 5849 |
| 115 | Ga0070684_100108252 | 3300005535 | Bacteria | 2490 |
| 116 | Ga0070684_100110930 | 3300005535 | Bacteria | 2460 |
| 117 | Ga0070697_100023341 | 3300005536 | Bacteria | 4918 |
| 118 | Ga0068853_100005313 | 3300005539 | Bacteria | 10082 |
| 119 | Ga0068853_100013838 | 3300005539 | Bacteria | 6595 |
| 120 | Ga0070672_100001796 | 3300005543 | Bacteria | 13421 |
| 121 | Ga0070686_100000266 | 3300005544 | Bacteria | 35675 |
| 122 | Ga0070686_100056466 | 3300005544 | Bacteria | 2518 |
| 123 | Ga0070686_100127351 | 3300005544 | Bacteria | 1756 |
| 124 | Ga0070695_100000864 | 3300005545 | Bacteria | 16329 |
| 125 | Ga0070695_100012251 | 3300005545 | Bacteria | 5142 |
| 126 | Ga0070696_100023586 | 3300005546 | Bacteria | 4181 |
| 127 | Ga0070693_100000326 | 3300005547 | Bacteria | 21830 |
| 128 | Ga0070693_100003813 | 3300005547 | Bacteria | 7061 |
| 129 | Ga0070665_100019274 | 3300005548 | Bacteria | 6845 |
| 130 | Ga0070665_100298903 | 3300005548 | Bacteria | 1612 |
| 131 | Ga0070704_100003256 | 3300005549 | Bacteria | 9278 |
| 132 | Ga0068855_100007108 | 3300005563 | Bacteria | 13578 |
| 133 | Ga0068855_100036393 | 3300005563 | Bacteria | 5859 |
| 134 | Ga0068855_100056948 | 3300005563 | Bacteria | 4583 |
| 135 | Ga0068855_100382090 | 3300005563 | Bacteria | 1546 |
| 136 | Ga0068855_100407744 | 3300005563 | Bacteria | 1488 |
| 137 | Ga0070664_100169224 | 3300005564 | Bacteria | 1938 |
| 138 | Ga0068857_100000859 | 3300005577 | Bacteria | 22784 |
| 139 | Ga0068857_100007649 | 3300005577 | Bacteria | 9304 |
| 140 | Ga0068857_100089166 | 3300005577 | Bacteria | 2759 |
| 141 | Ga0068857_100130927 | 3300005577 | Bacteria | 2262 |
| 142 | Ga0068857_100236645 | 3300005577 | Bacteria | 1671 |
| 143 | Ga0068854_100000885 | 3300005578 | Bacteria | 18009 |
| 144 | Ga0068854_100003411 | 3300005578 | Bacteria | 9905 |
| 145 | Ga0068854_100246938 | 3300005578 | Bacteria | 1423 |
| 146 | Ga0068854_100331493 | 3300005578 | Bacteria | 1240 |
| 147 | Ga0068856_100002298 | 3300005614 | Bacteria | 19709 |
| 148 | Ga0068856_100015301 | 3300005614 | Bacteria | 7414 |
| 149 | Ga0068856_100019878 | 3300005614 | Bacteria | 6519 |
| 150 | Ga0068856_100038892 | 3300005614 | Bacteria | 4670 |
| 151 | Ga0068856_100321961 | 3300005614 | Bacteria | 1563 |
| 152 | Ga0070702_100000139 | 3300005615 | Bacteria | 22443 |
| 153 | Ga0068852_100001969 | 3300005616 | Bacteria | 13992 |
| 154 | Ga0068852_100022339 | 3300005616 | Bacteria | 5073 |
| 155 | Ga0068859_100009674 | 3300005617 | Bacteria | 9732 |
| 156 | Ga0068859_100501024 | 3300005617 | Bacteria | 1309 |
| 157 | Ga0068864_100011694 | 3300005618 | Bacteria | 7248 |
| 158 | Ga0068866_10006115 | 3300005718 | Bacteria | 5009 |
| 159 | Ga0068861_100002618 | 3300005719 | Bacteria | 11760 |
| 160 | Ga0068870_10070882 | 3300005840 | Bacteria | 1901 |
| 161 | Ga0068863_100000834 | 3300005841 | Bacteria | 30888 |
| 162 | Ga0068863_100258227 | 3300005841 | Bacteria | 1684 |
| 163 | Ga0068858_100001979 | 3300005842 | Bacteria | 20923 |
| 164 | Ga0068858_100264509 | 3300005842 | Bacteria | 1635 |
| 165 | Ga0068860_100002133 | 3300005843 | Bacteria | 20873 |
| 166 | Ga0068860_100153885 | 3300005843 | Bacteria | 2216 |
| 167 | Ga0068860_100163311 | 3300005843 | Bacteria | 2148 |
| 168 | Ga0068860_100312705 | 3300005843 | Bacteria | 1540 |
| 169 | Ga0068862_100006042 | 3300005844 | Bacteria | 10081 |
| 170 | Ga0068862_100197885 | 3300005844 | Bacteria | 1811 |
| 171 | Ga0081455_10000031 | 3300005937 | Bacteria | 146486 |
| 172 | Ga0081455_10003325 | 3300005937 | Bacteria | 18556 |
| 173 | Ga0081538_10013324 | 3300005981 | Bacteria | 6516 |
| 174 | Ga0081540_1000054 | 3300005983 | Bacteria | 122877 |
| 175 | Ga0081540_1006385 | 3300005983 | Bacteria | 8595 |
| 176 | Ga0081540_1007455 | 3300005983 | Bacteria | 7790 |
| 177 | Ga0081540_1097568 | 3300005983 | Bacteria | 1275 |
| 178 | Ga0070717_10004121 | 3300006028 | Bacteria | 10478 |
| 179 | Ga0075365_10028242 | 3300006038 | Bacteria | 3577 |
| 180 | Ga0075365_10083293 | 3300006038 | Bacteria | 2169 |
| 181 | Ga0075363_100001280 | 3300006048 | Bacteria | 9353 |
| 182 | Ga0075364_10056584 | 3300006051 | Bacteria | 2568 |
| 183 | Ga0075364_10079571 | 3300006051 | Bacteria | 2166 |
| 184 | Ga0075364_10153432 | 3300006051 | Bacteria | 1553 |
| 185 | Ga0075364_10210508 | 3300006051 | Bacteria | 1318 |
| 186 | Ga0070715_10003350 | 3300006163 | Bacteria | 5079 |
| 187 | Ga0070715_10004973 | 3300006163 | Bacteria | 4404 |
| 188 | Ga0070716_100000665 | 3300006173 | Bacteria | 14606 |
| 189 | Ga0070716_100017392 | 3300006173 | Bacteria | 3727 |
| 190 | Ga0070712_100000828 | 3300006175 | Bacteria | 18403 |
| 191 | Ga0070712_100013772 | 3300006175 | Bacteria | 5173 |
| 192 | Ga0070712_100048016 | 3300006175 | Bacteria | 2957 |
| 193 | Ga0070712_100160370 | 3300006175 | Bacteria | 1736 |
| 194 | Ga0070712_100326985 | 3300006175 | Bacteria | 1248 |
| 195 | Ga0075362_10109335 | 3300006177 | Bacteria | 1300 |
| 196 | Ga0075367_10011766 | 3300006178 | Bacteria | 4644 |
| 197 | Ga0075367_10170213 | 3300006178 | Bacteria | 1357 |
| 198 | Ga0075369_10040039 | 3300006186 | Bacteria | 2002 |
| 199 | Ga0075366_10000720 | 3300006195 | Bacteria | 15704 |
| 200 | Ga0075366_10104284 | 3300006195 | Bacteria | 1703 |
| 201 | Ga0097621_100029902 | 3300006237 | Bacteria | 4306 |
| 202 | Ga0097621_100267583 | 3300006237 | Bacteria | 1501 |
| 203 | Ga0075370_10053644 | 3300006353 | Bacteria | 2288 |
| 204 | Ga0068871_100020391 | 3300006358 | Bacteria | 5077 |
| 205 | Ga0068871_100104909 | 3300006358 | Bacteria | 2371 |
| 206 | Ga0068871_100134484 | 3300006358 | Bacteria | 2099 |
| 207 | Ga0068871_100270403 | 3300006358 | Bacteria | 1485 |
| 208 | Ga0075428_100007488 | 3300006844 | Bacteria | 12097 |
| 209 | Ga0075428_100011583 | 3300006844 | Bacteria | 9812 |
| 210 | Ga0075428_100079977 | 3300006844 | Bacteria | 3567 |
| 211 | Ga0075430_100000194 | 3300006846 | Bacteria | 41024 |
| 212 | Ga0075430_100010104 | 3300006846 | Bacteria | 7987 |
| 213 | Ga0075431_100001907 | 3300006847 | Bacteria | 19804 |
| 214 | Ga0075433_10054818 | 3300006852 | Bacteria | 3479 |
| 215 | Ga0075433_10272174 | 3300006852 | Bacteria | 1501 |
| 216 | Ga0075434_100027681 | 3300006871 | Bacteria | 5565 |
| 217 | Ga0075434_100038910 | 3300006871 | Bacteria | 4712 |
| 218 | Ga0075434_100244944 | 3300006871 | Bacteria | 1812 |
| 219 | Ga0075429_100007710 | 3300006880 | Bacteria | 9344 |
| 220 | Ga0068865_100010883 | 3300006881 | Bacteria | 5675 |
| 221 | Ga0068865_100192614 | 3300006881 | Bacteria | 1578 |
| 222 | Ga0075436_100013964 | 3300006914 | Bacteria | 5494 |
| 223 | Ga0075436_100028674 | 3300006914 | Bacteria | 3829 |
| 224 | Ga0075436_100046607 | 3300006914 | Bacteria | 2989 |
| 225 | Ga0097620_100009674 | 3300006931 | Bacteria | 9732 |
| 226 | Ga0097620_100501017 | 3300006931 | Bacteria | 1309 |
| 227 | Ga0099824_1021728 | 3300006942 | Bacteria | 4402 |
| 228 | Ga0075435_100044461 | 3300007076 | Bacteria | 3557 |
| 229 | Ga0099794_10007029 | 3300007265 | Bacteria | 4595 |
| 230 | Ga0099794_10076104 | 3300007265 | Bacteria | 1650 |
| 231 | Ga0099795_10003412 | 3300007788 | Bacteria | 3928 |
| 232 | Ga0105240_10009798 | 3300009093 | Bacteria | 13523 |
| 233 | Ga0105240_10046855 | 3300009093 | Bacteria | 5474 |
| 234 | Ga0105240_10075491 | 3300009093 | Bacteria | 4158 |
| 235 | Ga0105240_10222481 | 3300009093 | Bacteria | 2198 |
| 236 | Ga0111539_10000178 | 3300009094 | Bacteria | 73928 |
| 237 | Ga0111539_10015064 | 3300009094 | Bacteria | 9636 |
| 238 | Ga0111539_10097907 | 3300009094 | Bacteria | 3446 |
| 239 | Ga0111539_10135829 | 3300009094 | Bacteria | 2880 |
| 240 | Ga0111539_10454921 | 3300009094 | Bacteria | 1491 |
| 241 | Ga0111539_10802949 | 3300009094 | Bacteria | 1095 |
| 242 | Ga0105245_10000795 | 3300009098 | Bacteria | 28669 |
| 243 | Ga0105245_10062246 | 3300009098 | Bacteria | 3367 |
| 244 | Ga0105245_10131908 | 3300009098 | Bacteria | 2344 |
| 245 | Ga0105245_10427741 | 3300009098 | Bacteria | 1328 |
| 246 | Ga0105247_10002881 | 3300009101 | Bacteria | 11450 |
| 247 | Ga0105247_10057895 | 3300009101 | Bacteria | 2396 |
| 248 | Ga0114129_10001129 | 3300009147 | Bacteria | 35251 |
| 249 | Ga0114129_10001774 | 3300009147 | Bacteria | 29378 |
| 250 | Ga0114129_10167848 | 3300009147 | Bacteria | 2994 |
| 251 | Ga0114129_10197519 | 3300009147 | Bacteria | 2727 |
| 252 | Ga0114129_10536806 | 3300009147 | Bacteria | 1523 |
| 253 | Ga0105243_10001724 | 3300009148 | Bacteria | 18831 |
| 254 | Ga0105241_10003139 | 3300009174 | Bacteria | 12289 |
| 255 | Ga0105242_10084848 | 3300009176 | Bacteria | 2655 |
| 256 | Ga0105242_10272776 | 3300009176 | Bacteria | 1533 |
| 257 | Ga0105248_10004961 | 3300009177 | Bacteria | 14704 |
| 258 | Ga0105248_10018306 | 3300009177 | Bacteria | 7735 |
| 259 | Ga0105248_10060964 | 3300009177 | Bacteria | 4235 |
| 260 | Ga0105248_10157262 | 3300009177 | Bacteria | 2564 |
| 261 | Ga0105248_10331904 | 3300009177 | Bacteria | 1713 |
| 262 | Ga0105237_10002479 | 3300009545 | Bacteria | 22904 |
| 263 | Ga0105237_10011410 | 3300009545 | Bacteria | 9400 |
| 264 | Ga0105237_10049801 | 3300009545 | Bacteria | 4209 |
| 265 | Ga0105238_10005746 | 3300009551 | Bacteria | 12270 |
| 266 | Ga0105238_10006964 | 3300009551 | Bacteria | 11296 |
| 267 | Ga0105238_10065663 | 3300009551 | Bacteria | 3630 |
| 268 | Ga0105238_10094208 | 3300009551 | Bacteria | 2982 |
| 269 | Ga0105238_10098196 | 3300009551 | Bacteria | 2913 |
| 270 | Ga0105238_10156278 | 3300009551 | Bacteria | 2256 |
| 271 | Ga0105238_10195955 | 3300009551 | Bacteria | 1996 |
| 272 | Ga0105238_10204562 | 3300009551 | Bacteria | 1950 |
| 273 | Ga0105238_10291349 | 3300009551 | Bacteria | 1614 |
| 274 | Ga0105249_10019431 | 3300009553 | Bacteria | 6062 |
| 275 | Ga0105249_10120341 | 3300009553 | Bacteria | 2494 |
| 276 | Ga0105249_10139501 | 3300009553 | Bacteria | 2323 |
| 277 | Ga0099796_10002243 | 3300010159 | Bacteria | 4191 |
| 278 | Ga0099796_10018620 | 3300010159 | Bacteria | 2089 |
| 279 | Ga0105239_10005471 | 3300010375 | Bacteria | 14906 |
| 280 | Ga0105239_10015919 | 3300010375 | Bacteria | 8324 |
| 281 | Ga0105239_10066301 | 3300010375 | Bacteria | 3966 |
| 282 | Ga0105239_10389279 | 3300010375 | Bacteria | 1577 |
| 283 | Ga0105246_10039290 | 3300011119 | Bacteria | 3187 |
| 284 | Ga0157313_1004702 | 3300012503 | Bacteria | 952 |
| 285 | Ga0157373_10153886 | 3300013100 | Bacteria | 1618 |
| 286 | Ga0157371_10013083 | 3300013102 | Bacteria | 6317 |
| 287 | Ga0157371_10263354 | 3300013102 | Bacteria | 1243 |
| 288 | Ga0157370_10096163 | 3300013104 | Bacteria | 2779 |
| 289 | Ga0157370_10118189 | 3300013104 | Bacteria | 2476 |
| 290 | Ga0157369_10006718 | 3300013105 | Bacteria | 13275 |
| 291 | Ga0157369_10006851 | 3300013105 | Bacteria | 13147 |
| 292 | Ga0157374_10249472 | 3300013296 | Bacteria | 1746 |
| 293 | Ga0157378_10003370 | 3300013297 | Bacteria | 14208 |
| 294 | Ga0163162_10018703 | 3300013306 | Bacteria | 6789 |
| 295 | Ga0163162_10233532 | 3300013306 | Bacteria | 1970 |
| 296 | Ga0163162_10351018 | 3300013306 | Bacteria | 1608 |
| 297 | Ga0163162_10635719 | 3300013306 | Bacteria | 1192 |
| 298 | Ga0163162_10709368 | 3300013306 | Bacteria | 1127 |
| 299 | Ga0157372_10019119 | 3300013307 | Bacteria | 7375 |
| 300 | Ga0157372_10455652 | 3300013307 | Bacteria | 1491 |
| 301 | Ga0157375_10006188 | 3300013308 | Bacteria | 10430 |
| 302 | Ga0157375_10041029 | 3300013308 | Bacteria | 4466 |
| 303 | Ga0157375_10067850 | 3300013308 | Bacteria | 3565 |
| 304 | Ga0157375_10292638 | 3300013308 | Bacteria | 1792 |
| 305 | Ga0163163_10004045 | 3300014325 | Bacteria | 12506 |
| 306 | Ga0163163_10057400 | 3300014325 | Bacteria | 3849 |
| 307 | Ga0163163_10137209 | 3300014325 | Bacteria | 2487 |
| 308 | Ga0163163_10294330 | 3300014325 | Bacteria | 1676 |
| 309 | Ga0157380_10001853 | 3300014326 | Bacteria | 13986 |
| 310 | Ga0157380_10074213 | 3300014326 | Bacteria | 2761 |
| 311 | Ga0182008_10138261 | 3300014497 | Bacteria | 1217 |
| 312 | Ga0157377_10005976 | 3300014745 | Bacteria | 5766 |
| 313 | Ga0157379_10008173 | 3300014968 | Bacteria | 9086 |
| 314 | Ga0157379_10071373 | 3300014968 | Bacteria | 3107 |
| 315 | Ga0157376_10000272 | 3300014969 | Bacteria | 35217 |
| 316 | Ga0163161_10002256 | 3300017792 | Bacteria | 13831 |
| 317 | Ga0213872_10021080 | 3300021361 | Bacteria | 3001 |
| 318 | Ga0213876_10001966 | 3300021384 | Bacteria | 12309 |
| 319 | Ga0213876_10021619 | 3300021384 | Bacteria | 3403 |
| 320 | Ga0213876_10040404 | 3300021384 | Bacteria | 2464 |
| 321 | Ga0213876_10099823 | 3300021384 | Bacteria | 1539 |
| 322 | Ga0213876_10103388 | 3300021384 | Bacteria | 1510 |
| 323 | Ga0213876_10122080 | 3300021384 | Bacteria | 1383 |
| 324 | Ga0213876_10187315 | 3300021384 | Bacteria | 1101 |
| 325 | Ga0213875_10000009 | 3300021388 | Bacteria | 451129 |
| 326 | Ga0228598_1000098 | 3300024227 | Bacteria | 14402 |
| 327 | Ga0209233_1001411 | 3300025261 | Bacteria | 9473 |
| 328 | Ga0209233_1003978 | 3300025261 | Bacteria | 5119 |
| 329 | Ga0209455_1001210 | 3300025272 | Bacteria | 12324 |
| 330 | Ga0209758_1000382 | 3300025297 | Bacteria | 76653 |
| 331 | Ga0207656_10024264 | 3300025321 | Bacteria | 2451 |
| 332 | Ga0207656_10030108 | 3300025321 | Bacteria | 2240 |
| 333 | Ga0207653_10024206 | 3300025885 | Bacteria | 1938 |
| 334 | Ga0207692_10009314 | 3300025898 | Bacteria | 4095 |
| 335 | Ga0207692_10010467 | 3300025898 | Bacteria | 3910 |
| 336 | Ga0207692_10013506 | 3300025898 | Bacteria | 3544 |
| 337 | Ga0207710_10025216 | 3300025900 | Bacteria | 2565 |
| 338 | Ga0207710_10051150 | 3300025900 | Bacteria | 1855 |
| 339 | Ga0207688_10004336 | 3300025901 | Bacteria | 7732 |
| 340 | Ga0207688_10027304 | 3300025901 | Bacteria | 3141 |
| 341 | Ga0207688_10096332 | 3300025901 | Bacteria | 1704 |
| 342 | Ga0207688_10135993 | 3300025901 | Bacteria | 1443 |
| 343 | Ga0207680_10046663 | 3300025903 | Bacteria | 2562 |
| 344 | Ga0207647_10000591 | 3300025904 | Bacteria | 28212 |
| 345 | Ga0207647_10009490 | 3300025904 | Bacteria | 6910 |
| 346 | Ga0207699_10001015 | 3300025906 | Bacteria | 13296 |
| 347 | Ga0207699_10011571 | 3300025906 | Bacteria | 4462 |
| 348 | Ga0207645_10003182 | 3300025907 | Bacteria | 12568 |
| 349 | Ga0207645_10214618 | 3300025907 | Bacteria | 1268 |
| 350 | Ga0207643_10044356 | 3300025908 | Bacteria | 2510 |
| 351 | Ga0207705_10031045 | 3300025909 | Bacteria | 3813 |
| 352 | Ga0207705_10074333 | 3300025909 | Bacteria | 2467 |
| 353 | Ga0207654_10002679 | 3300025911 | Bacteria | 9043 |
| 354 | Ga0207707_10016749 | 3300025912 | Bacteria | 6386 |
| 355 | Ga0207707_10160242 | 3300025912 | Bacteria | 1967 |
| 356 | Ga0207707_10317586 | 3300025912 | Bacteria | 1345 |
| 357 | Ga0207695_10072126 | 3300025913 | Bacteria | 3525 |
| 358 | Ga0207695_10115370 | 3300025913 | Bacteria | 2660 |
| 359 | Ga0207695_10146479 | 3300025913 | Bacteria | 2305 |
| 360 | Ga0207671_10039935 | 3300025914 | Bacteria | 3475 |
| 361 | Ga0207671_10056119 | 3300025914 | Bacteria | 2918 |
| 362 | Ga0207671_10193658 | 3300025914 | Bacteria | 1586 |
| 363 | Ga0207693_10000607 | 3300025915 | Bacteria | 32076 |
| 364 | Ga0207693_10004165 | 3300025915 | Bacteria | 12271 |
| 365 | Ga0207693_10007266 | 3300025915 | Bacteria | 9112 |
| 366 | Ga0207693_10008135 | 3300025915 | Bacteria | 8594 |
| 367 | Ga0207693_10012377 | 3300025915 | Bacteria | 6891 |
| 368 | Ga0207693_10047797 | 3300025915 | Bacteria | 3361 |
| 369 | Ga0207693_10057393 | 3300025915 | Bacteria | 3051 |
| 370 | Ga0207663_10014213 | 3300025916 | Bacteria | 4351 |
| 371 | Ga0207663_10027847 | 3300025916 | Bacteria | 3299 |
| 372 | Ga0207660_10004044 | 3300025917 | Bacteria | 9568 |
| 373 | Ga0207660_10043311 | 3300025917 | Bacteria | 3163 |
| 374 | Ga0207660_10064354 | 3300025917 | Bacteria | 2647 |
| 375 | Ga0207662_10005337 | 3300025918 | Bacteria | 6840 |
| 376 | Ga0207662_10027516 | 3300025918 | Bacteria | 3281 |
| 377 | Ga0207662_10051140 | 3300025918 | Bacteria | 2458 |
| 378 | Ga0207657_10000086 | 3300025919 | Bacteria | 88712 |
| 379 | Ga0207657_10005450 | 3300025919 | Bacteria | 13282 |
| 380 | Ga0207657_10053517 | 3300025919 | Bacteria | 3496 |
| 381 | Ga0207657_10079892 | 3300025919 | Bacteria | 2751 |
| 382 | Ga0207652_10014040 | 3300025921 | Bacteria | 6484 |
| 383 | Ga0207652_10024214 | 3300025921 | Bacteria | 5035 |
| 384 | Ga0207652_10070440 | 3300025921 | Bacteria | 3037 |
| 385 | Ga0207652_10094842 | 3300025921 | Bacteria | 2628 |
| 386 | Ga0207652_10137287 | 3300025921 | Bacteria | 2184 |
| 387 | Ga0207681_10007570 | 3300025923 | Bacteria | 6653 |
| 388 | Ga0207681_10027077 | 3300025923 | Bacteria | 3704 |
| 389 | Ga0207694_10009826 | 3300025924 | Bacteria | 7225 |
| 390 | Ga0207694_10084241 | 3300025924 | Bacteria | 2501 |
| 391 | Ga0207694_10245681 | 3300025924 | Bacteria | 1463 |
| 392 | Ga0207650_10207475 | 3300025925 | Bacteria | 1572 |
| 393 | Ga0207659_10008710 | 3300025926 | Bacteria | 6315 |
| 394 | Ga0207687_10003118 | 3300025927 | Bacteria | 11238 |
| 395 | Ga0207700_10012952 | 3300025928 | Bacteria | 5402 |
| 396 | Ga0207700_10041040 | 3300025928 | Bacteria | 3382 |
| 397 | Ga0207700_10249176 | 3300025928 | Bacteria | 1517 |
| 398 | Ga0207664_10011218 | 3300025929 | Bacteria | 6354 |
| 399 | Ga0207664_10100910 | 3300025929 | Bacteria | 2384 |
| 400 | Ga0207664_10174415 | 3300025929 | Bacteria | 1842 |
| 401 | Ga0207664_10479577 | 3300025929 | Bacteria | 1112 |
| 402 | Ga0207644_10006653 | 3300025931 | Bacteria | 7533 |
| 403 | Ga0207644_10304948 | 3300025931 | Bacteria | 1284 |
| 404 | Ga0207690_10002052 | 3300025932 | Bacteria | 12339 |
