F490117

General Info

Members Datasets Scaffolds Average Seq Length
1104 459 1072 300

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10004221|JGI25404J52841_100042212
Length 343
Sequence MALARGRRDRGIDYWPGFVDALSTLILGIIFLLTVFVVVQFFLSQEVAGKDTALSRLNAQIQQLTDLLSLEKTGKTTLEEQIAQLRANLSAAEGERDRLRGQVTAPGGLDAGAAQGRINDLSTTLTEERKISARALAQVEVLNQQXAALRRQLSALXAALDVSEKXDKESQTRIADLGQRLNVALAQRVQELSRYRSDFFGRLREILGNRPDIRVVGDRFVFQSEVFFDSGSAVVRPEGRIELDKLAAALLELDKSIPTEIAWVLRIDGHTDVRPITTSLQYKSNWELSSARAISVVQYLIAKGVSPQRLVAAGFGEFQPLDPDRTEEAFRRNRRIELKLTER

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
7 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
8 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
9 2643221733 Bosea sp. Root381 Isolate Unclassified
10 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
11 2773857925 Microvirga vignae BR3299 Isolate Unclassified
12 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
13 2791355199
14 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
15 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
16 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
17 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
18 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
19 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
20 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
21 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
22 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
23 2902330777 Methylobacterium sp. 2A Isolate Unclassified
24 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
25 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
26 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
27 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
28 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
29 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
30 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
33 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
34 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
35 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
65 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
66 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
67 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
68 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
69 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
70 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
71 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
109 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
116 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
117 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
118 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
119 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
120 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
121 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
127 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
128 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
129 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
137 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
153 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
158 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
159 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
160 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
161 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
162 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
166 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
167 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
168 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
171 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
172 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
173 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
174 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
175 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
236 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
238 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
239 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
246 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
247 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
248 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
249 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
250 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
251 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
252 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
253 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
254 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
255 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
256 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
257 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
258 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
259 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
260 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
261 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
262 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
263 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
266 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
269 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
270 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
271 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
272 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
273 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
275 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
276 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
277 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
281 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
282 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
283 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
284 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
285 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
286 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
287 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
288 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
289 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
290 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
291 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
292 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
293 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
294 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
295 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
296 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
297 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
298 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
299 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
301 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
302 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
303 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
304 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
305 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
306 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
307 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
308 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
309 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
310 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
311 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
312 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
313 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
314 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
315 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
316 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
317 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
318 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
323 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
324 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
327 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
328 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
329 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
330 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
331 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
332 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
333 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
334 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
335 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
336 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
339 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
340 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
341 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
342 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
343 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
344 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
347 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
348 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
356 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
357 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
358 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
359 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
360 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
361 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
362 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
363 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
364 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
365 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
374 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
375 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
376 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
377 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
381 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
382 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
383 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
384 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
385 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
386 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
402 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
403 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
404 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
405 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
406 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
407 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
408 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
409 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
410 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
411 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
412 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
413 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
414 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
415 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
416 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
419 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
420 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
423 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
424 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
425 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
426 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
427 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
428 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
429 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
430 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
431 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
432 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
433 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
434 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
435 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
436 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
437 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
438 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
439 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
440 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
441 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
442 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
443 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
444 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
445 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
446 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
447 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
448 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
449 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
450 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
451 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
452 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
453 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
454 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
455 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
456 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
457 641522639 Methylobacterium sp. 4-46 Isolate Nodule
458 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
459 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 0.09
Isolates 2.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.26
Nodule 1.81
Rhizoplane 7.88
Rhizosphere 81.43
Stem 0
Stem Tuber 0
Unclassified 4.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10004327 3300001990 Bacteria 4956
2 JGI24737J22298_10007387 3300001990 Bacteria 3713
3 JGI24735J21928_10037568 3300002067 Bacteria 1419
4 JGI24749J21850_1001685 3300002076 Bacteria 3133
5 JGI24744J21845_10017503 3300002077 Bacteria 1424
6 JGI24742J22300_10011595 3300002244 Bacteria 1465
7 JGI24751J29686_10005136 3300002459 Bacteria 2662
8 JGI25153J46596_10007775 3300003215 Bacteria 5212
9 JGI25404J52841_10004221 3300003659 Bacteria 2894
10 Ga0058692_1004883 3300003856 Bacteria 3899
11 Ga0070658_10002492 3300005327 Bacteria 15376
12 Ga0070658_10127049 3300005327 Bacteria 2123
13 Ga0070676_10000987 3300005328 Bacteria 14130
14 Ga0070683_100021229 3300005329 Bacteria 5792
15 Ga0070683_100410740 3300005329 Bacteria 1291
16 Ga0070690_100000506 3300005330 Bacteria 19537
17 Ga0070670_100001094 3300005331 Bacteria 21528
18 Ga0068869_100037466 3300005334 Bacteria 3448
19 Ga0068869_100093831 3300005334 Bacteria 2261
20 Ga0070666_10002984 3300005335 Bacteria 10257
21 Ga0070666_10058040 3300005335 Bacteria 2616
22 Ga0070666_10101212 3300005335 Bacteria 1986
23 Ga0070680_100014072 3300005336 Bacteria 6247
24 Ga0070680_100027539 3300005336 Bacteria 4551
25 Ga0070680_100041348 3300005336 Bacteria 3738
26 Ga0070680_100129620 3300005336 Bacteria 2109
27 Ga0070682_100004821 3300005337 Bacteria 7489
28 Ga0070682_100010302 3300005337 Bacteria 5305
29 Ga0068868_100000904 3300005338 Bacteria 20173
30 Ga0070660_100001178 3300005339 Bacteria 17696
31 Ga0070660_100003958 3300005339 Bacteria 10234
32 Ga0070660_100003975 3300005339 Bacteria 10218
33 Ga0070660_100017321 3300005339 Bacteria 5250
34 Ga0070660_100051545 3300005339 Bacteria 3170
35 Ga0070660_100087257 3300005339 Bacteria 2456
36 Ga0070689_100002505 3300005340 Bacteria 12016
37 Ga0070689_100004127 3300005340 Bacteria 9782
38 Ga0070691_10000155 3300005341 Bacteria 22187
39 Ga0070687_100001299 3300005343 Bacteria 8717
40 Ga0070687_100098019 3300005343 Bacteria 1636
41 Ga0070661_100001464 3300005344 Bacteria 16401
42 Ga0070692_10000912 3300005345 Bacteria 10006
43 Ga0070668_100000692 3300005347 Bacteria 22968
44 Ga0070668_100025445 3300005347 Bacteria 4487
45 Ga0070669_100000807 3300005353 Bacteria 22765
46 Ga0070675_100001608 3300005354 Bacteria 16654
47 Ga0070675_100431566 3300005354 Bacteria 1179
48 Ga0070671_100001121 3300005355 Bacteria 19883
49 Ga0070671_100072200 3300005355 Bacteria 2882
50 Ga0070674_100001386 3300005356 Bacteria 12805
51 Ga0070674_100054253 3300005356 Bacteria 2771
52 Ga0070674_100072160 3300005356 Bacteria 2444
53 Ga0070673_100000626 3300005364 Bacteria 19353
54 Ga0070673_100037774 3300005364 Bacteria 3682
55 Ga0070673_100329786 3300005364 Bacteria 1350
56 Ga0070688_100000139 3300005365 Bacteria 39353
57 Ga0070688_100009945 3300005365 Bacteria 5226
58 Ga0070659_100042178 3300005366 Bacteria 3567
59 Ga0070659_100330878 3300005366 Bacteria 1275
60 Ga0070667_100005155 3300005367 Bacteria 10931
61 Ga0070667_100016467 3300005367 Bacteria 6118
62 Ga0070667_100023204 3300005367 Bacteria 5147
63 Ga0070703_10035502 3300005406 Bacteria 1527
64 Ga0070709_10001924 3300005434 Bacteria 11284
65 Ga0070709_10003157 3300005434 Bacteria 8838
66 Ga0070709_10101995 3300005434 Bacteria 1913
67 Ga0070714_100002022 3300005435 Bacteria 14858
68 Ga0070714_100002527 3300005435 Bacteria 13488
69 Ga0070714_100042896 3300005435 Bacteria 3823
70 Ga0070714_100245359 3300005435 Bacteria 1654