| 405 | Ga0207690_10038007 | 3300025932 | Bacteria | 3129 |
| 406 | Ga0207706_10000234 | 3300025933 | Bacteria | 60759 |
| 407 | Ga0207706_10015658 | 3300025933 | Bacteria | 6852 |
| 408 | Ga0207706_10039839 | 3300025933 | Bacteria | 4165 |
| 409 | Ga0207686_10011136 | 3300025934 | Bacteria | 4916 |
| 410 | Ga0207686_10026555 | 3300025934 | Bacteria | 3380 |
| 411 | Ga0207686_10160255 | 3300025934 | Bacteria | 1576 |
| 412 | Ga0207709_10006140 | 3300025935 | Bacteria | 6767 |
| 413 | Ga0207709_10014962 | 3300025935 | Bacteria | 4295 |
| 414 | Ga0207670_10009279 | 3300025936 | Bacteria | 5604 |
| 415 | Ga0207670_10101130 | 3300025936 | Bacteria | 2059 |
| 416 | Ga0207669_10009575 | 3300025937 | Bacteria | 4625 |
| 417 | Ga0207669_10040977 | 3300025937 | Bacteria | 2691 |
| 418 | Ga0207669_10062712 | 3300025937 | Bacteria | 2291 |
| 419 | Ga0207704_10025319 | 3300025938 | Bacteria | 3235 |
| 420 | Ga0207665_10000120 | 3300025939 | Bacteria | 51773 |
| 421 | Ga0207665_10029075 | 3300025939 | Bacteria | 3655 |
| 422 | Ga0207665_10040476 | 3300025939 | Bacteria | 3110 |
| 423 | Ga0207665_10186652 | 3300025939 | Bacteria | 1504 |
| 424 | Ga0207691_10000538 | 3300025940 | Bacteria | 37878 |
| 425 | Ga0207711_10007098 | 3300025941 | Bacteria | 9384 |
| 426 | Ga0207711_10028742 | 3300025941 | Bacteria | 4683 |
| 427 | Ga0207711_10032664 | 3300025941 | Bacteria | 4401 |
| 428 | Ga0207711_10164895 | 3300025941 | Bacteria | 2008 |
| 429 | Ga0207689_10016336 | 3300025942 | Bacteria | 6288 |
| 430 | Ga0207689_10147605 | 3300025942 | Bacteria | 1938 |
| 431 | Ga0207661_10016618 | 3300025944 | Bacteria | 5432 |
| 432 | Ga0207661_10027740 | 3300025944 | Bacteria | 4329 |
| 433 | Ga0207661_10282717 | 3300025944 | Bacteria | 1483 |
| 434 | Ga0207679_10003216 | 3300025945 | Bacteria | 10074 |
| 435 | Ga0207667_10007354 | 3300025949 | Bacteria | 13255 |
| 436 | Ga0207667_10008981 | 3300025949 | Bacteria | 11823 |
| 437 | Ga0207667_10026394 | 3300025949 | Bacteria | 6348 |
| 438 | Ga0207667_10185330 | 3300025949 | Bacteria | 2137 |
| 439 | Ga0207667_10192076 | 3300025949 | Bacteria | 2095 |
| 440 | Ga0207651_10000671 | 3300025960 | Bacteria | 14621 |
| 441 | Ga0207651_10151692 | 3300025960 | Bacteria | 1805 |
| 442 | Ga0207712_10013620 | 3300025961 | Bacteria | 5215 |
| 443 | Ga0207712_10014439 | 3300025961 | Bacteria | 5083 |
| 444 | Ga0207712_10122304 | 3300025961 | Bacteria | 1971 |
| 445 | Ga0207668_10010926 | 3300025972 | Bacteria | 5504 |
| 446 | Ga0207668_10019195 | 3300025972 | Bacteria | 4315 |
| 447 | Ga0207668_10149217 | 3300025972 | Bacteria | 1808 |
| 448 | Ga0207668_10227758 | 3300025972 | Bacteria | 1501 |
| 449 | Ga0207640_10007336 | 3300025981 | Bacteria | 6086 |
| 450 | Ga0207640_10044405 | 3300025981 | Bacteria | 2847 |
| 451 | Ga0207640_10071720 | 3300025981 | Bacteria | 2334 |
| 452 | Ga0207703_10163721 | 3300026035 | Bacteria | 1950 |
| 453 | Ga0207639_10067181 | 3300026041 | Bacteria | 2789 |
| 454 | Ga0207639_10392588 | 3300026041 | Bacteria | 1248 |
| 455 | Ga0207678_10000048 | 3300026067 | Bacteria | 90920 |
| 456 | Ga0207678_10024049 | 3300026067 | Bacteria | 5323 |
| 457 | Ga0207678_10273436 | 3300026067 | Bacteria | 1449 |
| 458 | Ga0207708_10000443 | 3300026075 | Bacteria | 32270 |
| 459 | Ga0207708_10017716 | 3300026075 | Bacteria | 5361 |
| 460 | Ga0207708_10121060 | 3300026075 | Bacteria | 2039 |
| 461 | Ga0207702_10020692 | 3300026078 | Bacteria | 5443 |
| 462 | Ga0207702_10166763 | 3300026078 | Bacteria | 2016 |
| 463 | Ga0207648_10034341 | 3300026089 | Bacteria | 4471 |
| 464 | Ga0207648_10040596 | 3300026089 | Bacteria | 4088 |
| 465 | Ga0207648_10246897 | 3300026089 | Bacteria | 1591 |
| 466 | Ga0207676_10010515 | 3300026095 | Bacteria | 6593 |
| 467 | Ga0207676_10048660 | 3300026095 | Bacteria | 3293 |
| 468 | Ga0207676_10172389 | 3300026095 | Bacteria | 1886 |
| 469 | Ga0207674_10002888 | 3300026116 | Bacteria | 21348 |
| 470 | Ga0207674_10003550 | 3300026116 | Bacteria | 19032 |
| 471 | Ga0207674_10058414 | 3300026116 | Bacteria | 3908 |
| 472 | Ga0207674_10065797 | 3300026116 | Bacteria | 3653 |
| 473 | Ga0207674_10320521 | 3300026116 | Bacteria | 1499 |
| 474 | Ga0207675_100000155 | 3300026118 | Bacteria | 60380 |
| 475 | Ga0207675_100125719 | 3300026118 | Bacteria | 2429 |
| 476 | Ga0207683_10001926 | 3300026121 | Bacteria | 18374 |
| 477 | Ga0207683_10064387 | 3300026121 | Bacteria | 3231 |
| 478 | Ga0207683_10133008 | 3300026121 | Bacteria | 2238 |
| 479 | Ga0207683_10142076 | 3300026121 | Bacteria | 2164 |
| 480 | Ga0207683_10192748 | 3300026121 | Bacteria | 1851 |
| 481 | Ga0207698_10006352 | 3300026142 | Bacteria | 7365 |
| 482 | Ga0207698_10042376 | 3300026142 | Bacteria | 3400 |
| 483 | Ga0207698_10304829 | 3300026142 | Bacteria | 1484 |
| 484 | Ga0209389_1000034 | 3300027296 | Bacteria | 127289 |
| 485 | Ga0209371_1000729 | 3300027312 | Bacteria | 27629 |
| 486 | Ga0209371_1024599 | 3300027312 | Bacteria | 1398 |
| 487 | Ga0209589_1000038 | 3300027357 | Bacteria | 127285 |
| 488 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 489 | Ga0209179_1007997 | 3300027512 | Bacteria | 1766 |
| 490 | Ga0209179_1018677 | 3300027512 | Bacteria | 1326 |
| 491 | Ga0209998_10011035 | 3300027717 | Bacteria | 1869 |
| 492 | Ga0207428_10023841 | 3300027907 | Bacteria | 5140 |
| 493 | Ga0207428_10030696 | 3300027907 | Bacteria | 4440 |
| 494 | Ga0268266_10024250 | 3300028379 | Bacteria | 5162 |
| 495 | Ga0268265_10159114 | 3300028380 | Bacteria | 1916 |
| 496 | Ga0268264_10004457 | 3300028381 | Bacteria | 11942 |
| 497 | Ga0268264_10187032 | 3300028381 | Bacteria | 1885 |
| 498 | Ga0268256_1004292 | 3300030500 | Bacteria | 5970 |
| 499 | Ga0268256_1022380 | 3300030500 | Bacteria | 1658 |
| 500 | Ga0265330_10004963 | 3300031235 | Bacteria | 6690 |
| 501 | Ga0265330_10022124 | 3300031235 | Bacteria | 2897 |
| 502 | Ga0265330_10022247 | 3300031235 | Bacteria | 2887 |
| 503 | Ga0265330_10095647 | 3300031235 | Bacteria | 1273 |
| 504 | Ga0265332_10003645 | 3300031238 | Bacteria | 7379 |
| 505 | Ga0265332_10076693 | 3300031238 | Bacteria | 1420 |
| 506 | Ga0265320_10092642 | 3300031240 | Bacteria | 1398 |
| 507 | Ga0265325_10000254 | 3300031241 | Bacteria | 38034 |
| 508 | Ga0265325_10003840 | 3300031241 | Bacteria | 9661 |
| 509 | Ga0265325_10014755 | 3300031241 | Bacteria | 4409 |
| 510 | Ga0265329_10071541 | 3300031242 | Bacteria | 1097 |
| 511 | Ga0265340_10000617 | 3300031247 | Bacteria | 19928 |
| 512 | Ga0265340_10015541 | 3300031247 | Bacteria | 3953 |
| 513 | Ga0265340_10033670 | 3300031247 | Bacteria | 2550 |
| 514 | Ga0265339_10000016 | 3300031249 | Bacteria | 185313 |
| 515 | Ga0265339_10002621 | 3300031249 | Bacteria | 12830 |
| 516 | Ga0265339_10007837 | 3300031249 | Bacteria | 6853 |
| 517 | Ga0265339_10065515 | 3300031249 | Bacteria | 1947 |
| 518 | Ga0265331_10025502 | 3300031250 | Bacteria | 2984 |
| 519 | Ga0265316_10045413 | 3300031344 | Bacteria | 3488 |
| 520 | Ga0265316_10105018 | 3300031344 | Bacteria | 2144 |
| 521 | Ga0265316_10127390 | 3300031344 | Bacteria | 1919 |
| 522 | Ga0307513_10229070 | 3300031456 | Bacteria | 1672 |
| 523 | Ga0265313_10000060 | 3300031595 | Bacteria | 107224 |
| 524 | Ga0265313_10035182 | 3300031595 | Bacteria | 2525 |
| 525 | Ga0265313_10064893 | 3300031595 | Bacteria | 1697 |
| 526 | Ga0265313_10123110 | 3300031595 | Bacteria | 1130 |
| 527 | Ga0307508_10000012 | 3300031616 | Bacteria | 243167 |
| 528 | Ga0316575_10005549 | 3300031665 | Bacteria | 4499 |
| 529 | Ga0316579_10000697 | 3300031691 | Bacteria | 11453 |
| 530 | Ga0265314_10005172 | 3300031711 | Bacteria | 11847 |
| 531 | Ga0265314_10056160 | 3300031711 | Bacteria | 2712 |
| 532 | Ga0265314_10062854 | 3300031711 | Bacteria | 2521 |
| 533 | Ga0265314_10063537 | 3300031711 | Bacteria | 2504 |
| 534 | Ga0265342_10000321 | 3300031712 | Bacteria | 54074 |
| 535 | Ga0265342_10000681 | 3300031712 | Bacteria | 35543 |
| 536 | Ga0265342_10023484 | 3300031712 | Bacteria | 3902 |
| 537 | Ga0265342_10062440 | 3300031712 | Bacteria | 2193 |
| 538 | Ga0316576_10090234 | 3300031727 | Bacteria | 2282 |
| 539 | Ga0316578_10064945 | 3300031728 | Bacteria | 2154 |
| 540 | Ga0307516_10161782 | 3300031730 | Bacteria | 1988 |
| 541 | Ga0316577_10014741 | 3300031733 | Bacteria | 4294 |
| 542 | Ga0307414_10149706 | 3300032004 | Bacteria | 1839 |
| 543 | Ga0307414_10259159 | 3300032004 | Bacteria | 1450 |
| 544 | Ga0307411_10056659 | 3300032005 | Bacteria | 2585 |
| 545 | Ga0316583_10003003 | 3300032133 | Bacteria | 5931 |
| 546 | Ga0316585_10003818 | 3300032137 | Bacteria | 4166 |
| 547 | Ga0316580_10000948 | 3300032139 | Bacteria | 7207 |
| 548 | Ga0307510_10006633 | 3300033180 | Bacteria | 13810 |
| 549 | Ga0307510_10177783 | 3300033180 | Bacteria | 1696 |
| 550 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 551 | Ga0316596_1026098 | 3300033541 | Bacteria | 1505 |
| 552 | Ga0373938_0010032 | 3300034957 | Bacteria | 1730 |
| 553 | Ga0373929_0013142 | 3300035085 | Bacteria | 1583 |
| 554 | Ga0373934_0015955 | 3300035086 | Bacteria | 2853 |
| 555 | Ga0373923_0001014 | 3300035111 | Bacteria | 7618 |
| 556 | Ga0373923_0018141 | 3300035111 | Bacteria | 2704 |
| 557 | Ga0373923_0046030 | 3300035111 | Bacteria | 1813 |
| 558 | Ga0373932_0006296 | 3300035112 | Bacteria | 2806 |
| 559 | Ga0373936_0050748 | 3300035113 | Bacteria | 1678 |
| 560 | Ga0373941_0006186 | 3300035115 | Bacteria | 2869 |
| 561 | Ga0373945_0001639 | 3300035116 | Bacteria | 6866 |
| 562 | Ga0373953_0000726 | 3300035117 | Bacteria | 9096 |
| 563 | Ga0373953_0074506 | 3300035117 | Bacteria | 1404 |
| 564 | Ga0373954_0002928 | 3300035118 | Bacteria | 7200 |
| 565 | Ga0373954_0088688 | 3300035118 | Bacteria | 1484 |
| 566 | Ga0373956_0009029 | 3300035119 | Bacteria | 4042 |
| 567 | Ga0373956_0035536 | 3300035119 | Bacteria | 2198 |
| 568 | Ga0373943_0003886 | 3300035170 | Bacteria | 6800 |
| 569 | Ga0373943_0196710 | 3300035170 | Bacteria | 1114 |
| 570 | Ga0373946_0002901 | 3300035171 | Bacteria | 6083 |
| 571 | Ga0373946_0130182 | 3300035171 | Bacteria | 1157 |
| 572 | Ga0373955_0001221 | 3300035172 | Bacteria | 10920 |
| 573 | Ga0373942_0005006 | 3300035207 | Bacteria | 3072 |
| 574 | Ga0316574_0094787 | 3300035398 | Bacteria | 1906 |
| 575 | Ga0373924_0011619 | 3300035410 | Bacteria | 3274 |
| 576 | Ga0373924_0033708 | 3300035410 | Bacteria | 2069 |
| 577 | Ga0373931_0001104 | 3300035691 | Bacteria | 11454 |
| 578 | Ga0373931_0047101 | 3300035691 | Bacteria | 2281 |
| 579 | Ga0373931_0175453 | 3300035691 | Bacteria | 1266 |
| 580 | Ga0373935_0003708 | 3300035692 | Bacteria | 8915 |
| 581 | Ga0373935_0097406 | 3300035692 | Bacteria | 1935 |
| 582 | Ga0373935_0198344 | 3300035692 | Bacteria | 1386 |
| 583 | Ga0373935_0229814 | 3300035692 | Bacteria | 1291 |
| 584 | Ga0373927_0006337 | 3300035695 | Bacteria | 8062 |
| 585 | Ga0373927_0122295 | 3300035695 | Bacteria | 1699 |
| 586 | Ga0373933_0005193 | 3300035724 | Bacteria | 7107 |
| 587 | Ga0373933_0005801 | 3300035724 | Bacteria | 6717 |
| 588 | Ga0373933_0058496 | 3300035724 | Bacteria | 2319 |
| 589 | Ga0373933_0064749 | 3300035724 | Bacteria | 2212 |
| 590 | Ga0373947_0005376 | 3300035725 | Bacteria | 7472 |
| 591 | Ga0373947_0060879 | 3300035725 | Bacteria | 2293 |
| 592 | Ga0373947_0100030 | 3300035725 | Bacteria | 1821 |
| 593 | Ga0373947_0143534 | 3300035725 | Bacteria | 1533 |
| 594 | Ga0373947_0205445 | 3300035725 | Bacteria | 1290 |
| 595 | Ga0373937_0000058 | 3300036401 | Bacteria | 99025 |
| 596 | Ga0373937_0002442 | 3300036401 | Bacteria | 15442 |
| 597 | Ga0373937_0002520 | 3300036401 | Bacteria | 15212 |
| 598 | Ga0373937_0010494 | 3300036401 | Bacteria | 8089 |
| 599 | Ga0373937_0033289 | 3300036401 | Bacteria | 4679 |
| 600 | Ga0373937_0060812 | 3300036401 | Bacteria | 3471 |
| 601 | Ga0373937_0259175 | 3300036401 | Bacteria | 1640 |
| 602 | Ga0373937_0342657 | 3300036401 | Bacteria | 1415 |
| 603 | Ga0316582_0074705 | 3300036647 | Bacteria | 2201 |
| 604 | Ga0316582_0084831 | 3300036647 | Bacteria | 2074 |
| 605 | Ga0316584_0002253 | 3300036712 | Bacteria | 12117 |
| 606 | Ga0373925_0000036 | 3300037068 | Bacteria | 143388 |
| 607 | Ga0373925_0014258 | 3300037068 | Bacteria | 5750 |
| 608 | Ga0373925_0037001 | 3300037068 | Bacteria | 3602 |
| 609 | Ga0373925_0090824 | 3300037068 | Bacteria | 2335 |
| 610 | Ga0395900_0146615 | 3300037418 | Bacteria | 2413 |
| 611 | Ga0395898_0204915 | 3300037466 | Bacteria | 1882 |
| 612 | Ga0395898_0232753 | 3300037466 | Bacteria | 1757 |
| 613 | Ga0395905_0025716 | 3300037471 | Bacteria | 5550 |
| 614 | Ga0316581_0000324 | 3300037588 | Bacteria | 8599 |
| 615 | Ga0436364_0079156 | 3300037853 | Bacteria | 1400 |
| 616 | Ga0436364_0413488 | 3300037853 | Bacteria | 83589 |
| 617 | Ga0436364_0875330 | 3300037853 | Bacteria | 4257 |
| 618 | Ga0436364_1353015 | 3300037853 | Bacteria | 1902 |
| 619 | Ga0395901_0003430 | 3300038443 | Bacteria | 15971 |
| 620 | Ga0436365_0304759 | 3300039437 | Bacteria | 17649 |
| 621 | Ga0436365_0418627 | 3300039437 | Bacteria | 1753 |
| 622 | Ga0436365_0470321 | 3300039437 | Bacteria | 1384 |
| 623 | Ga0436365_1147119 | 3300039437 | Bacteria | 1411 |
| 624 | Ga0436365_1258671 | 3300039437 | Bacteria | 3647 |
| 625 | Ga0436365_1431698 | 3300039437 | Bacteria | 2419 |
| 626 | Ga0436365_1466455 | 3300039437 | Bacteria | 80141 |
| 627 | Ga0436365_1501331 | 3300039437 | Bacteria | 2412 |
| 628 | Ga0436365_1630180 | 3300039437 | Bacteria | 3851 |
| 629 | Ga0436360_0079901 | 3300039438 | Bacteria | 2558 |
| 630 | Ga0436360_0554196 | 3300039438 | Bacteria | 2241 |
| 631 | Ga0436360_0776902 | 3300039438 | Bacteria | 1583 |
| 632 | Ga0436361_0126718 | 3300039447 | Bacteria | 1489 |
| 633 | Ga0436361_0271405 | 3300039447 | Bacteria | 3305 |
| 634 | Ga0436361_0504819 | 3300039447 | Bacteria | 1613 |
| 635 | Ga0436361_0575176 | 3300039447 | Bacteria | 16913 |
| 636 | Ga0436361_1103503 | 3300039447 | Bacteria | 1136 |
| 637 | Ga0436363_0670432 | 3300039450 | Bacteria | 1413 |
| 638 | Ga0436363_0721044 | 3300039450 | Bacteria | 3006 |
| 639 | Ga0436363_0937763 | 3300039450 | Bacteria | 14249 |
| 640 | Ga0436362_0150968 | 3300039453 | Bacteria | 1315 |
| 641 | Ga0439453_0000430 | 3300041408 | Bacteria | 4556 |
| 642 | Ga0439448_0048723 | 3300042005 | Bacteria | 1384 |
| 643 | Ga0466966_0072437 | 3300044684 | Bacteria | 2157 |
| 644 | Ga0466961_0069040 | 3300044693 | Bacteria | 2244 |
| 645 | Ga0466961_0074335 | 3300044693 | Bacteria | 2155 |
| 646 | Ga0466963_0025056 | 3300044694 | Bacteria | 3801 |
| 647 | Ga0466963_0130010 | 3300044694 | Bacteria | 1739 |
| 648 | Ga0466963_0183059 | 3300044694 | Bacteria | 1463 |
| 649 | Ga0466957_0150399 | 3300044842 | Bacteria | 1505 |
| 650 | Ga0466959_0057250 | 3300045049 | Bacteria | 2842 |
| 651 | Ga0466959_0090259 | 3300045049 | Bacteria | 2201 |
| 652 | Ga0466958_0111706 | 3300045836 | Bacteria | 1706 |
| 653 | Ga0466958_0189181 | 3300045836 | Bacteria | 1308 |
| 654 | Ga0466967_0144639 | 3300045976 | Bacteria | 2217 |
| 655 | Ga0466967_0352298 | 3300045976 | Bacteria | 1425 |
| 656 | Ga0466967_0460219 | 3300045976 | Bacteria | 1244 |
| 657 | Ga0495592_0000232 | 3300046454 | Bacteria | 48214 |
| 658 | Ga0495592_0020438 | 3300046454 | Bacteria | 5035 |
| 659 | Ga0495603_0001784 | 3300046455 | Bacteria | 12697 |
| 660 | Ga0495590_0032126 | 3300046457 | Bacteria | 1836 |
| 661 | Ga0495629_0015449 | 3300046459 | Bacteria | 5482 |
| 662 | Ga0495629_0113224 | 3300046459 | Bacteria | 1891 |
| 663 | Ga0495629_0147983 | 3300046459 | Bacteria | 1633 |
| 664 | Ga0495638_0034095 | 3300046460 | Bacteria | 3251 |
| 665 | Ga0495651_0001333 | 3300046462 | Bacteria | 19125 |
| 666 | Ga0495651_0009003 | 3300046462 | Bacteria | 7664 |
| 667 | Ga0495651_0109611 | 3300046462 | Bacteria | 2043 |
| 668 | Ga0495653_0000069 | 3300046463 | Bacteria | 89715 |
| 669 | Ga0495653_0062850 | 3300046463 | Bacteria | 2804 |
| 670 | Ga0495653_0122136 | 3300046463 | Bacteria | 1854 |
| 671 | Ga0495582_0041078 | 3300046473 | Bacteria | 2548 |
| 672 | Ga0495582_0051531 | 3300046473 | Bacteria | 2269 |
| 673 | Ga0495582_0133492 | 3300046473 | Bacteria | 1404 |
| 674 | Ga0495605_0038492 | 3300046474 | Bacteria | 2399 |
| 675 | Ga0495662_0000613 | 3300046476 | Bacteria | 16534 |
| 676 | Ga0495662_0010328 | 3300046476 | Bacteria | 4575 |
| 677 | Ga0495664_0000010 | 3300046477 | Bacteria | 268381 |
| 678 | Ga0495664_0135693 | 3300046477 | Bacteria | 1491 |
| 679 | Ga0495664_0199257 | 3300046477 | Bacteria | 1213 |
| 680 | Ga0495608_0000008 | 3300046511 | Bacteria | 268629 |
| 681 | Ga0495608_0004302 | 3300046511 | Bacteria | 10197 |
| 682 | Ga0495608_0040234 | 3300046511 | Bacteria | 3132 |
| 683 | Ga0495618_0000002 | 3300046514 | Bacteria | 271353 |
| 684 | Ga0495628_0000009 | 3300046516 | Bacteria | 237611 |
| 685 | Ga0495628_0023938 | 3300046516 | Bacteria | 5005 |
| 686 | Ga0495630_0001382 | 3300046517 | Bacteria | 16742 |
| 687 | Ga0495637_0030494 | 3300046520 | Bacteria | 2392 |
| 688 | Ga0495666_0050554 | 3300046526 | Bacteria | 1998 |
| 689 | Ga0495652_0000011 | 3300046529 | Bacteria | 255329 |
| 690 | Ga0495652_0021038 | 3300046529 | Bacteria | 5798 |
| 691 | Ga0495665_0040561 | 3300046531 | Bacteria | 2478 |
| 692 | Ga0495640_0000009 | 3300046533 | Bacteria | 217086 |
| 693 | Ga0495640_0007182 | 3300046533 | Bacteria | 8774 |
| 694 | Ga0495640_0038316 | 3300046533 | Bacteria | 3372 |
| 695 | Ga0495640_0062038 | 3300046533 | Bacteria | 2537 |
| 696 | Ga0495640_0214174 | 3300046533 | Bacteria | 1217 |
| 697 | Ga0495586_0192144 | 3300046535 | Bacteria | 1156 |
| 698 | Ga0495587_0000006 | 3300046536 | Bacteria | 310070 |
| 699 | Ga0495587_0002711 | 3300046536 | Bacteria | 11824 |