71 Ga0070714_100446665 3300005435 Bacteria 1228
72 Ga0070713_100007833 3300005436 Bacteria 7531
73 Ga0070713_100012977 3300005436 Bacteria 6135
74 Ga0070713_100234538 3300005436 Bacteria 1669
75 Ga0070713_100347326 3300005436 Bacteria 1376
76 Ga0070710_10013755 3300005437 Bacteria 4060
77 Ga0070710_10053330 3300005437 Bacteria 2277
78 Ga0070701_10001747 3300005438 Bacteria 8179
79 Ga0070711_100002491 3300005439 Bacteria 10512
80 Ga0070711_100003965 3300005439 Bacteria 8698
81 Ga0070711_100053341 3300005439 Bacteria 2786
82 Ga0070711_100059511 3300005439 Bacteria 2652
83 Ga0070711_100131646 3300005439 Bacteria 1863
84 Ga0070711_100151895 3300005439 Bacteria 1747
85 Ga0070711_100196848 3300005439 Bacteria 1552
86 Ga0070705_100000298 3300005440 Bacteria 29561
87 Ga0070700_100000648 3300005441 Bacteria 17205
88 Ga0070700_100069729 3300005441 Bacteria 2239
89 Ga0070700_100198047 3300005441 Bacteria 1409
90 Ga0070700_100200866 3300005441 Bacteria 1400
91 Ga0070694_100004154 3300005444 Bacteria 8699
92 Ga0070694_100127321 3300005444 Bacteria 1835
93 Ga0070678_100000734 3300005456 Bacteria 16335
94 Ga0070678_100046092 3300005456 Bacteria 3123
95 Ga0070678_100057176 3300005456 Bacteria 2856
96 Ga0070662_100001979 3300005457 Bacteria 12572
97 Ga0070662_100044231 3300005457 Bacteria 3189
98 Ga0070662_100092216 3300005457 Bacteria 2276
99 Ga0070681_10006054 3300005458 Bacteria 11729
100 Ga0070681_10054547 3300005458 Bacteria 3983
101 Ga0070681_10061808 3300005458 Bacteria 3719
102 Ga0070681_10074337 3300005458 Bacteria 3360
103 Ga0070681_10096980 3300005458 Bacteria 2896
104 Ga0068867_100012592 3300005459 Bacteria 5982
105 Ga0068867_100047834 3300005459 Bacteria 3145
106 Ga0068867_100048863 3300005459 Bacteria 3113
107 Ga0070685_10002499 3300005466 Bacteria 9438
108 Ga0070698_100044278 3300005471 Bacteria 4559
109 Ga0070699_100007777 3300005518 Bacteria 9318
110 Ga0070679_100020169 3300005530 Bacteria 6496
111 Ga0070679_100036159 3300005530 Bacteria 4900
112 Ga0070679_100128056 3300005530 Bacteria 2520
113 Ga0070679_100383868 3300005530 Bacteria 1351
114 Ga0070684_100017742 3300005535 Bacteria 5849
115 Ga0070684_100108252 3300005535 Bacteria 2490
116 Ga0070684_100110930 3300005535 Bacteria 2460
117 Ga0070697_100023341 3300005536 Bacteria 4918
118 Ga0068853_100005313 3300005539 Bacteria 10082
119 Ga0068853_100013838 3300005539 Bacteria 6595
120 Ga0070672_100001796 3300005543 Bacteria 13421
121 Ga0070686_100000266 3300005544 Bacteria 35675
122 Ga0070686_100056466 3300005544 Bacteria 2518
123 Ga0070686_100127351 3300005544 Bacteria 1756
124 Ga0070695_100000864 3300005545 Bacteria 16329
125 Ga0070695_100012251 3300005545 Bacteria 5142
126 Ga0070696_100023586 3300005546 Bacteria 4181
127 Ga0070693_100000326 3300005547 Bacteria 21830
128 Ga0070693_100003813 3300005547 Bacteria 7061
129 Ga0070665_100019274 3300005548 Bacteria 6845
130 Ga0070665_100298903 3300005548 Bacteria 1612
131 Ga0070704_100003256 3300005549 Bacteria 9278
132 Ga0068855_100007108 3300005563 Bacteria 13578
133 Ga0068855_100036393 3300005563 Bacteria 5859
134 Ga0068855_100056948 3300005563 Bacteria 4583
135 Ga0068855_100382090 3300005563 Bacteria 1546
136 Ga0068855_100407744 3300005563 Bacteria 1488
137 Ga0070664_100169224 3300005564 Bacteria 1938
138 Ga0068857_100000859 3300005577 Bacteria 22784
139 Ga0068857_100007649 3300005577 Bacteria 9304
140 Ga0068857_100089166 3300005577 Bacteria 2759
141 Ga0068857_100130927 3300005577 Bacteria 2262
142 Ga0068857_100236645 3300005577 Bacteria 1671
143 Ga0068854_100000885 3300005578 Bacteria 18009
144 Ga0068854_100003411 3300005578 Bacteria 9905
145 Ga0068854_100246938 3300005578 Bacteria 1423
146 Ga0068854_100331493 3300005578 Bacteria 1240
147 Ga0068856_100002298 3300005614 Bacteria 19709
148 Ga0068856_100015301 3300005614 Bacteria 7414
149 Ga0068856_100019878 3300005614 Bacteria 6519
150 Ga0068856_100038892 3300005614 Bacteria 4670
151 Ga0068856_100321961 3300005614 Bacteria 1563
152 Ga0070702_100000139 3300005615 Bacteria 22443
153 Ga0068852_100001969 3300005616 Bacteria 13992
154 Ga0068852_100022339 3300005616 Bacteria 5073
155 Ga0068859_100009674 3300005617 Bacteria 9732
156 Ga0068859_100501024 3300005617 Bacteria 1309
157 Ga0068864_100011694 3300005618 Bacteria 7248
158 Ga0068866_10006115 3300005718 Bacteria 5009
159 Ga0068861_100002618 3300005719 Bacteria 11760
160 Ga0068870_10070882 3300005840 Bacteria 1901
161 Ga0068863_100000834 3300005841 Bacteria 30888
162 Ga0068863_100258227 3300005841 Bacteria 1684
163 Ga0068858_100001979 3300005842 Bacteria 20923
164 Ga0068858_100264509 3300005842 Bacteria 1635
165 Ga0068860_100002133 3300005843 Bacteria 20873
166 Ga0068860_100153885 3300005843 Bacteria 2216
167 Ga0068860_100163311 3300005843 Bacteria 2148
168 Ga0068860_100312705 3300005843 Bacteria 1540
169 Ga0068862_100006042 3300005844 Bacteria 10081
170 Ga0068862_100197885 3300005844 Bacteria 1811
171 Ga0081455_10000031 3300005937 Bacteria 146486
172 Ga0081455_10003325 3300005937 Bacteria 18556
173 Ga0081538_10013324 3300005981 Bacteria 6516
174 Ga0081540_1000054 3300005983 Bacteria 122877
175 Ga0081540_1006385 3300005983 Bacteria 8595
176 Ga0081540_1007455 3300005983 Bacteria 7790
177 Ga0081540_1097568 3300005983 Bacteria 1275
178 Ga0070717_10004121 3300006028 Bacteria 10478
179 Ga0075365_10028242 3300006038 Bacteria 3577
180 Ga0075365_10083293 3300006038 Bacteria 2169
181 Ga0075363_100001280 3300006048 Bacteria 9353
182 Ga0075364_10056584 3300006051 Bacteria 2568
183 Ga0075364_10079571 3300006051 Bacteria 2166
184 Ga0075364_10153432 3300006051 Bacteria 1553
185 Ga0075364_10210508 3300006051 Bacteria 1318
186 Ga0070715_10003350 3300006163 Bacteria 5079
187 Ga0070715_10004973 3300006163 Bacteria 4404
188 Ga0070716_100000665 3300006173 Bacteria 14606
189 Ga0070716_100017392 3300006173 Bacteria 3727
190 Ga0070712_100000828 3300006175 Bacteria 18403
191 Ga0070712_100013772 3300006175 Bacteria 5173
192 Ga0070712_100048016 3300006175 Bacteria 2957
193 Ga0070712_100160370 3300006175 Bacteria 1736
194 Ga0070712_100326985 3300006175 Bacteria 1248
195 Ga0075362_10109335 3300006177 Bacteria 1300
196 Ga0075367_10011766 3300006178 Bacteria 4644
197 Ga0075367_10170213 3300006178 Bacteria 1357
198 Ga0075369_10040039 3300006186 Bacteria 2002
199 Ga0075366_10000720 3300006195 Bacteria 15704
200 Ga0075366_10104284 3300006195 Bacteria 1703
201 Ga0097621_100029902 3300006237 Bacteria 4306
202 Ga0097621_100267583 3300006237 Bacteria 1501
203 Ga0075370_10053644 3300006353 Bacteria 2288
204 Ga0068871_100020391 3300006358 Bacteria 5077
205 Ga0068871_100104909 3300006358 Bacteria 2371
206 Ga0068871_100134484 3300006358 Bacteria 2099
207 Ga0068871_100270403 3300006358 Bacteria 1485
208 Ga0075428_100007488 3300006844 Bacteria 12097
209 Ga0075428_100011583 3300006844 Bacteria 9812
210 Ga0075428_100079977 3300006844 Bacteria 3567
211 Ga0075430_100000194 3300006846 Bacteria 41024
212 Ga0075430_100010104 3300006846 Bacteria 7987
213 Ga0075431_100001907 3300006847 Bacteria 19804
214 Ga0075433_10054818 3300006852 Bacteria 3479
215 Ga0075433_10272174 3300006852 Bacteria 1501
216 Ga0075434_100027681 3300006871 Bacteria 5565
217 Ga0075434_100038910 3300006871 Bacteria 4712
218 Ga0075434_100244944 3300006871 Bacteria 1812
219 Ga0075429_100007710 3300006880 Bacteria 9344
220 Ga0068865_100010883 3300006881 Bacteria 5675
221 Ga0068865_100192614 3300006881 Bacteria 1578
222 Ga0075436_100013964 3300006914 Bacteria 5494
223 Ga0075436_100028674 3300006914 Bacteria 3829
224 Ga0075436_100046607 3300006914 Bacteria 2989
225 Ga0097620_100009674 3300006931 Bacteria 9732
226 Ga0097620_100501017 3300006931 Bacteria 1309
227 Ga0099824_1021728 3300006942 Bacteria 4402
228 Ga0075435_100044461 3300007076 Bacteria 3557
229 Ga0099794_10007029 3300007265 Bacteria 4595
230 Ga0099794_10076104 3300007265 Bacteria 1650
231 Ga0099795_10003412 3300007788 Bacteria 3928
232 Ga0105240_10009798 3300009093 Bacteria 13523
233 Ga0105240_10046855 3300009093 Bacteria 5474
234 Ga0105240_10075491 3300009093 Bacteria 4158
235 Ga0105240_10222481 3300009093 Bacteria 2198
236 Ga0111539_10000178 3300009094 Bacteria 73928
237 Ga0111539_10015064 3300009094 Bacteria 9636
238 Ga0111539_10097907 3300009094 Bacteria 3446
239 Ga0111539_10135829 3300009094 Bacteria 2880
240 Ga0111539_10454921 3300009094 Bacteria 1491
241 Ga0111539_10802949 3300009094 Bacteria 1095
242 Ga0105245_10000795 3300009098 Bacteria 28669
243 Ga0105245_10062246 3300009098 Bacteria 3367
244 Ga0105245_10131908 3300009098 Bacteria 2344
245 Ga0105245_10427741 3300009098 Bacteria 1328
246 Ga0105247_10002881 3300009101 Bacteria 11450
247 Ga0105247_10057895 3300009101 Bacteria 2396
248 Ga0114129_10001129 3300009147 Bacteria 35251
249 Ga0114129_10001774 3300009147 Bacteria 29378
250 Ga0114129_10167848 3300009147 Bacteria 2994
251 Ga0114129_10197519 3300009147 Bacteria 2727
252 Ga0114129_10536806 3300009147 Bacteria 1523
253 Ga0105243_10001724 3300009148 Bacteria 18831
254 Ga0105241_10003139 3300009174 Bacteria 12289
255 Ga0105242_10084848 3300009176 Bacteria 2655
256 Ga0105242_10272776 3300009176 Bacteria 1533
257 Ga0105248_10004961 3300009177 Bacteria 14704
258 Ga0105248_10018306 3300009177 Bacteria 7735
259 Ga0105248_10060964 3300009177 Bacteria 4235
260 Ga0105248_10157262 3300009177 Bacteria 2564
261 Ga0105248_10331904 3300009177 Bacteria 1713
262 Ga0105237_10002479 3300009545 Bacteria 22904
263 Ga0105237_10011410 3300009545 Bacteria 9400
264 Ga0105237_10049801 3300009545 Bacteria 4209
265 Ga0105238_10005746 3300009551 Bacteria 12270
266 Ga0105238_10006964 3300009551 Bacteria 11296
267 Ga0105238_10065663 3300009551 Bacteria 3630
268 Ga0105238_10094208 3300009551 Bacteria 2982
269 Ga0105238_10098196 3300009551 Bacteria 2913
270 Ga0105238_10156278 3300009551 Bacteria 2256
271 Ga0105238_10195955 3300009551 Bacteria 1996
272 Ga0105238_10204562 3300009551 Bacteria 1950
273 Ga0105238_10291349 3300009551 Bacteria 1614
274 Ga0105249_10019431 3300009553 Bacteria 6062
275 Ga0105249_10120341 3300009553 Bacteria 2494
276 Ga0105249_10139501 3300009553 Bacteria 2323
277 Ga0099796_10002243 3300010159 Bacteria 4191
278 Ga0099796_10018620 3300010159 Bacteria 2089
279 Ga0105239_10005471 3300010375 Bacteria 14906
280 Ga0105239_10015919 3300010375 Bacteria 8324
281 Ga0105239_10066301 3300010375 Bacteria 3966
282 Ga0105239_10389279 3300010375 Bacteria 1577
283 Ga0105246_10039290 3300011119 Bacteria 3187
284 Ga0157313_1004702 3300012503 Bacteria 952
285 Ga0157373_10153886 3300013100 Bacteria 1618
286 Ga0157371_10013083 3300013102 Bacteria 6317
287 Ga0157371_10263354 3300013102 Bacteria 1243
288 Ga0157370_10096163 3300013104 Bacteria 2779
289 Ga0157370_10118189 3300013104 Bacteria 2476
290 Ga0157369_10006718 3300013105 Bacteria 13275
291 Ga0157369_10006851 3300013105 Bacteria 13147
292 Ga0157374_10249472 3300013296 Bacteria 1746
293 Ga0157378_10003370 3300013297 Bacteria 14208
294 Ga0163162_10018703 3300013306 Bacteria 6789
295 Ga0163162_10233532 3300013306 Bacteria 1970
296 Ga0163162_10351018 3300013306 Bacteria 1608
297 Ga0163162_10635719 3300013306 Bacteria 1192
298 Ga0163162_10709368 3300013306 Bacteria 1127
299 Ga0157372_10019119 3300013307 Bacteria 7375
300 Ga0157372_10455652 3300013307 Bacteria 1491
301 Ga0157375_10006188 3300013308 Bacteria 10430
302 Ga0157375_10041029 3300013308 Bacteria 4466
303 Ga0157375_10067850 3300013308 Bacteria 3565
304 Ga0157375_10292638 3300013308 Bacteria 1792
305 Ga0163163_10004045 3300014325 Bacteria 12506
306 Ga0163163_10057400 3300014325 Bacteria 3849
307 Ga0163163_10137209 3300014325 Bacteria 2487
308 Ga0163163_10294330 3300014325 Bacteria 1676
309 Ga0157380_10001853 3300014326 Bacteria 13986
310 Ga0157380_10074213 3300014326 Bacteria 2761
311 Ga0182008_10138261 3300014497 Bacteria 1217
312 Ga0157377_10005976 3300014745 Bacteria 5766
313 Ga0157379_10008173 3300014968 Bacteria 9086
314 Ga0157379_10071373 3300014968 Bacteria 3107
315 Ga0157376_10000272 3300014969 Bacteria 35217
316 Ga0163161_10002256 3300017792 Bacteria 13831
317 Ga0213872_10021080 3300021361 Bacteria 3001
318 Ga0213876_10001966 3300021384 Bacteria 12309
319 Ga0213876_10021619 3300021384 Bacteria 3403
320 Ga0213876_10040404 3300021384 Bacteria 2464
321 Ga0213876_10099823 3300021384 Bacteria 1539
322 Ga0213876_10103388 3300021384 Bacteria 1510
323 Ga0213876_10122080 3300021384 Bacteria 1383
324 Ga0213876_10187315 3300021384 Bacteria 1101
325 Ga0213875_10000009 3300021388 Bacteria 451129
326 Ga0228598_1000098 3300024227 Bacteria 14402
327 Ga0209233_1001411 3300025261 Bacteria 9473
328 Ga0209233_1003978 3300025261 Bacteria 5119
329 Ga0209455_1001210 3300025272 Bacteria 12324
330 Ga0209758_1000382 3300025297 Bacteria 76653
331 Ga0207656_10024264 3300025321 Bacteria 2451
332 Ga0207656_10030108 3300025321 Bacteria 2240
333 Ga0207653_10024206 3300025885 Bacteria 1938
334 Ga0207692_10009314 3300025898 Bacteria 4095
335 Ga0207692_10010467 3300025898 Bacteria 3910
336 Ga0207692_10013506 3300025898 Bacteria 3544
337 Ga0207710_10025216 3300025900 Bacteria 2565
338 Ga0207710_10051150 3300025900 Bacteria 1855
339 Ga0207688_10004336 3300025901 Bacteria 7732
340 Ga0207688_10027304 3300025901 Bacteria 3141
341 Ga0207688_10096332 3300025901 Bacteria 1704
342 Ga0207688_10135993 3300025901 Bacteria 1443
343 Ga0207680_10046663 3300025903 Bacteria 2562
344 Ga0207647_10000591 3300025904 Bacteria 28212
345 Ga0207647_10009490 3300025904 Bacteria 6910
346 Ga0207699_10001015 3300025906 Bacteria 13296
347 Ga0207699_10011571 3300025906 Bacteria 4462
348 Ga0207645_10003182 3300025907 Bacteria 12568
349 Ga0207645_10214618 3300025907 Bacteria 1268
350 Ga0207643_10044356 3300025908 Bacteria 2510
351 Ga0207705_10031045 3300025909 Bacteria 3813
352 Ga0207705_10074333 3300025909 Bacteria 2467
353 Ga0207654_10002679 3300025911 Bacteria 9043
354 Ga0207707_10016749 3300025912 Bacteria 6386
355 Ga0207707_10160242 3300025912 Bacteria 1967
356 Ga0207707_10317586 3300025912 Bacteria 1345
357 Ga0207695_10072126 3300025913 Bacteria 3525
358 Ga0207695_10115370 3300025913 Bacteria 2660
359 Ga0207695_10146479 3300025913 Bacteria 2305
360 Ga0207671_10039935 3300025914 Bacteria 3475
361 Ga0207671_10056119 3300025914 Bacteria 2918
362 Ga0207671_10193658 3300025914 Bacteria 1586
363 Ga0207693_10000607 3300025915 Bacteria 32076
364 Ga0207693_10004165 3300025915 Bacteria 12271
365 Ga0207693_10007266 3300025915 Bacteria 9112
366 Ga0207693_10008135 3300025915 Bacteria 8594
367 Ga0207693_10012377 3300025915 Bacteria 6891
368 Ga0207693_10047797 3300025915 Bacteria 3361
369 Ga0207693_10057393 3300025915 Bacteria 3051
370 Ga0207663_10014213 3300025916 Bacteria 4351
371 Ga0207663_10027847 3300025916 Bacteria 3299
372 Ga0207660_10004044 3300025917 Bacteria 9568
373 Ga0207660_10043311 3300025917 Bacteria 3163
374 Ga0207660_10064354 3300025917 Bacteria 2647
375 Ga0207662_10005337 3300025918 Bacteria 6840
376 Ga0207662_10027516 3300025918 Bacteria 3281
377 Ga0207662_10051140 3300025918 Bacteria 2458
378 Ga0207657_10000086 3300025919 Bacteria 88712
379 Ga0207657_10005450 3300025919 Bacteria 13282
380 Ga0207657_10053517 3300025919 Bacteria 3496
381 Ga0207657_10079892 3300025919 Bacteria 2751
382 Ga0207652_10014040 3300025921 Bacteria 6484
383 Ga0207652_10024214 3300025921 Bacteria 5035
384 Ga0207652_10070440 3300025921 Bacteria 3037
385 Ga0207652_10094842 3300025921 Bacteria 2628
386 Ga0207652_10137287 3300025921 Bacteria 2184
387 Ga0207681_10007570 3300025923 Bacteria 6653
388 Ga0207681_10027077 3300025923 Bacteria 3704
389 Ga0207694_10009826 3300025924 Bacteria 7225
390 Ga0207694_10084241 3300025924 Bacteria 2501
391 Ga0207694_10245681 3300025924 Bacteria 1463
392 Ga0207650_10207475 3300025925 Bacteria 1572
393 Ga0207659_10008710 3300025926 Bacteria 6315
394 Ga0207687_10003118 3300025927 Bacteria 11238
395 Ga0207700_10012952 3300025928 Bacteria 5402
396 Ga0207700_10041040 3300025928 Bacteria 3382
397 Ga0207700_10249176 3300025928 Bacteria 1517
398 Ga0207664_10011218 3300025929 Bacteria 6354
399 Ga0207664_10100910 3300025929 Bacteria 2384
400 Ga0207664_10174415 3300025929 Bacteria 1842
401 Ga0207664_10479577 3300025929 Bacteria 1112
402 Ga0207644_10006653 3300025931 Bacteria 7533
403 Ga0207644_10304948 3300025931 Bacteria 1284
404 Ga0207690_10002052 3300025932 Bacteria 12339
405 Ga0207690_10038007 3300025932 Bacteria 3129
406 Ga0207706_10000234 3300025933 Bacteria 60759
407 Ga0207706_10015658 3300025933 Bacteria 6852
408 Ga0207706_10039839 3300025933 Bacteria 4165
409 Ga0207686_10011136 3300025934 Bacteria 4916
410 Ga0207686_10026555 3300025934 Bacteria 3380
411 Ga0207686_10160255 3300025934 Bacteria 1576
412 Ga0207709_10006140 3300025935 Bacteria 6767
413 Ga0207709_10014962 3300025935 Bacteria 4295
414 Ga0207670_10009279 3300025936 Bacteria 5604
415 Ga0207670_10101130 3300025936 Bacteria 2059
416 Ga0207669_10009575 3300025937 Bacteria 4625
417 Ga0207669_10040977 3300025937 Bacteria 2691