| 700 | Ga0495587_0038741 | 3300046536 | Bacteria | 2856 |
| 701 | Ga0495645_0000010 | 3300046543 | Bacteria | 238337 |
| 702 | Ga0495645_0006697 | 3300046543 | Bacteria | 8004 |
| 703 | Ga0495667_0000005 | 3300046559 | Bacteria | 268252 |
| 704 | Ga0495667_0223220 | 3300046559 | Bacteria | 1202 |
| 705 | Ga0495656_0002300 | 3300046615 | Bacteria | 6315 |
| 706 | Ga0495656_0009606 | 3300046615 | Bacteria | 3486 |
| 707 | Ga0495656_0024270 | 3300046615 | Bacteria | 2393 |
| 708 | Ga0495634_0000055 | 3300046642 | Bacteria | 89761 |
| 709 | Ga0495634_0066453 | 3300046642 | Bacteria | 2387 |
| 710 | Ga0495634_0133131 | 3300046642 | Bacteria | 1583 |
| 711 | Ga0495635_0000008 | 3300046663 | Bacteria | 268349 |
| 712 | Ga0495635_0009980 | 3300046663 | Bacteria | 6639 |
| 713 | Ga0495635_0193476 | 3300046663 | Bacteria | 1380 |
| 714 | Ga0495659_0009162 | 3300046664 | Bacteria | 3156 |
| 715 | Ga0495659_0093143 | 3300046664 | Bacteria | 1159 |
| 716 | Ga0495657_0000470 | 3300046675 | Bacteria | 37809 |
| 717 | Ga0495657_0011293 | 3300046675 | Bacteria | 6685 |
| 718 | Ga0495657_0104687 | 3300046675 | Bacteria | 1799 |
| 719 | Ga0495599_0000250 | 3300046678 | Bacteria | 34000 |
| 720 | Ga0495599_0013111 | 3300046678 | Bacteria | 5120 |
| 721 | Ga0495599_0029696 | 3300046678 | Bacteria | 3428 |
| 722 | Ga0495599_0159518 | 3300046678 | Bacteria | 1394 |
| 723 | Ga0495623_0000004 | 3300046679 | Bacteria | 142249 |
| 724 | Ga0495623_0001957 | 3300046679 | Bacteria | 13828 |
| 725 | Ga0495623_0021314 | 3300046679 | Bacteria | 4185 |
| 726 | Ga0495646_0000040 | 3300046680 | Bacteria | 71368 |
| 727 | Ga0495646_0003029 | 3300046680 | Bacteria | 10405 |
| 728 | Ga0495646_0164906 | 3300046680 | Bacteria | 1224 |
| 729 | Ga0495647_0027549 | 3300046681 | Bacteria | 2089 |
| 730 | Ga0495658_0033556 | 3300046683 | Bacteria | 2812 |
| 731 | Ga0495658_0114604 | 3300046683 | Bacteria | 1624 |
| 732 | Ga0495613_0061740 | 3300046689 | Bacteria | 2744 |
| 733 | Ga0495624_0031025 | 3300046690 | Bacteria | 3479 |
| 734 | Ga0495600_0000080 | 3300046809 | Bacteria | 53421 |
| 735 | Ga0495600_0006445 | 3300046809 | Bacteria | 7147 |
| 736 | Ga0495600_0010737 | 3300046809 | Bacteria | 5693 |
| 737 | Ga0495581_0004214 | 3300047315 | Bacteria | 8287 |
| 738 | Ga0495604_0000012 | 3300047317 | Bacteria | 268341 |
| 739 | Ga0495604_0006606 | 3300047317 | Bacteria | 9191 |
| 740 | Ga0495604_0060950 | 3300047317 | Bacteria | 2887 |
| 741 | Ga0495604_0124284 | 3300047317 | Bacteria | 1863 |
| 742 | Ga0495674_0000011 | 3300047319 | Bacteria | 270911 |
| 743 | Ga0495674_0026023 | 3300047319 | Bacteria | 5354 |
| 744 | Ga0495674_0086589 | 3300047319 | Bacteria | 2682 |
| 745 | Ga0495674_0488623 | 3300047319 | Bacteria | 986 |
| 746 | Ga0495676_0051544 | 3300047321 | Bacteria | 3291 |
| 747 | Ga0495680_0001797 | 3300047322 | Bacteria | 22695 |
| 748 | Ga0495680_0011098 | 3300047322 | Bacteria | 7997 |
| 749 | Ga0495680_0015778 | 3300047322 | Bacteria | 6504 |
| 750 | Ga0495680_0016486 | 3300047322 | Bacteria | 6344 |
| 751 | Ga0495675_0000468 | 3300047444 | Bacteria | 26603 |
| 752 | Ga0495675_0002614 | 3300047444 | Bacteria | 10792 |
| 753 | Ga0495675_0179201 | 3300047444 | Bacteria | 1298 |
| 754 | Ga0495684_0000014 | 3300047471 | Bacteria | 172111 |
| 755 | Ga0495684_0026883 | 3300047471 | Bacteria | 4421 |
| 756 | Ga0495684_0047820 | 3300047471 | Bacteria | 3271 |
| 757 | Ga0495593_0000650 | 3300047673 | Bacteria | 20010 |
| 758 | Ga0495602_0000019 | 3300048088 | Bacteria | 170922 |
| 759 | Ga0495602_0004530 | 3300048088 | Bacteria | 14499 |
| 760 | Ga0496100_0024849 | 3300048903 | Bacteria | 3659 |
| 761 | Ga0496100_0035039 | 3300048903 | Bacteria | 3155 |
| 762 | Ga0496100_0050297 | 3300048903 | Bacteria | 2699 |
| 763 | Ga0496100_0051089 | 3300048903 | Bacteria | 2682 |
| 764 | Ga0496100_0063231 | 3300048903 | Bacteria | 2445 |
| 765 | Ga0496100_0081171 | 3300048903 | Bacteria | 2190 |
| 766 | Ga0496100_0084627 | 3300048903 | Bacteria | 2150 |
| 767 | Ga0496101_0005059 | 3300048904 | Bacteria | 8383 |
| 768 | Ga0496101_0033101 | 3300048904 | Bacteria | 3644 |
| 769 | Ga0496101_0046415 | 3300048904 | Bacteria | 3115 |
| 770 | Ga0496101_0096854 | 3300048904 | Bacteria | 2202 |
| 771 | Ga0496101_0148744 | 3300048904 | Bacteria | 1790 |
| 772 | Ga0496101_0299598 | 3300048904 | Bacteria | 1259 |
| 773 | Ga0496102_0026747 | 3300048905 | Bacteria | 5149 |
| 774 | Ga0496102_0209420 | 3300048905 | Bacteria | 1838 |
| 775 | Ga0496103_0006682 | 3300048906 | Bacteria | 6883 |
| 776 | Ga0496103_0024965 | 3300048906 | Bacteria | 3609 |
| 777 | Ga0496103_0115322 | 3300048906 | Bacteria | 1708 |
| 778 | Ga0496103_0124122 | 3300048906 | Bacteria | 1646 |
| 779 | Ga0496104_0029045 | 3300048907 | Bacteria | 5127 |
| 780 | Ga0496104_0031547 | 3300048907 | Bacteria | 4928 |
| 781 | Ga0496104_0050693 | 3300048907 | Bacteria | 3917 |
| 782 | Ga0496104_0056535 | 3300048907 | Bacteria | 3710 |
| 783 | Ga0496104_0089100 | 3300048907 | Bacteria | 2948 |
| 784 | Ga0496104_0130684 | 3300048907 | Bacteria | 2412 |
| 785 | Ga0496105_0002889 | 3300048908 | Bacteria | 12596 |
| 786 | Ga0496105_0004608 | 3300048908 | Bacteria | 10386 |
| 787 | Ga0496105_0017433 | 3300048908 | Bacteria | 5758 |
| 788 | Ga0496105_0112992 | 3300048908 | Bacteria | 2242 |
| 789 | Ga0496105_0140260 | 3300048908 | Bacteria | 1990 |
| 790 | Ga0496106_0004959 | 3300048909 | Bacteria | 9848 |
| 791 | Ga0496106_0018910 | 3300048909 | Bacteria | 5104 |
| 792 | Ga0496106_0031501 | 3300048909 | Bacteria | 3952 |
| 793 | Ga0496106_0031586 | 3300048909 | Bacteria | 3947 |
| 794 | Ga0496106_0052756 | 3300048909 | Bacteria | 3069 |
| 795 | Ga0496106_0080443 | 3300048909 | Bacteria | 2502 |
| 796 | Ga0496106_0290130 | 3300048909 | Bacteria | 1312 |
| 797 | Ga0496106_0405201 | 3300048909 | Bacteria | 1096 |
| 798 | Ga0496107_0005627 | 3300048910 | Bacteria | 8582 |
| 799 | Ga0496107_0013265 | 3300048910 | Bacteria | 5759 |
| 800 | Ga0496107_0045415 | 3300048910 | Bacteria | 3160 |
| 801 | Ga0496107_0060104 | 3300048910 | Bacteria | 2750 |
| 802 | Ga0496107_0108798 | 3300048910 | Bacteria | 2036 |
| 803 | Ga0496107_0151731 | 3300048910 | Bacteria | 1714 |
| 804 | Ga0496108_0000416 | 3300048911 | Bacteria | 34834 |
| 805 | Ga0496108_0019350 | 3300048911 | Bacteria | 5590 |
| 806 | Ga0496108_0075064 | 3300048911 | Bacteria | 2856 |
| 807 | Ga0496108_0111299 | 3300048911 | Bacteria | 2342 |
| 808 | Ga0496108_0499279 | 3300048911 | Bacteria | 1063 |
| 809 | Ga0496109_0001317 | 3300048912 | Bacteria | 20486 |
| 810 | Ga0496109_0017174 | 3300048912 | Bacteria | 6337 |
| 811 | Ga0496109_0035382 | 3300048912 | Bacteria | 4505 |
| 812 | Ga0496109_0132057 | 3300048912 | Bacteria | 2331 |
| 813 | Ga0496109_0137218 | 3300048912 | Bacteria | 2286 |
| 814 | Ga0496109_0155217 | 3300048912 | Bacteria | 2144 |
| 815 | Ga0496109_0172732 | 3300048912 | Bacteria | 2028 |
| 816 | Ga0496110_0007056 | 3300048913 | Bacteria | 8939 |
| 817 | Ga0496110_0012175 | 3300048913 | Bacteria | 7067 |
| 818 | Ga0496110_0020979 | 3300048913 | Bacteria | 5520 |
| 819 | Ga0496110_0022999 | 3300048913 | Bacteria | 5299 |
| 820 | Ga0496110_0164757 | 3300048913 | Bacteria | 2010 |
| 821 | Ga0496110_0172436 | 3300048913 | Bacteria | 1963 |
| 822 | Ga0496111_0017353 | 3300048914 | Bacteria | 4976 |
| 823 | Ga0496111_0019016 | 3300048914 | Bacteria | 4764 |
| 824 | Ga0496111_0045673 | 3300048914 | Bacteria | 3152 |
| 825 | Ga0496111_0084163 | 3300048914 | Bacteria | 2325 |
| 826 | Ga0496112_0013146 | 3300048915 | Bacteria | 7639 |
| 827 | Ga0496112_0014551 | 3300048915 | Bacteria | 7308 |
| 828 | Ga0496112_0018639 | 3300048915 | Bacteria | 6539 |
| 829 | Ga0496112_0076497 | 3300048915 | Bacteria | 3310 |
| 830 | Ga0496112_0104378 | 3300048915 | Bacteria | 2804 |
| 831 | Ga0496112_0471992 | 3300048915 | Bacteria | 1192 |
| 832 | Ga0496113_0005136 | 3300048916 | Bacteria | 8137 |
| 833 | Ga0496113_0021679 | 3300048916 | Bacteria | 4534 |
| 834 | Ga0496113_0283287 | 3300048916 | Bacteria | 1325 |
| 835 | Ga0496114_0007979 | 3300048917 | Bacteria | 8374 |
| 836 | Ga0496114_0017775 | 3300048917 | Bacteria | 5746 |
| 837 | Ga0496114_0019575 | 3300048917 | Bacteria | 5485 |
| 838 | Ga0496114_0024765 | 3300048917 | Bacteria | 4899 |
| 839 | Ga0496114_0251893 | 3300048917 | Bacteria | 1554 |
| 840 | Ga0496115_0008933 | 3300048918 | Bacteria | 7432 |
| 841 | Ga0496115_0038813 | 3300048918 | Bacteria | 3781 |
| 842 | Ga0496115_0044821 | 3300048918 | Bacteria | 3530 |
| 843 | Ga0496115_0049839 | 3300048918 | Bacteria | 3353 |
| 844 | Ga0496115_0053180 | 3300048918 | Bacteria | 3249 |
| 845 | Ga0496115_0076858 | 3300048918 | Bacteria | 2714 |
| 846 | Ga0496115_0088604 | 3300048918 | Bacteria | 2527 |
| 847 | Ga0496118_0021504 | 3300048921 | Bacteria | 5673 |
| 848 | Ga0496118_0098658 | 3300048921 | Bacteria | 1983 |
| 849 | Ga0496118_0138653 | 3300048921 | Bacteria | 1547 |
| 850 | Ga0496124_0085289 | 3300048927 | Bacteria | 2588 |
| 851 | Ga0496124_0092342 | 3300048927 | Bacteria | 2466 |
| 852 | Ga0496125_0000176 | 3300048928 | Bacteria | 140746 |
| 853 | Ga0496125_0000585 | 3300048928 | Bacteria | 62191 |
| 854 | Ga0496126_0016337 | 3300048929 | Bacteria | 7425 |
| 855 | Ga0496126_0059157 | 3300048929 | Bacteria | 3452 |
| 856 | Ga0501031_0002788 | 3300049568 | Bacteria | 11143 |
| 857 | Ga0501031_0006248 | 3300049568 | Bacteria | 7767 |
| 858 | Ga0501031_0019096 | 3300049568 | Bacteria | 4462 |
| 859 | Ga0501032_0000301 | 3300049569 | Bacteria | 41571 |
| 860 | Ga0501032_0012685 | 3300049569 | Bacteria | 6009 |
| 861 | Ga0501032_0014993 | 3300049569 | Bacteria | 5480 |
| 862 | Ga0501033_0000270 | 3300049570 | Bacteria | 50079 |
| 863 | Ga0501033_0006959 | 3300049570 | Bacteria | 8831 |
| 864 | Ga0501033_0017776 | 3300049570 | Bacteria | 5369 |
| 865 | Ga0501033_0078659 | 3300049570 | Bacteria | 2420 |
| 866 | Ga0501033_0090649 | 3300049570 | Bacteria | 2236 |
| 867 | Ga0501034_0000230 | 3300049571 | Bacteria | 105001 |
| 868 | Ga0501034_0000715 | 3300049571 | Bacteria | 50444 |
| 869 | Ga0501034_0003510 | 3300049571 | Bacteria | 17804 |
| 870 | Ga0501034_0023530 | 3300049571 | Bacteria | 6276 |
| 871 | Ga0501034_0064700 | 3300049571 | Bacteria | 3670 |
| 872 | Ga0501034_0065445 | 3300049571 | Bacteria | 3647 |
| 873 | Ga0501034_0102758 | 3300049571 | Bacteria | 2851 |
| 874 | Ga0501036_0000043 | 3300049572 | Bacteria | 79310 |
| 875 | Ga0501036_0007431 | 3300049572 | Bacteria | 8925 |
| 876 | Ga0501036_0026623 | 3300049572 | Bacteria | 4884 |
| 877 | Ga0501036_0073086 | 3300049572 | Bacteria | 2899 |
| 878 | Ga0501036_0097328 | 3300049572 | Bacteria | 2487 |
| 879 | Ga0501037_0000040 | 3300049573 | Bacteria | 119364 |
| 880 | Ga0501037_0002011 | 3300049573 | Bacteria | 14727 |
| 881 | Ga0501037_0068986 | 3300049573 | Bacteria | 2574 |
| 882 | Ga0501037_0076858 | 3300049573 | Bacteria | 2423 |
| 883 | Ga0501038_0000131 | 3300049574 | Bacteria | 63880 |
| 884 | Ga0501038_0010843 | 3300049574 | Bacteria | 8327 |
| 885 | Ga0501038_0061604 | 3300049574 | Bacteria | 3208 |
| 886 | Ga0501038_0108873 | 3300049574 | Bacteria | 2297 |
| 887 | Ga0501038_0134415 | 3300049574 | Bacteria | 2027 |
| 888 | Ga0501039_0000106 | 3300049575 | Bacteria | 56453 |
| 889 | Ga0501039_0001760 | 3300049575 | Bacteria | 15981 |
| 890 | Ga0501039_0019509 | 3300049575 | Bacteria | 5198 |
| 891 | Ga0501039_0022322 | 3300049575 | Bacteria | 4859 |
| 892 | Ga0501039_0102199 | 3300049575 | Bacteria | 2237 |
| 893 | Ga0501039_0119247 | 3300049575 | Bacteria | 2067 |
| 894 | Ga0501040_0235356 | 3300049576 | Bacteria | 1304 |
| 895 | Ga0501041_0014361 | 3300049577 | Bacteria | 4702 |
| 896 | Ga0501042_0032863 | 3300049578 | Bacteria | 3675 |
| 897 | Ga0501042_0047096 | 3300049578 | Bacteria | 3074 |
| 898 | Ga0501042_0062436 | 3300049578 | Bacteria | 2662 |
| 899 | Ga0501043_0000074 | 3300049579 | Bacteria | 87396 |
| 900 | Ga0501043_0005622 | 3300049579 | Bacteria | 10096 |
| 901 | Ga0501043_0009090 | 3300049579 | Bacteria | 7815 |
| 902 | Ga0501043_0035464 | 3300049579 | Bacteria | 3923 |
| 903 | Ga0501043_0113144 | 3300049579 | Bacteria | 2131 |
| 904 | Ga0501046_0000074 | 3300049580 | Bacteria | 104319 |
| 905 | Ga0501046_0011149 | 3300049580 | Bacteria | 7699 |
| 906 | Ga0501046_0044309 | 3300049580 | Bacteria | 3539 |
| 907 | Ga0501047_0000346 | 3300049581 | Bacteria | 52545 |
| 908 | Ga0501047_0006345 | 3300049581 | Bacteria | 11118 |
| 909 | Ga0501047_0025749 | 3300049581 | Bacteria | 5657 |
| 910 | Ga0501047_0062756 | 3300049581 | Bacteria | 3584 |
| 911 | Ga0501047_0099979 | 3300049581 | Bacteria | 2779 |
| 912 | Ga0501047_0172039 | 3300049581 | Bacteria | 2034 |
| 913 | Ga0501048_0000738 | 3300049582 | Bacteria | 23971 |
| 914 | Ga0501048_0004377 | 3300049582 | Bacteria | 10754 |
| 915 | Ga0501048_0020601 | 3300049582 | Bacteria | 4832 |
| 916 | Ga0501048_0098648 | 3300049582 | Bacteria | 2061 |
| 917 | Ga0501067_0000645 | 3300049583 | Bacteria | 18741 |
| 918 | Ga0501067_0002747 | 3300049583 | Bacteria | 9681 |
| 919 | Ga0501067_0003296 | 3300049583 | Bacteria | 8882 |
| 920 | Ga0501067_0141313 | 3300049583 | Bacteria | 1341 |
| 921 | Ga0501068_0000636 | 3300049584 | Bacteria | 17896 |
| 922 | Ga0501068_0005068 | 3300049584 | Bacteria | 7180 |
| 923 | Ga0501068_0006803 | 3300049584 | Bacteria | 6323 |
| 924 | Ga0501068_0042570 | 3300049584 | Bacteria | 2731 |
| 925 | Ga0501069_0006380 | 3300049585 | Bacteria | 6166 |
| 926 | Ga0501069_0006727 | 3300049585 | Bacteria | 6020 |
| 927 | Ga0501069_0030996 | 3300049585 | Bacteria | 2939 |
| 928 | Ga0501070_0007488 | 3300049586 | Bacteria | 9274 |
| 929 | Ga0501070_0009852 | 3300049586 | Bacteria | 8079 |
| 930 | Ga0501070_0053237 | 3300049586 | Bacteria | 3358 |
| 931 | Ga0501070_0069475 | 3300049586 | Bacteria | 2916 |
| 932 | Ga0501070_0076633 | 3300049586 | Bacteria | 2768 |
| 933 | Ga0501070_0172033 | 3300049586 | Bacteria | 1784 |
| 934 | Ga0501070_0202178 | 3300049586 | Bacteria | 1631 |
| 935 | Ga0501071_0008700 | 3300049587 | Bacteria | 6718 |
| 936 | Ga0501071_0074874 | 3300049587 | Bacteria | 2471 |
| 937 | Ga0501071_0096636 | 3300049587 | Bacteria | 2174 |
| 938 | Ga0501072_0008450 | 3300049588 | Bacteria | 7812 |
| 939 | Ga0501072_0110265 | 3300049588 | Bacteria | 2190 |
| 940 | Ga0501072_0182810 | 3300049588 | Bacteria | 1672 |
| 941 | Ga0501073_0000085 | 3300049589 | Bacteria | 59315 |
| 942 | Ga0501073_0011487 | 3300049589 | Bacteria | 6477 |
| 943 | Ga0501073_0024498 | 3300049589 | Bacteria | 4333 |
| 944 | Ga0501073_0038050 | 3300049589 | Bacteria | 3414 |
| 945 | Ga0501073_0083635 | 3300049589 | Bacteria | 2220 |
| 946 | Ga0501073_0136524 | 3300049589 | Bacteria | 1700 |
| 947 | Ga0501073_0151583 | 3300049589 | Bacteria | 1607 |
| 948 | Ga0501074_0000657 | 3300049590 | Bacteria | 21574 |
| 949 | Ga0501074_0010242 | 3300049590 | Bacteria | 6803 |
| 950 | Ga0501074_0023427 | 3300049590 | Bacteria | 4487 |
| 951 | Ga0501074_0024159 | 3300049590 | Bacteria | 4417 |
| 952 | Ga0501074_0060870 | 3300049590 | Bacteria | 2720 |
| 953 | Ga0501075_0057855 | 3300049591 | Bacteria | 2919 |
| 954 | Ga0501075_0112155 | 3300049591 | Bacteria | 2073 |
| 955 | Ga0501076_0038635 | 3300049592 | Bacteria | 3748 |
| 956 | Ga0501076_0041092 | 3300049592 | Bacteria | 3636 |
| 957 | Ga0501076_0048295 | 3300049592 | Bacteria | 3364 |
| 958 | Ga0501076_0086099 | 3300049592 | Bacteria | 2525 |
| 959 | Ga0501077_0029791 | 3300049593 | Bacteria | 3471 |
| 960 | Ga0501077_0046251 | 3300049593 | Bacteria | 2765 |
| 961 | Ga0501077_0076191 | 3300049593 | Bacteria | 2124 |
| 962 | Ga0501077_0087101 | 3300049593 | Bacteria | 1979 |
| 963 | Ga0501079_0000650 | 3300049741 | Bacteria | 23183 |
| 964 | Ga0501079_0014485 | 3300049741 | Bacteria | 6013 |
| 965 | Ga0501079_0035891 | 3300049741 | Bacteria | 3817 |
| 966 | Ga0501079_0072432 | 3300049741 | Bacteria | 2663 |
| 967 | Ga0501080_0001325 | 3300049742 | Bacteria | 20637 |
| 968 | Ga0501080_0017834 | 3300049742 | Bacteria | 6571 |
| 969 | Ga0501080_0088336 | 3300049742 | Bacteria | 2880 |
| 970 | Ga0501081_0020098 | 3300049743 | Bacteria | 4451 |
| 971 | Ga0501081_0029430 | 3300049743 | Bacteria | 3711 |
| 972 | Ga0501083_0001866 | 3300049744 | Bacteria | 14464 |
| 973 | Ga0501083_0014471 | 3300049744 | Bacteria | 5516 |
| 974 | Ga0501083_0049381 | 3300049744 | Bacteria | 2836 |
| 975 | Ga0501083_0274232 | 3300049744 | Bacteria | 1097 |
| 976 | Ga0501035_0004398 | 3300049822 | Bacteria | 13375 |
| 977 | Ga0501035_0028448 | 3300049822 | Bacteria | 5100 |
| 978 | Ga0501035_0035155 | 3300049822 | Bacteria | 4548 |
| 979 | Ga0501035_0074868 | 3300049822 | Bacteria | 2994 |
| 980 | Ga0501044_0000243 | 3300049823 | Bacteria | 68966 |
| 981 | Ga0501044_0000667 | 3300049823 | Bacteria | 41447 |
| 982 | Ga0501044_0008909 | 3300049823 | Bacteria | 10967 |
| 983 | Ga0501044_0011942 | 3300049823 | Bacteria | 9413 |
| 984 | Ga0501044_0138743 | 3300049823 | Bacteria | 2420 |
| 985 | Ga0501044_0269308 | 3300049823 | Bacteria | 1639 |
| 986 | Ga0501045_0002689 | 3300049824 | Bacteria | 12127 |
| 987 | Ga0501045_0005537 | 3300049824 | Bacteria | 8735 |
| 988 | Ga0501045_0009850 | 3300049824 | Bacteria | 6687 |
| 989 | Ga0501045_0195841 | 3300049824 | Bacteria | 1506 |
| 990 | nmdc:mga03n38_10098_c1 | 3300050490 | Bacteria | 3460 |
| 991 | nmdc:mga0yw44_73177_c1 | 3300050492 | Bacteria | 2131 |
| 992 | nmdc:mga0k408_13742_c1 | 3300050493 | Bacteria | 4447 |
| 993 | nmdc:mga0k408_17367_c1 | 3300050493 | Bacteria | 4009 |
| 994 | nmdc:mga06z11_18492_c1 | 3300050494 | Bacteria | 3183 |
| 995 | nmdc:mga06z11_228786_c1 | 3300050494 | Bacteria | 1089 |
| 996 | nmdc:mga06z11_51376_c1 | 3300050494 | Bacteria | 2111 |
| 997 | nmdc:mga07m45_132840_c1 | 3300050496 | Bacteria | 1440 |
| 998 | nmdc:mga07m45_152687_c1 | 3300050496 | Bacteria | 1339 |
| 999 | nmdc:mga05p37_143742_c1 | 3300050507 | Bacteria | 2922 |
| 1000 | nmdc:mga05p37_299586_c1 | 3300050507 | Bacteria | 1911 |
| 1001 | nmdc:mga05p37_743_c1 | 3300050507 | Bacteria | 36122 |
| 1002 | nmdc:mga05p37_7845_c1 | 3300050507 | Bacteria | 12600 |
| 1003 | nmdc:mga09592_781_c1 | 3300050508 | Bacteria | 24612 |
| 1004 | nmdc:mga0qj67_103_c1 | 3300050509 | Bacteria | 56674 |
| 1005 | nmdc:mga0qj67_110596_c1 | 3300050509 | Bacteria | 2218 |
| 1006 | nmdc:mga06r32_15926_c1 | 3300050510 | Bacteria | 6842 |
| 1007 | nmdc:mga06r32_41405_c1 | 3300050510 | Bacteria | 4377 |
| 1008 | nmdc:mga06r32_533507_c1 | 3300050510 | Bacteria | 1149 |
| 1009 | nmdc:mga08y16_121_c1 | 3300050511 | Bacteria | 67325 |
| 1010 | nmdc:mga08y16_125487_c1 | 3300050511 | Bacteria | 2670 |
| 1011 | nmdc:mga08y16_174255_c1 | 3300050511 | Bacteria | 2234 |
| 1012 | nmdc:mga08y16_25017_c1 | 3300050511 | Bacteria | 6298 |
| 1013 | nmdc:mga08y16_77399_c1 | 3300050511 | Bacteria | 3468 |
| 1014 | nmdc:mga0n895_180704_c1 | 3300050512 | Bacteria | 2141 |
| 1015 | nmdc:mga0n895_182347_c1 | 3300050512 | Bacteria | 2131 |
| 1016 | nmdc:mga0n895_198596_c1 | 3300050512 | Bacteria | 2037 |
| 1017 | nmdc:mga0n895_26889_c1 | 3300050512 | Bacteria | 5458 |
| 1018 | nmdc:mga0rr50_84733_c1 | 3300050513 | Bacteria | 2454 |
| 1019 | nmdc:mga08x19_122291_c1 | 3300050514 | Bacteria | 1746 |
| 1020 | nmdc:mga08x19_2300_c1 | 3300050514 | Bacteria | 11611 |
| 1021 | nmdc:mga08x19_90761_c1 | 3300050514 | Bacteria | 2016 |
| 1022 | nmdc:mga0a205_275722_c1 | 3300050515 | Bacteria | 1558 |
| 1023 | nmdc:mga0a205_64995_c1 | 3300050515 | Bacteria | 3524 |
| 1024 | nmdc:mga0sz30_23276_c1 | 3300050516 | Bacteria | 2519 |
| 1025 | Ga0495601_0000009 | 3300053077 | Bacteria | 270622 |
| 1026 | Ga0495601_0000532 | 3300053077 | Bacteria | 20138 |
| 1027 | Ga0495601_0003892 | 3300053077 | Bacteria | 8595 |
| 1028 | Ga0495601_0005331 | 3300053077 | Bacteria | 7488 |
| 1029 | Ga0495601_0009405 | 3300053077 | Bacteria | 5780 |
| 1030 | Ga0495612_0000021 | 3300053078 | Bacteria | 130528 |
| 1031 | Ga0495612_0018645 | 3300053078 | Bacteria | 2778 |
| 1032 | Ga0495612_0036956 | 3300053078 | Bacteria | 1982 |
| 1033 | Ga0495655_0001097 | 3300053083 | Bacteria | 4190 |
| 1034 | Ga0495595_0000067 | 3300053084 | Bacteria | 51316 |
| 1035 | Ga0495595_0000211 | 3300053084 | Bacteria | 23480 |
| 1036 | Ga0495595_0054127 | 3300053084 | Bacteria | 1865 |
| 1037 | Ga0495595_0059937 | 3300053084 | Bacteria | 1780 |
| 1038 | Ga0495619_0000012 | 3300053085 | Bacteria | 268349 |
| 1039 | Ga0495619_0000134 | 3300053085 | Bacteria | 54869 |
| 1040 | Ga0495619_0002870 | 3300053085 | Bacteria | 11209 |
| 1041 | Ga0495619_0048714 | 3300053085 | Bacteria | 2792 |
| 1042 | Ga0495619_0135228 | 3300053085 | Bacteria | 1696 |
| 1043 | Ga0500566_0004598 | 3300053094 | Bacteria | 8217 |
| 1044 | Ga0500641_0003319 | 3300053096 | Bacteria | 5696 |
| 1045 | Ga0500641_0003986 | 3300053096 | Bacteria | 5219 |
| 1046 | Ga0500641_0016480 | 3300053096 | Bacteria | 2752 |
| 1047 | Ga0500554_007410 | 3300053102 | Bacteria | 2523 |
| 1048 | Ga0500572_000177 | 3300053111 | Bacteria | 22361 |
| 1049 | Ga0500608_111432 | 3300053122 | Bacteria | 1254 |
| 1050 | Ga0500652_000019 | 3300053131 | Bacteria | 120149 |
| 1051 | Ga0500652_074652 | 3300053131 | Bacteria | 1408 |
| 1052 | Ga0500559_0000980 | 3300053136 | Bacteria | 17808 |
| 1053 | Ga0500604_0001259 | 3300053151 | Bacteria | 7076 |
| 1054 | Ga0500616_0000046 | 3300053153 | Bacteria | 333409 |
| 1055 | Ga0500616_0100980 | 3300053153 | Bacteria | 1410 |
| 1056 | Ga0500639_003548 | 3300053163 | Bacteria | 7872 |
| 1057 | Ga0500636_0007177 | 3300053177 | Bacteria | 6440 |
| 1058 | Ga0500637_0013087 | 3300053178 | Bacteria | 4338 |
| 1059 | Ga0500576_080247 | 3300053725 | Bacteria | 1380 |
| 1060 | Ga0500645_038812 | 3300053730 | Bacteria | 1412 |
| 1061 | Ga0501084_0014168 | 3300054114 | Bacteria | 6602 |
| 1062 | Ga0501084_0049539 | 3300054114 | Bacteria | 3516 |
| 1063 | Ga0501082_0003198 | 3300060353 | Bacteria | 14281 |
| 1064 | Ga0501082_0012246 | 3300060353 | Bacteria | 7371 |
| 1065 | Ga0501082_0031321 | 3300060353 | Bacteria | 4585 |
| 1066 | Ga0501082_0034986 | 3300060353 | Bacteria | 4329 |
| 1067 | Ga0501082_0070022 | 3300060353 | Bacteria | 3021 |
| 1068 | Ga0501082_0195042 | 3300060353 | Bacteria | 1762 |
| 1069 | Ga0466962_0044264 | 3300061719 | Bacteria | 2129 |
| 1070 | Ga0466962_0082069 | 3300061719 | Bacteria | 1542 |
| 1071 | Ga0530510_0017122 | 3300061734 | Bacteria | 5133 |
| 1072 | Ga0530510_0194452 | 3300061734 | Bacteria | 1506 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035170 | Ga0373943_0196710 | Ga0373943_0196710_11_784 | 216 |
| 2 | 3300035725 | Ga0373947_0143534 | Ga0373947_0143534_269_1294 | 219 |
| 3 | 3300046473 | Ga0495582_0133492 | Ga0495582_0133492_143_1168 | 219 |
| 4 | 3300012503 | Ga0157313_1004702 | Ga0157313_10047021 | 222 |
| 5 | 3300046477 | Ga0495664_0199257 | Ga0495664_0199257_341_1198 | 225 |
| 6 | 3300005327 | Ga0070658_10002492 | Ga0070658_1000249210 | 231 |
| 7 | 3300005336 | Ga0070680_100014072 | Ga0070680_1000140722 | 231 |
| 8 | 3300005339 | Ga0070660_100003958 | Ga0070660_1000039583 | 231 |
| 9 | 3300005530 | Ga0070679_100036159 | Ga0070679_1000361595 | 231 |
| 10 | 3300005563 | Ga0068855_100056948 | Ga0068855_1000569482 | 231 |
| 11 | 3300005577 | Ga0068857_100236645 | Ga0068857_1002366452 | 231 |
| 12 | 3300025909 | Ga0207705_10031045 | Ga0207705_100310454 | 231 |
| 13 | 3300025917 | Ga0207660_10064354 | Ga0207660_100643544 | 231 |
| 14 | 3300025919 | Ga0207657_10005450 | Ga0207657_100054509 | 231 |
| 15 | 3300025921 | Ga0207652_10014040 | Ga0207652_100140402 | 231 |
| 16 | 3300025949 | Ga0207667_10185330 | Ga0207667_101853302 | 231 |
| 17 | 3300026116 | Ga0207674_10320521 | Ga0207674_103205212 | 231 |
| 18 | 3300031711 | Ga0265314_10063537 | Ga0265314_100635374 | 231 |
| 19 | 3300031712 | Ga0265342_10000321 | Ga0265342_1000032150 | 231 |
| 20 | 3300049581 | Ga0501047_0006345 | Ga0501047_0006345_877_1902 | 231 |
| 21 | 3300005937 | Ga0081455_10000031 | Ga0081455_1000003182 | 232 |
| 22 | 3300005367 | Ga0070667_100016467 | Ga0070667_1000164672 | 233 |
| 23 | 3300005457 | Ga0070662_100044231 | Ga0070662_1000442315 | 233 |
| 24 | 3300005841 | Ga0068863_100258227 | Ga0068863_1002582272 | 233 |
| 25 | 3300005844 | Ga0068862_100197885 | Ga0068862_1001978851 | 233 |
| 26 | 3300009098 | Ga0105245_10131908 | Ga0105245_101319084 | 233 |
| 27 | 3300009553 | Ga0105249_10139501 | Ga0105249_101395012 | 233 |
| 28 | 3300013307 | Ga0157372_10455652 | Ga0157372_104556522 | 233 |
| 29 | 3300025961 | Ga0207712_10122304 | Ga0207712_101223044 | 233 |
| 30 | 3300028380 | Ga0268265_10159114 | Ga0268265_101591144 | 233 |
| 31 | 3300035113 | Ga0373936_0050748 | Ga0373936_0050748_663_1658 | 233 |
| 32 | 3300048906 | Ga0496103_0115322 | Ga0496103_0115322_85_1110 | 233 |
| 33 | 3300048912 | Ga0496109_0132057 | Ga0496109_0132057_553_1578 | 233 |
| 34 | 3300025903 | Ga0207680_10046663 | Ga0207680_100466632 | 234 |
| 35 | 3300006048 | Ga0075363_100001280 | Ga0075363_1000012806 | 235 |
| 36 | 3300053151 | Ga0500604_0001259 | Ga0500604_0001259_2466_3491 | 235 |
| 37 | 3300005347 | Ga0070668_100025445 | Ga0070668_1000254455 | 236 |
| 38 | 3300025972 | Ga0207668_10010926 | Ga0207668_100109266 | 236 |
| 39 | 3300005331 | Ga0070670_100001094 | Ga0070670_10000109416 | 237 |
| 40 | 3300009177 | Ga0105248_10004961 | Ga0105248_100049619 | 237 |
| 41 | 3300025925 | Ga0207650_10207475 | Ga0207650_102074751 | 237 |
| 42 | 3300021384 | Ga0213876_10040404 | Ga0213876_100404043 | 238 |
| 43 | 3300032004 | Ga0307414_10149706 | Ga0307414_101497062 | 238 |
| 44 | 3300037853 | Ga0436364_1353015 | Ga0436364_1353015_10_1029 | 238 |
| 45 | 3300039437 | Ga0436365_0418627 | Ga0436365_0418627_34_1053 | 238 |
| 46 | 3300039437 | Ga0436365_1147119 | Ga0436365_1147119_359_1378 | 238 |
| 47 | 3300039438 | Ga0436360_0079901 | Ga0436360_0079901_719_1738 | 238 |
| 48 | 3300039450 | Ga0436363_0670432 | Ga0436363_0670432_299_1318 | 238 |
| 49 | 3300048905 | Ga0496102_0209420 | Ga0496102_0209420_429_1448 | 238 |
| 50 | 3300048906 | Ga0496103_0124122 | Ga0496103_0124122_371_1390 | 238 |
| 51 | 3300048908 | Ga0496105_0112992 | Ga0496105_0112992_1171_2190 | 238 |
| 52 | 3300048910 | Ga0496107_0108798 | Ga0496107_0108798_771_1790 | 238 |
| 53 | 3300048912 | Ga0496109_0035382 | Ga0496109_0035382_446_1465 | 238 |
| 54 | 3300049571 | Ga0501034_0003510 | Ga0501034_0003510_2182_3207 | 239 |
| 55 | 3300005436 | Ga0070713_100234538 | Ga0070713_1002345382 | 240 |
| 56 | 3300025928 | Ga0207700_10249176 | Ga0207700_102491761 | 240 |
| 57 | 3300047319 | Ga0495674_0086589 | Ga0495674_0086589_1308_2657 | 240 |
| 58 | 3300048911 | Ga0496108_0019350 | Ga0496108_0019350_3511_4539 | 240 |
| 59 | 3300048912 | Ga0496109_0017174 | Ga0496109_0017174_2538_3566 | 240 |
| 60 | 3300048915 | Ga0496112_0014551 | Ga0496112_0014551_4156_5184 | 240 |
| 61 | 3300053077 | Ga0495601_0005331 | Ga0495601_0005331_3531_4550 | 240 |
| 62 | 3300046533 | Ga0495640_0214174 | Ga0495640_0214174_22_846 | 242 |
| 63 | 3300047319 | Ga0495674_0488623 | Ga0495674_0488623_18_842 | 242 |
| 64 | 3300007265 | Ga0099794_10007029 | Ga0099794_100070293 | 243 |
| 65 | 3300031249 | Ga0265339_10000016 | Ga0265339_1000001660 | 243 |
| 66 | 3300031595 | Ga0265313_10000060 | Ga0265313_1000006079 | 243 |
| 67 | 3300031712 | Ga0265342_10062440 | Ga0265342_100624401 | 243 |
| 68 | 3300032005 | Ga0307411_10056659 | Ga0307411_100566592 | 243 |
| 69 | 3300005435 | Ga0070714_100446665 | Ga0070714_1004466651 | 244 |
| 70 | 3300039447 | Ga0436361_1103503 | Ga0436361_1103503_74_1093 | 244 |
| 71 | 3300005444 | Ga0070694_100127321 | Ga0070694_1001273212 | 245 |
| 72 | 3300005546 | Ga0070696_100023586 | Ga0070696_1000235863 | 245 |
| 73 | 3300024227 | Ga0228598_1000098 | Ga0228598_100009810 | 245 |
| 74 | 3300025915 | Ga0207693_10047797 | Ga0207693_100477973 | 245 |
| 75 | 3300046476 | Ga0495662_0010328 | Ga0495662_0010328_466_1497 | 245 |
| 76 | 3300046526 | Ga0495666_0050554 | Ga0495666_0050554_190_1221 | 245 |
| 77 | 3300046531 | Ga0495665_0040561 | Ga0495665_0040561_400_1431 | 245 |
| 78 | 3300046642 | Ga0495634_0133131 | Ga0495634_0133131_320_1351 | 245 |
| 79 | 3300005335 | Ga0070666_10058040 | Ga0070666_100580403 | 246 |
| 80 | 3300005337 | Ga0070682_100010302 | Ga0070682_1000103022 | 246 |
| 81 | 3300005339 | Ga0070660_100051545 | Ga0070660_1000515453 | 246 |
| 82 | 3300005355 | Ga0070671_100072200 | Ga0070671_1000722003 | 246 |
| 83 | 3300005364 | Ga0070673_100037774 | Ga0070673_1000377742 | 246 |
| 84 | 3300005367 | Ga0070667_100023204 | Ga0070667_1000232045 | 246 |
| 85 | 3300005437 | Ga0070710_10053330 | Ga0070710_100533302 | 246 |
| 86 | 3300005439 | Ga0070711_100053341 | Ga0070711_1000533412 | 246 |
| 87 | 3300005441 | Ga0070700_100200866 | Ga0070700_1002008661 | 246 |
| 88 | 3300005456 | Ga0070678_100046092 | Ga0070678_1000460923 | 246 |
| 89 | 3300005457 | Ga0070662_100092216 | Ga0070662_1000922162 | 246 |
| 90 | 3300005458 | Ga0070681_10061808 | Ga0070681_100618083 | 246 |
| 91 | 3300005544 | Ga0070686_100127351 | Ga0070686_1001273512 | 246 |
| 92 | 3300005545 | Ga0070695_100012251 | Ga0070695_1000122515 | 246 |
| 93 | 3300005547 | Ga0070693_100003813 | Ga0070693_1000038135 | 246 |
| 94 | 3300005564 | Ga0070664_100169224 | Ga0070664_1001692242 | 246 |
| 95 | 3300005578 | Ga0068854_100246938 | Ga0068854_1002469382 | 246 |
| 96 | 3300005614 | Ga0068856_100038892 | Ga0068856_1000388922 | 246 |
| 97 | 3300005843 | Ga0068860_100312705 | Ga0068860_1003127052 | 246 |
| 98 | 3300006237 | Ga0097621_100029902 | Ga0097621_1000299023 | 246 |
| 99 | 3300006358 | Ga0068871_100104909 | Ga0068871_1001049092 | 246 |
| 100 | 3300009177 | Ga0105248_10331904 | Ga0105248_103319042 | 246 |
| 101 | 3300009551 | Ga0105238_10156278 | Ga0105238_101562783 | 246 |
| 102 | 3300013308 | Ga0157375_10041029 | Ga0157375_100410293 | 246 |
| 103 | 3300014968 | Ga0157379_10071373 | Ga0157379_100713733 | 246 |
| 104 | 3300025898 | Ga0207692_10010467 | Ga0207692_100104673 | 246 |
| 105 | 3300025900 | Ga0207710_10025216 | Ga0207710_100252162 | 246 |
| 106 | 3300025928 | Ga0207700_10012952 | Ga0207700_100129521 | 246 |
| 107 | 3300025932 | Ga0207690_10038007 | Ga0207690_100380073 | 246 |
| 108 | 3300025933 | Ga0207706_10015658 | Ga0207706_100156587 | 246 |
| 109 | 3300025934 | Ga0207686_10011136 | Ga0207686_100111361 | 246 |
| 110 | 3300025937 | Ga0207669_10009575 | Ga0207669_100095754 | 246 |
| 111 | 3300025939 | Ga0207665_10040476 | Ga0207665_100404762 | 246 |
| 112 | 3300025941 | Ga0207711_10032664 | Ga0207711_100326643 | 246 |
| 113 | 3300025960 | Ga0207651_10151692 | Ga0207651_101516922 | 246 |
| 114 | 3300026067 | Ga0207678_10024049 | Ga0207678_100240493 | 246 |
| 115 | 3300026121 | Ga0207683_10142076 | Ga0207683_101420762 | 246 |
| 116 | 3300028381 | Ga0268264_10187032 | Ga0268264_101870323 | 246 |
| 117 | 3300035086 | Ga0373934_0015955 | Ga0373934_0015955_1053_2084 | 246 |
| 118 | 3300035111 | Ga0373923_0046030 | Ga0373923_0046030_505_1536 | 246 |
| 119 | 3300035117 | Ga0373953_0000726 | Ga0373953_0000726_772_1803 | 246 |
| 120 | 3300035118 | Ga0373954_0088688 | Ga0373954_0088688_290_1321 | 246 |
| 121 | 3300035692 | Ga0373935_0229814 | Ga0373935_0229814_228_1259 | 246 |
| 122 | 3300035724 | Ga0373933_0005801 | Ga0373933_0005801_137_1168 | 246 |
| 123 | 3300036401 | Ga0373937_0002442 | Ga0373937_0002442_7040_8071 | 246 |
| 124 | 3300046454 | Ga0495592_0020438 | Ga0495592_0020438_59_1090 | 246 |
| 125 | 3300046462 | Ga0495651_0009003 | Ga0495651_0009003_3359_4390 | 246 |
| 126 | 3300046463 | Ga0495653_0122136 | Ga0495653_0122136_361_1392 | 246 |
| 127 | 3300046511 | Ga0495608_0004302 | Ga0495608_0004302_2127_3158 | 246 |
| 128 | 3300046516 | Ga0495628_0023938 | Ga0495628_0023938_1958_2989 | 246 |
| 129 | 3300046529 | Ga0495652_0021038 | Ga0495652_0021038_3909_4940 | 246 |
| 130 | 3300046533 | Ga0495640_0007182 | Ga0495640_0007182_7239_8270 | 246 |
| 131 | 3300046536 | Ga0495587_0002711 | Ga0495587_0002711_2434_3465 | 246 |
| 132 | 3300046536 | Ga0495587_0038741 | Ga0495587_0038741_76_1095 | 246 |
| 133 | 3300046543 | Ga0495645_0006697 | Ga0495645_0006697_4798_5829 | 246 |
| 134 | 3300046642 | Ga0495634_0066453 | Ga0495634_0066453_1124_2155 | 246 |
| 135 | 3300046675 | Ga0495657_0011293 | Ga0495657_0011293_1803_2834 | 246 |
| 136 | 3300046678 | Ga0495599_0013111 | Ga0495599_0013111_3231_4262 | 246 |
| 137 | 3300046679 | Ga0495623_0001957 | Ga0495623_0001957_8763_9794 | 246 |
| 138 | 3300046680 | Ga0495646_0003029 | Ga0495646_0003029_6016_7047 | 246 |
| 139 | 3300046809 | Ga0495600_0006445 | Ga0495600_0006445_3495_4526 | 246 |
| 140 | 3300047317 | Ga0495604_0006606 | Ga0495604_0006606_2017_3048 | 246 |
| 141 | 3300047319 | Ga0495674_0026023 | Ga0495674_0026023_133_1164 | 246 |
| 142 | 3300047322 | Ga0495680_0015778 | Ga0495680_0015778_1990_3021 | 246 |
| 143 | 3300047444 | Ga0495675_0002614 | Ga0495675_0002614_7040_8071 | 246 |
| 144 | 3300047471 | Ga0495684_0026883 | Ga0495684_0026883_933_1964 | 246 |
| 145 | 3300048088 | Ga0495602_0004530 | Ga0495602_0004530_4595_5626 | 246 |
| 146 | 3300048903 | Ga0496100_0024849 | Ga0496100_0024849_1991_3022 | 246 |
| 147 | 3300048907 | Ga0496104_0031547 | Ga0496104_0031547_1519_2550 | 246 |
| 148 | 3300048908 | Ga0496105_0004608 | Ga0496105_0004608_3059_4090 | 246 |
| 149 | 3300048909 | Ga0496106_0080443 | Ga0496106_0080443_1216_2247 | 246 |
| 150 | 3300048910 | Ga0496107_0060104 | Ga0496107_0060104_201_1232 | 246 |
| 151 | 3300048911 | Ga0496108_0111299 | Ga0496108_0111299_122_1153 | 246 |
| 152 | 3300048913 | Ga0496110_0022999 | Ga0496110_0022999_1865_2896 | 246 |
| 153 | 3300048914 | Ga0496111_0084163 | Ga0496111_0084163_1010_2041 | 246 |
| 154 | 3300048917 | Ga0496114_0024765 | Ga0496114_0024765_810_1841 | 246 |
| 155 | 3300048918 | Ga0496115_0038813 | Ga0496115_0038813_2519_3550 | 246 |
| 156 | 3300053077 | Ga0495601_0009405 | Ga0495601_0009405_2127_3158 | 246 |
| 157 | 3300053078 | Ga0495612_0018645 | Ga0495612_0018645_1515_2546 | 246 |
| 158 | 3300053084 | Ga0495595_0000211 | Ga0495595_0000211_6720_7751 | 246 |
| 159 | 3300053085 | Ga0495619_0002870 | Ga0495619_0002870_4998_6017 | 246 |
| 160 | 3300006175 | Ga0070712_100013772 | Ga0070712_1000137723 | 247 |
| 161 | 3300026095 | Ga0207676_10048660 | Ga0207676_100486604 | 247 |
| 162 | 3300047471 | Ga0495684_0047820 | Ga0495684_0047820_1815_2849 | 248 |
| 163 | 3300048914 | Ga0496111_0019016 | Ga0496111_0019016_13_1038 | 248 |
| 164 | 3300048927 | Ga0496124_0092342 | Ga0496124_0092342_1401_2426 | 248 |
| 165 | 3300048928 | Ga0496125_0000585 | Ga0496125_0000585_33296_34321 | 248 |
| 166 | 3300049591 | Ga0501075_0057855 | Ga0501075_0057855_2034_2903 | 248 |
| 167 | 3300005329 | Ga0070683_100410740 | Ga0070683_1004107401 | 249 |
| 168 | 3300014325 | Ga0163163_10004045 | Ga0163163_100040459 | 249 |
| 169 | 3300032004 | Ga0307414_10259159 | Ga0307414_102591592 | 249 |
| 170 | 3300035111 | Ga0373923_0018141 | Ga0373923_0018141_138_1163 | 249 |
| 171 | 3300035119 | Ga0373956_0035536 | Ga0373956_0035536_352_1377 | 249 |
| 172 | 3300035410 | Ga0373924_0033708 | Ga0373924_0033708_303_1328 | 249 |
| 173 | 3300036401 | Ga0373937_0060812 | Ga0373937_0060812_168_1193 | 249 |
| 174 | 3300039450 | Ga0436363_0721044 | Ga0436363_0721044_195_1217 | 249 |