418 Ga0207669_10062712 3300025937 Bacteria 2291
419 Ga0207704_10025319 3300025938 Bacteria 3235
420 Ga0207665_10000120 3300025939 Bacteria 51773
421 Ga0207665_10029075 3300025939 Bacteria 3655
422 Ga0207665_10040476 3300025939 Bacteria 3110
423 Ga0207665_10186652 3300025939 Bacteria 1504
424 Ga0207691_10000538 3300025940 Bacteria 37878
425 Ga0207711_10007098 3300025941 Bacteria 9384
426 Ga0207711_10028742 3300025941 Bacteria 4683
427 Ga0207711_10032664 3300025941 Bacteria 4401
428 Ga0207711_10164895 3300025941 Bacteria 2008
429 Ga0207689_10016336 3300025942 Bacteria 6288
430 Ga0207689_10147605 3300025942 Bacteria 1938
431 Ga0207661_10016618 3300025944 Bacteria 5432
432 Ga0207661_10027740 3300025944 Bacteria 4329
433 Ga0207661_10282717 3300025944 Bacteria 1483
434 Ga0207679_10003216 3300025945 Bacteria 10074
435 Ga0207667_10007354 3300025949 Bacteria 13255
436 Ga0207667_10008981 3300025949 Bacteria 11823
437 Ga0207667_10026394 3300025949 Bacteria 6348
438 Ga0207667_10185330 3300025949 Bacteria 2137
439 Ga0207667_10192076 3300025949 Bacteria 2095
440 Ga0207651_10000671 3300025960 Bacteria 14621
441 Ga0207651_10151692 3300025960 Bacteria 1805
442 Ga0207712_10013620 3300025961 Bacteria 5215
443 Ga0207712_10014439 3300025961 Bacteria 5083
444 Ga0207712_10122304 3300025961 Bacteria 1971
445 Ga0207668_10010926 3300025972 Bacteria 5504
446 Ga0207668_10019195 3300025972 Bacteria 4315
447 Ga0207668_10149217 3300025972 Bacteria 1808
448 Ga0207668_10227758 3300025972 Bacteria 1501
449 Ga0207640_10007336 3300025981 Bacteria 6086
450 Ga0207640_10044405 3300025981 Bacteria 2847
451 Ga0207640_10071720 3300025981 Bacteria 2334
452 Ga0207703_10163721 3300026035 Bacteria 1950
453 Ga0207639_10067181 3300026041 Bacteria 2789
454 Ga0207639_10392588 3300026041 Bacteria 1248
455 Ga0207678_10000048 3300026067 Bacteria 90920
456 Ga0207678_10024049 3300026067 Bacteria 5323
457 Ga0207678_10273436 3300026067 Bacteria 1449
458 Ga0207708_10000443 3300026075 Bacteria 32270
459 Ga0207708_10017716 3300026075 Bacteria 5361
460 Ga0207708_10121060 3300026075 Bacteria 2039
461 Ga0207702_10020692 3300026078 Bacteria 5443
462 Ga0207702_10166763 3300026078 Bacteria 2016
463 Ga0207648_10034341 3300026089 Bacteria 4471
464 Ga0207648_10040596 3300026089 Bacteria 4088
465 Ga0207648_10246897 3300026089 Bacteria 1591
466 Ga0207676_10010515 3300026095 Bacteria 6593
467 Ga0207676_10048660 3300026095 Bacteria 3293
468 Ga0207676_10172389 3300026095 Bacteria 1886
469 Ga0207674_10002888 3300026116 Bacteria 21348
470 Ga0207674_10003550 3300026116 Bacteria 19032
471 Ga0207674_10058414 3300026116 Bacteria 3908
472 Ga0207674_10065797 3300026116 Bacteria 3653
473 Ga0207674_10320521 3300026116 Bacteria 1499
474 Ga0207675_100000155 3300026118 Bacteria 60380
475 Ga0207675_100125719 3300026118 Bacteria 2429
476 Ga0207683_10001926 3300026121 Bacteria 18374
477 Ga0207683_10064387 3300026121 Bacteria 3231
478 Ga0207683_10133008 3300026121 Bacteria 2238
479 Ga0207683_10142076 3300026121 Bacteria 2164
480 Ga0207683_10192748 3300026121 Bacteria 1851
481 Ga0207698_10006352 3300026142 Bacteria 7365
482 Ga0207698_10042376 3300026142 Bacteria 3400
483 Ga0207698_10304829 3300026142 Bacteria 1484
484 Ga0209389_1000034 3300027296 Bacteria 127289
485 Ga0209371_1000729 3300027312 Bacteria 27629
486 Ga0209371_1024599 3300027312 Bacteria 1398
487 Ga0209589_1000038 3300027357 Bacteria 127285
488 Ga0209489_100023 3300027361 Bacteria 198829
489 Ga0209179_1007997 3300027512 Bacteria 1766
490 Ga0209179_1018677 3300027512 Bacteria 1326
491 Ga0209998_10011035 3300027717 Bacteria 1869
492 Ga0207428_10023841 3300027907 Bacteria 5140
493 Ga0207428_10030696 3300027907 Bacteria 4440
494 Ga0268266_10024250 3300028379 Bacteria 5162
495 Ga0268265_10159114 3300028380 Bacteria 1916
496 Ga0268264_10004457 3300028381 Bacteria 11942
497 Ga0268264_10187032 3300028381 Bacteria 1885
498 Ga0268256_1004292 3300030500 Bacteria 5970
499 Ga0268256_1022380 3300030500 Bacteria 1658
500 Ga0265330_10004963 3300031235 Bacteria 6690
501 Ga0265330_10022124 3300031235 Bacteria 2897
502 Ga0265330_10022247 3300031235 Bacteria 2887
503 Ga0265330_10095647 3300031235 Bacteria 1273
504 Ga0265332_10003645 3300031238 Bacteria 7379
505 Ga0265332_10076693 3300031238 Bacteria 1420
506 Ga0265320_10092642 3300031240 Bacteria 1398
507 Ga0265325_10000254 3300031241 Bacteria 38034
508 Ga0265325_10003840 3300031241 Bacteria 9661
509 Ga0265325_10014755 3300031241 Bacteria 4409
510 Ga0265329_10071541 3300031242 Bacteria 1097
511 Ga0265340_10000617 3300031247 Bacteria 19928
512 Ga0265340_10015541 3300031247 Bacteria 3953
513 Ga0265340_10033670 3300031247 Bacteria 2550
514 Ga0265339_10000016 3300031249 Bacteria 185313
515 Ga0265339_10002621 3300031249 Bacteria 12830
516 Ga0265339_10007837 3300031249 Bacteria 6853
517 Ga0265339_10065515 3300031249 Bacteria 1947
518 Ga0265331_10025502 3300031250 Bacteria 2984
519 Ga0265316_10045413 3300031344 Bacteria 3488
520 Ga0265316_10105018 3300031344 Bacteria 2144
521 Ga0265316_10127390 3300031344 Bacteria 1919
522 Ga0307513_10229070 3300031456 Bacteria 1672
523 Ga0265313_10000060 3300031595 Bacteria 107224
524 Ga0265313_10035182 3300031595 Bacteria 2525
525 Ga0265313_10064893 3300031595 Bacteria 1697
526 Ga0265313_10123110 3300031595 Bacteria 1130
527 Ga0307508_10000012 3300031616 Bacteria 243167
528 Ga0316575_10005549 3300031665 Bacteria 4499
529 Ga0316579_10000697 3300031691 Bacteria 11453
530 Ga0265314_10005172 3300031711 Bacteria 11847
531 Ga0265314_10056160 3300031711 Bacteria 2712
532 Ga0265314_10062854 3300031711 Bacteria 2521
533 Ga0265314_10063537 3300031711 Bacteria 2504
534 Ga0265342_10000321 3300031712 Bacteria 54074
535 Ga0265342_10000681 3300031712 Bacteria 35543
536 Ga0265342_10023484 3300031712 Bacteria 3902
537 Ga0265342_10062440 3300031712 Bacteria 2193
538 Ga0316576_10090234 3300031727 Bacteria 2282
539 Ga0316578_10064945 3300031728 Bacteria 2154
540 Ga0307516_10161782 3300031730 Bacteria 1988
541 Ga0316577_10014741 3300031733 Bacteria 4294
542 Ga0307414_10149706 3300032004 Bacteria 1839
543 Ga0307414_10259159 3300032004 Bacteria 1450
544 Ga0307411_10056659 3300032005 Bacteria 2585
545 Ga0316583_10003003 3300032133 Bacteria 5931
546 Ga0316585_10003818 3300032137 Bacteria 4166
547 Ga0316580_10000948 3300032139 Bacteria 7207
548 Ga0307510_10006633 3300033180 Bacteria 13810
549 Ga0307510_10177783 3300033180 Bacteria 1696
550 Ga0315911_1000005 3300033442 Bacteria 426255
551 Ga0316596_1026098 3300033541 Bacteria 1505
552 Ga0373938_0010032 3300034957 Bacteria 1730
553 Ga0373929_0013142 3300035085 Bacteria 1583
554 Ga0373934_0015955 3300035086 Bacteria 2853
555 Ga0373923_0001014 3300035111 Bacteria 7618
556 Ga0373923_0018141 3300035111 Bacteria 2704
557 Ga0373923_0046030 3300035111 Bacteria 1813
558 Ga0373932_0006296 3300035112 Bacteria 2806
559 Ga0373936_0050748 3300035113 Bacteria 1678
560 Ga0373941_0006186 3300035115 Bacteria 2869
561 Ga0373945_0001639 3300035116 Bacteria 6866
562 Ga0373953_0000726 3300035117 Bacteria 9096
563 Ga0373953_0074506 3300035117 Bacteria 1404
564 Ga0373954_0002928 3300035118 Bacteria 7200
565 Ga0373954_0088688 3300035118 Bacteria 1484
566 Ga0373956_0009029 3300035119 Bacteria 4042
567 Ga0373956_0035536 3300035119 Bacteria 2198
568 Ga0373943_0003886 3300035170 Bacteria 6800
569 Ga0373943_0196710 3300035170 Bacteria 1114
570 Ga0373946_0002901 3300035171 Bacteria 6083
571 Ga0373946_0130182 3300035171 Bacteria 1157
572 Ga0373955_0001221 3300035172 Bacteria 10920
573 Ga0373942_0005006 3300035207 Bacteria 3072
574 Ga0316574_0094787 3300035398 Bacteria 1906
575 Ga0373924_0011619 3300035410 Bacteria 3274
576 Ga0373924_0033708 3300035410 Bacteria 2069
577 Ga0373931_0001104 3300035691 Bacteria 11454
578 Ga0373931_0047101 3300035691 Bacteria 2281
579 Ga0373931_0175453 3300035691 Bacteria 1266
580 Ga0373935_0003708 3300035692 Bacteria 8915
581 Ga0373935_0097406 3300035692 Bacteria 1935
582 Ga0373935_0198344 3300035692 Bacteria 1386
583 Ga0373935_0229814 3300035692 Bacteria 1291
584 Ga0373927_0006337 3300035695 Bacteria 8062
585 Ga0373927_0122295 3300035695 Bacteria 1699
586 Ga0373933_0005193 3300035724 Bacteria 7107
587 Ga0373933_0005801 3300035724 Bacteria 6717
588 Ga0373933_0058496 3300035724 Bacteria 2319
589 Ga0373933_0064749 3300035724 Bacteria 2212
590 Ga0373947_0005376 3300035725 Bacteria 7472
591 Ga0373947_0060879 3300035725 Bacteria 2293
592 Ga0373947_0100030 3300035725 Bacteria 1821
593 Ga0373947_0143534 3300035725 Bacteria 1533
594 Ga0373947_0205445 3300035725 Bacteria 1290
595 Ga0373937_0000058 3300036401 Bacteria 99025
596 Ga0373937_0002442 3300036401 Bacteria 15442
597 Ga0373937_0002520 3300036401 Bacteria 15212
598 Ga0373937_0010494 3300036401 Bacteria 8089
599 Ga0373937_0033289 3300036401 Bacteria 4679
600 Ga0373937_0060812 3300036401 Bacteria 3471
601 Ga0373937_0259175 3300036401 Bacteria 1640
602 Ga0373937_0342657 3300036401 Bacteria 1415
603 Ga0316582_0074705 3300036647 Bacteria 2201
604 Ga0316582_0084831 3300036647 Bacteria 2074
605 Ga0316584_0002253 3300036712 Bacteria 12117
606 Ga0373925_0000036 3300037068 Bacteria 143388
607 Ga0373925_0014258 3300037068 Bacteria 5750
608 Ga0373925_0037001 3300037068 Bacteria 3602
609 Ga0373925_0090824 3300037068 Bacteria 2335
610 Ga0395900_0146615 3300037418 Bacteria 2413
611 Ga0395898_0204915 3300037466 Bacteria 1882
612 Ga0395898_0232753 3300037466 Bacteria 1757
613 Ga0395905_0025716 3300037471 Bacteria 5550
614 Ga0316581_0000324 3300037588 Bacteria 8599
615 Ga0436364_0079156 3300037853 Bacteria 1400
616 Ga0436364_0413488 3300037853 Bacteria 83589
617 Ga0436364_0875330 3300037853 Bacteria 4257
618 Ga0436364_1353015 3300037853 Bacteria 1902
619 Ga0395901_0003430 3300038443 Bacteria 15971
620 Ga0436365_0304759 3300039437 Bacteria 17649
621 Ga0436365_0418627 3300039437 Bacteria 1753
622 Ga0436365_0470321 3300039437 Bacteria 1384
623 Ga0436365_1147119 3300039437 Bacteria 1411
624 Ga0436365_1258671 3300039437 Bacteria 3647
625 Ga0436365_1431698 3300039437 Bacteria 2419
626 Ga0436365_1466455 3300039437 Bacteria 80141
627 Ga0436365_1501331 3300039437 Bacteria 2412
628 Ga0436365_1630180 3300039437 Bacteria 3851
629 Ga0436360_0079901 3300039438 Bacteria 2558
630 Ga0436360_0554196 3300039438 Bacteria 2241
631 Ga0436360_0776902 3300039438 Bacteria 1583
632 Ga0436361_0126718 3300039447 Bacteria 1489
633 Ga0436361_0271405 3300039447 Bacteria 3305
634 Ga0436361_0504819 3300039447 Bacteria 1613
635 Ga0436361_0575176 3300039447 Bacteria 16913
636 Ga0436361_1103503 3300039447 Bacteria 1136
637 Ga0436363_0670432 3300039450 Bacteria 1413
638 Ga0436363_0721044 3300039450 Bacteria 3006
639 Ga0436363_0937763 3300039450 Bacteria 14249
640 Ga0436362_0150968 3300039453 Bacteria 1315
641 Ga0439453_0000430 3300041408 Bacteria 4556
642 Ga0439448_0048723 3300042005 Bacteria 1384
643 Ga0466966_0072437 3300044684 Bacteria 2157
644 Ga0466961_0069040 3300044693 Bacteria 2244
645 Ga0466961_0074335 3300044693 Bacteria 2155
646 Ga0466963_0025056 3300044694 Bacteria 3801
647 Ga0466963_0130010 3300044694 Bacteria 1739
648 Ga0466963_0183059 3300044694 Bacteria 1463
649 Ga0466957_0150399 3300044842 Bacteria 1505
650 Ga0466959_0057250 3300045049 Bacteria 2842
651 Ga0466959_0090259 3300045049 Bacteria 2201
652 Ga0466958_0111706 3300045836 Bacteria 1706
653 Ga0466958_0189181 3300045836 Bacteria 1308
654 Ga0466967_0144639 3300045976 Bacteria 2217
655 Ga0466967_0352298 3300045976 Bacteria 1425
656 Ga0466967_0460219 3300045976 Bacteria 1244
657 Ga0495592_0000232 3300046454 Bacteria 48214
658 Ga0495592_0020438 3300046454 Bacteria 5035
659 Ga0495603_0001784 3300046455 Bacteria 12697
660 Ga0495590_0032126 3300046457 Bacteria 1836
661 Ga0495629_0015449 3300046459 Bacteria 5482
662 Ga0495629_0113224 3300046459 Bacteria 1891
663 Ga0495629_0147983 3300046459 Bacteria 1633
664 Ga0495638_0034095 3300046460 Bacteria 3251
665 Ga0495651_0001333 3300046462 Bacteria 19125
666 Ga0495651_0009003 3300046462 Bacteria 7664
667 Ga0495651_0109611 3300046462 Bacteria 2043
668 Ga0495653_0000069 3300046463 Bacteria 89715
669 Ga0495653_0062850 3300046463 Bacteria 2804
670 Ga0495653_0122136 3300046463 Bacteria 1854
671 Ga0495582_0041078 3300046473 Bacteria 2548
672 Ga0495582_0051531 3300046473 Bacteria 2269
673 Ga0495582_0133492 3300046473 Bacteria 1404
674 Ga0495605_0038492 3300046474 Bacteria 2399
675 Ga0495662_0000613 3300046476 Bacteria 16534
676 Ga0495662_0010328 3300046476 Bacteria 4575
677 Ga0495664_0000010 3300046477 Bacteria 268381
678 Ga0495664_0135693 3300046477 Bacteria 1491
679 Ga0495664_0199257 3300046477 Bacteria 1213
680 Ga0495608_0000008 3300046511 Bacteria 268629
681 Ga0495608_0004302 3300046511 Bacteria 10197
682 Ga0495608_0040234 3300046511 Bacteria 3132
683 Ga0495618_0000002 3300046514 Bacteria 271353
684 Ga0495628_0000009 3300046516 Bacteria 237611
685 Ga0495628_0023938 3300046516 Bacteria 5005
686 Ga0495630_0001382 3300046517 Bacteria 16742
687 Ga0495637_0030494 3300046520 Bacteria 2392
688 Ga0495666_0050554 3300046526 Bacteria 1998
689 Ga0495652_0000011 3300046529 Bacteria 255329
690 Ga0495652_0021038 3300046529 Bacteria 5798
691 Ga0495665_0040561 3300046531 Bacteria 2478
692 Ga0495640_0000009 3300046533 Bacteria 217086
693 Ga0495640_0007182 3300046533 Bacteria 8774
694 Ga0495640_0038316 3300046533 Bacteria 3372
695 Ga0495640_0062038 3300046533 Bacteria 2537
696 Ga0495640_0214174 3300046533 Bacteria 1217
697 Ga0495586_0192144 3300046535 Bacteria 1156
698 Ga0495587_0000006 3300046536 Bacteria 310070
699 Ga0495587_0002711 3300046536 Bacteria 11824
700 Ga0495587_0038741 3300046536 Bacteria 2856
701 Ga0495645_0000010 3300046543 Bacteria 238337
702 Ga0495645_0006697 3300046543 Bacteria 8004
703 Ga0495667_0000005 3300046559 Bacteria 268252
704 Ga0495667_0223220 3300046559 Bacteria 1202
705 Ga0495656_0002300 3300046615 Bacteria 6315
706 Ga0495656_0009606 3300046615 Bacteria 3486
707 Ga0495656_0024270 3300046615 Bacteria 2393
708 Ga0495634_0000055 3300046642 Bacteria 89761
709 Ga0495634_0066453 3300046642 Bacteria 2387
710 Ga0495634_0133131 3300046642 Bacteria 1583
711 Ga0495635_0000008 3300046663 Bacteria 268349
712 Ga0495635_0009980 3300046663 Bacteria 6639
713 Ga0495635_0193476 3300046663 Bacteria 1380
714 Ga0495659_0009162 3300046664 Bacteria 3156
715 Ga0495659_0093143 3300046664 Bacteria 1159
716 Ga0495657_0000470 3300046675 Bacteria 37809
717 Ga0495657_0011293 3300046675 Bacteria 6685
718 Ga0495657_0104687 3300046675 Bacteria 1799
719 Ga0495599_0000250 3300046678 Bacteria 34000
720 Ga0495599_0013111 3300046678 Bacteria 5120
721 Ga0495599_0029696 3300046678 Bacteria 3428
722 Ga0495599_0159518 3300046678 Bacteria 1394
723 Ga0495623_0000004 3300046679 Bacteria 142249
724 Ga0495623_0001957 3300046679 Bacteria 13828
725 Ga0495623_0021314 3300046679 Bacteria 4185
726 Ga0495646_0000040 3300046680 Bacteria 71368
727 Ga0495646_0003029 3300046680 Bacteria 10405
728 Ga0495646_0164906 3300046680 Bacteria 1224
729 Ga0495647_0027549 3300046681 Bacteria 2089
730 Ga0495658_0033556 3300046683 Bacteria 2812
731 Ga0495658_0114604 3300046683 Bacteria 1624
732 Ga0495613_0061740 3300046689 Bacteria 2744
733 Ga0495624_0031025 3300046690 Bacteria 3479
734 Ga0495600_0000080 3300046809 Bacteria 53421
735 Ga0495600_0006445 3300046809 Bacteria 7147
736 Ga0495600_0010737 3300046809 Bacteria 5693
737 Ga0495581_0004214 3300047315 Bacteria 8287
738 Ga0495604_0000012 3300047317 Bacteria 268341
739 Ga0495604_0006606 3300047317 Bacteria 9191
740 Ga0495604_0060950 3300047317 Bacteria 2887
741 Ga0495604_0124284 3300047317 Bacteria 1863
742 Ga0495674_0000011 3300047319 Bacteria 270911
743 Ga0495674_0026023 3300047319 Bacteria 5354
744 Ga0495674_0086589 3300047319 Bacteria 2682
745 Ga0495674_0488623 3300047319 Bacteria 986
746 Ga0495676_0051544 3300047321 Bacteria 3291
747 Ga0495680_0001797 3300047322 Bacteria 22695
748 Ga0495680_0011098 3300047322 Bacteria 7997
749 Ga0495680_0015778 3300047322 Bacteria 6504
750 Ga0495680_0016486 3300047322 Bacteria 6344
751 Ga0495675_0000468 3300047444 Bacteria 26603
752 Ga0495675_0002614 3300047444 Bacteria 10792
753 Ga0495675_0179201 3300047444 Bacteria 1298
754 Ga0495684_0000014 3300047471 Bacteria 172111
755 Ga0495684_0026883 3300047471 Bacteria 4421
756 Ga0495684_0047820 3300047471 Bacteria 3271
757 Ga0495593_0000650 3300047673 Bacteria 20010
758 Ga0495602_0000019 3300048088 Bacteria 170922
759 Ga0495602_0004530 3300048088 Bacteria 14499
760 Ga0496100_0024849 3300048903 Bacteria 3659
761 Ga0496100_0035039 3300048903 Bacteria 3155
762 Ga0496100_0050297 3300048903 Bacteria 2699
763 Ga0496100_0051089 3300048903 Bacteria 2682
764 Ga0496100_0063231 3300048903 Bacteria 2445
765 Ga0496100_0081171 3300048903 Bacteria 2190
766 Ga0496100_0084627 3300048903 Bacteria 2150
767 Ga0496101_0005059 3300048904 Bacteria 8383
768 Ga0496101_0033101 3300048904 Bacteria 3644
769 Ga0496101_0046415 3300048904 Bacteria 3115
770 Ga0496101_0096854 3300048904 Bacteria 2202
771 Ga0496101_0148744 3300048904 Bacteria 1790