| 175 | 3300046459 | Ga0495629_0113224 | Ga0495629_0113224_237_1262 | 249 |
| 176 | 3300046463 | Ga0495653_0062850 | Ga0495653_0062850_1075_2100 | 249 |
| 177 | 3300046511 | Ga0495608_0040234 | Ga0495608_0040234_334_1359 | 249 |
| 178 | 3300046559 | Ga0495667_0223220 | Ga0495667_0223220_80_1105 | 249 |
| 179 | 3300046663 | Ga0495635_0193476 | Ga0495635_0193476_53_1078 | 249 |
| 180 | 3300046675 | Ga0495657_0104687 | Ga0495657_0104687_177_1202 | 249 |
| 181 | 3300046678 | Ga0495599_0159518 | Ga0495599_0159518_310_1335 | 249 |
| 182 | 3300046679 | Ga0495623_0021314 | Ga0495623_0021314_2665_3690 | 249 |
| 183 | 3300046680 | Ga0495646_0164906 | Ga0495646_0164906_151_1176 | 249 |
| 184 | 3300046809 | Ga0495600_0010737 | Ga0495600_0010737_1897_2922 | 249 |
| 185 | 3300047317 | Ga0495604_0060950 | Ga0495604_0060950_308_1333 | 249 |
| 186 | 3300047322 | Ga0495680_0016486 | Ga0495680_0016486_4056_5081 | 249 |
| 187 | 3300048904 | Ga0496101_0148744 | Ga0496101_0148744_112_1137 | 249 |
| 188 | 3300048907 | Ga0496104_0029045 | Ga0496104_0029045_294_1319 | 249 |
| 189 | 3300048908 | Ga0496105_0002889 | Ga0496105_0002889_7069_8094 | 249 |
| 190 | 3300048911 | Ga0496108_0000416 | Ga0496108_0000416_6457_7482 | 249 |
| 191 | 3300048912 | Ga0496109_0001317 | Ga0496109_0001317_17537_18562 | 249 |
| 192 | 3300048913 | Ga0496110_0012175 | Ga0496110_0012175_1567_2592 | 249 |
| 193 | 3300048915 | Ga0496112_0104378 | Ga0496112_0104378_1363_2388 | 249 |
| 194 | 3300048916 | Ga0496113_0021679 | Ga0496113_0021679_945_1970 | 249 |
| 195 | 3300048918 | Ga0496115_0008933 | Ga0496115_0008933_5950_6975 | 249 |
| 196 | 3300053078 | Ga0495612_0036956 | Ga0495612_0036956_412_1437 | 249 |
| 197 | 3300053084 | Ga0495595_0059937 | Ga0495595_0059937_479_1504 | 249 |
| 198 | 3300049581 | Ga0501047_0099979 | Ga0501047_0099979_298_1281 | 250 |
| 199 | 3300014325 | Ga0163163_10294330 | Ga0163163_102943302 | 251 |
| 200 | 3300053131 | Ga0500652_074652 | Ga0500652_074652_10_861 | 251 |
| 201 | 3300035725 | Ga0373947_0205445 | Ga0373947_0205445_164_1198 | 252 |
| 202 | 3300048913 | Ga0496110_0164757 | Ga0496110_0164757_961_1986 | 252 |
| 203 | 3300031595 | Ga0265313_10064893 | Ga0265313_100648931 | 253 |
| 204 | 3300046683 | Ga0495658_0033556 | Ga0495658_0033556_1671_2702 | 254 |
| 205 | 3300047444 | Ga0495675_0179201 | Ga0495675_0179201_77_1096 | 254 |
| 206 | 3300006038 | Ga0075365_10083293 | Ga0075365_100832932 | 256 |
| 207 | 3300049575 | Ga0501039_0102199 | Ga0501039_0102199_909_1940 | 256 |
| 208 | 3300005439 | Ga0070711_100151895 | Ga0070711_1001518952 | 257 |
| 209 | 3300025915 | Ga0207693_10057393 | Ga0207693_100573933 | 257 |
| 210 | 3300035398 | Ga0316574_0094787 | Ga0316574_0094787_10_879 | 257 |
| 211 | 3300036401 | Ga0373937_0342657 | Ga0373937_0342657_365_1393 | 257 |
| 212 | 3300048907 | Ga0496104_0130684 | Ga0496104_0130684_19_1047 | 257 |
| 213 | 3300048915 | Ga0496112_0013146 | Ga0496112_0013146_6447_7475 | 257 |
| 214 | 3300005456 | Ga0070678_100057176 | Ga0070678_1000571762 | 258 |
| 215 | 3300021384 | Ga0213876_10021619 | Ga0213876_100216193 | 258 |
| 216 | 3300025901 | Ga0207688_10135993 | Ga0207688_101359932 | 258 |
| 217 | 3300025972 | Ga0207668_10227758 | Ga0207668_102277582 | 258 |
| 218 | 3300026121 | Ga0207683_10133008 | Ga0207683_101330083 | 258 |
| 219 | 3300039437 | Ga0436365_1258671 | Ga0436365_1258671_1599_2627 | 258 |
| 220 | 3300049572 | Ga0501036_0007431 | Ga0501036_0007431_6927_7958 | 258 |
| 221 | 3300049573 | Ga0501037_0076858 | Ga0501037_0076858_934_1965 | 258 |
| 222 | 3300049574 | Ga0501038_0061604 | Ga0501038_0061604_766_1797 | 258 |
| 223 | 3300049581 | Ga0501047_0172039 | Ga0501047_0172039_173_1204 | 258 |
| 224 | 3300049586 | Ga0501070_0069475 | Ga0501070_0069475_879_1910 | 258 |
| 225 | 3300049823 | Ga0501044_0269308 | Ga0501044_0269308_303_1334 | 258 |
| 226 | 3300035724 | Ga0373933_0064749 | Ga0373933_0064749_316_1722 | 259 |
| 227 | 3300036401 | Ga0373937_0033289 | Ga0373937_0033289_3242_4648 | 259 |
| 228 | 3300037068 | Ga0373925_0037001 | Ga0373925_0037001_468_1874 | 259 |
| 229 | 3300039453 | Ga0436362_0150968 | Ga0436362_0150968_197_1222 | 259 |
| 230 | 3300046462 | Ga0495651_0109611 | Ga0495651_0109611_343_1749 | 259 |
| 231 | 3300009147 | Ga0114129_10167848 | Ga0114129_101678482 | 260 |
| 232 | 3300050507 | nmdc:mga05p37_143742_c1 | nmdc:mga05p37_143742_c1_487_1512 | 260 |
| 233 | 3300053730 | Ga0500645_038812 | Ga0500645_038812_357_1382 | 260 |
| 234 | 3300006038 | Ga0075365_10028242 | Ga0075365_100282422 | 261 |
| 235 | 3300006178 | Ga0075367_10011766 | Ga0075367_100117664 | 261 |
| 236 | 3300006186 | Ga0075369_10040039 | Ga0075369_100400392 | 261 |
| 237 | 3300046678 | Ga0495599_0029696 | Ga0495599_0029696_1156_2562 | 261 |
| 238 | 3300048903 | Ga0496100_0084627 | Ga0496100_0084627_580_1605 | 261 |
| 239 | 3300048917 | Ga0496114_0251893 | Ga0496114_0251893_297_1322 | 261 |
| 240 | 3300050490 | nmdc:mga03n38_10098_c1 | nmdc:mga03n38_10098_c1_145_1170 | 261 |
| 241 | 3300050494 | nmdc:mga06z11_51376_c1 | nmdc:mga06z11_51376_c1_424_1449 | 261 |
| 242 | 3300050496 | nmdc:mga07m45_152687_c1 | nmdc:mga07m45_152687_c1_96_1121 | 261 |
| 243 | 3300050516 | nmdc:mga0sz30_23276_c1 | nmdc:mga0sz30_23276_c1_828_1853 | 261 |
| 244 | 3300006844 | Ga0075428_100079977 | Ga0075428_1000799774 | 262 |
| 245 | 3300025901 | Ga0207688_10027304 | Ga0207688_100273042 | 262 |
| 246 | 3300035725 | Ga0373947_0100030 | Ga0373947_0100030_11_916 | 262 |
| 247 | 3300039447 | Ga0436361_0271405 | Ga0436361_0271405_1200_2225 | 262 |
| 248 | 3300049582 | Ga0501048_0098648 | Ga0501048_0098648_743_1765 | 262 |
| 249 | 3300009147 | Ga0114129_10197519 | Ga0114129_101975193 | 263 |
| 250 | 3300048911 | Ga0496108_0499279 | Ga0496108_0499279_15_1034 | 263 |
| 251 | 3300050507 | nmdc:mga05p37_299586_c1 | nmdc:mga05p37_299586_c1_1014_1901 | 263 |
| 252 | 3300010159 | Ga0099796_10002243 | Ga0099796_100022431 | 264 |
| 253 | 3300027512 | Ga0209179_1007997 | Ga0209179_10079972 | 264 |
| 254 | 3300021384 | Ga0213876_10099823 | Ga0213876_100998232 | 265 |
| 255 | 3300037853 | Ga0436364_0079156 | Ga0436364_0079156_483_1388 | 265 |
| 256 | 3300037853 | Ga0436364_0875330 | Ga0436364_0875330_579_1619 | 265 |
| 257 | 3300039437 | Ga0436365_1431698 | Ga0436365_1431698_746_1786 | 265 |
| 258 | 3300048908 | Ga0496105_0017433 | Ga0496105_0017433_3103_4146 | 265 |
| 259 | 3300048910 | Ga0496107_0151731 | Ga0496107_0151731_63_1106 | 265 |
| 260 | 3300048918 | Ga0496115_0076858 | Ga0496115_0076858_346_1389 | 265 |
| 261 | 3300005563 | Ga0068855_100382090 | Ga0068855_1003820902 | 266 |
| 262 | 3300006852 | Ga0075433_10272174 | Ga0075433_102721742 | 266 |
| 263 | 3300009094 | Ga0111539_10135829 | Ga0111539_101358294 | 266 |
| 264 | 3300009176 | Ga0105242_10272776 | Ga0105242_102727761 | 266 |
| 265 | 3300044694 | Ga0466963_0183059 | Ga0466963_0183059_409_1440 | 266 |
| 266 | 3300045976 | Ga0466967_0144639 | Ga0466967_0144639_48_1079 | 266 |
| 267 | 3300049571 | Ga0501034_0064700 | Ga0501034_0064700_1701_2732 | 266 |
| 268 | 3300049576 | Ga0501040_0235356 | Ga0501040_0235356_40_1005 | 266 |
| 269 | 3300049579 | Ga0501043_0113144 | Ga0501043_0113144_317_1348 | 266 |
| 270 | 3300049589 | Ga0501073_0151583 | Ga0501073_0151583_341_1372 | 266 |
| 271 | 3300050511 | nmdc:mga08y16_125487_c1 | nmdc:mga08y16_125487_c1_614_1636 | 266 |
| 272 | 3300050512 | nmdc:mga0n895_198596_c1 | nmdc:mga0n895_198596_c1_596_1618 | 266 |
| 273 | 3300050515 | nmdc:mga0a205_275722_c1 | nmdc:mga0a205_275722_c1_366_1388 | 266 |
| 274 | 3300060353 | Ga0501082_0195042 | Ga0501082_0195042_494_1525 | 266 |
| 275 | 3300010159 | Ga0099796_10018620 | Ga0099796_100186202 | 267 |
| 276 | 3300006175 | Ga0070712_100326985 | Ga0070712_1003269852 | 268 |
| 277 | 3300044693 | Ga0466961_0074335 | Ga0466961_0074335_19_1047 | 268 |
| 278 | 3300045049 | Ga0466959_0057250 | Ga0466959_0057250_821_1849 | 268 |
| 279 | 3300061719 | Ga0466962_0082069 | Ga0466962_0082069_468_1496 | 268 |
| 280 | 3300037418 | Ga0395900_0146615 | Ga0395900_0146615_1467_2396 | 269 |
| 281 | 3300031241 | Ga0265325_10003840 | Ga0265325_100038406 | 270 |
| 282 | 3300021388 | Ga0213875_10000009 | Ga0213875_10000009427 | 271 |
| 283 | 3300037853 | Ga0436364_0413488 | Ga0436364_0413488_76281_77306 | 271 |
| 284 | 3300044684 | Ga0466966_0072437 | Ga0466966_0072437_20_1006 | 271 |
| 285 | 3300005578 | Ga0068854_100331493 | Ga0068854_1003314931 | 272 |
| 286 | 3300006914 | Ga0075436_100013964 | Ga0075436_1000139643 | 272 |
| 287 | 3300026075 | Ga0207708_10017716 | Ga0207708_100177165 | 272 |
| 288 | 3300035691 | Ga0373931_0175453 | Ga0373931_0175453_45_1064 | 272 |
| 289 | 3300049571 | Ga0501034_0000230 | Ga0501034_0000230_55965_56996 | 272 |
| 290 | 3300049744 | Ga0501083_0274232 | Ga0501083_0274232_104_1069 | 272 |
| 291 | 3300050514 | nmdc:mga08x19_2300_c1 | nmdc:mga08x19_2300_c1_7311_8336 | 272 |
| 292 | 3300053131 | Ga0500652_000019 | Ga0500652_000019_14521_15546 | 272 |
| 293 | 3300053177 | Ga0500636_0007177 | Ga0500636_0007177_4593_5618 | 272 |
| 294 | 3300031235 | Ga0265330_10022247 | Ga0265330_100222474 | 273 |
| 295 | 3300005435 | Ga0070714_100245359 | Ga0070714_1002453591 | 274 |
| 296 | 3300005439 | Ga0070711_100059511 | Ga0070711_1000595112 | 274 |
| 297 | 3300025261 | Ga0209233_1003978 | Ga0209233_10039782 | 274 |
| 298 | 3300025906 | Ga0207699_10011571 | Ga0207699_100115712 | 274 |
| 299 | 3300025915 | Ga0207693_10012377 | Ga0207693_100123774 | 274 |
| 300 | 3300025929 | Ga0207664_10100910 | Ga0207664_101009102 | 274 |
| 301 | 3300031711 | Ga0265314_10005172 | Ga0265314_100051723 | 274 |
| 302 | 3300021384 | Ga0213876_10001966 | Ga0213876_100019669 | 275 |
| 303 | 3300025921 | Ga0207652_10094842 | Ga0207652_100948422 | 275 |
| 304 | 3300035724 | Ga0373933_0058496 | Ga0373933_0058496_201_1232 | 275 |
| 305 | 3300036401 | Ga0373937_0002520 | Ga0373937_0002520_4769_5800 | 275 |
| 306 | 3300039437 | Ga0436365_1466455 | Ga0436365_1466455_8880_9911 | 275 |
| 307 | 3300039450 | Ga0436363_0937763 | Ga0436363_0937763_11450_12481 | 275 |
| 308 | 3300046459 | Ga0495629_0147983 | Ga0495629_0147983_536_1534 | 275 |
| 309 | 3300046533 | Ga0495640_0062038 | Ga0495640_0062038_346_1377 | 275 |
| 310 | 3300046663 | Ga0495635_0009980 | Ga0495635_0009980_2363_3394 | 275 |
| 311 | 3300047317 | Ga0495604_0124284 | Ga0495604_0124284_303_1334 | 275 |
| 312 | 3300047322 | Ga0495680_0011098 | Ga0495680_0011098_3200_4231 | 275 |
| 313 | 3300053077 | Ga0495601_0000532 | Ga0495601_0000532_18454_19485 | 275 |
| 314 | 3300053084 | Ga0495595_0054127 | Ga0495595_0054127_313_1344 | 275 |
| 315 | 3300053085 | Ga0495619_0000134 | Ga0495619_0000134_4114_5145 | 275 |
| 316 | 3300003856 | Ga0058692_1004883 | Ga0058692_10048833 | 276 |
| 317 | 3300006051 | Ga0075364_10153432 | Ga0075364_101534322 | 276 |
| 318 | 3300006871 | Ga0075434_100244944 | Ga0075434_1002449442 | 276 |
| 319 | 3300009094 | Ga0111539_10015064 | Ga0111539_1001506412 | 276 |
| 320 | 3300027312 | Ga0209371_1000729 | Ga0209371_100072920 | 276 |
| 321 | 3300030500 | Ga0268256_1004292 | Ga0268256_10042923 | 276 |
| 322 | 3300031595 | Ga0265313_10123110 | Ga0265313_101231101 | 276 |
| 323 | 3300050511 | nmdc:mga08y16_25017_c1 | nmdc:mga08y16_25017_c1_467_1489 | 276 |
| 324 | 3300025907 | Ga0207645_10214618 | Ga0207645_102146181 | 277 |
| 325 | 3300039438 | Ga0436360_0554196 | Ga0436360_0554196_23_1051 | 277 |
| 326 | 3300049568 | Ga0501031_0019096 | Ga0501031_0019096_1548_2576 | 277 |
| 327 | 3300049572 | Ga0501036_0026623 | Ga0501036_0026623_1937_2965 | 277 |
| 328 | 3300049575 | Ga0501039_0022322 | Ga0501039_0022322_1912_2940 | 277 |
| 329 | 3300049577 | Ga0501041_0014361 | Ga0501041_0014361_3011_4039 | 277 |
| 330 | 3300049580 | Ga0501046_0044309 | Ga0501046_0044309_1030_2058 | 277 |
| 331 | 3300049584 | Ga0501068_0042570 | Ga0501068_0042570_914_1942 | 277 |
| 332 | 3300049585 | Ga0501069_0030996 | Ga0501069_0030996_1366_2394 | 277 |
| 333 | 3300049586 | Ga0501070_0172033 | Ga0501070_0172033_261_1289 | 277 |
| 334 | 3300049591 | Ga0501075_0112155 | Ga0501075_0112155_444_1472 | 277 |
| 335 | 3300049592 | Ga0501076_0048295 | Ga0501076_0048295_731_1759 | 277 |
| 336 | 3300049593 | Ga0501077_0046251 | Ga0501077_0046251_122_1150 | 277 |
| 337 | 3300049742 | Ga0501080_0088336 | Ga0501080_0088336_1647_2675 | 277 |
| 338 | 3300049743 | Ga0501081_0029430 | Ga0501081_0029430_883_1911 | 277 |
| 339 | 3300049744 | Ga0501083_0049381 | Ga0501083_0049381_1250_2278 | 277 |
| 340 | 3300053096 | Ga0500641_0003986 | Ga0500641_0003986_3002_4027 | 277 |
| 341 | 3300006051 | Ga0075364_10079571 | Ga0075364_100795713 | 278 |
| 342 | 3300006051 | Ga0075364_10210508 | Ga0075364_102105082 | 278 |
| 343 | 3300006195 | Ga0075366_10000720 | Ga0075366_1000072010 | 278 |
| 344 | 3300006353 | Ga0075370_10053644 | Ga0075370_100536443 | 278 |
| 345 | 3300027312 | Ga0209371_1024599 | Ga0209371_10245991 | 278 |
| 346 | 3300030500 | Ga0268256_1022380 | Ga0268256_10223801 | 278 |
| 347 | 3300035692 | Ga0373935_0097406 | Ga0373935_0097406_794_1813 | 278 |
| 348 | 3300036401 | Ga0373937_0010494 | Ga0373937_0010494_6844_7878 | 278 |
| 349 | 3300037068 | Ga0373925_0014258 | Ga0373925_0014258_4005_5024 | 278 |
| 350 | 3300045836 | Ga0466958_0189181 | Ga0466958_0189181_90_1112 | 278 |
| 351 | 3300049593 | Ga0501077_0076191 | Ga0501077_0076191_1015_2040 | 278 |
| 352 | 3300050493 | nmdc:mga0k408_13742_c1 | nmdc:mga0k408_13742_c1_3130_4143 | 278 |
| 353 | 3300050496 | nmdc:mga07m45_132840_c1 | nmdc:mga07m45_132840_c1_382_1395 | 278 |
| 354 | 3300009551 | Ga0105238_10065663 | Ga0105238_100656634 | 279 |
| 355 | 3300014497 | Ga0182008_10138261 | Ga0182008_101382611 | 279 |
| 356 | 3300036647 | Ga0316582_0074705 | Ga0316582_0074705_424_1452 | 279 |
| 357 | 3300039437 | Ga0436365_0304759 | Ga0436365_0304759_7012_8040 | 279 |
| 358 | 3300039437 | Ga0436365_1630180 | Ga0436365_1630180_2573_3598 | 279 |
| 359 | 3300044693 | Ga0466961_0069040 | Ga0466961_0069040_134_1159 | 279 |
| 360 | 3300049578 | Ga0501042_0062436 | Ga0501042_0062436_656_1681 | 279 |
| 361 | 3300049590 | Ga0501074_0060870 | Ga0501074_0060870_59_1084 | 279 |
| 362 | 3300049592 | Ga0501076_0041092 | Ga0501076_0041092_482_1507 | 279 |
| 363 | 3300049593 | Ga0501077_0087101 | Ga0501077_0087101_595_1620 | 279 |
| 364 | 3300049741 | Ga0501079_0035891 | Ga0501079_0035891_770_1795 | 279 |
| 365 | 3300005439 | Ga0070711_100131646 | Ga0070711_1001316462 | 280 |
| 366 | 3300042005 | Ga0439448_0048723 | Ga0439448_0048723_271_1299 | 280 |
| 367 | 3300044842 | Ga0466957_0150399 | Ga0466957_0150399_22_1014 | 281 |
| 368 | 3300048912 | Ga0496109_0155217 | Ga0496109_0155217_312_1337 | 281 |
| 369 | 3300048918 | Ga0496115_0088604 | Ga0496115_0088604_1152_2168 | 281 |
| 370 | 3300049570 | Ga0501033_0078659 | Ga0501033_0078659_642_1670 | 281 |
| 371 | 3300001990 | JGI24737J22298_10007387 | JGI24737J22298_100073872 | 282 |
| 372 | 3300002067 | JGI24735J21928_10037568 | JGI24735J21928_100375682 | 282 |
| 373 | 3300002076 | JGI24749J21850_1001685 | JGI24749J21850_10016852 | 282 |
| 374 | 3300002459 | JGI24751J29686_10005136 | JGI24751J29686_100051362 | 282 |
| 375 | 3300005330 | Ga0070690_100000506 | Ga0070690_1000005066 | 282 |
| 376 | 3300005334 | Ga0068869_100037466 | Ga0068869_1000374663 | 282 |
| 377 | 3300005335 | Ga0070666_10002984 | Ga0070666_1000298411 | 282 |
| 378 | 3300005336 | Ga0070680_100041348 | Ga0070680_1000413484 | 282 |
| 379 | 3300005337 | Ga0070682_100004821 | Ga0070682_1000048213 | 282 |
| 380 | 3300005338 | Ga0068868_100000904 | Ga0068868_10000090417 | 282 |
| 381 | 3300005339 | Ga0070660_100001178 | Ga0070660_10000117811 | 282 |
| 382 | 3300005340 | Ga0070689_100004127 | Ga0070689_10000412711 | 282 |
| 383 | 3300005341 | Ga0070691_10000155 | Ga0070691_1000015515 | 282 |
| 384 | 3300005343 | Ga0070687_100001299 | Ga0070687_10000129910 | 282 |
| 385 | 3300005344 | Ga0070661_100001464 | Ga0070661_10000146412 | 282 |
| 386 | 3300005345 | Ga0070692_10000912 | Ga0070692_100009126 | 282 |
| 387 | 3300005347 | Ga0070668_100000692 | Ga0070668_10000069211 | 282 |
| 388 | 3300005353 | Ga0070669_100000807 | Ga0070669_1000008076 | 282 |
| 389 | 3300005354 | Ga0070675_100001608 | Ga0070675_10000160815 | 282 |
| 390 | 3300005355 | Ga0070671_100001121 | Ga0070671_1000011216 | 282 |
| 391 | 3300005356 | Ga0070674_100001386 | Ga0070674_1000013868 | 282 |
| 392 | 3300005364 | Ga0070673_100000626 | Ga0070673_10000062612 | 282 |
| 393 | 3300005365 | Ga0070688_100000139 | Ga0070688_10000013940 | 282 |
| 394 | 3300005367 | Ga0070667_100005155 | Ga0070667_1000051553 | 282 |
| 395 | 3300005406 | Ga0070703_10035502 | Ga0070703_100355023 | 282 |
| 396 | 3300005434 | Ga0070709_10001924 | Ga0070709_1000192413 | 282 |
| 397 | 3300005435 | Ga0070714_100002022 | Ga0070714_1000020227 | 282 |
| 398 | 3300005436 | Ga0070713_100007833 | Ga0070713_1000078335 | 282 |
| 399 | 3300005437 | Ga0070710_10013755 | Ga0070710_100137551 | 282 |
| 400 | 3300005438 | Ga0070701_10001747 | Ga0070701_100017472 | 282 |
| 401 | 3300005439 | Ga0070711_100002491 | Ga0070711_1000024916 | 282 |
| 402 | 3300005440 | Ga0070705_100000298 | Ga0070705_1000002982 | 282 |
| 403 | 3300005441 | Ga0070700_100000648 | Ga0070700_1000006487 | 282 |
| 404 | 3300005444 | Ga0070694_100004154 | Ga0070694_1000041543 | 282 |
| 405 | 3300005456 | Ga0070678_100000734 | Ga0070678_1000007348 | 282 |
| 406 | 3300005457 | Ga0070662_100001979 | Ga0070662_1000019799 | 282 |
| 407 | 3300005458 | Ga0070681_10096980 | Ga0070681_100969802 | 282 |
| 408 | 3300005459 | Ga0068867_100012592 | Ga0068867_1000125926 | 282 |
| 409 | 3300005466 | Ga0070685_10002499 | Ga0070685_1000249911 | 282 |