772 Ga0496101_0299598 3300048904 Bacteria 1259
773 Ga0496102_0026747 3300048905 Bacteria 5149
774 Ga0496102_0209420 3300048905 Bacteria 1838
775 Ga0496103_0006682 3300048906 Bacteria 6883
776 Ga0496103_0024965 3300048906 Bacteria 3609
777 Ga0496103_0115322 3300048906 Bacteria 1708
778 Ga0496103_0124122 3300048906 Bacteria 1646
779 Ga0496104_0029045 3300048907 Bacteria 5127
780 Ga0496104_0031547 3300048907 Bacteria 4928
781 Ga0496104_0050693 3300048907 Bacteria 3917
782 Ga0496104_0056535 3300048907 Bacteria 3710
783 Ga0496104_0089100 3300048907 Bacteria 2948
784 Ga0496104_0130684 3300048907 Bacteria 2412
785 Ga0496105_0002889 3300048908 Bacteria 12596
786 Ga0496105_0004608 3300048908 Bacteria 10386
787 Ga0496105_0017433 3300048908 Bacteria 5758
788 Ga0496105_0112992 3300048908 Bacteria 2242
789 Ga0496105_0140260 3300048908 Bacteria 1990
790 Ga0496106_0004959 3300048909 Bacteria 9848
791 Ga0496106_0018910 3300048909 Bacteria 5104
792 Ga0496106_0031501 3300048909 Bacteria 3952
793 Ga0496106_0031586 3300048909 Bacteria 3947
794 Ga0496106_0052756 3300048909 Bacteria 3069
795 Ga0496106_0080443 3300048909 Bacteria 2502
796 Ga0496106_0290130 3300048909 Bacteria 1312
797 Ga0496106_0405201 3300048909 Bacteria 1096
798 Ga0496107_0005627 3300048910 Bacteria 8582
799 Ga0496107_0013265 3300048910 Bacteria 5759
800 Ga0496107_0045415 3300048910 Bacteria 3160
801 Ga0496107_0060104 3300048910 Bacteria 2750
802 Ga0496107_0108798 3300048910 Bacteria 2036
803 Ga0496107_0151731 3300048910 Bacteria 1714
804 Ga0496108_0000416 3300048911 Bacteria 34834
805 Ga0496108_0019350 3300048911 Bacteria 5590
806 Ga0496108_0075064 3300048911 Bacteria 2856
807 Ga0496108_0111299 3300048911 Bacteria 2342
808 Ga0496108_0499279 3300048911 Bacteria 1063
809 Ga0496109_0001317 3300048912 Bacteria 20486
810 Ga0496109_0017174 3300048912 Bacteria 6337
811 Ga0496109_0035382 3300048912 Bacteria 4505
812 Ga0496109_0132057 3300048912 Bacteria 2331
813 Ga0496109_0137218 3300048912 Bacteria 2286
814 Ga0496109_0155217 3300048912 Bacteria 2144
815 Ga0496109_0172732 3300048912 Bacteria 2028
816 Ga0496110_0007056 3300048913 Bacteria 8939
817 Ga0496110_0012175 3300048913 Bacteria 7067
818 Ga0496110_0020979 3300048913 Bacteria 5520
819 Ga0496110_0022999 3300048913 Bacteria 5299
820 Ga0496110_0164757 3300048913 Bacteria 2010
821 Ga0496110_0172436 3300048913 Bacteria 1963
822 Ga0496111_0017353 3300048914 Bacteria 4976
823 Ga0496111_0019016 3300048914 Bacteria 4764
824 Ga0496111_0045673 3300048914 Bacteria 3152
825 Ga0496111_0084163 3300048914 Bacteria 2325
826 Ga0496112_0013146 3300048915 Bacteria 7639
827 Ga0496112_0014551 3300048915 Bacteria 7308
828 Ga0496112_0018639 3300048915 Bacteria 6539
829 Ga0496112_0076497 3300048915 Bacteria 3310
830 Ga0496112_0104378 3300048915 Bacteria 2804
831 Ga0496112_0471992 3300048915 Bacteria 1192
832 Ga0496113_0005136 3300048916 Bacteria 8137
833 Ga0496113_0021679 3300048916 Bacteria 4534
834 Ga0496113_0283287 3300048916 Bacteria 1325
835 Ga0496114_0007979 3300048917 Bacteria 8374
836 Ga0496114_0017775 3300048917 Bacteria 5746
837 Ga0496114_0019575 3300048917 Bacteria 5485
838 Ga0496114_0024765 3300048917 Bacteria 4899
839 Ga0496114_0251893 3300048917 Bacteria 1554
840 Ga0496115_0008933 3300048918 Bacteria 7432
841 Ga0496115_0038813 3300048918 Bacteria 3781
842 Ga0496115_0044821 3300048918 Bacteria 3530
843 Ga0496115_0049839 3300048918 Bacteria 3353
844 Ga0496115_0053180 3300048918 Bacteria 3249
845 Ga0496115_0076858 3300048918 Bacteria 2714
846 Ga0496115_0088604 3300048918 Bacteria 2527
847 Ga0496118_0021504 3300048921 Bacteria 5673
848 Ga0496118_0098658 3300048921 Bacteria 1983
849 Ga0496118_0138653 3300048921 Bacteria 1547
850 Ga0496124_0085289 3300048927 Bacteria 2588
851 Ga0496124_0092342 3300048927 Bacteria 2466
852 Ga0496125_0000176 3300048928 Bacteria 140746
853 Ga0496125_0000585 3300048928 Bacteria 62191
854 Ga0496126_0016337 3300048929 Bacteria 7425
855 Ga0496126_0059157 3300048929 Bacteria 3452
856 Ga0501031_0002788 3300049568 Bacteria 11143
857 Ga0501031_0006248 3300049568 Bacteria 7767
858 Ga0501031_0019096 3300049568 Bacteria 4462
859 Ga0501032_0000301 3300049569 Bacteria 41571
860 Ga0501032_0012685 3300049569 Bacteria 6009
861 Ga0501032_0014993 3300049569 Bacteria 5480
862 Ga0501033_0000270 3300049570 Bacteria 50079
863 Ga0501033_0006959 3300049570 Bacteria 8831
864 Ga0501033_0017776 3300049570 Bacteria 5369
865 Ga0501033_0078659 3300049570 Bacteria 2420
866 Ga0501033_0090649 3300049570 Bacteria 2236
867 Ga0501034_0000230 3300049571 Bacteria 105001
868 Ga0501034_0000715 3300049571 Bacteria 50444
869 Ga0501034_0003510 3300049571 Bacteria 17804
870 Ga0501034_0023530 3300049571 Bacteria 6276
871 Ga0501034_0064700 3300049571 Bacteria 3670
872 Ga0501034_0065445 3300049571 Bacteria 3647
873 Ga0501034_0102758 3300049571 Bacteria 2851
874 Ga0501036_0000043 3300049572 Bacteria 79310
875 Ga0501036_0007431 3300049572 Bacteria 8925
876 Ga0501036_0026623 3300049572 Bacteria 4884
877 Ga0501036_0073086 3300049572 Bacteria 2899
878 Ga0501036_0097328 3300049572 Bacteria 2487
879 Ga0501037_0000040 3300049573 Bacteria 119364
880 Ga0501037_0002011 3300049573 Bacteria 14727
881 Ga0501037_0068986 3300049573 Bacteria 2574
882 Ga0501037_0076858 3300049573 Bacteria 2423
883 Ga0501038_0000131 3300049574 Bacteria 63880
884 Ga0501038_0010843 3300049574 Bacteria 8327
885 Ga0501038_0061604 3300049574 Bacteria 3208
886 Ga0501038_0108873 3300049574 Bacteria 2297
887 Ga0501038_0134415 3300049574 Bacteria 2027
888 Ga0501039_0000106 3300049575 Bacteria 56453
889 Ga0501039_0001760 3300049575 Bacteria 15981
890 Ga0501039_0019509 3300049575 Bacteria 5198
891 Ga0501039_0022322 3300049575 Bacteria 4859
892 Ga0501039_0102199 3300049575 Bacteria 2237
893 Ga0501039_0119247 3300049575 Bacteria 2067
894 Ga0501040_0235356 3300049576 Bacteria 1304
895 Ga0501041_0014361 3300049577 Bacteria 4702
896 Ga0501042_0032863 3300049578 Bacteria 3675
897 Ga0501042_0047096 3300049578 Bacteria 3074
898 Ga0501042_0062436 3300049578 Bacteria 2662
899 Ga0501043_0000074 3300049579 Bacteria 87396
900 Ga0501043_0005622 3300049579 Bacteria 10096
901 Ga0501043_0009090 3300049579 Bacteria 7815
902 Ga0501043_0035464 3300049579 Bacteria 3923
903 Ga0501043_0113144 3300049579 Bacteria 2131
904 Ga0501046_0000074 3300049580 Bacteria 104319
905 Ga0501046_0011149 3300049580 Bacteria 7699
906 Ga0501046_0044309 3300049580 Bacteria 3539
907 Ga0501047_0000346 3300049581 Bacteria 52545
908 Ga0501047_0006345 3300049581 Bacteria 11118
909 Ga0501047_0025749 3300049581 Bacteria 5657
910 Ga0501047_0062756 3300049581 Bacteria 3584
911 Ga0501047_0099979 3300049581 Bacteria 2779
912 Ga0501047_0172039 3300049581 Bacteria 2034
913 Ga0501048_0000738 3300049582 Bacteria 23971
914 Ga0501048_0004377 3300049582 Bacteria 10754
915 Ga0501048_0020601 3300049582 Bacteria 4832
916 Ga0501048_0098648 3300049582 Bacteria 2061
917 Ga0501067_0000645 3300049583 Bacteria 18741
918 Ga0501067_0002747 3300049583 Bacteria 9681
919 Ga0501067_0003296 3300049583 Bacteria 8882
920 Ga0501067_0141313 3300049583 Bacteria 1341
921 Ga0501068_0000636 3300049584 Bacteria 17896
922 Ga0501068_0005068 3300049584 Bacteria 7180
923 Ga0501068_0006803 3300049584 Bacteria 6323
924 Ga0501068_0042570 3300049584 Bacteria 2731
925 Ga0501069_0006380 3300049585 Bacteria 6166
926 Ga0501069_0006727 3300049585 Bacteria 6020
927 Ga0501069_0030996 3300049585 Bacteria 2939
928 Ga0501070_0007488 3300049586 Bacteria 9274
929 Ga0501070_0009852 3300049586 Bacteria 8079
930 Ga0501070_0053237 3300049586 Bacteria 3358
931 Ga0501070_0069475 3300049586 Bacteria 2916
932 Ga0501070_0076633 3300049586 Bacteria 2768
933 Ga0501070_0172033 3300049586 Bacteria 1784
934 Ga0501070_0202178 3300049586 Bacteria 1631
935 Ga0501071_0008700 3300049587 Bacteria 6718
936 Ga0501071_0074874 3300049587 Bacteria 2471
937 Ga0501071_0096636 3300049587 Bacteria 2174
938 Ga0501072_0008450 3300049588 Bacteria 7812
939 Ga0501072_0110265 3300049588 Bacteria 2190
940 Ga0501072_0182810 3300049588 Bacteria 1672
941 Ga0501073_0000085 3300049589 Bacteria 59315
942 Ga0501073_0011487 3300049589 Bacteria 6477
943 Ga0501073_0024498 3300049589 Bacteria 4333
944 Ga0501073_0038050 3300049589 Bacteria 3414
945 Ga0501073_0083635 3300049589 Bacteria 2220
946 Ga0501073_0136524 3300049589 Bacteria 1700
947 Ga0501073_0151583 3300049589 Bacteria 1607
948 Ga0501074_0000657 3300049590 Bacteria 21574
949 Ga0501074_0010242 3300049590 Bacteria 6803
950 Ga0501074_0023427 3300049590 Bacteria 4487
951 Ga0501074_0024159 3300049590 Bacteria 4417
952 Ga0501074_0060870 3300049590 Bacteria 2720
953 Ga0501075_0057855 3300049591 Bacteria 2919
954 Ga0501075_0112155 3300049591 Bacteria 2073
955 Ga0501076_0038635 3300049592 Bacteria 3748
956 Ga0501076_0041092 3300049592 Bacteria 3636
957 Ga0501076_0048295 3300049592 Bacteria 3364
958 Ga0501076_0086099 3300049592 Bacteria 2525
959 Ga0501077_0029791 3300049593 Bacteria 3471
960 Ga0501077_0046251 3300049593 Bacteria 2765
961 Ga0501077_0076191 3300049593 Bacteria 2124
962 Ga0501077_0087101 3300049593 Bacteria 1979
963 Ga0501079_0000650 3300049741 Bacteria 23183
964 Ga0501079_0014485 3300049741 Bacteria 6013
965 Ga0501079_0035891 3300049741 Bacteria 3817
966 Ga0501079_0072432 3300049741 Bacteria 2663
967 Ga0501080_0001325 3300049742 Bacteria 20637
968 Ga0501080_0017834 3300049742 Bacteria 6571
969 Ga0501080_0088336 3300049742 Bacteria 2880
970 Ga0501081_0020098 3300049743 Bacteria 4451
971 Ga0501081_0029430 3300049743 Bacteria 3711
972 Ga0501083_0001866 3300049744 Bacteria 14464
973 Ga0501083_0014471 3300049744 Bacteria 5516
974 Ga0501083_0049381 3300049744 Bacteria 2836
975 Ga0501083_0274232 3300049744 Bacteria 1097
976 Ga0501035_0004398 3300049822 Bacteria 13375
977 Ga0501035_0028448 3300049822 Bacteria 5100
978 Ga0501035_0035155 3300049822 Bacteria 4548
979 Ga0501035_0074868 3300049822 Bacteria 2994
980 Ga0501044_0000243 3300049823 Bacteria 68966
981 Ga0501044_0000667 3300049823 Bacteria 41447
982 Ga0501044_0008909 3300049823 Bacteria 10967
983 Ga0501044_0011942 3300049823 Bacteria 9413
984 Ga0501044_0138743 3300049823 Bacteria 2420
985 Ga0501044_0269308 3300049823 Bacteria 1639
986 Ga0501045_0002689 3300049824 Bacteria 12127
987 Ga0501045_0005537 3300049824 Bacteria 8735
988 Ga0501045_0009850 3300049824 Bacteria 6687
989 Ga0501045_0195841 3300049824 Bacteria 1506
990 nmdc:mga03n38_10098_c1 3300050490 Bacteria 3460
991 nmdc:mga0yw44_73177_c1 3300050492 Bacteria 2131
992 nmdc:mga0k408_13742_c1 3300050493 Bacteria 4447
993 nmdc:mga0k408_17367_c1 3300050493 Bacteria 4009
994 nmdc:mga06z11_18492_c1 3300050494 Bacteria 3183
995 nmdc:mga06z11_228786_c1 3300050494 Bacteria 1089
996 nmdc:mga06z11_51376_c1 3300050494 Bacteria 2111
997 nmdc:mga07m45_132840_c1 3300050496 Bacteria 1440
998 nmdc:mga07m45_152687_c1 3300050496 Bacteria 1339
999 nmdc:mga05p37_143742_c1 3300050507 Bacteria 2922
1000 nmdc:mga05p37_299586_c1 3300050507 Bacteria 1911
1001 nmdc:mga05p37_743_c1 3300050507 Bacteria 36122
1002 nmdc:mga05p37_7845_c1 3300050507 Bacteria 12600
1003 nmdc:mga09592_781_c1 3300050508 Bacteria 24612
1004 nmdc:mga0qj67_103_c1 3300050509 Bacteria 56674
1005 nmdc:mga0qj67_110596_c1 3300050509 Bacteria 2218
1006 nmdc:mga06r32_15926_c1 3300050510 Bacteria 6842
1007 nmdc:mga06r32_41405_c1 3300050510 Bacteria 4377
1008 nmdc:mga06r32_533507_c1 3300050510 Bacteria 1149
1009 nmdc:mga08y16_121_c1 3300050511 Bacteria 67325
1010 nmdc:mga08y16_125487_c1 3300050511 Bacteria 2670
1011 nmdc:mga08y16_174255_c1 3300050511 Bacteria 2234
1012 nmdc:mga08y16_25017_c1 3300050511 Bacteria 6298
1013 nmdc:mga08y16_77399_c1 3300050511 Bacteria 3468
1014 nmdc:mga0n895_180704_c1 3300050512 Bacteria 2141
1015 nmdc:mga0n895_182347_c1 3300050512 Bacteria 2131
1016 nmdc:mga0n895_198596_c1 3300050512 Bacteria 2037
1017 nmdc:mga0n895_26889_c1 3300050512 Bacteria 5458
1018 nmdc:mga0rr50_84733_c1 3300050513 Bacteria 2454
1019 nmdc:mga08x19_122291_c1 3300050514 Bacteria 1746
1020 nmdc:mga08x19_2300_c1 3300050514 Bacteria 11611
1021 nmdc:mga08x19_90761_c1 3300050514 Bacteria 2016
1022 nmdc:mga0a205_275722_c1 3300050515 Bacteria 1558
1023 nmdc:mga0a205_64995_c1 3300050515 Bacteria 3524
1024 nmdc:mga0sz30_23276_c1 3300050516 Bacteria 2519
1025 Ga0495601_0000009 3300053077 Bacteria 270622
1026 Ga0495601_0000532 3300053077 Bacteria 20138
1027 Ga0495601_0003892 3300053077 Bacteria 8595
1028 Ga0495601_0005331 3300053077 Bacteria 7488
1029 Ga0495601_0009405 3300053077 Bacteria 5780
1030 Ga0495612_0000021 3300053078 Bacteria 130528
1031 Ga0495612_0018645 3300053078 Bacteria 2778
1032 Ga0495612_0036956 3300053078 Bacteria 1982
1033 Ga0495655_0001097 3300053083 Bacteria 4190
1034 Ga0495595_0000067 3300053084 Bacteria 51316
1035 Ga0495595_0000211 3300053084 Bacteria 23480
1036 Ga0495595_0054127 3300053084 Bacteria 1865
1037 Ga0495595_0059937 3300053084 Bacteria 1780
1038 Ga0495619_0000012 3300053085 Bacteria 268349
1039 Ga0495619_0000134 3300053085 Bacteria 54869
1040 Ga0495619_0002870 3300053085 Bacteria 11209
1041 Ga0495619_0048714 3300053085 Bacteria 2792
1042 Ga0495619_0135228 3300053085 Bacteria 1696
1043 Ga0500566_0004598 3300053094 Bacteria 8217
1044 Ga0500641_0003319 3300053096 Bacteria 5696
1045 Ga0500641_0003986 3300053096 Bacteria 5219
1046 Ga0500641_0016480 3300053096 Bacteria 2752
1047 Ga0500554_007410 3300053102 Bacteria 2523
1048 Ga0500572_000177 3300053111 Bacteria 22361
1049 Ga0500608_111432 3300053122 Bacteria 1254
1050 Ga0500652_000019 3300053131 Bacteria 120149
1051 Ga0500652_074652 3300053131 Bacteria 1408
1052 Ga0500559_0000980 3300053136 Bacteria 17808
1053 Ga0500604_0001259 3300053151 Bacteria 7076
1054 Ga0500616_0000046 3300053153 Bacteria 333409
1055 Ga0500616_0100980 3300053153 Bacteria 1410
1056 Ga0500639_003548 3300053163 Bacteria 7872
1057 Ga0500636_0007177 3300053177 Bacteria 6440
1058 Ga0500637_0013087 3300053178 Bacteria 4338
1059 Ga0500576_080247 3300053725 Bacteria 1380
1060 Ga0500645_038812 3300053730 Bacteria 1412
1061 Ga0501084_0014168 3300054114 Bacteria 6602
1062 Ga0501084_0049539 3300054114 Bacteria 3516
1063 Ga0501082_0003198 3300060353 Bacteria 14281
1064 Ga0501082_0012246 3300060353 Bacteria 7371
1065 Ga0501082_0031321 3300060353 Bacteria 4585
1066 Ga0501082_0034986 3300060353 Bacteria 4329
1067 Ga0501082_0070022 3300060353 Bacteria 3021
1068 Ga0501082_0195042 3300060353 Bacteria 1762
1069 Ga0466962_0044264 3300061719 Bacteria 2129
1070 Ga0466962_0082069 3300061719 Bacteria 1542
1071 Ga0530510_0017122 3300061734 Bacteria 5133
1072 Ga0530510_0194452 3300061734 Bacteria 1506

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0196710 Ga0373943_0196710_11_784 216
2 3300035725 Ga0373947_0143534 Ga0373947_0143534_269_1294 219
3 3300046473 Ga0495582_0133492 Ga0495582_0133492_143_1168 219
4 3300012503 Ga0157313_1004702 Ga0157313_10047021 222
5 3300046477 Ga0495664_0199257 Ga0495664_0199257_341_1198 225
6 3300005327 Ga0070658_10002492 Ga0070658_1000249210 231
7 3300005336 Ga0070680_100014072 Ga0070680_1000140722 231
8 3300005339 Ga0070660_100003958 Ga0070660_1000039583 231
9 3300005530 Ga0070679_100036159 Ga0070679_1000361595 231
10 3300005563 Ga0068855_100056948 Ga0068855_1000569482 231
11 3300005577 Ga0068857_100236645 Ga0068857_1002366452 231
12 3300025909 Ga0207705_10031045 Ga0207705_100310454 231
13 3300025917 Ga0207660_10064354 Ga0207660_100643544 231
14 3300025919 Ga0207657_10005450 Ga0207657_100054509 231
15 3300025921 Ga0207652_10014040 Ga0207652_100140402 231
16 3300025949 Ga0207667_10185330 Ga0207667_101853302 231
17 3300026116 Ga0207674_10320521 Ga0207674_103205212 231
18 3300031711 Ga0265314_10063537 Ga0265314_100635374 231
19 3300031712 Ga0265342_10000321 Ga0265342_1000032150 231
20 3300049581 Ga0501047_0006345 Ga0501047_0006345_877_1902 231
21 3300005937 Ga0081455_10000031 Ga0081455_1000003182 232
22 3300005367 Ga0070667_100016467 Ga0070667_1000164672 233
23 3300005457 Ga0070662_100044231 Ga0070662_1000442315 233
24 3300005841 Ga0068863_100258227 Ga0068863_1002582272 233
25 3300005844 Ga0068862_100197885 Ga0068862_1001978851 233
26 3300009098 Ga0105245_10131908 Ga0105245_101319084 233
27 3300009553 Ga0105249_10139501 Ga0105249_101395012 233
28 3300013307 Ga0157372_10455652 Ga0157372_104556522 233
29 3300025961 Ga0207712_10122304 Ga0207712_101223044 233
30 3300028380 Ga0268265_10159114 Ga0268265_101591144 233
31 3300035113 Ga0373936_0050748 Ga0373936_0050748_663_1658 233
32 3300048906 Ga0496103_0115322 Ga0496103_0115322_85_1110 233
33 3300048912 Ga0496109_0132057 Ga0496109_0132057_553_1578 233
34 3300025903 Ga0207680_10046663 Ga0207680_100466632 234
35 3300006048 Ga0075363_100001280 Ga0075363_1000012806 235
36 3300053151 Ga0500604_0001259 Ga0500604_0001259_2466_3491 235
37 3300005347 Ga0070668_100025445 Ga0070668_1000254455 236
38 3300025972 Ga0207668_10010926 Ga0207668_100109266 236
39 3300005331 Ga0070670_100001094 Ga0070670_10000109416 237
40 3300009177 Ga0105248_10004961 Ga0105248_100049619 237