| 410 | 3300005530 | Ga0070679_100020169 | Ga0070679_1000201694 | 282 |
| 411 | 3300005535 | Ga0070684_100108252 | Ga0070684_1001082522 | 282 |
| 412 | 3300005536 | Ga0070697_100023341 | Ga0070697_1000233415 | 282 |
| 413 | 3300005539 | Ga0068853_100013838 | Ga0068853_1000138381 | 282 |
| 414 | 3300005543 | Ga0070672_100001796 | Ga0070672_10000179610 | 282 |
| 415 | 3300005544 | Ga0070686_100000266 | Ga0070686_10000026630 | 282 |
| 416 | 3300005545 | Ga0070695_100000864 | Ga0070695_1000008648 | 282 |
| 417 | 3300005547 | Ga0070693_100000326 | Ga0070693_1000003267 | 282 |
| 418 | 3300005548 | Ga0070665_100019274 | Ga0070665_1000192745 | 282 |
| 419 | 3300005549 | Ga0070704_100003256 | Ga0070704_10000325611 | 282 |
| 420 | 3300005563 | Ga0068855_100007108 | Ga0068855_1000071088 | 282 |
| 421 | 3300005577 | Ga0068857_100007649 | Ga0068857_1000076494 | 282 |
| 422 | 3300005578 | Ga0068854_100000885 | Ga0068854_10000088511 | 282 |
| 423 | 3300005614 | Ga0068856_100002298 | Ga0068856_10000229817 | 282 |
| 424 | 3300005615 | Ga0070702_100000139 | Ga0070702_10000013917 | 282 |
| 425 | 3300005616 | Ga0068852_100001969 | Ga0068852_10000196910 | 282 |
| 426 | 3300005618 | Ga0068864_100011694 | Ga0068864_1000116942 | 282 |
| 427 | 3300005718 | Ga0068866_10006115 | Ga0068866_100061152 | 282 |
| 428 | 3300005719 | Ga0068861_100002618 | Ga0068861_10000261812 | 282 |
| 429 | 3300005841 | Ga0068863_100000834 | Ga0068863_10000083419 | 282 |
| 430 | 3300005842 | Ga0068858_100001979 | Ga0068858_10000197915 | 282 |
| 431 | 3300005843 | Ga0068860_100002133 | Ga0068860_1000021332 | 282 |
| 432 | 3300005844 | Ga0068862_100006042 | Ga0068862_10000604210 | 282 |
| 433 | 3300006163 | Ga0070715_10003350 | Ga0070715_100033503 | 282 |
| 434 | 3300006173 | Ga0070716_100000665 | Ga0070716_1000006656 | 282 |
| 435 | 3300006175 | Ga0070712_100000828 | Ga0070712_10000082812 | 282 |
| 436 | 3300006358 | Ga0068871_100020391 | Ga0068871_1000203916 | 282 |
| 437 | 3300006844 | Ga0075428_100011583 | Ga0075428_1000115833 | 282 |
| 438 | 3300006871 | Ga0075434_100038910 | Ga0075434_1000389102 | 282 |
| 439 | 3300006880 | Ga0075429_100007710 | Ga0075429_1000077109 | 282 |
| 440 | 3300006881 | Ga0068865_100010883 | Ga0068865_1000108836 | 282 |
| 441 | 3300006914 | Ga0075436_100046607 | Ga0075436_1000466072 | 282 |
| 442 | 3300007076 | Ga0075435_100044461 | Ga0075435_1000444612 | 282 |
| 443 | 3300009093 | Ga0105240_10222481 | Ga0105240_102224813 | 282 |
| 444 | 3300009094 | Ga0111539_10454921 | Ga0111539_104549212 | 282 |
| 445 | 3300009098 | Ga0105245_10000795 | Ga0105245_100007954 | 282 |
| 446 | 3300009148 | Ga0105243_10001724 | Ga0105243_100017243 | 282 |
| 447 | 3300009174 | Ga0105241_10003139 | Ga0105241_100031395 | 282 |
| 448 | 3300009545 | Ga0105237_10002479 | Ga0105237_1000247912 | 282 |
| 449 | 3300009553 | Ga0105249_10019431 | Ga0105249_100194316 | 282 |
| 450 | 3300010375 | Ga0105239_10015919 | Ga0105239_100159193 | 282 |
| 451 | 3300011119 | Ga0105246_10039290 | Ga0105246_100392903 | 282 |
| 452 | 3300013100 | Ga0157373_10153886 | Ga0157373_101538861 | 282 |
| 453 | 3300013105 | Ga0157369_10006851 | Ga0157369_1000685110 | 282 |
| 454 | 3300013297 | Ga0157378_10003370 | Ga0157378_100033708 | 282 |
| 455 | 3300013306 | Ga0163162_10018703 | Ga0163162_100187034 | 282 |
| 456 | 3300013307 | Ga0157372_10019119 | Ga0157372_100191199 | 282 |
| 457 | 3300014326 | Ga0157380_10001853 | Ga0157380_1000185313 | 282 |
| 458 | 3300014745 | Ga0157377_10005976 | Ga0157377_100059766 | 282 |
| 459 | 3300014968 | Ga0157379_10008173 | Ga0157379_100081732 | 282 |
| 460 | 3300014969 | Ga0157376_10000272 | Ga0157376_100002729 | 282 |
| 461 | 3300017792 | Ga0163161_10002256 | Ga0163161_100022563 | 282 |
| 462 | 3300025321 | Ga0207656_10024264 | Ga0207656_100242642 | 282 |
| 463 | 3300025898 | Ga0207692_10009314 | Ga0207692_100093145 | 282 |
| 464 | 3300025901 | Ga0207688_10004336 | Ga0207688_100043368 | 282 |
| 465 | 3300025904 | Ga0207647_10009490 | Ga0207647_100094908 | 282 |
| 466 | 3300025906 | Ga0207699_10001015 | Ga0207699_1000101516 | 282 |
| 467 | 3300025907 | Ga0207645_10003182 | Ga0207645_100031826 | 282 |
| 468 | 3300025911 | Ga0207654_10002679 | Ga0207654_100026793 | 282 |
| 469 | 3300025912 | Ga0207707_10160242 | Ga0207707_101602422 | 282 |
| 470 | 3300025914 | Ga0207671_10039935 | Ga0207671_100399352 | 282 |
| 471 | 3300025915 | Ga0207693_10000607 | Ga0207693_1000060727 | 282 |
| 472 | 3300025916 | Ga0207663_10027847 | Ga0207663_100278472 | 282 |
| 473 | 3300025918 | Ga0207662_10005337 | Ga0207662_100053377 | 282 |
| 474 | 3300025919 | Ga0207657_10000086 | Ga0207657_1000008621 | 282 |
| 475 | 3300025921 | Ga0207652_10137287 | Ga0207652_101372873 | 282 |
| 476 | 3300025923 | Ga0207681_10007570 | Ga0207681_100075703 | 282 |
| 477 | 3300025924 | Ga0207694_10084241 | Ga0207694_100842412 | 282 |
| 478 | 3300025926 | Ga0207659_10008710 | Ga0207659_100087107 | 282 |
| 479 | 3300025927 | Ga0207687_10003118 | Ga0207687_100031183 | 282 |
| 480 | 3300025928 | Ga0207700_10041040 | Ga0207700_100410403 | 282 |
| 481 | 3300025929 | Ga0207664_10174415 | Ga0207664_101744152 | 282 |
| 482 | 3300025931 | Ga0207644_10006653 | Ga0207644_100066533 | 282 |
| 483 | 3300025932 | Ga0207690_10002052 | Ga0207690_100020529 | 282 |
| 484 | 3300025933 | Ga0207706_10000234 | Ga0207706_1000023446 | 282 |
| 485 | 3300025934 | Ga0207686_10026555 | Ga0207686_100265552 | 282 |
| 486 | 3300025935 | Ga0207709_10014962 | Ga0207709_100149623 | 282 |
| 487 | 3300025936 | Ga0207670_10101130 | Ga0207670_101011302 | 282 |
| 488 | 3300025937 | Ga0207669_10040977 | Ga0207669_100409772 | 282 |
| 489 | 3300025939 | Ga0207665_10000120 | Ga0207665_100001208 | 282 |
| 490 | 3300025940 | Ga0207691_10000538 | Ga0207691_1000053810 | 282 |
| 491 | 3300025941 | Ga0207711_10007098 | Ga0207711_100070989 | 282 |
| 492 | 3300025944 | Ga0207661_10016618 | Ga0207661_100166185 | 282 |
| 493 | 3300025945 | Ga0207679_10003216 | Ga0207679_100032168 | 282 |
| 494 | 3300025949 | Ga0207667_10026394 | Ga0207667_100263941 | 282 |
| 495 | 3300025960 | Ga0207651_10000671 | Ga0207651_100006719 | 282 |
| 496 | 3300025961 | Ga0207712_10014439 | Ga0207712_100144394 | 282 |
| 497 | 3300025972 | Ga0207668_10019195 | Ga0207668_100191952 | 282 |
| 498 | 3300025981 | Ga0207640_10044405 | Ga0207640_100444051 | 282 |
| 499 | 3300026041 | Ga0207639_10067181 | Ga0207639_100671812 | 282 |
| 500 | 3300026067 | Ga0207678_10000048 | Ga0207678_1000004818 | 282 |
| 501 | 3300026075 | Ga0207708_10000443 | Ga0207708_1000044328 | 282 |
| 502 | 3300026078 | Ga0207702_10020692 | Ga0207702_100206922 | 282 |
| 503 | 3300026089 | Ga0207648_10246897 | Ga0207648_102468972 | 282 |
| 504 | 3300026095 | Ga0207676_10010515 | Ga0207676_100105154 | 282 |
| 505 | 3300026116 | Ga0207674_10003550 | Ga0207674_1000355012 | 282 |
| 506 | 3300026118 | Ga0207675_100000155 | Ga0207675_10000015545 | 282 |
| 507 | 3300026121 | Ga0207683_10001926 | Ga0207683_1000192611 | 282 |
| 508 | 3300026142 | Ga0207698_10006352 | Ga0207698_100063528 | 282 |
| 509 | 3300027907 | Ga0207428_10023841 | Ga0207428_100238411 | 282 |
| 510 | 3300028379 | Ga0268266_10024250 | Ga0268266_100242503 | 282 |
| 511 | 3300028381 | Ga0268264_10004457 | Ga0268264_1000445711 | 282 |
| 512 | 3300035085 | Ga0373929_0013142 | Ga0373929_0013142_355_1383 | 282 |
| 513 | 3300035115 | Ga0373941_0006186 | Ga0373941_0006186_1212_2240 | 282 |
| 514 | 3300035691 | Ga0373931_0047101 | Ga0373931_0047101_388_1416 | 282 |
| 515 | 3300037471 | Ga0395905_0025716 | Ga0395905_0025716_4258_5286 | 282 |
| 516 | 3300038443 | Ga0395901_0003430 | Ga0395901_0003430_5401_6429 | 282 |
| 517 | 3300045836 | Ga0466958_0111706 | Ga0466958_0111706_107_1126 | 282 |
| 518 | 3300048903 | Ga0496100_0050297 | Ga0496100_0050297_118_1146 | 282 |
| 519 | 3300048904 | Ga0496101_0005059 | Ga0496101_0005059_3511_4539 | 282 |
| 520 | 3300048905 | Ga0496102_0026747 | Ga0496102_0026747_3383_4411 | 282 |
| 521 | 3300048906 | Ga0496103_0006682 | Ga0496103_0006682_4425_5453 | 282 |
| 522 | 3300048907 | Ga0496104_0056535 | Ga0496104_0056535_488_1516 | 282 |
| 523 | 3300048909 | Ga0496106_0018910 | Ga0496106_0018910_3210_4238 | 282 |
| 524 | 3300048910 | Ga0496107_0005627 | Ga0496107_0005627_3210_4238 | 282 |
| 525 | 3300048913 | Ga0496110_0007056 | Ga0496110_0007056_6019_7047 | 282 |
| 526 | 3300048914 | Ga0496111_0017353 | Ga0496111_0017353_3210_4238 | 282 |
| 527 | 3300048915 | Ga0496112_0018639 | Ga0496112_0018639_3747_4775 | 282 |
| 528 | 3300048916 | Ga0496113_0005136 | Ga0496113_0005136_1426_2454 | 282 |
| 529 | 3300048917 | Ga0496114_0007979 | Ga0496114_0007979_1426_2454 | 282 |
| 530 | 3300048918 | Ga0496115_0053180 | Ga0496115_0053180_668_1696 | 282 |
| 531 | 3300049589 | Ga0501073_0136524 | Ga0501073_0136524_376_1398 | 282 |
| 532 | 3300050510 | nmdc:mga06r32_533507_c1 | nmdc:mga06r32_533507_c1_72_1100 | 282 |
| 533 | 3300050511 | nmdc:mga08y16_174255_c1 | nmdc:mga08y16_174255_c1_279_1307 | 282 |
| 534 | 3300005327 | Ga0070658_10127049 | Ga0070658_101270491 | 283 |
| 535 | 3300006177 | Ga0075362_10109335 | Ga0075362_101093352 | 283 |
| 536 | 3300009098 | Ga0105245_10427741 | Ga0105245_104277412 | 283 |
| 537 | 3300013306 | Ga0163162_10351018 | Ga0163162_103510182 | 283 |
| 538 | 3300025909 | Ga0207705_10074333 | Ga0207705_100743331 | 283 |
| 539 | 3300048910 | Ga0496107_0045415 | Ga0496107_0045415_1604_2632 | 283 |
| 540 | 3300049823 | Ga0501044_0000243 | Ga0501044_0000243_30809_31831 | 283 |
| 541 | 3300005535 | Ga0070684_100110930 | Ga0070684_1001109303 | 284 |
| 542 | 3300009551 | Ga0105238_10204562 | Ga0105238_102045622 | 284 |
| 543 | 3300025924 | Ga0207694_10245681 | Ga0207694_102456812 | 284 |
| 544 | 3300039437 | Ga0436365_0470321 | Ga0436365_0470321_324_1349 | 284 |
| 545 | 3300006051 | Ga0075364_10056584 | Ga0075364_100565843 | 285 |
| 546 | 3300049587 | Ga0501071_0096636 | Ga0501071_0096636_95_1120 | 285 |
| 547 | 3300025972 | Ga0207668_10149217 | Ga0207668_101492172 | 286 |
| 548 | 3300035171 | Ga0373946_0130182 | Ga0373946_0130182_41_1060 | 286 |
| 549 | 3300049574 | Ga0501038_0108873 | Ga0501038_0108873_903_1889 | 286 |
| 550 | 3300009176 | Ga0105242_10084848 | Ga0105242_100848482 | 287 |
| 551 | 3300009177 | Ga0105248_10018306 | Ga0105248_100183063 | 287 |
| 552 | 3300025272 | Ga0209455_1001210 | Ga0209455_10012105 | 287 |
| 553 | 3300025934 | Ga0207686_10160255 | Ga0207686_101602552 | 287 |
| 554 | 3300025941 | Ga0207711_10028742 | Ga0207711_100287421 | 287 |
| 555 | 3300031250 | Ga0265331_10025502 | Ga0265331_100255023 | 287 |
| 556 | 3300035112 | Ga0373932_0006296 | Ga0373932_0006296_725_1744 | 287 |
| 557 | 3300035691 | Ga0373931_0001104 | Ga0373931_0001104_4729_5748 | 287 |
| 558 | 3300045049 | Ga0466959_0090259 | Ga0466959_0090259_124_1152 | 287 |
| 559 | 3300048904 | Ga0496101_0046415 | Ga0496101_0046415_128_1147 | 287 |
| 560 | 3300048915 | Ga0496112_0076497 | Ga0496112_0076497_2090_3109 | 287 |
| 561 | 3300048921 | Ga0496118_0021504 | Ga0496118_0021504_3167_4195 | 287 |
| 562 | 3300049575 | Ga0501039_0119247 | Ga0501039_0119247_828_1856 | 287 |
| 563 | 3300053096 | Ga0500641_0003319 | Ga0500641_0003319_589_1617 | 287 |
| 564 | 3300005340 | Ga0070689_100002505 | Ga0070689_10000250512 | 288 |
| 565 | 3300005356 | Ga0070674_100072160 | Ga0070674_1000721602 | 288 |
| 566 | 3300005365 | Ga0070688_100009945 | Ga0070688_1000099454 | 288 |
| 567 | 3300005459 | Ga0068867_100047834 | Ga0068867_1000478342 | 288 |
| 568 | 3300005544 | Ga0070686_100056466 | Ga0070686_1000564662 | 288 |
| 569 | 3300005617 | Ga0068859_100501024 | Ga0068859_1005010242 | 288 |
| 570 | 3300005840 | Ga0068870_10070882 | Ga0068870_100708823 | 288 |
| 571 | 3300005842 | Ga0068858_100264509 | Ga0068858_1002645092 | 288 |
| 572 | 3300005981 | Ga0081538_10013324 | Ga0081538_100133245 | 288 |
| 573 | 3300006881 | Ga0068865_100192614 | Ga0068865_1001926142 | 288 |
| 574 | 3300006931 | Ga0097620_100501017 | Ga0097620_1005010172 | 288 |
| 575 | 3300009101 | Ga0105247_10057895 | Ga0105247_100578952 | 288 |
| 576 | 3300009551 | Ga0105238_10195955 | Ga0105238_101959552 | 288 |
| 577 | 3300010375 | Ga0105239_10389279 | Ga0105239_103892792 | 288 |
| 578 | 3300013306 | Ga0163162_10635719 | Ga0163162_106357192 | 288 |
| 579 | 3300014325 | Ga0163163_10137209 | Ga0163163_101372092 | 288 |
| 580 | 3300025900 | Ga0207710_10051150 | Ga0207710_100511501 | 288 |
| 581 | 3300025901 | Ga0207688_10096332 | Ga0207688_100963321 | 288 |
| 582 | 3300025908 | Ga0207643_10044356 | Ga0207643_100443562 | 288 |
| 583 | 3300025918 | Ga0207662_10027516 | Ga0207662_100275164 | 288 |
| 584 | 3300025923 | Ga0207681_10027077 | Ga0207681_100270774 | 288 |
| 585 | 3300025931 | Ga0207644_10304948 | Ga0207644_103049482 | 288 |
| 586 | 3300025936 | Ga0207670_10009279 | Ga0207670_100092797 | 288 |
| 587 | 3300025937 | Ga0207669_10062712 | Ga0207669_100627122 | 288 |
| 588 | 3300026035 | Ga0207703_10163721 | Ga0207703_101637211 | 288 |
| 589 | 3300026067 | Ga0207678_10273436 | Ga0207678_102734362 | 288 |
| 590 | 3300026089 | Ga0207648_10034341 | Ga0207648_100343413 | 288 |
| 591 | 3300026095 | Ga0207676_10172389 | Ga0207676_101723892 | 288 |
| 592 | 3300026121 | Ga0207683_10064387 | Ga0207683_100643872 | 288 |
| 593 | 3300035207 | Ga0373942_0005006 | Ga0373942_0005006_2038_3057 | 288 |
| 594 | 3300035725 | Ga0373947_0060879 | Ga0373947_0060879_1142_2161 | 288 |
| 595 | 3300048903 | Ga0496100_0081171 | Ga0496100_0081171_344_1363 | 288 |
| 596 | 3300048909 | Ga0496106_0031586 | Ga0496106_0031586_587_1606 | 288 |
| 597 | 3300048913 | Ga0496110_0020979 | Ga0496110_0020979_2392_3411 | 288 |
| 598 | 3300048914 | Ga0496111_0045673 | Ga0496111_0045673_1906_2925 | 288 |
| 599 | 3300048916 | Ga0496113_0283287 | Ga0496113_0283287_31_1026 | 288 |
| 600 | 3300048917 | Ga0496114_0017775 | Ga0496114_0017775_4051_5070 | 288 |
| 601 | 3300048921 | Ga0496118_0098658 | Ga0496118_0098658_844_1872 | 288 |
| 602 | 3300048927 | Ga0496124_0085289 | Ga0496124_0085289_379_1407 | 288 |
| 603 | 3300049588 | Ga0501072_0008450 | Ga0501072_0008450_6481_7494 | 288 |
| 604 | 3300053111 | Ga0500572_000177 | Ga0500572_000177_7558_8586 | 288 |
| 605 | 3300053136 | Ga0500559_0000980 | Ga0500559_0000980_15655_16683 | 288 |
| 606 | 3300053163 | Ga0500639_003548 | Ga0500639_003548_262_1290 | 288 |
| 607 | 3300053725 | Ga0500576_080247 | Ga0500576_080247_206_1234 | 288 |
| 608 | 3300005441 | Ga0070700_100198047 | Ga0070700_1001980471 | 289 |
| 609 | 3300006844 | Ga0075428_100007488 | Ga0075428_1000074886 | 289 |
| 610 | 3300006847 | Ga0075431_100001907 | Ga0075431_10000190712 | 289 |
| 611 | 3300009094 | Ga0111539_10000178 | Ga0111539_1000017818 | 289 |
| 612 | 3300009147 | Ga0114129_10001129 | Ga0114129_1000112917 | 289 |
| 613 | 3300027907 | Ga0207428_10030696 | Ga0207428_100306962 | 289 |
| 614 | 3300046520 | Ga0495637_0030494 | Ga0495637_0030494_99_1124 | 289 |
| 615 | 3300046615 | Ga0495656_0002300 | Ga0495656_0002300_485_1510 | 289 |
| 616 | 3300048907 | Ga0496104_0050693 | Ga0496104_0050693_749_1774 | 289 |
| 617 | 3300048908 | Ga0496105_0140260 | Ga0496105_0140260_353_1378 | 289 |
| 618 | 3300048909 | Ga0496106_0405201 | Ga0496106_0405201_25_1050 | 289 |
| 619 | 3300048917 | Ga0496114_0019575 | Ga0496114_0019575_1839_2864 | 289 |
| 620 | 3300049586 | Ga0501070_0202178 | Ga0501070_0202178_311_1336 | 289 |
| 621 | 3300049590 | Ga0501074_0024159 | Ga0501074_0024159_2352_3377 | 289 |
| 622 | 3300049741 | Ga0501079_0072432 | Ga0501079_0072432_898_1923 | 289 |
| 623 | 3300050494 | nmdc:mga06z11_228786_c1 | nmdc:mga06z11_228786_c1_14_1039 | 289 |
| 624 | 3300050507 | nmdc:mga05p37_743_c1 | nmdc:mga05p37_743_c1_20431_21456 | 289 |
| 625 | 3300050508 | nmdc:mga09592_781_c1 | nmdc:mga09592_781_c1_19426_20451 | 289 |
| 626 | 3300050510 | nmdc:mga06r32_15926_c1 | nmdc:mga06r32_15926_c1_3068_4093 | 289 |
| 627 | 3300050511 | nmdc:mga08y16_121_c1 | nmdc:mga08y16_121_c1_14562_15587 | 289 |
| 628 | 3300039438 | Ga0436360_0776902 | Ga0436360_0776902_488_1510 | 290 |
| 629 | 3300048915 | Ga0496112_0471992 | Ga0496112_0471992_39_1064 | 290 |
| 630 | 3300049589 | Ga0501073_0024498 | Ga0501073_0024498_830_1855 | 290 |
| 631 | 3300005434 | Ga0070709_10003157 | Ga0070709_100031578 | 291 |
| 632 | 3300005434 | Ga0070709_10101995 | Ga0070709_101019952 | 291 |
| 633 | 3300005435 | Ga0070714_100002527 | Ga0070714_1000025275 | 291 |
| 634 | 3300005435 | Ga0070714_100042896 | Ga0070714_1000428964 | 291 |
| 635 | 3300005436 | Ga0070713_100012977 | Ga0070713_1000129774 | 291 |
| 636 | 3300005439 | Ga0070711_100196848 | Ga0070711_1001968482 | 291 |
| 637 | 3300005563 | Ga0068855_100407744 | Ga0068855_1004077441 | 291 |
| 638 | 3300005614 | Ga0068856_100321961 | Ga0068856_1003219612 | 291 |
| 639 | 3300005983 | Ga0081540_1007455 | Ga0081540_10074556 | 291 |
| 640 | 3300006028 | Ga0070717_10004121 | Ga0070717_100041218 | 291 |
| 641 | 3300006163 | Ga0070715_10004973 | Ga0070715_100049733 | 291 |
| 642 | 3300006173 | Ga0070716_100017392 | Ga0070716_1000173922 | 291 |
| 643 | 3300006175 | Ga0070712_100048016 | Ga0070712_1000480162 | 291 |
| 644 | 3300006175 | Ga0070712_100160370 | Ga0070712_1001603702 | 291 |
| 645 | 3300006871 | Ga0075434_100027681 | Ga0075434_1000276815 | 291 |
| 646 | 3300006914 | Ga0075436_100028674 | Ga0075436_1000286744 | 291 |
| 647 | 3300009551 | Ga0105238_10291349 | Ga0105238_102913492 | 291 |
| 648 | 3300013306 | Ga0163162_10709368 | Ga0163162_107093681 | 291 |
| 649 | 3300025898 | Ga0207692_10013506 | Ga0207692_100135061 | 291 |
| 650 | 3300025912 | Ga0207707_10317586 | Ga0207707_103175861 | 291 |
| 651 | 3300025915 | Ga0207693_10007266 | Ga0207693_100072667 | 291 |