41 3300025925 Ga0207650_10207475 Ga0207650_102074751 237
42 3300021384 Ga0213876_10040404 Ga0213876_100404043 238
43 3300032004 Ga0307414_10149706 Ga0307414_101497062 238
44 3300037853 Ga0436364_1353015 Ga0436364_1353015_10_1029 238
45 3300039437 Ga0436365_0418627 Ga0436365_0418627_34_1053 238
46 3300039437 Ga0436365_1147119 Ga0436365_1147119_359_1378 238
47 3300039438 Ga0436360_0079901 Ga0436360_0079901_719_1738 238
48 3300039450 Ga0436363_0670432 Ga0436363_0670432_299_1318 238
49 3300048905 Ga0496102_0209420 Ga0496102_0209420_429_1448 238
50 3300048906 Ga0496103_0124122 Ga0496103_0124122_371_1390 238
51 3300048908 Ga0496105_0112992 Ga0496105_0112992_1171_2190 238
52 3300048910 Ga0496107_0108798 Ga0496107_0108798_771_1790 238
53 3300048912 Ga0496109_0035382 Ga0496109_0035382_446_1465 238
54 3300049571 Ga0501034_0003510 Ga0501034_0003510_2182_3207 239
55 3300005436 Ga0070713_100234538 Ga0070713_1002345382 240
56 3300025928 Ga0207700_10249176 Ga0207700_102491761 240
57 3300047319 Ga0495674_0086589 Ga0495674_0086589_1308_2657 240
58 3300048911 Ga0496108_0019350 Ga0496108_0019350_3511_4539 240
59 3300048912 Ga0496109_0017174 Ga0496109_0017174_2538_3566 240
60 3300048915 Ga0496112_0014551 Ga0496112_0014551_4156_5184 240
61 3300053077 Ga0495601_0005331 Ga0495601_0005331_3531_4550 240
62 3300046533 Ga0495640_0214174 Ga0495640_0214174_22_846 242
63 3300047319 Ga0495674_0488623 Ga0495674_0488623_18_842 242
64 3300007265 Ga0099794_10007029 Ga0099794_100070293 243
65 3300031249 Ga0265339_10000016 Ga0265339_1000001660 243
66 3300031595 Ga0265313_10000060 Ga0265313_1000006079 243
67 3300031712 Ga0265342_10062440 Ga0265342_100624401 243
68 3300032005 Ga0307411_10056659 Ga0307411_100566592 243
69 3300005435 Ga0070714_100446665 Ga0070714_1004466651 244
70 3300039447 Ga0436361_1103503 Ga0436361_1103503_74_1093 244
71 3300005444 Ga0070694_100127321 Ga0070694_1001273212 245
72 3300005546 Ga0070696_100023586 Ga0070696_1000235863 245
73 3300024227 Ga0228598_1000098 Ga0228598_100009810 245
74 3300025915 Ga0207693_10047797 Ga0207693_100477973 245
75 3300046476 Ga0495662_0010328 Ga0495662_0010328_466_1497 245
76 3300046526 Ga0495666_0050554 Ga0495666_0050554_190_1221 245
77 3300046531 Ga0495665_0040561 Ga0495665_0040561_400_1431 245
78 3300046642 Ga0495634_0133131 Ga0495634_0133131_320_1351 245
79 3300005335 Ga0070666_10058040 Ga0070666_100580403 246
80 3300005337 Ga0070682_100010302 Ga0070682_1000103022 246
81 3300005339 Ga0070660_100051545 Ga0070660_1000515453 246
82 3300005355 Ga0070671_100072200 Ga0070671_1000722003 246
83 3300005364 Ga0070673_100037774 Ga0070673_1000377742 246
84 3300005367 Ga0070667_100023204 Ga0070667_1000232045 246
85 3300005437 Ga0070710_10053330 Ga0070710_100533302 246
86 3300005439 Ga0070711_100053341 Ga0070711_1000533412 246
87 3300005441 Ga0070700_100200866 Ga0070700_1002008661 246
88 3300005456 Ga0070678_100046092 Ga0070678_1000460923 246
89 3300005457 Ga0070662_100092216 Ga0070662_1000922162 246
90 3300005458 Ga0070681_10061808 Ga0070681_100618083 246
91 3300005544 Ga0070686_100127351 Ga0070686_1001273512 246
92 3300005545 Ga0070695_100012251 Ga0070695_1000122515 246
93 3300005547 Ga0070693_100003813 Ga0070693_1000038135 246
94 3300005564 Ga0070664_100169224 Ga0070664_1001692242 246
95 3300005578 Ga0068854_100246938 Ga0068854_1002469382 246
96 3300005614 Ga0068856_100038892 Ga0068856_1000388922 246
97 3300005843 Ga0068860_100312705 Ga0068860_1003127052 246
98 3300006237 Ga0097621_100029902 Ga0097621_1000299023 246
99 3300006358 Ga0068871_100104909 Ga0068871_1001049092 246
100 3300009177 Ga0105248_10331904 Ga0105248_103319042 246
101 3300009551 Ga0105238_10156278 Ga0105238_101562783 246
102 3300013308 Ga0157375_10041029 Ga0157375_100410293 246
103 3300014968 Ga0157379_10071373 Ga0157379_100713733 246
104 3300025898 Ga0207692_10010467 Ga0207692_100104673 246
105 3300025900 Ga0207710_10025216 Ga0207710_100252162 246
106 3300025928 Ga0207700_10012952 Ga0207700_100129521 246
107 3300025932 Ga0207690_10038007 Ga0207690_100380073 246
108 3300025933 Ga0207706_10015658 Ga0207706_100156587 246
109 3300025934 Ga0207686_10011136 Ga0207686_100111361 246
110 3300025937 Ga0207669_10009575 Ga0207669_100095754 246
111 3300025939 Ga0207665_10040476 Ga0207665_100404762 246
112 3300025941 Ga0207711_10032664 Ga0207711_100326643 246
113 3300025960 Ga0207651_10151692 Ga0207651_101516922 246
114 3300026067 Ga0207678_10024049 Ga0207678_100240493 246
115 3300026121 Ga0207683_10142076 Ga0207683_101420762 246
116 3300028381 Ga0268264_10187032 Ga0268264_101870323 246
117 3300035086 Ga0373934_0015955 Ga0373934_0015955_1053_2084 246
118 3300035111 Ga0373923_0046030 Ga0373923_0046030_505_1536 246
119 3300035117 Ga0373953_0000726 Ga0373953_0000726_772_1803 246
120 3300035118 Ga0373954_0088688 Ga0373954_0088688_290_1321 246
121 3300035692 Ga0373935_0229814 Ga0373935_0229814_228_1259 246
122 3300035724 Ga0373933_0005801 Ga0373933_0005801_137_1168 246
123 3300036401 Ga0373937_0002442 Ga0373937_0002442_7040_8071 246
124 3300046454 Ga0495592_0020438 Ga0495592_0020438_59_1090 246
125 3300046462 Ga0495651_0009003 Ga0495651_0009003_3359_4390 246
126 3300046463 Ga0495653_0122136 Ga0495653_0122136_361_1392 246
127 3300046511 Ga0495608_0004302 Ga0495608_0004302_2127_3158 246
128 3300046516 Ga0495628_0023938 Ga0495628_0023938_1958_2989 246
129 3300046529 Ga0495652_0021038 Ga0495652_0021038_3909_4940 246
130 3300046533 Ga0495640_0007182 Ga0495640_0007182_7239_8270 246
131 3300046536 Ga0495587_0002711 Ga0495587_0002711_2434_3465 246
132 3300046536 Ga0495587_0038741 Ga0495587_0038741_76_1095 246
133 3300046543 Ga0495645_0006697 Ga0495645_0006697_4798_5829 246
134 3300046642 Ga0495634_0066453 Ga0495634_0066453_1124_2155 246
135 3300046675 Ga0495657_0011293 Ga0495657_0011293_1803_2834 246
136 3300046678 Ga0495599_0013111 Ga0495599_0013111_3231_4262 246
137 3300046679 Ga0495623_0001957 Ga0495623_0001957_8763_9794 246
138 3300046680 Ga0495646_0003029 Ga0495646_0003029_6016_7047 246
139 3300046809 Ga0495600_0006445 Ga0495600_0006445_3495_4526 246
140 3300047317 Ga0495604_0006606 Ga0495604_0006606_2017_3048 246
141 3300047319 Ga0495674_0026023 Ga0495674_0026023_133_1164 246
142 3300047322 Ga0495680_0015778 Ga0495680_0015778_1990_3021 246
143 3300047444 Ga0495675_0002614 Ga0495675_0002614_7040_8071 246
144 3300047471 Ga0495684_0026883 Ga0495684_0026883_933_1964 246
145 3300048088 Ga0495602_0004530 Ga0495602_0004530_4595_5626 246
146 3300048903 Ga0496100_0024849 Ga0496100_0024849_1991_3022 246
147 3300048907 Ga0496104_0031547 Ga0496104_0031547_1519_2550 246
148 3300048908 Ga0496105_0004608 Ga0496105_0004608_3059_4090 246
149 3300048909 Ga0496106_0080443 Ga0496106_0080443_1216_2247 246
150 3300048910 Ga0496107_0060104 Ga0496107_0060104_201_1232 246
151 3300048911 Ga0496108_0111299 Ga0496108_0111299_122_1153 246
152 3300048913 Ga0496110_0022999 Ga0496110_0022999_1865_2896 246
153 3300048914 Ga0496111_0084163 Ga0496111_0084163_1010_2041 246
154 3300048917 Ga0496114_0024765 Ga0496114_0024765_810_1841 246
155 3300048918 Ga0496115_0038813 Ga0496115_0038813_2519_3550 246
156 3300053077 Ga0495601_0009405 Ga0495601_0009405_2127_3158 246
157 3300053078 Ga0495612_0018645 Ga0495612_0018645_1515_2546 246
158 3300053084 Ga0495595_0000211 Ga0495595_0000211_6720_7751 246
159 3300053085 Ga0495619_0002870 Ga0495619_0002870_4998_6017 246
160 3300006175 Ga0070712_100013772 Ga0070712_1000137723 247
161 3300026095 Ga0207676_10048660 Ga0207676_100486604 247
162 3300047471 Ga0495684_0047820 Ga0495684_0047820_1815_2849 248
163 3300048914 Ga0496111_0019016 Ga0496111_0019016_13_1038 248
164 3300048927 Ga0496124_0092342 Ga0496124_0092342_1401_2426 248
165 3300048928 Ga0496125_0000585 Ga0496125_0000585_33296_34321 248
166 3300049591 Ga0501075_0057855 Ga0501075_0057855_2034_2903 248
167 3300005329 Ga0070683_100410740 Ga0070683_1004107401 249
168 3300014325 Ga0163163_10004045 Ga0163163_100040459 249
169 3300032004 Ga0307414_10259159 Ga0307414_102591592 249
170 3300035111 Ga0373923_0018141 Ga0373923_0018141_138_1163 249
171 3300035119 Ga0373956_0035536 Ga0373956_0035536_352_1377 249
172 3300035410 Ga0373924_0033708 Ga0373924_0033708_303_1328 249
173 3300036401 Ga0373937_0060812 Ga0373937_0060812_168_1193 249
174 3300039450 Ga0436363_0721044 Ga0436363_0721044_195_1217 249
175 3300046459 Ga0495629_0113224 Ga0495629_0113224_237_1262 249
176 3300046463 Ga0495653_0062850 Ga0495653_0062850_1075_2100 249
177 3300046511 Ga0495608_0040234 Ga0495608_0040234_334_1359 249
178 3300046559 Ga0495667_0223220 Ga0495667_0223220_80_1105 249
179 3300046663 Ga0495635_0193476 Ga0495635_0193476_53_1078 249
180 3300046675 Ga0495657_0104687 Ga0495657_0104687_177_1202 249
181 3300046678 Ga0495599_0159518 Ga0495599_0159518_310_1335 249
182 3300046679 Ga0495623_0021314 Ga0495623_0021314_2665_3690 249
183 3300046680 Ga0495646_0164906 Ga0495646_0164906_151_1176 249
184 3300046809 Ga0495600_0010737 Ga0495600_0010737_1897_2922 249
185 3300047317 Ga0495604_0060950 Ga0495604_0060950_308_1333 249
186 3300047322 Ga0495680_0016486 Ga0495680_0016486_4056_5081 249
187 3300048904 Ga0496101_0148744 Ga0496101_0148744_112_1137 249
188 3300048907 Ga0496104_0029045 Ga0496104_0029045_294_1319 249
189 3300048908 Ga0496105_0002889 Ga0496105_0002889_7069_8094 249
190 3300048911 Ga0496108_0000416 Ga0496108_0000416_6457_7482 249
191 3300048912 Ga0496109_0001317 Ga0496109_0001317_17537_18562 249
192 3300048913 Ga0496110_0012175 Ga0496110_0012175_1567_2592 249
193 3300048915 Ga0496112_0104378 Ga0496112_0104378_1363_2388 249
194 3300048916 Ga0496113_0021679 Ga0496113_0021679_945_1970 249
195 3300048918 Ga0496115_0008933 Ga0496115_0008933_5950_6975 249
196 3300053078 Ga0495612_0036956 Ga0495612_0036956_412_1437 249
197 3300053084 Ga0495595_0059937 Ga0495595_0059937_479_1504 249
198 3300049581 Ga0501047_0099979 Ga0501047_0099979_298_1281 250
199 3300014325 Ga0163163_10294330 Ga0163163_102943302 251
200 3300053131 Ga0500652_074652 Ga0500652_074652_10_861 251
201 3300035725 Ga0373947_0205445 Ga0373947_0205445_164_1198 252
202 3300048913 Ga0496110_0164757 Ga0496110_0164757_961_1986 252
203 3300031595 Ga0265313_10064893 Ga0265313_100648931 253
204 3300046683 Ga0495658_0033556 Ga0495658_0033556_1671_2702 254
205 3300047444 Ga0495675_0179201 Ga0495675_0179201_77_1096 254
206 3300006038 Ga0075365_10083293 Ga0075365_100832932 256
207 3300049575 Ga0501039_0102199 Ga0501039_0102199_909_1940 256
208 3300005439 Ga0070711_100151895 Ga0070711_1001518952 257
209 3300025915 Ga0207693_10057393 Ga0207693_100573933 257
210 3300035398 Ga0316574_0094787 Ga0316574_0094787_10_879 257
211 3300036401 Ga0373937_0342657 Ga0373937_0342657_365_1393 257
212 3300048907 Ga0496104_0130684 Ga0496104_0130684_19_1047 257
213 3300048915 Ga0496112_0013146 Ga0496112_0013146_6447_7475 257
214 3300005456 Ga0070678_100057176 Ga0070678_1000571762 258
215 3300021384 Ga0213876_10021619 Ga0213876_100216193 258
216 3300025901 Ga0207688_10135993 Ga0207688_101359932 258
217 3300025972 Ga0207668_10227758 Ga0207668_102277582 258
218 3300026121 Ga0207683_10133008 Ga0207683_101330083 258
219 3300039437 Ga0436365_1258671 Ga0436365_1258671_1599_2627 258
220 3300049572 Ga0501036_0007431 Ga0501036_0007431_6927_7958 258
221 3300049573 Ga0501037_0076858 Ga0501037_0076858_934_1965 258
222 3300049574 Ga0501038_0061604 Ga0501038_0061604_766_1797 258
223 3300049581 Ga0501047_0172039 Ga0501047_0172039_173_1204 258
224 3300049586 Ga0501070_0069475 Ga0501070_0069475_879_1910 258
225 3300049823 Ga0501044_0269308 Ga0501044_0269308_303_1334 258
226 3300035724 Ga0373933_0064749 Ga0373933_0064749_316_1722 259
227 3300036401 Ga0373937_0033289 Ga0373937_0033289_3242_4648 259
228 3300037068 Ga0373925_0037001 Ga0373925_0037001_468_1874 259
229 3300039453 Ga0436362_0150968 Ga0436362_0150968_197_1222 259
230 3300046462 Ga0495651_0109611 Ga0495651_0109611_343_1749 259
231 3300009147 Ga0114129_10167848 Ga0114129_101678482 260
232 3300050507 nmdc:mga05p37_143742_c1 nmdc:mga05p37_143742_c1_487_1512 260
233 3300053730 Ga0500645_038812 Ga0500645_038812_357_1382 260
234 3300006038 Ga0075365_10028242 Ga0075365_100282422 261
235 3300006178 Ga0075367_10011766 Ga0075367_100117664 261
236 3300006186 Ga0075369_10040039 Ga0075369_100400392 261
237 3300046678 Ga0495599_0029696 Ga0495599_0029696_1156_2562 261
238 3300048903 Ga0496100_0084627 Ga0496100_0084627_580_1605 261
239 3300048917 Ga0496114_0251893 Ga0496114_0251893_297_1322 261
240 3300050490 nmdc:mga03n38_10098_c1 nmdc:mga03n38_10098_c1_145_1170 261
241 3300050494 nmdc:mga06z11_51376_c1 nmdc:mga06z11_51376_c1_424_1449 261
242 3300050496 nmdc:mga07m45_152687_c1 nmdc:mga07m45_152687_c1_96_1121 261
243 3300050516 nmdc:mga0sz30_23276_c1 nmdc:mga0sz30_23276_c1_828_1853 261
244 3300006844 Ga0075428_100079977 Ga0075428_1000799774 262
245 3300025901 Ga0207688_10027304 Ga0207688_100273042 262
246 3300035725 Ga0373947_0100030 Ga0373947_0100030_11_916 262
247 3300039447 Ga0436361_0271405 Ga0436361_0271405_1200_2225 262
248 3300049582 Ga0501048_0098648 Ga0501048_0098648_743_1765 262
249 3300009147 Ga0114129_10197519 Ga0114129_101975193 263
250 3300048911 Ga0496108_0499279 Ga0496108_0499279_15_1034 263
251 3300050507 nmdc:mga05p37_299586_c1 nmdc:mga05p37_299586_c1_1014_1901 263
252 3300010159 Ga0099796_10002243 Ga0099796_100022431 264
253 3300027512 Ga0209179_1007997 Ga0209179_10079972 264
254 3300021384 Ga0213876_10099823 Ga0213876_100998232 265
255 3300037853 Ga0436364_0079156 Ga0436364_0079156_483_1388 265
256 3300037853 Ga0436364_0875330 Ga0436364_0875330_579_1619 265
257 3300039437 Ga0436365_1431698 Ga0436365_1431698_746_1786 265
258 3300048908 Ga0496105_0017433 Ga0496105_0017433_3103_4146 265
259 3300048910 Ga0496107_0151731 Ga0496107_0151731_63_1106 265
260 3300048918 Ga0496115_0076858 Ga0496115_0076858_346_1389 265
261 3300005563 Ga0068855_100382090 Ga0068855_1003820902 266
262 3300006852 Ga0075433_10272174 Ga0075433_102721742 266
263 3300009094 Ga0111539_10135829 Ga0111539_101358294 266
264 3300009176 Ga0105242_10272776 Ga0105242_102727761 266
265 3300044694 Ga0466963_0183059 Ga0466963_0183059_409_1440 266
266 3300045976 Ga0466967_0144639 Ga0466967_0144639_48_1079 266
267 3300049571 Ga0501034_0064700 Ga0501034_0064700_1701_2732 266
268 3300049576 Ga0501040_0235356 Ga0501040_0235356_40_1005 266
269 3300049579 Ga0501043_0113144 Ga0501043_0113144_317_1348 266
270 3300049589 Ga0501073_0151583 Ga0501073_0151583_341_1372 266
271 3300050511 nmdc:mga08y16_125487_c1 nmdc:mga08y16_125487_c1_614_1636 266
272 3300050512 nmdc:mga0n895_198596_c1 nmdc:mga0n895_198596_c1_596_1618 266
273 3300050515 nmdc:mga0a205_275722_c1 nmdc:mga0a205_275722_c1_366_1388 266
274 3300060353 Ga0501082_0195042 Ga0501082_0195042_494_1525 266
275 3300010159 Ga0099796_10018620 Ga0099796_100186202 267
276 3300006175 Ga0070712_100326985 Ga0070712_1003269852 268
277 3300044693 Ga0466961_0074335 Ga0466961_0074335_19_1047 268
278 3300045049 Ga0466959_0057250 Ga0466959_0057250_821_1849 268
279 3300061719 Ga0466962_0082069 Ga0466962_0082069_468_1496 268
280 3300037418 Ga0395900_0146615 Ga0395900_0146615_1467_2396 269
281 3300031241 Ga0265325_10003840 Ga0265325_100038406 270
282 3300021388 Ga0213875_10000009 Ga0213875_10000009427 271
283 3300037853 Ga0436364_0413488 Ga0436364_0413488_76281_77306 271
284 3300044684 Ga0466966_0072437 Ga0466966_0072437_20_1006 271
285 3300005578 Ga0068854_100331493 Ga0068854_1003314931 272
286 3300006914 Ga0075436_100013964 Ga0075436_1000139643 272
287 3300026075 Ga0207708_10017716 Ga0207708_100177165 272
288 3300035691 Ga0373931_0175453 Ga0373931_0175453_45_1064 272
289 3300049571 Ga0501034_0000230 Ga0501034_0000230_55965_56996 272
290 3300049744 Ga0501083_0274232 Ga0501083_0274232_104_1069 272
291 3300050514 nmdc:mga08x19_2300_c1 nmdc:mga08x19_2300_c1_7311_8336 272
292 3300053131 Ga0500652_000019 Ga0500652_000019_14521_15546 272
293 3300053177 Ga0500636_0007177 Ga0500636_0007177_4593_5618 272
294 3300031235 Ga0265330_10022247 Ga0265330_100222474 273
295 3300005435 Ga0070714_100245359 Ga0070714_1002453591 274
296 3300005439 Ga0070711_100059511 Ga0070711_1000595112 274
297 3300025261 Ga0209233_1003978 Ga0209233_10039782 274
298 3300025906 Ga0207699_10011571 Ga0207699_100115712 274
299 3300025915 Ga0207693_10012377 Ga0207693_100123774 274
300 3300025929 Ga0207664_10100910 Ga0207664_101009102 274
301 3300031711 Ga0265314_10005172 Ga0265314_100051723 274
302 3300021384 Ga0213876_10001966 Ga0213876_100019669 275
303 3300025921 Ga0207652_10094842 Ga0207652_100948422 275
304 3300035724 Ga0373933_0058496 Ga0373933_0058496_201_1232 275
305 3300036401 Ga0373937_0002520 Ga0373937_0002520_4769_5800 275
306 3300039437 Ga0436365_1466455 Ga0436365_1466455_8880_9911 275
307 3300039450 Ga0436363_0937763 Ga0436363_0937763_11450_12481 275
308 3300046459 Ga0495629_0147983 Ga0495629_0147983_536_1534 275
309 3300046533 Ga0495640_0062038 Ga0495640_0062038_346_1377 275
310 3300046663 Ga0495635_0009980 Ga0495635_0009980_2363_3394 275
311 3300047317 Ga0495604_0124284 Ga0495604_0124284_303_1334 275
312 3300047322 Ga0495680_0011098 Ga0495680_0011098_3200_4231 275
313 3300053077 Ga0495601_0000532 Ga0495601_0000532_18454_19485 275
314 3300053084 Ga0495595_0054127 Ga0495595_0054127_313_1344 275
315 3300053085 Ga0495619_0000134 Ga0495619_0000134_4114_5145 275
316 3300003856 Ga0058692_1004883 Ga0058692_10048833 276
317 3300006051 Ga0075364_10153432 Ga0075364_101534322 276
318 3300006871 Ga0075434_100244944 Ga0075434_1002449442 276
319 3300009094 Ga0111539_10015064 Ga0111539_1001506412 276
320 3300027312 Ga0209371_1000729 Ga0209371_100072920 276
321 3300030500 Ga0268256_1004292 Ga0268256_10042923 276
322 3300031595 Ga0265313_10123110 Ga0265313_101231101 276
323 3300050511 nmdc:mga08y16_25017_c1 nmdc:mga08y16_25017_c1_467_1489 276
324 3300025907 Ga0207645_10214618 Ga0207645_102146181 277
325 3300039438 Ga0436360_0554196 Ga0436360_0554196_23_1051 277
326 3300049568 Ga0501031_0019096 Ga0501031_0019096_1548_2576 277
327 3300049572 Ga0501036_0026623 Ga0501036_0026623_1937_2965 277
328 3300049575 Ga0501039_0022322 Ga0501039_0022322_1912_2940 277
329 3300049577 Ga0501041_0014361 Ga0501041_0014361_3011_4039 277
330 3300049580 Ga0501046_0044309 Ga0501046_0044309_1030_2058 277
331 3300049584 Ga0501068_0042570 Ga0501068_0042570_914_1942 277
332 3300049585 Ga0501069_0030996 Ga0501069_0030996_1366_2394 277
333 3300049586 Ga0501070_0172033 Ga0501070_0172033_261_1289 277
334 3300049591 Ga0501075_0112155 Ga0501075_0112155_444_1472 277
335 3300049592 Ga0501076_0048295 Ga0501076_0048295_731_1759 277
336 3300049593 Ga0501077_0046251 Ga0501077_0046251_122_1150 277
337 3300049742 Ga0501080_0088336 Ga0501080_0088336_1647_2675 277
338 3300049743 Ga0501081_0029430 Ga0501081_0029430_883_1911 277
339 3300049744 Ga0501083_0049381 Ga0501083_0049381_1250_2278 277
340 3300053096 Ga0500641_0003986 Ga0500641_0003986_3002_4027 277
341 3300006051 Ga0075364_10079571 Ga0075364_100795713 278
342 3300006051 Ga0075364_10210508 Ga0075364_102105082 278
343 3300006195 Ga0075366_10000720 Ga0075366_1000072010 278
344 3300006353 Ga0075370_10053644 Ga0075370_100536443 278
345 3300027312 Ga0209371_1024599 Ga0209371_10245991 278
346 3300030500 Ga0268256_1022380 Ga0268256_10223801 278
347 3300035692 Ga0373935_0097406 Ga0373935_0097406_794_1813 278
348 3300036401 Ga0373937_0010494 Ga0373937_0010494_6844_7878 278
349 3300037068 Ga0373925_0014258 Ga0373925_0014258_4005_5024 278
350 3300045836 Ga0466958_0189181 Ga0466958_0189181_90_1112 278
351 3300049593 Ga0501077_0076191 Ga0501077_0076191_1015_2040 278
352 3300050493 nmdc:mga0k408_13742_c1 nmdc:mga0k408_13742_c1_3130_4143 278
353 3300050496 nmdc:mga07m45_132840_c1 nmdc:mga07m45_132840_c1_382_1395 278
354 3300009551 Ga0105238_10065663 Ga0105238_100656634 279
355 3300014497 Ga0182008_10138261 Ga0182008_101382611 279
356 3300036647 Ga0316582_0074705 Ga0316582_0074705_424_1452 279
357 3300039437 Ga0436365_0304759 Ga0436365_0304759_7012_8040 279
358 3300039437 Ga0436365_1630180 Ga0436365_1630180_2573_3598 279
359 3300044693 Ga0466961_0069040 Ga0466961_0069040_134_1159 279
360 3300049578 Ga0501042_0062436 Ga0501042_0062436_656_1681 279
361 3300049590 Ga0501074_0060870 Ga0501074_0060870_59_1084 279
362 3300049592 Ga0501076_0041092 Ga0501076_0041092_482_1507 279
363 3300049593 Ga0501077_0087101 Ga0501077_0087101_595_1620 279
364 3300049741 Ga0501079_0035891 Ga0501079_0035891_770_1795 279
365 3300005439 Ga0070711_100131646 Ga0070711_1001316462 280
366 3300042005 Ga0439448_0048723 Ga0439448_0048723_271_1299 280
367 3300044842 Ga0466957_0150399 Ga0466957_0150399_22_1014 281
368 3300048912 Ga0496109_0155217 Ga0496109_0155217_312_1337 281
369 3300048918 Ga0496115_0088604 Ga0496115_0088604_1152_2168 281
370 3300049570 Ga0501033_0078659 Ga0501033_0078659_642_1670 281
371 3300001990 JGI24737J22298_10007387 JGI24737J22298_100073872 282
372 3300002067 JGI24735J21928_10037568 JGI24735J21928_100375682 282
373 3300002076 JGI24749J21850_1001685 JGI24749J21850_10016852 282
374 3300002459 JGI24751J29686_10005136 JGI24751J29686_100051362 282
375 3300005330 Ga0070690_100000506 Ga0070690_1000005066 282
376 3300005334 Ga0068869_100037466 Ga0068869_1000374663 282
377 3300005335 Ga0070666_10002984 Ga0070666_1000298411 282
378 3300005336 Ga0070680_100041348 Ga0070680_1000413484 282
379 3300005337 Ga0070682_100004821 Ga0070682_1000048213 282
380 3300005338 Ga0068868_100000904 Ga0068868_10000090417 282
381 3300005339 Ga0070660_100001178 Ga0070660_10000117811 282
382 3300005340 Ga0070689_100004127 Ga0070689_10000412711 282
383 3300005341 Ga0070691_10000155 Ga0070691_1000015515 282
384 3300005343 Ga0070687_100001299 Ga0070687_10000129910 282
385 3300005344 Ga0070661_100001464 Ga0070661_10000146412 282
386 3300005345 Ga0070692_10000912 Ga0070692_100009126 282
387 3300005347 Ga0070668_100000692 Ga0070668_10000069211 282
388 3300005353 Ga0070669_100000807 Ga0070669_1000008076 282
389 3300005354 Ga0070675_100001608 Ga0070675_10000160815 282
390 3300005355 Ga0070671_100001121 Ga0070671_1000011216 282
391 3300005356 Ga0070674_100001386 Ga0070674_1000013868 282
392 3300005364 Ga0070673_100000626 Ga0070673_10000062612 282
393 3300005365 Ga0070688_100000139 Ga0070688_10000013940 282
394 3300005367 Ga0070667_100005155 Ga0070667_1000051553 282
395 3300005406 Ga0070703_10035502 Ga0070703_100355023 282
396 3300005434 Ga0070709_10001924 Ga0070709_1000192413 282
397 3300005435 Ga0070714_100002022 Ga0070714_1000020227 282
398 3300005436 Ga0070713_100007833 Ga0070713_1000078335 282
399 3300005437 Ga0070710_10013755 Ga0070710_100137551 282
400 3300005438 Ga0070701_10001747 Ga0070701_100017472 282
401 3300005439 Ga0070711_100002491 Ga0070711_1000024916 282
402 3300005440 Ga0070705_100000298 Ga0070705_1000002982 282
403 3300005441 Ga0070700_100000648 Ga0070700_1000006487 282
404 3300005444 Ga0070694_100004154 Ga0070694_1000041543 282
405 3300005456 Ga0070678_100000734 Ga0070678_1000007348 282
406 3300005457 Ga0070662_100001979 Ga0070662_1000019799 282
407 3300005458 Ga0070681_10096980 Ga0070681_100969802 282
408 3300005459 Ga0068867_100012592 Ga0068867_1000125926 282
409 3300005466 Ga0070685_10002499 Ga0070685_1000249911 282
410 3300005530 Ga0070679_100020169 Ga0070679_1000201694 282
411 3300005535 Ga0070684_100108252 Ga0070684_1001082522 282
412 3300005536 Ga0070697_100023341 Ga0070697_1000233415 282
413 3300005539 Ga0068853_100013838 Ga0068853_1000138381 282
414 3300005543 Ga0070672_100001796 Ga0070672_10000179610 282
415 3300005544 Ga0070686_100000266 Ga0070686_10000026630 282
416 3300005545 Ga0070695_100000864 Ga0070695_1000008648 282
417 3300005547 Ga0070693_100000326 Ga0070693_1000003267 282
418 3300005548 Ga0070665_100019274 Ga0070665_1000192745 282
419 3300005549 Ga0070704_100003256 Ga0070704_10000325611 282
420 3300005563 Ga0068855_100007108 Ga0068855_1000071088 282
421 3300005577 Ga0068857_100007649 Ga0068857_1000076494 282
422 3300005578 Ga0068854_100000885 Ga0068854_10000088511 282
423 3300005614 Ga0068856_100002298 Ga0068856_10000229817 282
424 3300005615 Ga0070702_100000139 Ga0070702_10000013917 282
425 3300005616 Ga0068852_100001969 Ga0068852_10000196910 282
426 3300005618 Ga0068864_100011694 Ga0068864_1000116942 282
427 3300005718 Ga0068866_10006115 Ga0068866_100061152 282
428 3300005719 Ga0068861_100002618 Ga0068861_10000261812 282
429 3300005841 Ga0068863_100000834 Ga0068863_10000083419 282
430 3300005842 Ga0068858_100001979 Ga0068858_10000197915 282
431 3300005843 Ga0068860_100002133 Ga0068860_1000021332 282
432 3300005844 Ga0068862_100006042 Ga0068862_10000604210 282
433 3300006163 Ga0070715_10003350 Ga0070715_100033503 282
434 3300006173 Ga0070716_100000665 Ga0070716_1000006656 282
435 3300006175 Ga0070712_100000828 Ga0070712_10000082812 282
436 3300006358 Ga0068871_100020391 Ga0068871_1000203916 282
437 3300006844 Ga0075428_100011583 Ga0075428_1000115833 282
438 3300006871 Ga0075434_100038910 Ga0075434_1000389102 282
439 3300006880 Ga0075429_100007710 Ga0075429_1000077109 282
440 3300006881 Ga0068865_100010883 Ga0068865_1000108836 282
441 3300006914 Ga0075436_100046607 Ga0075436_1000466072 282
442 3300007076 Ga0075435_100044461 Ga0075435_1000444612 282
443 3300009093 Ga0105240_10222481 Ga0105240_102224813 282
444 3300009094 Ga0111539_10454921 Ga0111539_104549212 282
445 3300009098 Ga0105245_10000795 Ga0105245_100007954 282
446 3300009148 Ga0105243_10001724 Ga0105243_100017243 282
447 3300009174 Ga0105241_10003139 Ga0105241_100031395 282
448 3300009545 Ga0105237_10002479 Ga0105237_1000247912 282
449 3300009553 Ga0105249_10019431 Ga0105249_100194316 282
450 3300010375 Ga0105239_10015919 Ga0105239_100159193 282
451 3300011119 Ga0105246_10039290 Ga0105246_100392903 282
452 3300013100 Ga0157373_10153886 Ga0157373_101538861 282
453 3300013105 Ga0157369_10006851 Ga0157369_1000685110 282
454 3300013297 Ga0157378_10003370 Ga0157378_100033708 282
455 3300013306 Ga0163162_10018703 Ga0163162_100187034 282
456 3300013307 Ga0157372_10019119 Ga0157372_100191199 282
457 3300014326 Ga0157380_10001853 Ga0157380_1000185313 282
458 3300014745 Ga0157377_10005976 Ga0157377_100059766 282
459 3300014968 Ga0157379_10008173 Ga0157379_100081732 282
460 3300014969 Ga0157376_10000272 Ga0157376_100002729 282
461 3300017792 Ga0163161_10002256 Ga0163161_100022563 282
462 3300025321 Ga0207656_10024264 Ga0207656_100242642 282
463 3300025898 Ga0207692_10009314 Ga0207692_100093145 282
464 3300025901 Ga0207688_10004336 Ga0207688_100043368 282
465 3300025904 Ga0207647_10009490 Ga0207647_100094908 282
466 3300025906 Ga0207699_10001015 Ga0207699_1000101516 282
467 3300025907 Ga0207645_10003182 Ga0207645_100031826 282
468 3300025911 Ga0207654_10002679 Ga0207654_100026793 282
469 3300025912 Ga0207707_10160242 Ga0207707_101602422 282
470 3300025914 Ga0207671_10039935 Ga0207671_100399352 282
471 3300025915 Ga0207693_10000607 Ga0207693_1000060727 282
472 3300025916 Ga0207663_10027847 Ga0207663_100278472 282
473 3300025918 Ga0207662_10005337 Ga0207662_100053377 282
474 3300025919 Ga0207657_10000086 Ga0207657_1000008621 282
475 3300025921 Ga0207652_10137287 Ga0207652_101372873 282
476 3300025923 Ga0207681_10007570 Ga0207681_100075703 282
477 3300025924 Ga0207694_10084241 Ga0207694_100842412 282
478 3300025926 Ga0207659_10008710 Ga0207659_100087107 282
479 3300025927 Ga0207687_10003118 Ga0207687_100031183 282
480 3300025928 Ga0207700_10041040 Ga0207700_100410403 282
481 3300025929 Ga0207664_10174415 Ga0207664_101744152 282
482 3300025931 Ga0207644_10006653 Ga0207644_100066533 282
483 3300025932 Ga0207690_10002052 Ga0207690_100020529 282
484 3300025933 Ga0207706_10000234 Ga0207706_1000023446 282
485 3300025934 Ga0207686_10026555 Ga0207686_100265552 282
486 3300025935 Ga0207709_10014962 Ga0207709_100149623 282
487 3300025936 Ga0207670_10101130 Ga0207670_101011302 282
488 3300025937 Ga0207669_10040977 Ga0207669_100409772 282
489 3300025939 Ga0207665_10000120 Ga0207665_100001208 282
490 3300025940 Ga0207691_10000538 Ga0207691_1000053810 282
491 3300025941 Ga0207711_10007098 Ga0207711_100070989 282
492 3300025944 Ga0207661_10016618 Ga0207661_100166185 282
493 3300025945 Ga0207679_10003216 Ga0207679_100032168 282
494 3300025949 Ga0207667_10026394 Ga0207667_100263941 282
495 3300025960 Ga0207651_10000671 Ga0207651_100006719 282
496 3300025961 Ga0207712_10014439 Ga0207712_100144394 282
497 3300025972 Ga0207668_10019195 Ga0207668_100191952 282
498 3300025981 Ga0207640_10044405 Ga0207640_100444051 282
499 3300026041 Ga0207639_10067181 Ga0207639_100671812 282
500 3300026067 Ga0207678_10000048 Ga0207678_1000004818 282
501 3300026075 Ga0207708_10000443 Ga0207708_1000044328 282
502 3300026078 Ga0207702_10020692 Ga0207702_100206922 282
503 3300026089 Ga0207648_10246897 Ga0207648_102468972 282
504 3300026095 Ga0207676_10010515 Ga0207676_100105154 282
505 3300026116 Ga0207674_10003550 Ga0207674_1000355012 282
506 3300026118 Ga0207675_100000155 Ga0207675_10000015545 282
507 3300026121 Ga0207683_10001926 Ga0207683_1000192611 282
508 3300026142 Ga0207698_10006352 Ga0207698_100063528 282
509 3300027907 Ga0207428_10023841 Ga0207428_100238411 282
510 3300028379 Ga0268266_10024250 Ga0268266_100242503 282
511 3300028381 Ga0268264_10004457 Ga0268264_1000445711 282
512 3300035085 Ga0373929_0013142 Ga0373929_0013142_355_1383 282
513 3300035115 Ga0373941_0006186 Ga0373941_0006186_1212_2240 282
514 3300035691 Ga0373931_0047101 Ga0373931_0047101_388_1416 282
515 3300037471 Ga0395905_0025716 Ga0395905_0025716_4258_5286 282
516 3300038443 Ga0395901_0003430 Ga0395901_0003430_5401_6429 282
517 3300045836 Ga0466958_0111706 Ga0466958_0111706_107_1126 282
518 3300048903 Ga0496100_0050297 Ga0496100_0050297_118_1146 282
519 3300048904 Ga0496101_0005059 Ga0496101_0005059_3511_4539 282
520 3300048905 Ga0496102_0026747 Ga0496102_0026747_3383_4411 282
521 3300048906 Ga0496103_0006682 Ga0496103_0006682_4425_5453 282
522 3300048907 Ga0496104_0056535 Ga0496104_0056535_488_1516 282
523 3300048909 Ga0496106_0018910 Ga0496106_0018910_3210_4238 282
524 3300048910 Ga0496107_0005627 Ga0496107_0005627_3210_4238 282
525 3300048913 Ga0496110_0007056 Ga0496110_0007056_6019_7047 282
526 3300048914 Ga0496111_0017353 Ga0496111_0017353_3210_4238 282
527 3300048915 Ga0496112_0018639 Ga0496112_0018639_3747_4775 282
528 3300048916 Ga0496113_0005136 Ga0496113_0005136_1426_2454 282
529 3300048917 Ga0496114_0007979 Ga0496114_0007979_1426_2454 282
530 3300048918 Ga0496115_0053180 Ga0496115_0053180_668_1696 282
531 3300049589 Ga0501073_0136524 Ga0501073_0136524_376_1398 282
532 3300050510 nmdc:mga06r32_533507_c1 nmdc:mga06r32_533507_c1_72_1100 282
533 3300050511 nmdc:mga08y16_174255_c1 nmdc:mga08y16_174255_c1_279_1307 282
534 3300005327 Ga0070658_10127049 Ga0070658_101270491 283
535 3300006177 Ga0075362_10109335 Ga0075362_101093352 283
536 3300009098 Ga0105245_10427741 Ga0105245_104277412 283
537 3300013306 Ga0163162_10351018 Ga0163162_103510182 283
538 3300025909 Ga0207705_10074333 Ga0207705_100743331 283
539 3300048910 Ga0496107_0045415 Ga0496107_0045415_1604_2632 283
540 3300049823 Ga0501044_0000243 Ga0501044_0000243_30809_31831 283
541 3300005535 Ga0070684_100110930 Ga0070684_1001109303 284
542 3300009551 Ga0105238_10204562 Ga0105238_102045622 284
543 3300025924 Ga0207694_10245681 Ga0207694_102456812 284
544 3300039437 Ga0436365_0470321 Ga0436365_0470321_324_1349 284
545 3300006051 Ga0075364_10056584 Ga0075364_100565843 285
546 3300049587 Ga0501071_0096636 Ga0501071_0096636_95_1120 285
547 3300025972 Ga0207668_10149217 Ga0207668_101492172 286
548 3300035171 Ga0373946_0130182 Ga0373946_0130182_41_1060 286
549 3300049574 Ga0501038_0108873 Ga0501038_0108873_903_1889 286
550 3300009176 Ga0105242_10084848 Ga0105242_100848482 287
551 3300009177 Ga0105248_10018306 Ga0105248_100183063 287
552 3300025272 Ga0209455_1001210 Ga0209455_10012105 287
553 3300025934 Ga0207686_10160255 Ga0207686_101602552 287
554 3300025941 Ga0207711_10028742 Ga0207711_100287421 287
555 3300031250 Ga0265331_10025502 Ga0265331_100255023 287
556 3300035112 Ga0373932_0006296 Ga0373932_0006296_725_1744 287
557 3300035691 Ga0373931_0001104 Ga0373931_0001104_4729_5748 287
558 3300045049 Ga0466959_0090259 Ga0466959_0090259_124_1152 287
559 3300048904 Ga0496101_0046415 Ga0496101_0046415_128_1147 287
560 3300048915 Ga0496112_0076497 Ga0496112_0076497_2090_3109 287
561 3300048921 Ga0496118_0021504 Ga0496118_0021504_3167_4195 287
562 3300049575 Ga0501039_0119247 Ga0501039_0119247_828_1856 287
563 3300053096 Ga0500641_0003319 Ga0500641_0003319_589_1617 287
564 3300005340 Ga0070689_100002505 Ga0070689_10000250512 288
565 3300005356 Ga0070674_100072160 Ga0070674_1000721602 288
566 3300005365 Ga0070688_100009945 Ga0070688_1000099454 288
567 3300005459 Ga0068867_100047834 Ga0068867_1000478342 288
568 3300005544 Ga0070686_100056466 Ga0070686_1000564662 288
569 3300005617 Ga0068859_100501024 Ga0068859_1005010242 288
570 3300005840 Ga0068870_10070882 Ga0068870_100708823 288
571 3300005842 Ga0068858_100264509 Ga0068858_1002645092 288
572 3300005981 Ga0081538_10013324 Ga0081538_100133245 288
573 3300006881 Ga0068865_100192614 Ga0068865_1001926142 288
574 3300006931 Ga0097620_100501017 Ga0097620_1005010172 288
575 3300009101 Ga0105247_10057895 Ga0105247_100578952 288
576 3300009551 Ga0105238_10195955 Ga0105238_101959552 288
577 3300010375 Ga0105239_10389279 Ga0105239_103892792 288
578 3300013306 Ga0163162_10635719 Ga0163162_106357192 288
579 3300014325 Ga0163163_10137209 Ga0163163_101372092 288
580 3300025900 Ga0207710_10051150 Ga0207710_100511501 288
581 3300025901 Ga0207688_10096332 Ga0207688_100963321 288
582 3300025908 Ga0207643_10044356 Ga0207643_100443562 288
583 3300025918 Ga0207662_10027516 Ga0207662_100275164 288
584 3300025923 Ga0207681_10027077 Ga0207681_100270774 288
585 3300025931 Ga0207644_10304948 Ga0207644_103049482 288
586 3300025936 Ga0207670_10009279 Ga0207670_100092797 288
587 3300025937 Ga0207669_10062712 Ga0207669_100627122 288