| 652 | 3300025915 | Ga0207693_10008135 | Ga0207693_100081355 | 291 |
| 653 | 3300025916 | Ga0207663_10014213 | Ga0207663_100142133 | 291 |
| 654 | 3300025929 | Ga0207664_10011218 | Ga0207664_100112186 | 291 |
| 655 | 3300025929 | Ga0207664_10479577 | Ga0207664_104795771 | 291 |
| 656 | 3300025939 | Ga0207665_10029075 | Ga0207665_100290753 | 291 |
| 657 | 3300025944 | Ga0207661_10282717 | Ga0207661_102827172 | 291 |
| 658 | 3300025981 | Ga0207640_10071720 | Ga0207640_100717201 | 291 |
| 659 | 3300026142 | Ga0207698_10304829 | Ga0207698_103048291 | 291 |
| 660 | 3300031235 | Ga0265330_10095647 | Ga0265330_100956471 | 291 |
| 661 | 3300031249 | Ga0265339_10065515 | Ga0265339_100655153 | 291 |
| 662 | 3300031344 | Ga0265316_10045413 | Ga0265316_100454133 | 291 |
| 663 | 3300031711 | Ga0265314_10062854 | Ga0265314_100628543 | 291 |
| 664 | 3300048903 | Ga0496100_0051089 | Ga0496100_0051089_301_1317 | 291 |
| 665 | 3300048904 | Ga0496101_0033101 | Ga0496101_0033101_1721_2737 | 291 |
| 666 | 3300048909 | Ga0496106_0052756 | Ga0496106_0052756_1408_2424 | 291 |
| 667 | 3300048913 | Ga0496110_0172436 | Ga0496110_0172436_794_1810 | 291 |
| 668 | 3300050492 | nmdc:mga0yw44_73177_c1 | nmdc:mga0yw44_73177_c1_979_2004 | 291 |
| 669 | 3300050512 | nmdc:mga0n895_180704_c1 | nmdc:mga0n895_180704_c1_799_1815 | 291 |
| 670 | 3300050512 | nmdc:mga0n895_26889_c1 | nmdc:mga0n895_26889_c1_3464_4480 | 291 |
| 671 | 3300050513 | nmdc:mga0rr50_84733_c1 | nmdc:mga0rr50_84733_c1_1213_2229 | 291 |
| 672 | 3300050514 | nmdc:mga08x19_122291_c1 | nmdc:mga08x19_122291_c1_492_1520 | 291 |
| 673 | 3300050514 | nmdc:mga08x19_90761_c1 | nmdc:mga08x19_90761_c1_390_1406 | 291 |
| 674 | 3300053122 | Ga0500608_111432 | Ga0500608_111432_224_1240 | 291 |
| 675 | iso_pu_bacteria | 2545555834 | 2545678357 | 291 |
| 676 | iso_pu_bacteria | 2595698237 | 2596374533 | 291 |
| 677 | iso_pu_bacteria | 2643221733 | 2644728534 | 291 |
| 678 | iso_pu_bacteria | 2829745981 | 2829747244 | 291 |
| 679 | iso_pu_bacteria | 2841911363 | 2841914233 | 291 |
| 680 | iso_pu_bacteria | 2841917233 | 2841921436 | 291 |
| 681 | iso_pu_bacteria | 2861691609 | 2861692344 | 291 |
| 682 | iso_pu_bacteria | 2889306138 | 2889310506 | 291 |
| 683 | iso_pu_bacteria | 2902330777 | 2902335725 | 291 |
| 684 | iso_pu_bacteria | 2902405164 | 2902405824 | 291 |
| 685 | iso_pu_bacteria | 2928125067 | 2928125171 | 291 |
| 686 | iso_pu_bacteria | 641522639 | 641643266 | 291 |
| 687 | iso_pu_bacteria | 643348564 | 643602185 | 291 |
| 688 | 3300005339 | Ga0070660_100017321 | Ga0070660_1000173213 | 292 |
| 689 | 3300005366 | Ga0070659_100330878 | Ga0070659_1003308782 | 292 |
| 690 | 3300005436 | Ga0070713_100347326 | Ga0070713_1003473261 | 292 |
| 691 | 3300005577 | Ga0068857_100089166 | Ga0068857_1000891664 | 292 |
| 692 | 3300006846 | Ga0075430_100010104 | Ga0075430_1000101047 | 292 |
| 693 | 3300006852 | Ga0075433_10054818 | Ga0075433_100548183 | 292 |
| 694 | 3300009093 | Ga0105240_10075491 | Ga0105240_100754912 | 292 |
| 695 | 3300009147 | Ga0114129_10536806 | Ga0114129_105368061 | 292 |
| 696 | 3300009551 | Ga0105238_10098196 | Ga0105238_100981961 | 292 |
| 697 | 3300021384 | Ga0213876_10103388 | Ga0213876_101033882 | 292 |
| 698 | 3300025919 | Ga0207657_10053517 | Ga0207657_100535172 | 292 |
| 699 | 3300026116 | Ga0207674_10065797 | Ga0207674_100657974 | 292 |
| 700 | 3300027717 | Ga0209998_10011035 | Ga0209998_100110351 | 292 |
| 701 | 3300033180 | Ga0307510_10177783 | Ga0307510_101777831 | 292 |
| 702 | 3300039437 | Ga0436365_1501331 | Ga0436365_1501331_867_1895 | 292 |
| 703 | 3300039447 | Ga0436361_0504819 | Ga0436361_0504819_198_1271 | 292 |
| 704 | 3300044694 | Ga0466963_0025056 | Ga0466963_0025056_1768_2796 | 292 |
| 705 | 3300045976 | Ga0466967_0352298 | Ga0466967_0352298_259_1287 | 292 |
| 706 | 3300048903 | Ga0496100_0035039 | Ga0496100_0035039_957_1970 | 292 |
| 707 | 3300048907 | Ga0496104_0089100 | Ga0496104_0089100_1125_2153 | 292 |
| 708 | 3300048909 | Ga0496106_0290130 | Ga0496106_0290130_19_1047 | 292 |
| 709 | 3300048921 | Ga0496118_0138653 | Ga0496118_0138653_185_1222 | 292 |
| 710 | 3300050509 | nmdc:mga0qj67_110596_c1 | nmdc:mga0qj67_110596_c1_810_1835 | 292 |
| 711 | 3300050510 | nmdc:mga06r32_41405_c1 | nmdc:mga06r32_41405_c1_2942_3967 | 292 |
| 712 | 3300050512 | nmdc:mga0n895_182347_c1 | nmdc:mga0n895_182347_c1_1039_2064 | 292 |
| 713 | 3300050515 | nmdc:mga0a205_64995_c1 | nmdc:mga0a205_64995_c1_950_1975 | 292 |
| 714 | 3300053096 | Ga0500641_0016480 | Ga0500641_0016480_535_1548 | 292 |
| 715 | 3300061719 | Ga0466962_0044264 | Ga0466962_0044264_276_1304 | 292 |
| 716 | 3300009094 | Ga0111539_10097907 | Ga0111539_100979072 | 293 |
| 717 | 3300031616 | Ga0307508_10000012 | Ga0307508_10000012165 | 293 |
| 718 | 3300046664 | Ga0495659_0093143 | Ga0495659_0093143_81_1106 | 293 |
| 719 | 3300049824 | Ga0501045_0195841 | Ga0501045_0195841_442_1467 | 293 |
| 720 | 3300050511 | nmdc:mga08y16_77399_c1 | nmdc:mga08y16_77399_c1_1523_2536 | 293 |
| 721 | iso_pu_bacteria | 3003665799 | 3003670356 | 293 |
| 722 | 3300005336 | Ga0070680_100027539 | Ga0070680_1000275393 | 294 |
| 723 | 3300005339 | Ga0070660_100087257 | Ga0070660_1000872572 | 294 |
| 724 | 3300005458 | Ga0070681_10006054 | Ga0070681_100060549 | 294 |
| 725 | 3300005530 | Ga0070679_100128056 | Ga0070679_1001280562 | 294 |
| 726 | 3300006195 | Ga0075366_10104284 | Ga0075366_101042842 | 294 |
| 727 | 3300021384 | Ga0213876_10122080 | Ga0213876_101220801 | 294 |
| 728 | 3300025917 | Ga0207660_10043311 | Ga0207660_100433112 | 294 |
| 729 | 3300025919 | Ga0207657_10079892 | Ga0207657_100798922 | 294 |
| 730 | 3300025921 | Ga0207652_10024214 | Ga0207652_100242143 | 294 |
| 731 | 3300035692 | Ga0373935_0198344 | Ga0373935_0198344_36_1061 | 294 |
| 732 | 3300046473 | Ga0495582_0051531 | Ga0495582_0051531_861_1886 | 294 |
| 733 | 3300046615 | Ga0495656_0009606 | Ga0495656_0009606_1901_2929 | 294 |
| 734 | 3300046681 | Ga0495647_0027549 | Ga0495647_0027549_17_1042 | 294 |
| 735 | 3300049593 | Ga0501077_0029791 | Ga0501077_0029791_1112_2140 | 294 |
| 736 | 3300049743 | Ga0501081_0020098 | Ga0501081_0020098_838_1866 | 294 |
| 737 | 3300050493 | nmdc:mga0k408_17367_c1 | nmdc:mga0k408_17367_c1_671_1681 | 294 |
| 738 | 3300050494 | nmdc:mga06z11_18492_c1 | nmdc:mga06z11_18492_c1_569_1579 | 294 |
| 739 | 3300060353 | Ga0501082_0070022 | Ga0501082_0070022_41_1054 | 294 |
| 740 | iso_pu_bacteria | 2671180139 | 2671691843 | 294 |
| 741 | 3300003215 | JGI25153J46596_10007775 | JGI25153J46596_100077752 | 295 |
| 742 | 3300005334 | Ga0068869_100093831 | Ga0068869_1000938312 | 295 |
| 743 | 3300005354 | Ga0070675_100431566 | Ga0070675_1004315661 | 295 |
| 744 | 3300005458 | Ga0070681_10074337 | Ga0070681_100743372 | 295 |
| 745 | 3300005843 | Ga0068860_100153885 | Ga0068860_1001538852 | 295 |
| 746 | 3300006178 | Ga0075367_10170213 | Ga0075367_101702132 | 295 |
| 747 | 3300006358 | Ga0068871_100134484 | Ga0068871_1001344842 | 295 |
| 748 | 3300006846 | Ga0075430_100000194 | Ga0075430_10000019424 | 295 |
| 749 | 3300006942 | Ga0099824_1021728 | Ga0099824_10217284 | 295 |
| 750 | 3300013104 | Ga0157370_10096163 | Ga0157370_100961632 | 295 |
| 751 | 3300014325 | Ga0163163_10057400 | Ga0163163_100574002 | 295 |
| 752 | 3300025261 | Ga0209233_1001411 | Ga0209233_10014113 | 295 |
| 753 | 3300025297 | Ga0209758_1000382 | Ga0209758_10003822 | 295 |
| 754 | 3300025913 | Ga0207695_10146479 | Ga0207695_101464792 | 295 |
| 755 | 3300025942 | Ga0207689_10147605 | Ga0207689_101476052 | 295 |
| 756 | 3300025949 | Ga0207667_10192076 | Ga0207667_101920762 | 295 |
| 757 | 3300027296 | Ga0209389_1000034 | Ga0209389_100003421 | 295 |
| 758 | 3300027357 | Ga0209589_1000038 | Ga0209589_100003899 | 295 |
| 759 | 3300027361 | Ga0209489_100023 | Ga0209489_10002394 | 295 |
| 760 | 3300031240 | Ga0265320_10092642 | Ga0265320_100926422 | 295 |
| 761 | 3300031241 | Ga0265325_10014755 | Ga0265325_100147552 | 295 |
| 762 | 3300031242 | Ga0265329_10071541 | Ga0265329_100715411 | 295 |
| 763 | 3300031247 | Ga0265340_10033670 | Ga0265340_100336702 | 295 |
| 764 | 3300031344 | Ga0265316_10127390 | Ga0265316_101273902 | 295 |
| 765 | 3300031456 | Ga0307513_10229070 | Ga0307513_102290702 | 295 |
| 766 | 3300031595 | Ga0265313_10035182 | Ga0265313_100351824 | 295 |
| 767 | 3300031665 | Ga0316575_10005549 | Ga0316575_100055493 | 295 |
| 768 | 3300031691 | Ga0316579_10000697 | Ga0316579_1000069711 | 295 |
| 769 | 3300031711 | Ga0265314_10056160 | Ga0265314_100561602 | 295 |
| 770 | 3300031712 | Ga0265342_10023484 | Ga0265342_100234842 | 295 |
| 771 | 3300031727 | Ga0316576_10090234 | Ga0316576_100902341 | 295 |
| 772 | 3300031728 | Ga0316578_10064945 | Ga0316578_100649452 | 295 |
| 773 | 3300031733 | Ga0316577_10014741 | Ga0316577_100147412 | 295 |
| 774 | 3300032133 | Ga0316583_10003003 | Ga0316583_100030036 | 295 |
| 775 | 3300032137 | Ga0316585_10003818 | Ga0316585_100038182 | 295 |
| 776 | 3300032139 | Ga0316580_10000948 | Ga0316580_100009486 | 295 |
| 777 | 3300033541 | Ga0316596_1026098 | Ga0316596_10260982 | 295 |
| 778 | 3300036647 | Ga0316582_0084831 | Ga0316582_0084831_1012_2040 | 295 |
| 779 | 3300036712 | Ga0316584_0002253 | Ga0316584_0002253_8786_9814 | 295 |
| 780 | 3300037588 | Ga0316581_0000324 | Ga0316581_0000324_2168_3196 | 295 |
| 781 | 3300041408 | Ga0439453_0000430 | Ga0439453_0000430_592_1605 | 295 |
| 782 | 3300046460 | Ga0495638_0034095 | Ga0495638_0034095_1175_2188 | 295 |
| 783 | 3300046474 | Ga0495605_0038492 | Ga0495605_0038492_1094_2107 | 295 |
| 784 | 3300046664 | Ga0495659_0009162 | Ga0495659_0009162_451_1479 | 295 |
| 785 | 3300050509 | nmdc:mga0qj67_103_c1 | nmdc:mga0qj67_103_c1_20828_21847 | 295 |
| 786 | 3300053153 | Ga0500616_0100980 | Ga0500616_0100980_301_1314 | 295 |
| 787 | 3300035111 | Ga0373923_0001014 | Ga0373923_0001014_3078_4103 | 296 |
| 788 | 3300035116 | Ga0373945_0001639 | Ga0373945_0001639_1151_2176 | 296 |
| 789 | 3300035117 | Ga0373953_0074506 | Ga0373953_0074506_332_1357 | 296 |
| 790 | 3300035118 | Ga0373954_0002928 | Ga0373954_0002928_2403_3428 | 296 |
| 791 | 3300035119 | Ga0373956_0009029 | Ga0373956_0009029_1515_2540 | 296 |
| 792 | 3300035170 | Ga0373943_0003886 | Ga0373943_0003886_2312_3337 | 296 |
| 793 | 3300035171 | Ga0373946_0002901 | Ga0373946_0002901_438_1463 | 296 |
| 794 | 3300035172 | Ga0373955_0001221 | Ga0373955_0001221_5669_6694 | 296 |
| 795 | 3300035410 | Ga0373924_0011619 | Ga0373924_0011619_1625_2650 | 296 |
| 796 | 3300035692 | Ga0373935_0003708 | Ga0373935_0003708_3479_4504 | 296 |
| 797 | 3300035695 | Ga0373927_0006337 | Ga0373927_0006337_2093_3118 | 296 |
| 798 | 3300035724 | Ga0373933_0005193 | Ga0373933_0005193_4940_5965 | 296 |
| 799 | 3300035725 | Ga0373947_0005376 | Ga0373947_0005376_4919_5944 | 296 |
| 800 | 3300036401 | Ga0373937_0000058 | Ga0373937_0000058_79160_80185 | 296 |
| 801 | 3300037068 | Ga0373925_0000036 | Ga0373925_0000036_5879_6904 | 296 |
| 802 | 3300044694 | Ga0466963_0130010 | Ga0466963_0130010_647_1672 | 296 |
| 803 | 3300045976 | Ga0466967_0460219 | Ga0466967_0460219_169_1194 | 296 |
| 804 | 3300046454 | Ga0495592_0000232 | Ga0495592_0000232_44741_45766 | 296 |
| 805 | 3300046459 | Ga0495629_0015449 | Ga0495629_0015449_1197_2222 | 296 |
| 806 | 3300046462 | Ga0495651_0001333 | Ga0495651_0001333_6435_7460 | 296 |
| 807 | 3300046463 | Ga0495653_0000069 | Ga0495653_0000069_3538_4563 | 296 |
| 808 | 3300046473 | Ga0495582_0041078 | Ga0495582_0041078_1006_2031 | 296 |
| 809 | 3300046476 | Ga0495662_0000613 | Ga0495662_0000613_15425_16450 | 296 |
| 810 | 3300046477 | Ga0495664_0000010 | Ga0495664_0000010_18830_19855 | 296 |
| 811 | 3300046511 | Ga0495608_0000008 | Ga0495608_0000008_248794_249819 | 296 |
| 812 | 3300046514 | Ga0495618_0000002 | Ga0495618_0000002_21103_22128 | 296 |
| 813 | 3300046516 | Ga0495628_0000009 | Ga0495628_0000009_18858_19883 | 296 |
| 814 | 3300046517 | Ga0495630_0001382 | Ga0495630_0001382_10943_11968 | 296 |
| 815 | 3300046529 | Ga0495652_0000011 | Ga0495652_0000011_248484_249509 | 296 |
| 816 | 3300046533 | Ga0495640_0000009 | Ga0495640_0000009_197236_198261 | 296 |
| 817 | 3300046535 | Ga0495586_0192144 | Ga0495586_0192144_26_1051 | 296 |
| 818 | 3300046536 | Ga0495587_0000006 | Ga0495587_0000006_132576_133601 | 296 |
| 819 | 3300046543 | Ga0495645_0000010 | Ga0495645_0000010_217857_218882 | 296 |
| 820 | 3300046559 | Ga0495667_0000005 | Ga0495667_0000005_18858_19883 | 296 |
| 821 | 3300046642 | Ga0495634_0000055 | Ga0495634_0000055_18846_19871 | 296 |
| 822 | 3300046663 | Ga0495635_0000008 | Ga0495635_0000008_248467_249492 | 296 |
| 823 | 3300046675 | Ga0495657_0000470 | Ga0495657_0000470_21131_22156 | 296 |
| 824 | 3300046678 | Ga0495599_0000250 | Ga0495599_0000250_11845_12870 | 296 |
| 825 | 3300046679 | Ga0495623_0000004 | Ga0495623_0000004_54523_55548 | 296 |
| 826 | 3300046680 | Ga0495646_0000040 | Ga0495646_0000040_51486_52511 | 296 |
| 827 | 3300046683 | Ga0495658_0114604 | Ga0495658_0114604_78_1103 | 296 |
| 828 | 3300046689 | Ga0495613_0061740 | Ga0495613_0061740_474_1499 | 296 |
| 829 | 3300046690 | Ga0495624_0031025 | Ga0495624_0031025_2304_3329 | 296 |
| 830 | 3300046809 | Ga0495600_0000080 | Ga0495600_0000080_18847_19872 | 296 |
| 831 | 3300047315 | Ga0495581_0004214 | Ga0495581_0004214_5458_6483 | 296 |
| 832 | 3300047317 | Ga0495604_0000012 | Ga0495604_0000012_18845_19870 | 296 |
| 833 | 3300047319 | Ga0495674_0000011 | Ga0495674_0000011_21131_22156 | 296 |
| 834 | 3300047321 | Ga0495676_0051544 | Ga0495676_0051544_311_1336 | 296 |
| 835 | 3300047322 | Ga0495680_0001797 | Ga0495680_0001797_18075_19100 | 296 |
| 836 | 3300047444 | Ga0495675_0000468 | Ga0495675_0000468_18839_19864 | 296 |
| 837 | 3300047471 | Ga0495684_0000014 | Ga0495684_0000014_18847_19872 | 296 |
| 838 | 3300047673 | Ga0495593_0000650 | Ga0495593_0000650_3296_4321 | 296 |
| 839 | 3300048088 | Ga0495602_0000019 | Ga0495602_0000019_18823_19848 | 296 |
| 840 | 3300053077 | Ga0495601_0000009 | Ga0495601_0000009_248467_249492 | 296 |
| 841 | 3300053078 | Ga0495612_0000021 | Ga0495612_0000021_18737_19762 | 296 |
| 842 | 3300053084 | Ga0495595_0000067 | Ga0495595_0000067_21817_22842 | 296 |
| 843 | 3300053085 | Ga0495619_0000012 | Ga0495619_0000012_248467_249492 | 296 |
| 844 | iso_pu_bacteria | 2508501050 | 2508725257 | 296 |
| 845 | iso_pu_bacteria | 2508501114 | 2509077286 | 296 |
| 846 | iso_pu_bacteria | 2773857925 | 2774870762 | 296 |
| 847 | iso_pu_bacteria | 2775506901 | 2776262263 | 296 |
| 848 | iso_pu_bacteria | 2835312727 | 2835315930 | 296 |
| 849 | iso_pu_bacteria | 2882456835 | 2882458827 | 296 |
| 850 | iso_pu_bacteria | 2884298095 | 2884298918 | 296 |
| 851 | iso_pu_bacteria | 2894232714 | 2894237640 | 296 |
| 852 | 3300009098 | Ga0105245_10062246 | Ga0105245_100622465 | 297 |
| 853 | 3300031238 | Ga0265332_10003645 | Ga0265332_100036455 | 297 |
| 854 | 3300031247 | Ga0265340_10000617 | Ga0265340_1000061714 | 297 |
| 855 | 3300031249 | Ga0265339_10002621 | Ga0265339_100026218 | 297 |
| 856 | 3300031712 | Ga0265342_10000681 | Ga0265342_1000068110 | 297 |
| 857 | 3300049570 | Ga0501033_0006959 | Ga0501033_0006959_685_1704 | 297 |
| 858 | 3300049581 | Ga0501047_0062756 | Ga0501047_0062756_2370_3389 | 297 |
| 859 | 3300049586 | Ga0501070_0053237 | Ga0501070_0053237_2290_3309 | 297 |
| 860 | 3300049586 | Ga0501070_0076633 | Ga0501070_0076633_305_1324 | 297 |
| 861 | 3300060353 | Ga0501082_0031321 | Ga0501082_0031321_3367_4389 | 297 |
| 862 | iso_pu_bacteria | 2513237096 | 2513655325 | 297 |
| 863 | iso_pu_bacteria | 2513237137 | 2513861572 | 297 |
| 864 | iso_pu_bacteria | 2517572143 | 2517889813 | 297 |
| 865 | iso_pu_bacteria | 2524023210 | 2524465356 | 297 |
| 866 | iso_pu_bacteria | 2791355199 | 2793078900 | 297 |
| 867 | iso_pu_bacteria | 2903748898 | 2903750770 | 297 |
| 868 | iso_pu_bacteria | 2906635258 | 2906642481 | 297 |
| 869 | iso_pu_bacteria | 2906660503 | 2906661065 | 297 |
| 870 | iso_pu_bacteria | 8056673599 | 8056675321 | 297 |
| 871 | 3300003659 | JGI25404J52841_10004221 | JGI25404J52841_100042212 | 298 |
| 872 | 3300005518 | Ga0070699_100007777 | Ga0070699_1000077777 | 298 |
| 873 | 3300005983 | Ga0081540_1000054 | Ga0081540_100005470 | 298 |
| 874 | 3300007265 | Ga0099794_10076104 | Ga0099794_100761041 | 298 |
| 875 | 3300021361 | Ga0213872_10021080 | Ga0213872_100210801 | 298 |
| 876 | 3300031241 | Ga0265325_10000254 | Ga0265325_1000025413 | 298 |
| 877 | 3300035695 | Ga0373927_0122295 | Ga0373927_0122295_366_1409 | 298 |
| 878 | 3300036401 | Ga0373937_0259175 | Ga0373937_0259175_327_1349 | 298 |
| 879 | 3300037068 | Ga0373925_0090824 | Ga0373925_0090824_722_1765 | 298 |
| 880 | 3300039447 | Ga0436361_0575176 | Ga0436361_0575176_7265_8290 | 298 |
| 881 | 3300046533 | Ga0495640_0038316 | Ga0495640_0038316_913_1956 | 298 |
| 882 | 3300049569 | Ga0501032_0014993 | Ga0501032_0014993_779_1801 | 298 |
| 883 | 3300049570 | Ga0501033_0090649 | Ga0501033_0090649_401_1423 | 298 |
| 884 | 3300049571 | Ga0501034_0065445 | Ga0501034_0065445_1956_2978 | 298 |
| 885 | 3300049572 | Ga0501036_0073086 | Ga0501036_0073086_1712_2734 | 298 |
| 886 | 3300049574 | Ga0501038_0134415 | Ga0501038_0134415_814_1836 | 298 |
| 887 | 3300049575 | Ga0501039_0001760 | Ga0501039_0001760_14104_15126 | 298 |
| 888 | 3300049578 | Ga0501042_0047096 | Ga0501042_0047096_184_1206 | 298 |
| 889 | 3300049579 | Ga0501043_0005622 | Ga0501043_0005622_9045_10067 | 298 |
| 890 | 3300049582 | Ga0501048_0004377 | Ga0501048_0004377_6461_7483 | 298 |
| 891 | 3300049583 | Ga0501067_0002747 | Ga0501067_0002747_5379_6401 | 298 |
| 892 | 3300049584 | Ga0501068_0005068 | Ga0501068_0005068_5396_6418 | 298 |