588 3300026035 Ga0207703_10163721 Ga0207703_101637211 288
589 3300026067 Ga0207678_10273436 Ga0207678_102734362 288
590 3300026089 Ga0207648_10034341 Ga0207648_100343413 288
591 3300026095 Ga0207676_10172389 Ga0207676_101723892 288
592 3300026121 Ga0207683_10064387 Ga0207683_100643872 288
593 3300035207 Ga0373942_0005006 Ga0373942_0005006_2038_3057 288
594 3300035725 Ga0373947_0060879 Ga0373947_0060879_1142_2161 288
595 3300048903 Ga0496100_0081171 Ga0496100_0081171_344_1363 288
596 3300048909 Ga0496106_0031586 Ga0496106_0031586_587_1606 288
597 3300048913 Ga0496110_0020979 Ga0496110_0020979_2392_3411 288
598 3300048914 Ga0496111_0045673 Ga0496111_0045673_1906_2925 288
599 3300048916 Ga0496113_0283287 Ga0496113_0283287_31_1026 288
600 3300048917 Ga0496114_0017775 Ga0496114_0017775_4051_5070 288
601 3300048921 Ga0496118_0098658 Ga0496118_0098658_844_1872 288
602 3300048927 Ga0496124_0085289 Ga0496124_0085289_379_1407 288
603 3300049588 Ga0501072_0008450 Ga0501072_0008450_6481_7494 288
604 3300053111 Ga0500572_000177 Ga0500572_000177_7558_8586 288
605 3300053136 Ga0500559_0000980 Ga0500559_0000980_15655_16683 288
606 3300053163 Ga0500639_003548 Ga0500639_003548_262_1290 288
607 3300053725 Ga0500576_080247 Ga0500576_080247_206_1234 288
608 3300005441 Ga0070700_100198047 Ga0070700_1001980471 289
609 3300006844 Ga0075428_100007488 Ga0075428_1000074886 289
610 3300006847 Ga0075431_100001907 Ga0075431_10000190712 289
611 3300009094 Ga0111539_10000178 Ga0111539_1000017818 289
612 3300009147 Ga0114129_10001129 Ga0114129_1000112917 289
613 3300027907 Ga0207428_10030696 Ga0207428_100306962 289
614 3300046520 Ga0495637_0030494 Ga0495637_0030494_99_1124 289
615 3300046615 Ga0495656_0002300 Ga0495656_0002300_485_1510 289
616 3300048907 Ga0496104_0050693 Ga0496104_0050693_749_1774 289
617 3300048908 Ga0496105_0140260 Ga0496105_0140260_353_1378 289
618 3300048909 Ga0496106_0405201 Ga0496106_0405201_25_1050 289
619 3300048917 Ga0496114_0019575 Ga0496114_0019575_1839_2864 289
620 3300049586 Ga0501070_0202178 Ga0501070_0202178_311_1336 289
621 3300049590 Ga0501074_0024159 Ga0501074_0024159_2352_3377 289
622 3300049741 Ga0501079_0072432 Ga0501079_0072432_898_1923 289
623 3300050494 nmdc:mga06z11_228786_c1 nmdc:mga06z11_228786_c1_14_1039 289
624 3300050507 nmdc:mga05p37_743_c1 nmdc:mga05p37_743_c1_20431_21456 289
625 3300050508 nmdc:mga09592_781_c1 nmdc:mga09592_781_c1_19426_20451 289
626 3300050510 nmdc:mga06r32_15926_c1 nmdc:mga06r32_15926_c1_3068_4093 289
627 3300050511 nmdc:mga08y16_121_c1 nmdc:mga08y16_121_c1_14562_15587 289
628 3300039438 Ga0436360_0776902 Ga0436360_0776902_488_1510 290
629 3300048915 Ga0496112_0471992 Ga0496112_0471992_39_1064 290
630 3300049589 Ga0501073_0024498 Ga0501073_0024498_830_1855 290
631 3300005434 Ga0070709_10003157 Ga0070709_100031578 291
632 3300005434 Ga0070709_10101995 Ga0070709_101019952 291
633 3300005435 Ga0070714_100002527 Ga0070714_1000025275 291
634 3300005435 Ga0070714_100042896 Ga0070714_1000428964 291
635 3300005436 Ga0070713_100012977 Ga0070713_1000129774 291
636 3300005439 Ga0070711_100196848 Ga0070711_1001968482 291
637 3300005563 Ga0068855_100407744 Ga0068855_1004077441 291
638 3300005614 Ga0068856_100321961 Ga0068856_1003219612 291
639 3300005983 Ga0081540_1007455 Ga0081540_10074556 291
640 3300006028 Ga0070717_10004121 Ga0070717_100041218 291
641 3300006163 Ga0070715_10004973 Ga0070715_100049733 291
642 3300006173 Ga0070716_100017392 Ga0070716_1000173922 291
643 3300006175 Ga0070712_100048016 Ga0070712_1000480162 291
644 3300006175 Ga0070712_100160370 Ga0070712_1001603702 291
645 3300006871 Ga0075434_100027681 Ga0075434_1000276815 291
646 3300006914 Ga0075436_100028674 Ga0075436_1000286744 291
647 3300009551 Ga0105238_10291349 Ga0105238_102913492 291
648 3300013306 Ga0163162_10709368 Ga0163162_107093681 291
649 3300025898 Ga0207692_10013506 Ga0207692_100135061 291
650 3300025912 Ga0207707_10317586 Ga0207707_103175861 291
651 3300025915 Ga0207693_10007266 Ga0207693_100072667 291
652 3300025915 Ga0207693_10008135 Ga0207693_100081355 291
653 3300025916 Ga0207663_10014213 Ga0207663_100142133 291
654 3300025929 Ga0207664_10011218 Ga0207664_100112186 291
655 3300025929 Ga0207664_10479577 Ga0207664_104795771 291
656 3300025939 Ga0207665_10029075 Ga0207665_100290753 291
657 3300025944 Ga0207661_10282717 Ga0207661_102827172 291
658 3300025981 Ga0207640_10071720 Ga0207640_100717201 291
659 3300026142 Ga0207698_10304829 Ga0207698_103048291 291
660 3300031235 Ga0265330_10095647 Ga0265330_100956471 291
661 3300031249 Ga0265339_10065515 Ga0265339_100655153 291
662 3300031344 Ga0265316_10045413 Ga0265316_100454133 291
663 3300031711 Ga0265314_10062854 Ga0265314_100628543 291
664 3300048903 Ga0496100_0051089 Ga0496100_0051089_301_1317 291
665 3300048904 Ga0496101_0033101 Ga0496101_0033101_1721_2737 291
666 3300048909 Ga0496106_0052756 Ga0496106_0052756_1408_2424 291
667 3300048913 Ga0496110_0172436 Ga0496110_0172436_794_1810 291
668 3300050492 nmdc:mga0yw44_73177_c1 nmdc:mga0yw44_73177_c1_979_2004 291
669 3300050512 nmdc:mga0n895_180704_c1 nmdc:mga0n895_180704_c1_799_1815 291
670 3300050512 nmdc:mga0n895_26889_c1 nmdc:mga0n895_26889_c1_3464_4480 291
671 3300050513 nmdc:mga0rr50_84733_c1 nmdc:mga0rr50_84733_c1_1213_2229 291
672 3300050514 nmdc:mga08x19_122291_c1 nmdc:mga08x19_122291_c1_492_1520 291
673 3300050514 nmdc:mga08x19_90761_c1 nmdc:mga08x19_90761_c1_390_1406 291
674 3300053122 Ga0500608_111432 Ga0500608_111432_224_1240 291
675 iso_pu_bacteria 2545555834 2545678357 291
676 iso_pu_bacteria 2595698237 2596374533 291
677 iso_pu_bacteria 2643221733 2644728534 291
678 iso_pu_bacteria 2829745981 2829747244 291
679 iso_pu_bacteria 2841911363 2841914233 291
680 iso_pu_bacteria 2841917233 2841921436 291
681 iso_pu_bacteria 2861691609 2861692344 291
682 iso_pu_bacteria 2889306138 2889310506 291
683 iso_pu_bacteria 2902330777 2902335725 291
684 iso_pu_bacteria 2902405164 2902405824 291
685 iso_pu_bacteria 2928125067 2928125171 291
686 iso_pu_bacteria 641522639 641643266 291
687 iso_pu_bacteria 643348564 643602185 291
688 3300005339 Ga0070660_100017321 Ga0070660_1000173213 292
689 3300005366 Ga0070659_100330878 Ga0070659_1003308782 292
690 3300005436 Ga0070713_100347326 Ga0070713_1003473261 292
691 3300005577 Ga0068857_100089166 Ga0068857_1000891664 292
692 3300006846 Ga0075430_100010104 Ga0075430_1000101047 292
693 3300006852 Ga0075433_10054818 Ga0075433_100548183 292
694 3300009093 Ga0105240_10075491 Ga0105240_100754912 292
695 3300009147 Ga0114129_10536806 Ga0114129_105368061 292
696 3300009551 Ga0105238_10098196 Ga0105238_100981961 292
697 3300021384 Ga0213876_10103388 Ga0213876_101033882 292
698 3300025919 Ga0207657_10053517 Ga0207657_100535172 292
699 3300026116 Ga0207674_10065797 Ga0207674_100657974 292
700 3300027717 Ga0209998_10011035 Ga0209998_100110351 292
701 3300033180 Ga0307510_10177783 Ga0307510_101777831 292
702 3300039437 Ga0436365_1501331 Ga0436365_1501331_867_1895 292
703 3300039447 Ga0436361_0504819 Ga0436361_0504819_198_1271 292
704 3300044694 Ga0466963_0025056 Ga0466963_0025056_1768_2796 292
705 3300045976 Ga0466967_0352298 Ga0466967_0352298_259_1287 292
706 3300048903 Ga0496100_0035039 Ga0496100_0035039_957_1970 292
707 3300048907 Ga0496104_0089100 Ga0496104_0089100_1125_2153 292
708 3300048909 Ga0496106_0290130 Ga0496106_0290130_19_1047 292
709 3300048921 Ga0496118_0138653 Ga0496118_0138653_185_1222 292
710 3300050509 nmdc:mga0qj67_110596_c1 nmdc:mga0qj67_110596_c1_810_1835 292
711 3300050510 nmdc:mga06r32_41405_c1 nmdc:mga06r32_41405_c1_2942_3967 292
712 3300050512 nmdc:mga0n895_182347_c1 nmdc:mga0n895_182347_c1_1039_2064 292
713 3300050515 nmdc:mga0a205_64995_c1 nmdc:mga0a205_64995_c1_950_1975 292
714 3300053096 Ga0500641_0016480 Ga0500641_0016480_535_1548 292
715 3300061719 Ga0466962_0044264 Ga0466962_0044264_276_1304 292
716 3300009094 Ga0111539_10097907 Ga0111539_100979072 293
717 3300031616 Ga0307508_10000012 Ga0307508_10000012165 293
718 3300046664 Ga0495659_0093143 Ga0495659_0093143_81_1106 293
719 3300049824 Ga0501045_0195841 Ga0501045_0195841_442_1467 293
720 3300050511 nmdc:mga08y16_77399_c1 nmdc:mga08y16_77399_c1_1523_2536 293
721 iso_pu_bacteria 3003665799 3003670356 293
722 3300005336 Ga0070680_100027539 Ga0070680_1000275393 294
723 3300005339 Ga0070660_100087257 Ga0070660_1000872572 294
724 3300005458 Ga0070681_10006054 Ga0070681_100060549 294
725 3300005530 Ga0070679_100128056 Ga0070679_1001280562 294
726 3300006195 Ga0075366_10104284 Ga0075366_101042842 294
727 3300021384 Ga0213876_10122080 Ga0213876_101220801 294
728 3300025917 Ga0207660_10043311 Ga0207660_100433112 294
729 3300025919 Ga0207657_10079892 Ga0207657_100798922 294
730 3300025921 Ga0207652_10024214 Ga0207652_100242143 294
731 3300035692 Ga0373935_0198344 Ga0373935_0198344_36_1061 294
732 3300046473 Ga0495582_0051531 Ga0495582_0051531_861_1886 294
733 3300046615 Ga0495656_0009606 Ga0495656_0009606_1901_2929 294
734 3300046681 Ga0495647_0027549 Ga0495647_0027549_17_1042 294
735 3300049593 Ga0501077_0029791 Ga0501077_0029791_1112_2140 294
736 3300049743 Ga0501081_0020098 Ga0501081_0020098_838_1866 294
737 3300050493 nmdc:mga0k408_17367_c1 nmdc:mga0k408_17367_c1_671_1681 294
738 3300050494 nmdc:mga06z11_18492_c1 nmdc:mga06z11_18492_c1_569_1579 294
739 3300060353 Ga0501082_0070022 Ga0501082_0070022_41_1054 294
740 iso_pu_bacteria 2671180139 2671691843 294
741 3300003215 JGI25153J46596_10007775 JGI25153J46596_100077752 295
742 3300005334 Ga0068869_100093831 Ga0068869_1000938312 295
743 3300005354 Ga0070675_100431566 Ga0070675_1004315661 295
744 3300005458 Ga0070681_10074337 Ga0070681_100743372 295
745 3300005843 Ga0068860_100153885 Ga0068860_1001538852 295
746 3300006178 Ga0075367_10170213 Ga0075367_101702132 295
747 3300006358 Ga0068871_100134484 Ga0068871_1001344842 295
748 3300006846 Ga0075430_100000194 Ga0075430_10000019424 295
749 3300006942 Ga0099824_1021728 Ga0099824_10217284 295
750 3300013104 Ga0157370_10096163 Ga0157370_100961632 295
751 3300014325 Ga0163163_10057400 Ga0163163_100574002 295
752 3300025261 Ga0209233_1001411 Ga0209233_10014113 295
753 3300025297 Ga0209758_1000382 Ga0209758_10003822 295
754 3300025913 Ga0207695_10146479 Ga0207695_101464792 295
755 3300025942 Ga0207689_10147605 Ga0207689_101476052 295
756 3300025949 Ga0207667_10192076 Ga0207667_101920762 295
757 3300027296 Ga0209389_1000034 Ga0209389_100003421 295
758 3300027357 Ga0209589_1000038 Ga0209589_100003899 295
759 3300027361 Ga0209489_100023 Ga0209489_10002394 295
760 3300031240 Ga0265320_10092642 Ga0265320_100926422 295
761 3300031241 Ga0265325_10014755 Ga0265325_100147552 295
762 3300031242 Ga0265329_10071541 Ga0265329_100715411 295
763 3300031247 Ga0265340_10033670 Ga0265340_100336702 295
764 3300031344 Ga0265316_10127390 Ga0265316_101273902 295
765 3300031456 Ga0307513_10229070 Ga0307513_102290702 295
766 3300031595 Ga0265313_10035182 Ga0265313_100351824 295
767 3300031665 Ga0316575_10005549 Ga0316575_100055493 295
768 3300031691 Ga0316579_10000697 Ga0316579_1000069711 295
769 3300031711 Ga0265314_10056160 Ga0265314_100561602 295
770 3300031712 Ga0265342_10023484 Ga0265342_100234842 295
771 3300031727 Ga0316576_10090234 Ga0316576_100902341 295
772 3300031728 Ga0316578_10064945 Ga0316578_100649452 295
773 3300031733 Ga0316577_10014741 Ga0316577_100147412 295
774 3300032133 Ga0316583_10003003 Ga0316583_100030036 295
775 3300032137 Ga0316585_10003818 Ga0316585_100038182 295
776 3300032139 Ga0316580_10000948 Ga0316580_100009486 295
777 3300033541 Ga0316596_1026098 Ga0316596_10260982 295
778 3300036647 Ga0316582_0084831 Ga0316582_0084831_1012_2040 295
779 3300036712 Ga0316584_0002253 Ga0316584_0002253_8786_9814 295
780 3300037588 Ga0316581_0000324 Ga0316581_0000324_2168_3196 295
781 3300041408 Ga0439453_0000430 Ga0439453_0000430_592_1605 295
782 3300046460 Ga0495638_0034095 Ga0495638_0034095_1175_2188 295
783 3300046474 Ga0495605_0038492 Ga0495605_0038492_1094_2107 295
784 3300046664 Ga0495659_0009162 Ga0495659_0009162_451_1479 295
785 3300050509 nmdc:mga0qj67_103_c1 nmdc:mga0qj67_103_c1_20828_21847 295
786 3300053153 Ga0500616_0100980 Ga0500616_0100980_301_1314 295
787 3300035111 Ga0373923_0001014 Ga0373923_0001014_3078_4103 296
788 3300035116 Ga0373945_0001639 Ga0373945_0001639_1151_2176 296
789 3300035117 Ga0373953_0074506 Ga0373953_0074506_332_1357 296
790 3300035118 Ga0373954_0002928 Ga0373954_0002928_2403_3428 296
791 3300035119 Ga0373956_0009029 Ga0373956_0009029_1515_2540 296
792 3300035170 Ga0373943_0003886 Ga0373943_0003886_2312_3337 296
793 3300035171 Ga0373946_0002901 Ga0373946_0002901_438_1463 296
794 3300035172 Ga0373955_0001221 Ga0373955_0001221_5669_6694 296
795 3300035410 Ga0373924_0011619 Ga0373924_0011619_1625_2650 296
796 3300035692 Ga0373935_0003708 Ga0373935_0003708_3479_4504 296
797 3300035695 Ga0373927_0006337 Ga0373927_0006337_2093_3118 296
798 3300035724 Ga0373933_0005193 Ga0373933_0005193_4940_5965 296
799 3300035725 Ga0373947_0005376 Ga0373947_0005376_4919_5944 296
800 3300036401 Ga0373937_0000058 Ga0373937_0000058_79160_80185 296
801 3300037068 Ga0373925_0000036 Ga0373925_0000036_5879_6904 296
802 3300044694 Ga0466963_0130010 Ga0466963_0130010_647_1672 296
803 3300045976 Ga0466967_0460219 Ga0466967_0460219_169_1194 296
804 3300046454 Ga0495592_0000232 Ga0495592_0000232_44741_45766 296
805 3300046459 Ga0495629_0015449 Ga0495629_0015449_1197_2222 296
806 3300046462 Ga0495651_0001333 Ga0495651_0001333_6435_7460 296
807 3300046463 Ga0495653_0000069 Ga0495653_0000069_3538_4563 296
808 3300046473 Ga0495582_0041078 Ga0495582_0041078_1006_2031 296
809 3300046476 Ga0495662_0000613 Ga0495662_0000613_15425_16450 296
810 3300046477 Ga0495664_0000010 Ga0495664_0000010_18830_19855 296
811 3300046511 Ga0495608_0000008 Ga0495608_0000008_248794_249819 296
812 3300046514 Ga0495618_0000002 Ga0495618_0000002_21103_22128 296
813 3300046516 Ga0495628_0000009 Ga0495628_0000009_18858_19883 296
814 3300046517 Ga0495630_0001382 Ga0495630_0001382_10943_11968 296
815 3300046529 Ga0495652_0000011 Ga0495652_0000011_248484_249509 296
816 3300046533 Ga0495640_0000009 Ga0495640_0000009_197236_198261 296
817 3300046535 Ga0495586_0192144 Ga0495586_0192144_26_1051 296
818 3300046536 Ga0495587_0000006 Ga0495587_0000006_132576_133601 296
819 3300046543 Ga0495645_0000010 Ga0495645_0000010_217857_218882 296
820 3300046559 Ga0495667_0000005 Ga0495667_0000005_18858_19883 296
821 3300046642 Ga0495634_0000055 Ga0495634_0000055_18846_19871 296
822 3300046663 Ga0495635_0000008 Ga0495635_0000008_248467_249492 296
823 3300046675 Ga0495657_0000470 Ga0495657_0000470_21131_22156 296
824 3300046678 Ga0495599_0000250 Ga0495599_0000250_11845_12870 296
825 3300046679 Ga0495623_0000004 Ga0495623_0000004_54523_55548 296
826 3300046680 Ga0495646_0000040 Ga0495646_0000040_51486_52511 296
827 3300046683 Ga0495658_0114604 Ga0495658_0114604_78_1103 296
828 3300046689 Ga0495613_0061740 Ga0495613_0061740_474_1499 296
829 3300046690 Ga0495624_0031025 Ga0495624_0031025_2304_3329 296
830 3300046809 Ga0495600_0000080 Ga0495600_0000080_18847_19872 296
831 3300047315 Ga0495581_0004214 Ga0495581_0004214_5458_6483 296
832 3300047317 Ga0495604_0000012 Ga0495604_0000012_18845_19870 296
833 3300047319 Ga0495674_0000011 Ga0495674_0000011_21131_22156 296
834 3300047321 Ga0495676_0051544 Ga0495676_0051544_311_1336 296
835 3300047322 Ga0495680_0001797 Ga0495680_0001797_18075_19100 296
836 3300047444 Ga0495675_0000468 Ga0495675_0000468_18839_19864 296
837 3300047471 Ga0495684_0000014 Ga0495684_0000014_18847_19872 296
838 3300047673 Ga0495593_0000650 Ga0495593_0000650_3296_4321 296
839 3300048088 Ga0495602_0000019 Ga0495602_0000019_18823_19848 296
840 3300053077 Ga0495601_0000009 Ga0495601_0000009_248467_249492 296
841 3300053078 Ga0495612_0000021 Ga0495612_0000021_18737_19762 296
842 3300053084 Ga0495595_0000067 Ga0495595_0000067_21817_22842 296
843 3300053085 Ga0495619_0000012 Ga0495619_0000012_248467_249492 296
844 iso_pu_bacteria 2508501050 2508725257 296
845 iso_pu_bacteria 2508501114 2509077286 296
846 iso_pu_bacteria 2773857925 2774870762 296
847 iso_pu_bacteria 2775506901 2776262263 296
848 iso_pu_bacteria 2835312727 2835315930 296
849 iso_pu_bacteria 2882456835 2882458827 296
850 iso_pu_bacteria 2884298095 2884298918 296
851 iso_pu_bacteria 2894232714 2894237640 296
852 3300009098 Ga0105245_10062246 Ga0105245_100622465 297
853 3300031238 Ga0265332_10003645 Ga0265332_100036455 297
854 3300031247 Ga0265340_10000617 Ga0265340_1000061714 297
855 3300031249 Ga0265339_10002621 Ga0265339_100026218 297
856 3300031712 Ga0265342_10000681 Ga0265342_1000068110 297
857 3300049570 Ga0501033_0006959 Ga0501033_0006959_685_1704 297
858 3300049581 Ga0501047_0062756 Ga0501047_0062756_2370_3389 297
859 3300049586 Ga0501070_0053237 Ga0501070_0053237_2290_3309 297
860 3300049586 Ga0501070_0076633 Ga0501070_0076633_305_1324 297
861 3300060353 Ga0501082_0031321 Ga0501082_0031321_3367_4389 297
862 iso_pu_bacteria 2513237096 2513655325 297
863 iso_pu_bacteria 2513237137 2513861572 297
864 iso_pu_bacteria 2517572143 2517889813 297
865 iso_pu_bacteria 2524023210 2524465356 297
866 iso_pu_bacteria 2791355199 2793078900 297
867 iso_pu_bacteria 2903748898 2903750770 297
868 iso_pu_bacteria 2906635258 2906642481 297
869 iso_pu_bacteria 2906660503 2906661065 297
870 iso_pu_bacteria 8056673599 8056675321 297
871 3300003659 JGI25404J52841_10004221 JGI25404J52841_100042212 298
872 3300005518 Ga0070699_100007777 Ga0070699_1000077777 298
873 3300005983 Ga0081540_1000054 Ga0081540_100005470 298
874 3300007265 Ga0099794_10076104 Ga0099794_100761041 298
875 3300021361 Ga0213872_10021080 Ga0213872_100210801 298
876 3300031241 Ga0265325_10000254 Ga0265325_1000025413 298
877 3300035695 Ga0373927_0122295 Ga0373927_0122295_366_1409 298
878 3300036401 Ga0373937_0259175 Ga0373937_0259175_327_1349 298
879 3300037068 Ga0373925_0090824 Ga0373925_0090824_722_1765 298
880 3300039447 Ga0436361_0575176 Ga0436361_0575176_7265_8290 298
881 3300046533 Ga0495640_0038316 Ga0495640_0038316_913_1956 298
882 3300049569 Ga0501032_0014993 Ga0501032_0014993_779_1801 298
883 3300049570 Ga0501033_0090649 Ga0501033_0090649_401_1423 298
884 3300049571 Ga0501034_0065445 Ga0501034_0065445_1956_2978 298
885 3300049572 Ga0501036_0073086 Ga0501036_0073086_1712_2734 298
886 3300049574 Ga0501038_0134415 Ga0501038_0134415_814_1836 298
887 3300049575 Ga0501039_0001760 Ga0501039_0001760_14104_15126 298
888 3300049578 Ga0501042_0047096 Ga0501042_0047096_184_1206 298
889 3300049579 Ga0501043_0005622 Ga0501043_0005622_9045_10067 298
890 3300049582 Ga0501048_0004377 Ga0501048_0004377_6461_7483 298
891 3300049583 Ga0501067_0002747 Ga0501067_0002747_5379_6401 298
892 3300049584 Ga0501068_0005068 Ga0501068_0005068_5396_6418 298
893 3300049587 Ga0501071_0008700 Ga0501071_0008700_16_1038 298
894 3300049589 Ga0501073_0011487 Ga0501073_0011487_2716_3741 298
895 3300049589 Ga0501073_0083635 Ga0501073_0083635_798_1820 298
896 3300049590 Ga0501074_0023427 Ga0501074_0023427_670_1692 298
897 3300049742 Ga0501080_0017834 Ga0501080_0017834_4736_5758 298
898 3300049744 Ga0501083_0014471 Ga0501083_0014471_4366_5388 298
899 3300049822 Ga0501035_0074868 Ga0501035_0074868_401_1423 298
900 3300049823 Ga0501044_0138743 Ga0501044_0138743_670_1692 298
901 3300049824 Ga0501045_0002689 Ga0501045_0002689_1429_2451 298
902 3300060353 Ga0501082_0034986 Ga0501082_0034986_18_1040 298
903 3300005439 Ga0070711_100003965 Ga0070711_1000039654 299
904 3300005471 Ga0070698_100044278 Ga0070698_1000442786 299
905 3300007788 Ga0099795_10003412 Ga0099795_100034123 299
906 3300009094 Ga0111539_10802949 Ga0111539_108029491 299
907 3300009147 Ga0114129_10001774 Ga0114129_1000177422 299
908 3300021384 Ga0213876_10187315 Ga0213876_101873151 299
909 3300025915 Ga0207693_10004165 Ga0207693_100041659 299
910 3300025939 Ga0207665_10186652 Ga0207665_101866522 299
911 3300027512 Ga0209179_1018677 Ga0209179_10186772 299
912 3300048903 Ga0496100_0063231 Ga0496100_0063231_480_1511 299
913 3300048904 Ga0496101_0096854 Ga0496101_0096854_666_1697 299
914 3300048904 Ga0496101_0299598 Ga0496101_0299598_101_1129 299
915 3300048906 Ga0496103_0024965 Ga0496103_0024965_1310_2341 299
916 3300048909 Ga0496106_0004959 Ga0496106_0004959_253_1284 299
917 3300048910 Ga0496107_0013265 Ga0496107_0013265_1949_2980 299
918 3300048911 Ga0496108_0075064 Ga0496108_0075064_1463_2494 299
919 3300048912 Ga0496109_0172732 Ga0496109_0172732_339_1367 299
920 3300048918 Ga0496115_0049839 Ga0496115_0049839_416_1447 299
921 3300050507 nmdc:mga05p37_7845_c1 nmdc:mga05p37_7845_c1_8744_9772 299
922 3300002077 JGI24744J21845_10017503 JGI24744J21845_100175032 300
923 3300002244 JGI24742J22300_10011595 JGI24742J22300_100115952 300
924 3300005328 Ga0070676_10000987 Ga0070676_100009875 300
925 3300005329 Ga0070683_100021229 Ga0070683_1000212295 300
926 3300005336 Ga0070680_100129620 Ga0070680_1001296202 300
927 3300005339 Ga0070660_100003975 Ga0070660_1000039754 300
928 3300005343 Ga0070687_100098019 Ga0070687_1000980192 300
929 3300005356 Ga0070674_100054253 Ga0070674_1000542533 300
930 3300005441 Ga0070700_100069729 Ga0070700_1000697292 300
931 3300005458 Ga0070681_10054547 Ga0070681_100545472 300
932 3300005459 Ga0068867_100048863 Ga0068867_1000488632 300
933 3300005530 Ga0070679_100383868 Ga0070679_1003838682 300
934 3300005535 Ga0070684_100017742 Ga0070684_1000177423 300
935 3300005539 Ga0068853_100005313 Ga0068853_1000053138 300
936 3300005548 Ga0070665_100298903 Ga0070665_1002989032 300
937 3300005563 Ga0068855_100036393 Ga0068855_1000363934 300
938 3300005577 Ga0068857_100130927 Ga0068857_1001309272 300
939 3300005617 Ga0068859_100009674 Ga0068859_1000096749 300
940 3300005843 Ga0068860_100163311 Ga0068860_1001633113 300
941 3300005937 Ga0081455_10003325 Ga0081455_1000332515 300
942 3300005983 Ga0081540_1097568 Ga0081540_10975682 300
943 3300006237 Ga0097621_100267583 Ga0097621_1002675832 300
944 3300006931 Ga0097620_100009674 Ga0097620_1000096749 300
945 3300009093 Ga0105240_10046855 Ga0105240_100468554 300
946 3300009101 Ga0105247_10002881 Ga0105247_100028818 300
947 3300009177 Ga0105248_10157262 Ga0105248_101572625 300
948 3300009545 Ga0105237_10011410 Ga0105237_100114102 300
949 3300009551 Ga0105238_10006964 Ga0105238_100069644 300
950 3300009551 Ga0105238_10094208 Ga0105238_100942082 300
951 3300009553 Ga0105249_10120341 Ga0105249_101203413 300
952 3300010375 Ga0105239_10066301 Ga0105239_100663012 300
953 3300013102 Ga0157371_10013083 Ga0157371_100130835 300
954 3300013102 Ga0157371_10263354 Ga0157371_102633541 300
955 3300013104 Ga0157370_10118189 Ga0157370_101181892 300
956 3300013105 Ga0157369_10006718 Ga0157369_100067185 300
957 3300013296 Ga0157374_10249472 Ga0157374_102494722 300
958 3300013306 Ga0163162_10233532 Ga0163162_102335322 300
959 3300013308 Ga0157375_10006188 Ga0157375_100061888 300
960 3300013308 Ga0157375_10067850 Ga0157375_100678505 300
961 3300014326 Ga0157380_10074213 Ga0157380_100742133 300
962 3300025321 Ga0207656_10030108 Ga0207656_100301082 300
963 3300025885 Ga0207653_10024206 Ga0207653_100242062 300
964 3300025912 Ga0207707_10016749 Ga0207707_100167493 300
965 3300025913 Ga0207695_10115370 Ga0207695_101153702 300
966 3300025914 Ga0207671_10056119 Ga0207671_100561193 300
967 3300025917 Ga0207660_10004044 Ga0207660_100040442 300
968 3300025918 Ga0207662_10051140 Ga0207662_100511403 300
969 3300025921 Ga0207652_10070440 Ga0207652_100704402 300
970 3300025924 Ga0207694_10009826 Ga0207694_100098265 300
971 3300025933 Ga0207706_10039839 Ga0207706_100398393 300
972 3300025935 Ga0207709_10006140 Ga0207709_100061405 300
973 3300025938 Ga0207704_10025319 Ga0207704_100253192 300
974 3300025942 Ga0207689_10016336 Ga0207689_100163361 300
975 3300025944 Ga0207661_10027740 Ga0207661_100277402 300
976 3300025949 Ga0207667_10007354 Ga0207667_100073545 300
977 3300025961 Ga0207712_10013620 Ga0207712_100136205 300
978 3300026075 Ga0207708_10121060 Ga0207708_101210602 300
979 3300026089 Ga0207648_10040596 Ga0207648_100405964 300
980 3300026116 Ga0207674_10058414 Ga0207674_100584143 300
981 3300026118 Ga0207675_100125719 Ga0207675_1001257192 300
982 3300031235 Ga0265330_10004963 Ga0265330_100049636 300
983 3300031235 Ga0265330_10022124 Ga0265330_100221243 300
984 3300031247 Ga0265340_10015541 Ga0265340_100155412 300
985 3300031344 Ga0265316_10105018 Ga0265316_101050182 300
986 3300033442 Ga0315911_1000005 Ga0315911_1000005201 300
987 3300034957 Ga0373938_0010032 Ga0373938_0010032_666_1694 300
988 3300037466 Ga0395898_0232753 Ga0395898_0232753_62_1090 300
989 3300039447 Ga0436361_0126718 Ga0436361_0126718_296_1333 300
990 3300046457 Ga0495590_0032126 Ga0495590_0032126_424_1452 300
991 3300046477 Ga0495664_0135693 Ga0495664_0135693_56_1084 300
992 3300046615 Ga0495656_0024270 Ga0495656_0024270_140_1168 300
993 3300048909 Ga0496106_0031501 Ga0496106_0031501_133_1161 300
994 3300048918 Ga0496115_0044821 Ga0496115_0044821_1731_2759 300
995 3300048929 Ga0496126_0016337 Ga0496126_0016337_2020_3048 300
996 3300049568 Ga0501031_0002788 Ga0501031_0002788_3907_4935 300
997 3300049569 Ga0501032_0000301 Ga0501032_0000301_17663_18691 300
998 3300049570 Ga0501033_0000270 Ga0501033_0000270_10962_11990 300
999 3300049571 Ga0501034_0000715 Ga0501034_0000715_31244_32272 300
1000 3300049572 Ga0501036_0000043 Ga0501036_0000043_24661_25689 300
1001 3300049573 Ga0501037_0000040 Ga0501037_0000040_105192_106220 300
1002 3300049574 Ga0501038_0000131 Ga0501038_0000131_17692_18720 300
1003 3300049575 Ga0501039_0000106 Ga0501039_0000106_20871_21899 300
1004 3300049579 Ga0501043_0000074 Ga0501043_0000074_29570_30598 300
1005 3300049580 Ga0501046_0000074 Ga0501046_0000074_58495_59523 300
1006 3300049581 Ga0501047_0000346 Ga0501047_0000346_49749_50777 300
1007 3300049582 Ga0501048_0000738 Ga0501048_0000738_17702_18730 300
1008 3300049583 Ga0501067_0000645 Ga0501067_0000645_17681_18709 300
1009 3300049584 Ga0501068_0000636 Ga0501068_0000636_7711_8739 300
1010 3300049585 Ga0501069_0006727 Ga0501069_0006727_3003_4031 300
1011 3300049586 Ga0501070_0007488 Ga0501070_0007488_4976_6004 300
1012 3300049587 Ga0501071_0074874 Ga0501071_0074874_622_1650 300
1013 3300049588 Ga0501072_0110265 Ga0501072_0110265_461_1489 300
1014 3300049589 Ga0501073_0000085 Ga0501073_0000085_53882_54910 300
1015 3300049590 Ga0501074_0000657 Ga0501074_0000657_5283_6311 300
1016 3300049592 Ga0501076_0038635 Ga0501076_0038635_37_1065 300
1017 3300049741 Ga0501079_0000650 Ga0501079_0000650_9852_10880 300
1018 3300049742 Ga0501080_0001325 Ga0501080_0001325_6608_7636 300
1019 3300049744 Ga0501083_0001866 Ga0501083_0001866_40_1068 300
1020 3300049822 Ga0501035_0004398 Ga0501035_0004398_5740_6768 300
1021 3300049823 Ga0501044_0000667 Ga0501044_0000667_22753_23781 300
1022 3300049823 Ga0501044_0011942 Ga0501044_0011942_1667_2695 300
1023 3300049824 Ga0501045_0009850 Ga0501045_0009850_19_1047 300
1024 3300053077 Ga0495601_0003892 Ga0495601_0003892_1478_2506 300
1025 3300053083 Ga0495655_0001097 Ga0495655_0001097_2169_3197 300
1026 3300053085 Ga0495619_0048714 Ga0495619_0048714_127_1155 300
1027 3300053094 Ga0500566_0004598 Ga0500566_0004598_2610_3638 300
1028 3300054114 Ga0501084_0049539 Ga0501084_0049539_95_1123 300
1029 3300060353 Ga0501082_0003198 Ga0501082_0003198_1532_2560 300
1030 3300061734 Ga0530510_0017122 Ga0530510_0017122_3264_4292 300
1031 3300061734 Ga0530510_0194452 Ga0530510_0194452_211_1239 300
1032 3300001990 JGI24737J22298_10004327 JGI24737J22298_100043271 301
1033 3300005335 Ga0070666_10101212 Ga0070666_101012122 301
1034 3300005364 Ga0070673_100329786 Ga0070673_1003297861 301
1035 3300005366 Ga0070659_100042178 Ga0070659_1000421782 301
1036 3300005577 Ga0068857_100000859 Ga0068857_10000085917 301
1037 3300005578 Ga0068854_100003411 Ga0068854_1000034113 301
1038 3300005614 Ga0068856_100015301 Ga0068856_1000153013 301
1039 3300005614 Ga0068856_100019878 Ga0068856_1000198784 301
1040 3300005616 Ga0068852_100022339 Ga0068852_1000223395 301
1041 3300005983 Ga0081540_1006385 Ga0081540_10063856 301
1042 3300006358 Ga0068871_100270403 Ga0068871_1002704032 301
1043 3300009093 Ga0105240_10009798 Ga0105240_100097988 301
1044 3300009177 Ga0105248_10060964 Ga0105248_100609642 301
1045 3300009545 Ga0105237_10049801 Ga0105237_100498012 301
1046 3300009551 Ga0105238_10005746 Ga0105238_100057467 301
1047 3300010375 Ga0105239_10005471 Ga0105239_100054718 301
1048 3300013308 Ga0157375_10292638 Ga0157375_102926382 301
1049 3300025904 Ga0207647_10000591 Ga0207647_1000059114 301
1050 3300025913 Ga0207695_10072126 Ga0207695_100721262 301
1051 3300025914 Ga0207671_10193658 Ga0207671_101936582 301
1052 3300025941 Ga0207711_10164895 Ga0207711_101648952 301
1053 3300025949 Ga0207667_10008981 Ga0207667_100089818 301
1054 3300025981 Ga0207640_10007336 Ga0207640_100073363 301
1055 3300026041 Ga0207639_10392588 Ga0207639_103925881 301
1056 3300026078 Ga0207702_10166763 Ga0207702_101667632 301
1057 3300026116 Ga0207674_10002888 Ga0207674_1000288814 301
1058 3300026121 Ga0207683_10192748 Ga0207683_101927482 301
1059 3300026142 Ga0207698_10042376 Ga0207698_100423763 301
1060 3300031238 Ga0265332_10076693 Ga0265332_100766932 301
1061 3300031249 Ga0265339_10007837 Ga0265339_100078377 301
1062 3300031730 Ga0307516_10161782 Ga0307516_101617822 301
1063 3300033180 Ga0307510_10006633 Ga0307510_1000663313 301
1064 3300037466 Ga0395898_0204915 Ga0395898_0204915_746_1774 301
1065 3300046455 Ga0495603_0001784 Ga0495603_0001784_3950_4981 301
1066 3300048912 Ga0496109_0137218 Ga0496109_0137218_821_1852 301
1067 3300048928 Ga0496125_0000176 Ga0496125_0000176_86567_87598 301
1068 3300048929 Ga0496126_0059157 Ga0496126_0059157_2318_3352 301
1069 3300049568 Ga0501031_0006248 Ga0501031_0006248_2900_3928 301
1070 3300049569 Ga0501032_0012685 Ga0501032_0012685_1703_2731 301
1071 3300049570 Ga0501033_0017776 Ga0501033_0017776_3123_4151 301
1072 3300049571 Ga0501034_0023530 Ga0501034_0023530_1968_2996 301
1073 3300049571 Ga0501034_0102758 Ga0501034_0102758_1173_2201 301
1074 3300049572 Ga0501036_0097328 Ga0501036_0097328_756_1784 301
1075 3300049573 Ga0501037_0002011 Ga0501037_0002011_11997_13025 301
1076 3300049573 Ga0501037_0068986 Ga0501037_0068986_584_1612 301
1077 3300049574 Ga0501038_0010843 Ga0501038_0010843_7281_8309 301
1078 3300049575 Ga0501039_0019509 Ga0501039_0019509_1219_2247 301
1079 3300049578 Ga0501042_0032863 Ga0501042_0032863_2090_3118 301
1080 3300049579 Ga0501043_0009090 Ga0501043_0009090_2947_3975 301
1081 3300049579 Ga0501043_0035464 Ga0501043_0035464_193_1221 301
1082 3300049580 Ga0501046_0011149 Ga0501046_0011149_3549_4577 301
1083 3300049581 Ga0501047_0025749 Ga0501047_0025749_4329_5357 301
1084 3300049582 Ga0501048_0020601 Ga0501048_0020601_1470_2498 301
1085 3300049583 Ga0501067_0003296 Ga0501067_0003296_3548_4576 301
1086 3300049583 Ga0501067_0141313 Ga0501067_0141313_290_1318 301
1087 3300049584 Ga0501068_0006803 Ga0501068_0006803_4293_5321 301
1088 3300049585 Ga0501069_0006380 Ga0501069_0006380_4132_5160 301
1089 3300049586 Ga0501070_0009852 Ga0501070_0009852_5350_6378 301
1090 3300049588 Ga0501072_0182810 Ga0501072_0182810_300_1328 301
1091 3300049589 Ga0501073_0038050 Ga0501073_0038050_727_1755 301
1092 3300049590 Ga0501074_0010242 Ga0501074_0010242_4306_5334 301
1093 3300049592 Ga0501076_0086099 Ga0501076_0086099_1102_2130 301
1094 3300049741 Ga0501079_0014485 Ga0501079_0014485_4319_5347 301
1095 3300049822 Ga0501035_0028448 Ga0501035_0028448_2900_3928 301
1096 3300049822 Ga0501035_0035155 Ga0501035_0035155_50_1078 301
1097 3300049823 Ga0501044_0008909 Ga0501044_0008909_3674_4702 301
1098 3300049824 Ga0501045_0005537 Ga0501045_0005537_7030_8058 301
1099 3300053085 Ga0495619_0135228 Ga0495619_0135228_202_1233 301
1100 3300053102 Ga0500554_007410 Ga0500554_007410_311_1342 301
1101 3300053153 Ga0500616_0000046 Ga0500616_0000046_266337_267365 301
1102 3300053178 Ga0500637_0013087 Ga0500637_0013087_2361_3392 301
1103 3300054114 Ga0501084_0014168 Ga0501084_0014168_4633_5661 301
1104 3300060353 Ga0501082_0012246 Ga0501082_0012246_3029_4057 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00691

OmpA

OmpA family

227

334

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ikj-assembly1.cif.gz_B crystal structure of yfib(f48s) 0.8763 178 296
3cyp-assembly3.cif.gz_B the crystal structure of the c-terminal domain of helicobacter pylori motb (residues 125-256). 0.871 185 301
5wtp-assembly2.cif.gz_B crystal structure of the c-terminal domain of outer membrane protein a (ompa) from capnocytophaga gingivalis 0.8692 182 299
5wtl-assembly4.cif.gz_D crystal structure of the periplasmic portion of outer membrane protein a (ompa) from capnocytophaga gingivalis 0.864 182 300
3imp-assembly5.cif.gz_I new crystal form of the c-terminal domain of helicobacter pylori motb (residues 125-256) 0.8631 185 301
ID Description Score Start End Superfamily
3cypB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.871 185 301 3.30.1330.60
5wtpB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8692 182 299 3.30.1330.60
5n2cC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8587 185 299 3.30.1330.60
4zhwA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8416 185 296 3.30.1330.60
3s0wA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8399 172 300 3.30.1330.60
ID Description Score Start End GO Terms
AF-A0A6I1JB18-F1-model_v4 OmpA-like domain-containing protein 0.983 149 301 GO:0016020
AF-A0A846SZH6-F1-model_v4 OmpA family protein 0.981 126 301 GO:0016020
AF-A0A3C1NID4-F1-model_v4 Peptidoglycan-binding protein 0.9739 185 269 GO:0016020
AF-A0A439KLY8-F1-model_v4 Peptidoglycan-binding protein 0.9734 173 301 GO:0016020
AF-A0A6I1JB18-F1-model_v4 OmpA-like domain-containing protein 0.9705 149 301 GO:0016020

Feature Viewer

pLDDT pTM Quality
81.9 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map