| 893 | 3300049587 | Ga0501071_0008700 | Ga0501071_0008700_16_1038 | 298 |
| 894 | 3300049589 | Ga0501073_0011487 | Ga0501073_0011487_2716_3741 | 298 |
| 895 | 3300049589 | Ga0501073_0083635 | Ga0501073_0083635_798_1820 | 298 |
| 896 | 3300049590 | Ga0501074_0023427 | Ga0501074_0023427_670_1692 | 298 |
| 897 | 3300049742 | Ga0501080_0017834 | Ga0501080_0017834_4736_5758 | 298 |
| 898 | 3300049744 | Ga0501083_0014471 | Ga0501083_0014471_4366_5388 | 298 |
| 899 | 3300049822 | Ga0501035_0074868 | Ga0501035_0074868_401_1423 | 298 |
| 900 | 3300049823 | Ga0501044_0138743 | Ga0501044_0138743_670_1692 | 298 |
| 901 | 3300049824 | Ga0501045_0002689 | Ga0501045_0002689_1429_2451 | 298 |
| 902 | 3300060353 | Ga0501082_0034986 | Ga0501082_0034986_18_1040 | 298 |
| 903 | 3300005439 | Ga0070711_100003965 | Ga0070711_1000039654 | 299 |
| 904 | 3300005471 | Ga0070698_100044278 | Ga0070698_1000442786 | 299 |
| 905 | 3300007788 | Ga0099795_10003412 | Ga0099795_100034123 | 299 |
| 906 | 3300009094 | Ga0111539_10802949 | Ga0111539_108029491 | 299 |
| 907 | 3300009147 | Ga0114129_10001774 | Ga0114129_1000177422 | 299 |
| 908 | 3300021384 | Ga0213876_10187315 | Ga0213876_101873151 | 299 |
| 909 | 3300025915 | Ga0207693_10004165 | Ga0207693_100041659 | 299 |
| 910 | 3300025939 | Ga0207665_10186652 | Ga0207665_101866522 | 299 |
| 911 | 3300027512 | Ga0209179_1018677 | Ga0209179_10186772 | 299 |
| 912 | 3300048903 | Ga0496100_0063231 | Ga0496100_0063231_480_1511 | 299 |
| 913 | 3300048904 | Ga0496101_0096854 | Ga0496101_0096854_666_1697 | 299 |
| 914 | 3300048904 | Ga0496101_0299598 | Ga0496101_0299598_101_1129 | 299 |
| 915 | 3300048906 | Ga0496103_0024965 | Ga0496103_0024965_1310_2341 | 299 |
| 916 | 3300048909 | Ga0496106_0004959 | Ga0496106_0004959_253_1284 | 299 |
| 917 | 3300048910 | Ga0496107_0013265 | Ga0496107_0013265_1949_2980 | 299 |
| 918 | 3300048911 | Ga0496108_0075064 | Ga0496108_0075064_1463_2494 | 299 |
| 919 | 3300048912 | Ga0496109_0172732 | Ga0496109_0172732_339_1367 | 299 |
| 920 | 3300048918 | Ga0496115_0049839 | Ga0496115_0049839_416_1447 | 299 |
| 921 | 3300050507 | nmdc:mga05p37_7845_c1 | nmdc:mga05p37_7845_c1_8744_9772 | 299 |
| 922 | 3300002077 | JGI24744J21845_10017503 | JGI24744J21845_100175032 | 300 |
| 923 | 3300002244 | JGI24742J22300_10011595 | JGI24742J22300_100115952 | 300 |
| 924 | 3300005328 | Ga0070676_10000987 | Ga0070676_100009875 | 300 |
| 925 | 3300005329 | Ga0070683_100021229 | Ga0070683_1000212295 | 300 |
| 926 | 3300005336 | Ga0070680_100129620 | Ga0070680_1001296202 | 300 |
| 927 | 3300005339 | Ga0070660_100003975 | Ga0070660_1000039754 | 300 |
| 928 | 3300005343 | Ga0070687_100098019 | Ga0070687_1000980192 | 300 |
| 929 | 3300005356 | Ga0070674_100054253 | Ga0070674_1000542533 | 300 |
| 930 | 3300005441 | Ga0070700_100069729 | Ga0070700_1000697292 | 300 |
| 931 | 3300005458 | Ga0070681_10054547 | Ga0070681_100545472 | 300 |
| 932 | 3300005459 | Ga0068867_100048863 | Ga0068867_1000488632 | 300 |
| 933 | 3300005530 | Ga0070679_100383868 | Ga0070679_1003838682 | 300 |
| 934 | 3300005535 | Ga0070684_100017742 | Ga0070684_1000177423 | 300 |
| 935 | 3300005539 | Ga0068853_100005313 | Ga0068853_1000053138 | 300 |
| 936 | 3300005548 | Ga0070665_100298903 | Ga0070665_1002989032 | 300 |
| 937 | 3300005563 | Ga0068855_100036393 | Ga0068855_1000363934 | 300 |
| 938 | 3300005577 | Ga0068857_100130927 | Ga0068857_1001309272 | 300 |
| 939 | 3300005617 | Ga0068859_100009674 | Ga0068859_1000096749 | 300 |
| 940 | 3300005843 | Ga0068860_100163311 | Ga0068860_1001633113 | 300 |
| 941 | 3300005937 | Ga0081455_10003325 | Ga0081455_1000332515 | 300 |
| 942 | 3300005983 | Ga0081540_1097568 | Ga0081540_10975682 | 300 |
| 943 | 3300006237 | Ga0097621_100267583 | Ga0097621_1002675832 | 300 |
| 944 | 3300006931 | Ga0097620_100009674 | Ga0097620_1000096749 | 300 |
| 945 | 3300009093 | Ga0105240_10046855 | Ga0105240_100468554 | 300 |
| 946 | 3300009101 | Ga0105247_10002881 | Ga0105247_100028818 | 300 |
| 947 | 3300009177 | Ga0105248_10157262 | Ga0105248_101572625 | 300 |
| 948 | 3300009545 | Ga0105237_10011410 | Ga0105237_100114102 | 300 |
| 949 | 3300009551 | Ga0105238_10006964 | Ga0105238_100069644 | 300 |
| 950 | 3300009551 | Ga0105238_10094208 | Ga0105238_100942082 | 300 |
| 951 | 3300009553 | Ga0105249_10120341 | Ga0105249_101203413 | 300 |
| 952 | 3300010375 | Ga0105239_10066301 | Ga0105239_100663012 | 300 |
| 953 | 3300013102 | Ga0157371_10013083 | Ga0157371_100130835 | 300 |
| 954 | 3300013102 | Ga0157371_10263354 | Ga0157371_102633541 | 300 |
| 955 | 3300013104 | Ga0157370_10118189 | Ga0157370_101181892 | 300 |
| 956 | 3300013105 | Ga0157369_10006718 | Ga0157369_100067185 | 300 |
| 957 | 3300013296 | Ga0157374_10249472 | Ga0157374_102494722 | 300 |
| 958 | 3300013306 | Ga0163162_10233532 | Ga0163162_102335322 | 300 |
| 959 | 3300013308 | Ga0157375_10006188 | Ga0157375_100061888 | 300 |
| 960 | 3300013308 | Ga0157375_10067850 | Ga0157375_100678505 | 300 |
| 961 | 3300014326 | Ga0157380_10074213 | Ga0157380_100742133 | 300 |
| 962 | 3300025321 | Ga0207656_10030108 | Ga0207656_100301082 | 300 |
| 963 | 3300025885 | Ga0207653_10024206 | Ga0207653_100242062 | 300 |
| 964 | 3300025912 | Ga0207707_10016749 | Ga0207707_100167493 | 300 |
| 965 | 3300025913 | Ga0207695_10115370 | Ga0207695_101153702 | 300 |
| 966 | 3300025914 | Ga0207671_10056119 | Ga0207671_100561193 | 300 |
| 967 | 3300025917 | Ga0207660_10004044 | Ga0207660_100040442 | 300 |
| 968 | 3300025918 | Ga0207662_10051140 | Ga0207662_100511403 | 300 |
| 969 | 3300025921 | Ga0207652_10070440 | Ga0207652_100704402 | 300 |
| 970 | 3300025924 | Ga0207694_10009826 | Ga0207694_100098265 | 300 |
| 971 | 3300025933 | Ga0207706_10039839 | Ga0207706_100398393 | 300 |
| 972 | 3300025935 | Ga0207709_10006140 | Ga0207709_100061405 | 300 |
| 973 | 3300025938 | Ga0207704_10025319 | Ga0207704_100253192 | 300 |
| 974 | 3300025942 | Ga0207689_10016336 | Ga0207689_100163361 | 300 |
| 975 | 3300025944 | Ga0207661_10027740 | Ga0207661_100277402 | 300 |
| 976 | 3300025949 | Ga0207667_10007354 | Ga0207667_100073545 | 300 |
| 977 | 3300025961 | Ga0207712_10013620 | Ga0207712_100136205 | 300 |
| 978 | 3300026075 | Ga0207708_10121060 | Ga0207708_101210602 | 300 |
| 979 | 3300026089 | Ga0207648_10040596 | Ga0207648_100405964 | 300 |
| 980 | 3300026116 | Ga0207674_10058414 | Ga0207674_100584143 | 300 |
| 981 | 3300026118 | Ga0207675_100125719 | Ga0207675_1001257192 | 300 |
| 982 | 3300031235 | Ga0265330_10004963 | Ga0265330_100049636 | 300 |
| 983 | 3300031235 | Ga0265330_10022124 | Ga0265330_100221243 | 300 |
| 984 | 3300031247 | Ga0265340_10015541 | Ga0265340_100155412 | 300 |
| 985 | 3300031344 | Ga0265316_10105018 | Ga0265316_101050182 | 300 |
| 986 | 3300033442 | Ga0315911_1000005 | Ga0315911_1000005201 | 300 |
| 987 | 3300034957 | Ga0373938_0010032 | Ga0373938_0010032_666_1694 | 300 |
| 988 | 3300037466 | Ga0395898_0232753 | Ga0395898_0232753_62_1090 | 300 |
| 989 | 3300039447 | Ga0436361_0126718 | Ga0436361_0126718_296_1333 | 300 |
| 990 | 3300046457 | Ga0495590_0032126 | Ga0495590_0032126_424_1452 | 300 |
| 991 | 3300046477 | Ga0495664_0135693 | Ga0495664_0135693_56_1084 | 300 |
| 992 | 3300046615 | Ga0495656_0024270 | Ga0495656_0024270_140_1168 | 300 |
| 993 | 3300048909 | Ga0496106_0031501 | Ga0496106_0031501_133_1161 | 300 |
| 994 | 3300048918 | Ga0496115_0044821 | Ga0496115_0044821_1731_2759 | 300 |
| 995 | 3300048929 | Ga0496126_0016337 | Ga0496126_0016337_2020_3048 | 300 |
| 996 | 3300049568 | Ga0501031_0002788 | Ga0501031_0002788_3907_4935 | 300 |
| 997 | 3300049569 | Ga0501032_0000301 | Ga0501032_0000301_17663_18691 | 300 |
| 998 | 3300049570 | Ga0501033_0000270 | Ga0501033_0000270_10962_11990 | 300 |
| 999 | 3300049571 | Ga0501034_0000715 | Ga0501034_0000715_31244_32272 | 300 |
| 1000 | 3300049572 | Ga0501036_0000043 | Ga0501036_0000043_24661_25689 | 300 |
| 1001 | 3300049573 | Ga0501037_0000040 | Ga0501037_0000040_105192_106220 | 300 |
| 1002 | 3300049574 | Ga0501038_0000131 | Ga0501038_0000131_17692_18720 | 300 |
| 1003 | 3300049575 | Ga0501039_0000106 | Ga0501039_0000106_20871_21899 | 300 |
| 1004 | 3300049579 | Ga0501043_0000074 | Ga0501043_0000074_29570_30598 | 300 |
| 1005 | 3300049580 | Ga0501046_0000074 | Ga0501046_0000074_58495_59523 | 300 |
| 1006 | 3300049581 | Ga0501047_0000346 | Ga0501047_0000346_49749_50777 | 300 |
| 1007 | 3300049582 | Ga0501048_0000738 | Ga0501048_0000738_17702_18730 | 300 |
| 1008 | 3300049583 | Ga0501067_0000645 | Ga0501067_0000645_17681_18709 | 300 |
| 1009 | 3300049584 | Ga0501068_0000636 | Ga0501068_0000636_7711_8739 | 300 |
| 1010 | 3300049585 | Ga0501069_0006727 | Ga0501069_0006727_3003_4031 | 300 |
| 1011 | 3300049586 | Ga0501070_0007488 | Ga0501070_0007488_4976_6004 | 300 |
| 1012 | 3300049587 | Ga0501071_0074874 | Ga0501071_0074874_622_1650 | 300 |
| 1013 | 3300049588 | Ga0501072_0110265 | Ga0501072_0110265_461_1489 | 300 |
| 1014 | 3300049589 | Ga0501073_0000085 | Ga0501073_0000085_53882_54910 | 300 |
| 1015 | 3300049590 | Ga0501074_0000657 | Ga0501074_0000657_5283_6311 | 300 |
| 1016 | 3300049592 | Ga0501076_0038635 | Ga0501076_0038635_37_1065 | 300 |
| 1017 | 3300049741 | Ga0501079_0000650 | Ga0501079_0000650_9852_10880 | 300 |
| 1018 | 3300049742 | Ga0501080_0001325 | Ga0501080_0001325_6608_7636 | 300 |
| 1019 | 3300049744 | Ga0501083_0001866 | Ga0501083_0001866_40_1068 | 300 |
| 1020 | 3300049822 | Ga0501035_0004398 | Ga0501035_0004398_5740_6768 | 300 |
| 1021 | 3300049823 | Ga0501044_0000667 | Ga0501044_0000667_22753_23781 | 300 |
| 1022 | 3300049823 | Ga0501044_0011942 | Ga0501044_0011942_1667_2695 | 300 |
| 1023 | 3300049824 | Ga0501045_0009850 | Ga0501045_0009850_19_1047 | 300 |
| 1024 | 3300053077 | Ga0495601_0003892 | Ga0495601_0003892_1478_2506 | 300 |
| 1025 | 3300053083 | Ga0495655_0001097 | Ga0495655_0001097_2169_3197 | 300 |
| 1026 | 3300053085 | Ga0495619_0048714 | Ga0495619_0048714_127_1155 | 300 |
| 1027 | 3300053094 | Ga0500566_0004598 | Ga0500566_0004598_2610_3638 | 300 |
| 1028 | 3300054114 | Ga0501084_0049539 | Ga0501084_0049539_95_1123 | 300 |
| 1029 | 3300060353 | Ga0501082_0003198 | Ga0501082_0003198_1532_2560 | 300 |
| 1030 | 3300061734 | Ga0530510_0017122 | Ga0530510_0017122_3264_4292 | 300 |
| 1031 | 3300061734 | Ga0530510_0194452 | Ga0530510_0194452_211_1239 | 300 |
| 1032 | 3300001990 | JGI24737J22298_10004327 | JGI24737J22298_100043271 | 301 |
| 1033 | 3300005335 | Ga0070666_10101212 | Ga0070666_101012122 | 301 |
| 1034 | 3300005364 | Ga0070673_100329786 | Ga0070673_1003297861 | 301 |
| 1035 | 3300005366 | Ga0070659_100042178 | Ga0070659_1000421782 | 301 |
| 1036 | 3300005577 | Ga0068857_100000859 | Ga0068857_10000085917 | 301 |
| 1037 | 3300005578 | Ga0068854_100003411 | Ga0068854_1000034113 | 301 |
| 1038 | 3300005614 | Ga0068856_100015301 | Ga0068856_1000153013 | 301 |
| 1039 | 3300005614 | Ga0068856_100019878 | Ga0068856_1000198784 | 301 |
| 1040 | 3300005616 | Ga0068852_100022339 | Ga0068852_1000223395 | 301 |
| 1041 | 3300005983 | Ga0081540_1006385 | Ga0081540_10063856 | 301 |
| 1042 | 3300006358 | Ga0068871_100270403 | Ga0068871_1002704032 | 301 |
| 1043 | 3300009093 | Ga0105240_10009798 | Ga0105240_100097988 | 301 |
| 1044 | 3300009177 | Ga0105248_10060964 | Ga0105248_100609642 | 301 |
| 1045 | 3300009545 | Ga0105237_10049801 | Ga0105237_100498012 | 301 |
| 1046 | 3300009551 | Ga0105238_10005746 | Ga0105238_100057467 | 301 |
| 1047 | 3300010375 | Ga0105239_10005471 | Ga0105239_100054718 | 301 |
| 1048 | 3300013308 | Ga0157375_10292638 | Ga0157375_102926382 | 301 |
| 1049 | 3300025904 | Ga0207647_10000591 | Ga0207647_1000059114 | 301 |
| 1050 | 3300025913 | Ga0207695_10072126 | Ga0207695_100721262 | 301 |
| 1051 | 3300025914 | Ga0207671_10193658 | Ga0207671_101936582 | 301 |
| 1052 | 3300025941 | Ga0207711_10164895 | Ga0207711_101648952 | 301 |
| 1053 | 3300025949 | Ga0207667_10008981 | Ga0207667_100089818 | 301 |
| 1054 | 3300025981 | Ga0207640_10007336 | Ga0207640_100073363 | 301 |
| 1055 | 3300026041 | Ga0207639_10392588 | Ga0207639_103925881 | 301 |
| 1056 | 3300026078 | Ga0207702_10166763 | Ga0207702_101667632 | 301 |
| 1057 | 3300026116 | Ga0207674_10002888 | Ga0207674_1000288814 | 301 |
| 1058 | 3300026121 | Ga0207683_10192748 | Ga0207683_101927482 | 301 |
| 1059 | 3300026142 | Ga0207698_10042376 | Ga0207698_100423763 | 301 |
| 1060 | 3300031238 | Ga0265332_10076693 | Ga0265332_100766932 | 301 |
| 1061 | 3300031249 | Ga0265339_10007837 | Ga0265339_100078377 | 301 |
| 1062 | 3300031730 | Ga0307516_10161782 | Ga0307516_101617822 | 301 |
| 1063 | 3300033180 | Ga0307510_10006633 | Ga0307510_1000663313 | 301 |
| 1064 | 3300037466 | Ga0395898_0204915 | Ga0395898_0204915_746_1774 | 301 |
| 1065 | 3300046455 | Ga0495603_0001784 | Ga0495603_0001784_3950_4981 | 301 |
| 1066 | 3300048912 | Ga0496109_0137218 | Ga0496109_0137218_821_1852 | 301 |
| 1067 | 3300048928 | Ga0496125_0000176 | Ga0496125_0000176_86567_87598 | 301 |
| 1068 | 3300048929 | Ga0496126_0059157 | Ga0496126_0059157_2318_3352 | 301 |
| 1069 | 3300049568 | Ga0501031_0006248 | Ga0501031_0006248_2900_3928 | 301 |
| 1070 | 3300049569 | Ga0501032_0012685 | Ga0501032_0012685_1703_2731 | 301 |
| 1071 | 3300049570 | Ga0501033_0017776 | Ga0501033_0017776_3123_4151 | 301 |
| 1072 | 3300049571 | Ga0501034_0023530 | Ga0501034_0023530_1968_2996 | 301 |
| 1073 | 3300049571 | Ga0501034_0102758 | Ga0501034_0102758_1173_2201 | 301 |
| 1074 | 3300049572 | Ga0501036_0097328 | Ga0501036_0097328_756_1784 | 301 |
| 1075 | 3300049573 | Ga0501037_0002011 | Ga0501037_0002011_11997_13025 | 301 |
| 1076 | 3300049573 | Ga0501037_0068986 | Ga0501037_0068986_584_1612 | 301 |
| 1077 | 3300049574 | Ga0501038_0010843 | Ga0501038_0010843_7281_8309 | 301 |
| 1078 | 3300049575 | Ga0501039_0019509 | Ga0501039_0019509_1219_2247 | 301 |
| 1079 | 3300049578 | Ga0501042_0032863 | Ga0501042_0032863_2090_3118 | 301 |
| 1080 | 3300049579 | Ga0501043_0009090 | Ga0501043_0009090_2947_3975 | 301 |
| 1081 | 3300049579 | Ga0501043_0035464 | Ga0501043_0035464_193_1221 | 301 |
| 1082 | 3300049580 | Ga0501046_0011149 | Ga0501046_0011149_3549_4577 | 301 |
| 1083 | 3300049581 | Ga0501047_0025749 | Ga0501047_0025749_4329_5357 | 301 |
| 1084 | 3300049582 | Ga0501048_0020601 | Ga0501048_0020601_1470_2498 | 301 |
| 1085 | 3300049583 | Ga0501067_0003296 | Ga0501067_0003296_3548_4576 | 301 |
| 1086 | 3300049583 | Ga0501067_0141313 | Ga0501067_0141313_290_1318 | 301 |
| 1087 | 3300049584 | Ga0501068_0006803 | Ga0501068_0006803_4293_5321 | 301 |
| 1088 | 3300049585 | Ga0501069_0006380 | Ga0501069_0006380_4132_5160 | 301 |
| 1089 | 3300049586 | Ga0501070_0009852 | Ga0501070_0009852_5350_6378 | 301 |
| 1090 | 3300049588 | Ga0501072_0182810 | Ga0501072_0182810_300_1328 | 301 |
| 1091 | 3300049589 | Ga0501073_0038050 | Ga0501073_0038050_727_1755 | 301 |
| 1092 | 3300049590 | Ga0501074_0010242 | Ga0501074_0010242_4306_5334 | 301 |
| 1093 | 3300049592 | Ga0501076_0086099 | Ga0501076_0086099_1102_2130 | 301 |
| 1094 | 3300049741 | Ga0501079_0014485 | Ga0501079_0014485_4319_5347 | 301 |
| 1095 | 3300049822 | Ga0501035_0028448 | Ga0501035_0028448_2900_3928 | 301 |
| 1096 | 3300049822 | Ga0501035_0035155 | Ga0501035_0035155_50_1078 | 301 |
| 1097 | 3300049823 | Ga0501044_0008909 | Ga0501044_0008909_3674_4702 | 301 |
| 1098 | 3300049824 | Ga0501045_0005537 | Ga0501045_0005537_7030_8058 | 301 |
| 1099 | 3300053085 | Ga0495619_0135228 | Ga0495619_0135228_202_1233 | 301 |
| 1100 | 3300053102 | Ga0500554_007410 | Ga0500554_007410_311_1342 | 301 |
| 1101 | 3300053153 | Ga0500616_0000046 | Ga0500616_0000046_266337_267365 | 301 |
| 1102 | 3300053178 | Ga0500637_0013087 | Ga0500637_0013087_2361_3392 | 301 |
| 1103 | 3300054114 | Ga0501084_0014168 | Ga0501084_0014168_4633_5661 | 301 |
| 1104 | 3300060353 | Ga0501082_0012246 | Ga0501082_0012246_3029_4057 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ikj-assembly1.cif.gz_B | crystal structure of yfib(f48s) | 0.8763 | 178 | 296 |
| 3cyp-assembly3.cif.gz_B | the crystal structure of the c-terminal domain of helicobacter pylori motb (residues 125-256). | 0.871 | 185 | 301 |
| 5wtp-assembly2.cif.gz_B | crystal structure of the c-terminal domain of outer membrane protein a (ompa) from capnocytophaga gingivalis | 0.8692 | 182 | 299 |
| 5wtl-assembly4.cif.gz_D | crystal structure of the periplasmic portion of outer membrane protein a (ompa) from capnocytophaga gingivalis | 0.864 | 182 | 300 |
| 3imp-assembly5.cif.gz_I | new crystal form of the c-terminal domain of helicobacter pylori motb (residues 125-256) | 0.8631 | 185 | 301 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3cypB00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.871 | 185 | 301 | 3.30.1330.60 |
| 5wtpB00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.8692 | 182 | 299 | 3.30.1330.60 |
| 5n2cC00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.8587 | 185 | 299 | 3.30.1330.60 |
| 4zhwA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.8416 | 185 | 296 | 3.30.1330.60 |
| 3s0wA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.8399 | 172 | 300 | 3.30.1330.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I1JB18-F1-model_v4 | OmpA-like domain-containing protein | 0.983 | 149 | 301 |
GO:0016020
|
| AF-A0A846SZH6-F1-model_v4 | OmpA family protein | 0.981 | 126 | 301 |
GO:0016020
|
| AF-A0A3C1NID4-F1-model_v4 | Peptidoglycan-binding protein | 0.9739 | 185 | 269 |
GO:0016020
|
| AF-A0A439KLY8-F1-model_v4 | Peptidoglycan-binding protein | 0.9734 | 173 | 301 |
GO:0016020
|
| AF-A0A6I1JB18-F1-model_v4 | OmpA-like domain-containing protein | 0.9705 | 149 | 301 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar