F490093
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1102 | 378 | 1101 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300059423|Ga0590074_001275|Ga0590074_001275_686_1471 |
| Length | 261 |
| Sequence | VIVCRSQAEVEKLRRVNQLVARILAELRAMVAPGVTTQQIDELAERRVREAGAVPAFKGYHGYPATVCASVNEQVVHGIPSKRRLVDGDVLSIDIGAQLDGFFGDSAVTVPVGTVAPQAAQLLKVTEEALFHGIEAVKPGARVSDIGAAVQRHVEAYGFSVVREFVGHGIGTSLHEEPQIANYGPGGRGPRLAEGMVLAIEPMVNLGKAAVKVLGDGWTAVTRDGSLSAHFEHTVVVTSDGCEILTLLGHQAAKATMVAHS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 124 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 203 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 205 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 206 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 207 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 209 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 214 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 240 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 241 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 242 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 243 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 246 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 247 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 248 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 322 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 323 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 324 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 335 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 336 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 373 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 374 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 375 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 376 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 377 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.55 |
| Metatranscriptomes | 0.36 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.27 |
| Nodule | 0 |
| Rhizoplane | 4.17 |
| Rhizosphere | 94.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10023592 | 3300002239 | Bacteria | 977 |
| 2 | JGI24751J29686_10025647 | 3300002459 | Bacteria | 1223 |
| 3 | JGI25404J52841_10004671 | 3300003659 | Bacteria | 2792 |
| 4 | Ga0058862_12783239 | 3300004803 | Bacteria | 2387 |
| 5 | Ga0065712_10010472 | 3300005290 | Bacteria | 2496 |
| 6 | Ga0065712_10071314 | 3300005290 | Bacteria | 5345 |
| 7 | Ga0065715_10094515 | 3300005293 | Bacteria | 4316 |
| 8 | Ga0065707_10005887 | 3300005295 | Bacteria | 3199 |
| 9 | Ga0065707_10167480 | 3300005295 | Bacteria | 1507 |
| 10 | Ga0070658_10000766 | 3300005327 | Bacteria | 27565 |
| 11 | Ga0070658_10001004 | 3300005327 | Bacteria | 24213 |
| 12 | Ga0070658_10070625 | 3300005327 | Bacteria | 2859 |
| 13 | Ga0070658_10103382 | 3300005327 | Bacteria | 2356 |
| 14 | Ga0070658_10169859 | 3300005327 | Bacteria | 1832 |
| 15 | Ga0070658_10239990 | 3300005327 | Bacteria | 1536 |
| 16 | Ga0070658_10615310 | 3300005327 | Bacteria | 942 |
| 17 | Ga0070676_10000510 | 3300005328 | Bacteria | 18623 |
| 18 | Ga0070676_10078880 | 3300005328 | Bacteria | 1993 |
| 19 | Ga0070683_100017258 | 3300005329 | Bacteria | 6378 |
| 20 | Ga0070683_100048913 | 3300005329 | Bacteria | 3909 |
| 21 | Ga0070683_100116656 | 3300005329 | Bacteria | 2521 |
| 22 | Ga0070683_100139567 | 3300005329 | Bacteria | 2296 |
| 23 | Ga0070690_100000366 | 3300005330 | Bacteria | 23062 |
| 24 | Ga0070690_100006534 | 3300005330 | Bacteria | 6617 |
| 25 | Ga0070670_100047369 | 3300005331 | Bacteria | 3699 |
| 26 | Ga0070670_100345458 | 3300005331 | Bacteria | 1306 |
| 27 | Ga0068869_100002833 | 3300005334 | Bacteria | 10512 |
| 28 | Ga0068869_100175092 | 3300005334 | Bacteria | 1678 |
| 29 | Ga0068869_100410718 | 3300005334 | Bacteria | 1115 |
| 30 | Ga0070666_10007809 | 3300005335 | Bacteria | 6607 |
| 31 | Ga0070666_10021119 | 3300005335 | Bacteria | 4218 |
| 32 | Ga0070666_10069715 | 3300005335 | Bacteria | 2391 |
| 33 | Ga0070666_10236804 | 3300005335 | Bacteria | 1290 |
| 34 | Ga0070666_10382760 | 3300005335 | Bacteria | 1010 |
| 35 | Ga0070680_100014163 | 3300005336 | Bacteria | 6229 |
| 36 | Ga0070680_100075087 | 3300005336 | Bacteria | 2783 |
| 37 | Ga0070680_100181162 | 3300005336 | Bacteria | 1774 |
| 38 | Ga0068868_100002098 | 3300005338 | Bacteria | 13728 |
| 39 | Ga0068868_100181756 | 3300005338 | Bacteria | 1745 |
| 40 | Ga0068868_100227577 | 3300005338 | Bacteria | 1563 |
| 41 | Ga0068868_100645934 | 3300005338 | Bacteria | 942 |
| 42 | Ga0070660_100002987 | 3300005339 | Bacteria | 11642 |
| 43 | Ga0070660_100009153 | 3300005339 | Bacteria | 6952 |
| 44 | Ga0070660_100027583 | 3300005339 | Bacteria | 4239 |
| 45 | Ga0070660_100075797 | 3300005339 | Bacteria | 2634 |
| 46 | Ga0070660_100211410 | 3300005339 | Bacteria | 1575 |
| 47 | Ga0070689_100001862 | 3300005340 | Bacteria | 13594 |
| 48 | Ga0070689_100043206 | 3300005340 | Bacteria | 3463 |
| 49 | Ga0070689_100064561 | 3300005340 | Bacteria | 2850 |
| 50 | Ga0070689_100112365 | 3300005340 | Bacteria | 2168 |
| 51 | Ga0070691_10004188 | 3300005341 | Bacteria | 6554 |
| 52 | Ga0070687_100000205 | 3300005343 | Bacteria | 20626 |
| 53 | Ga0070687_100030822 | 3300005343 | Bacteria | 2625 |
| 54 | Ga0070661_100009522 | 3300005344 | Bacteria | 6731 |
| 55 | Ga0070661_100085265 | 3300005344 | Bacteria | 2334 |
| 56 | Ga0070661_100677188 | 3300005344 | Bacteria | 839 |
| 57 | Ga0070692_10001681 | 3300005345 | Bacteria | 8190 |
| 58 | Ga0070692_10038405 | 3300005345 | Bacteria | 2440 |
| 59 | Ga0070668_100001206 | 3300005347 | Bacteria | 18356 |
| 60 | Ga0070668_100054493 | 3300005347 | Bacteria | 3084 |
| 61 | Ga0070668_100188378 | 3300005347 | Bacteria | 1689 |
| 62 | Ga0070668_100206939 | 3300005347 | Bacteria | 1612 |
| 63 | Ga0070668_100547736 | 3300005347 | Bacteria | 1007 |
| 64 | Ga0070669_100035389 | 3300005353 | Bacteria | 3617 |
| 65 | Ga0070669_100051867 | 3300005353 | Bacteria | 2999 |
| 66 | Ga0070669_100178091 | 3300005353 | Bacteria | 1662 |
| 67 | Ga0070675_100000056 | 3300005354 | Bacteria | 66985 |
| 68 | Ga0070675_100002314 | 3300005354 | Bacteria | 14155 |
| 69 | Ga0070675_100224737 | 3300005354 | Bacteria | 1636 |
| 70 | Ga0070671_100001676 | 3300005355 | Bacteria | 16774 |
| 71 | Ga0070671_100005888 | 3300005355 | Bacteria | 9769 |
| 72 | Ga0070671_100031409 | 3300005355 | Bacteria | 4387 |
| 73 | Ga0070671_100141666 | 3300005355 | Bacteria | 2029 |
| 74 | Ga0070671_100207169 | 3300005355 | Bacteria | 1663 |
| 75 | Ga0070674_100000202 | 3300005356 | Bacteria | 28786 |
| 76 | Ga0070674_100008546 | 3300005356 | Bacteria | 6104 |
| 77 | Ga0070674_100219684 | 3300005356 | Bacteria | 1478 |
| 78 | Ga0070673_100003427 | 3300005364 | Bacteria | 9877 |
| 79 | Ga0070673_100005301 | 3300005364 | Bacteria | 8239 |
| 80 | Ga0070673_100176401 | 3300005364 | Bacteria | 1827 |
| 81 | Ga0070673_100197094 | 3300005364 | Bacteria | 1733 |
| 82 | Ga0070688_100000519 | 3300005365 | Bacteria | 19443 |
| 83 | Ga0070688_100070904 | 3300005365 | Bacteria | 2229 |
| 84 | Ga0070688_100132643 | 3300005365 | Bacteria | 1683 |
| 85 | Ga0070659_100000088 | 3300005366 | Bacteria | 69112 |
| 86 | Ga0070659_100001021 | 3300005366 | Bacteria | 20542 |
| 87 | Ga0070659_100059884 | 3300005366 | Bacteria | 3007 |
| 88 | Ga0070659_100064943 | 3300005366 | Bacteria | 2890 |
| 89 | Ga0070659_100149861 | 3300005366 | Bacteria | 1902 |
| 90 | Ga0070667_100315003 | 3300005367 | Bacteria | 1411 |
| 91 | Ga0070714_100101561 | 3300005435 | Bacteria | 2535 |
| 92 | Ga0070714_100315339 | 3300005435 | Bacteria | 1461 |
| 93 | Ga0070714_100492224 | 3300005435 | Bacteria | 1168 |
| 94 | Ga0070713_100025501 | 3300005436 | Bacteria | 4622 |
| 95 | Ga0070701_10065697 | 3300005438 | Bacteria | 1926 |
| 96 | Ga0070701_10100710 | 3300005438 | Bacteria | 1600 |
| 97 | Ga0070701_10194700 | 3300005438 | Bacteria | 1195 |
| 98 | Ga0070705_100000543 | 3300005440 | Bacteria | 21853 |
| 99 | Ga0070705_100121105 | 3300005440 | Bacteria | 1690 |
| 100 | Ga0070700_100028280 | 3300005441 | Bacteria | 3332 |
| 101 | Ga0070700_100071314 | 3300005441 | Bacteria | 2218 |
| 102 | Ga0070700_100185954 | 3300005441 | Bacteria | 1449 |
| 103 | Ga0070700_100563804 | 3300005441 | Bacteria | 887 |
| 104 | Ga0070694_100338305 | 3300005444 | Bacteria | 1163 |
| 105 | Ga0070708_100074375 | 3300005445 | Bacteria | 3064 |
| 106 | Ga0070708_100100566 | 3300005445 | Bacteria | 2647 |
| 107 | Ga0070708_100236502 | 3300005445 | Bacteria | 1714 |
| 108 | Ga0070663_100021838 | 3300005455 | Bacteria | 4264 |
| 109 | Ga0070663_100067372 | 3300005455 | Bacteria | 2596 |
| 110 | Ga0070663_100169091 | 3300005455 | Bacteria | 1688 |
| 111 | Ga0070663_100213585 | 3300005455 | Bacteria | 1512 |
| 112 | Ga0070678_100004288 | 3300005456 | Bacteria | 8062 |
| 113 | Ga0070678_100066041 | 3300005456 | Bacteria | 2688 |
| 114 | Ga0070678_100193215 | 3300005456 | Bacteria | 1675 |
| 115 | Ga0070662_100524581 | 3300005457 | Bacteria | 990 |
| 116 | Ga0070681_10045035 | 3300005458 | Bacteria | 4416 |
| 117 | Ga0070681_10047185 | 3300005458 | Bacteria | 4306 |
| 118 | Ga0070681_10258473 | 3300005458 | Bacteria | 1653 |
| 119 | Ga0068867_100178546 | 3300005459 | Bacteria | 1687 |
| 120 | Ga0070685_10000717 | 3300005466 | Bacteria | 18012 |
| 121 | Ga0070685_10261157 | 3300005466 | Bacteria | 1152 |
| 122 | Ga0070706_100014444 | 3300005467 | Bacteria | 7294 |
| 123 | Ga0070706_100386616 | 3300005467 | Bacteria | 1303 |
| 124 | Ga0070707_100000221 | 3300005468 | Bacteria | 57035 |
| 125 | Ga0070707_100012972 | 3300005468 | Bacteria | 7786 |
| 126 | Ga0070707_100272326 | 3300005468 | Bacteria | 1646 |
| 127 | Ga0070707_100337037 | 3300005468 | Bacteria | 1465 |
| 128 | Ga0070698_100003045 | 3300005471 | Bacteria | 18470 |
| 129 | Ga0070698_100015478 | 3300005471 | Bacteria | 8057 |
| 130 | Ga0070698_100034124 | 3300005471 | Bacteria | 5270 |
| 131 | Ga0070698_100040017 | 3300005471 | Bacteria | 4820 |
| 132 | Ga0070698_100260579 | 3300005471 | Bacteria | 1666 |
| 133 | Ga0070698_100324402 | 3300005471 | Bacteria | 1471 |
| 134 | Ga0070698_100348933 | 3300005471 | Bacteria | 1411 |
| 135 | Ga0070699_100004496 | 3300005518 | Bacteria | 12337 |
| 136 | Ga0070699_100006991 | 3300005518 | Bacteria | 9807 |
| 137 | Ga0070699_100200625 | 3300005518 | Bacteria | 1774 |
| 138 | Ga0070699_100333055 | 3300005518 | Bacteria | 1366 |
| 139 | Ga0070679_100044653 | 3300005530 | Bacteria | 4415 |
| 140 | Ga0070679_100056981 | 3300005530 | Bacteria | 3894 |
| 141 | Ga0070679_100124874 | 3300005530 | Bacteria | 2557 |
| 142 | Ga0070679_100129389 | 3300005530 | Bacteria | 2506 |
| 143 | Ga0070679_100136540 | 3300005530 | Bacteria | 2433 |
| 144 | Ga0070679_100171866 | 3300005530 | Bacteria | 2140 |
| 145 | Ga0070679_100312644 | 3300005530 | Bacteria | 1520 |
| 146 | Ga0070684_100078274 | 3300005535 | Bacteria | 2921 |
| 147 | Ga0070684_100192829 | 3300005535 | Bacteria | 1854 |
| 148 | Ga0070684_100194820 | 3300005535 | Bacteria | 1845 |
| 149 | Ga0070697_100059883 | 3300005536 | Bacteria | 3102 |
| 150 | Ga0070697_100111457 | 3300005536 | Bacteria | 2281 |
| 151 | Ga0070697_100386456 | 3300005536 | Bacteria | 1213 |
| 152 | Ga0068853_100000054 | 3300005539 | Bacteria | 80837 |
| 153 | Ga0068853_100000347 | 3300005539 | Bacteria | 32301 |
| 154 | Ga0070672_100000351 | 3300005543 | Bacteria | 26640 |
| 155 | Ga0070672_100150676 | 3300005543 | Bacteria | 1924 |
| 156 | Ga0070672_100306641 | 3300005543 | Bacteria | 1347 |
| 157 | Ga0070672_100549363 | 3300005543 | Bacteria | 1003 |
| 158 | Ga0070686_100000914 | 3300005544 | Bacteria | 17078 |
| 159 | Ga0070686_100002243 | 3300005544 | Bacteria | 10661 |
| 160 | Ga0070686_100095531 | 3300005544 | Bacteria | 1997 |
| 161 | Ga0070695_100003541 | 3300005545 | Bacteria | 9119 |
| 162 | Ga0070695_100034315 | 3300005545 | Bacteria | 3180 |
| 163 | Ga0070695_100230632 | 3300005545 | Bacteria | 1338 |
| 164 | Ga0070696_100118842 | 3300005546 | Bacteria | 1911 |
| 165 | Ga0070696_100130833 | 3300005546 | Bacteria | 1826 |
| 166 | Ga0070693_100041481 | 3300005547 | Bacteria | 2589 |
| 167 | Ga0070665_100004733 | 3300005548 | Bacteria | 14164 |
| 168 | Ga0070665_100005447 | 3300005548 | Bacteria | 13122 |
| 169 | Ga0070665_100008632 | 3300005548 | Bacteria | 10311 |
| 170 | Ga0070665_100010437 | 3300005548 | Bacteria | 9398 |
| 171 | Ga0070665_100039128 | 3300005548 | Bacteria | 4769 |
| 172 | Ga0070704_100019087 | 3300005549 | Bacteria | 4400 |
| 173 | Ga0070704_100176447 | 3300005549 | Bacteria | 1705 |
| 174 | Ga0070704_100365659 | 3300005549 | Bacteria | 1222 |
| 175 | Ga0068855_100000527 | 3300005563 | Bacteria | 46819 |
| 176 | Ga0068855_100000913 | 3300005563 | Bacteria | 36693 |
| 177 | Ga0068855_100003825 | 3300005563 | Bacteria | 18405 |
| 178 | Ga0068855_100012883 | 3300005563 | Bacteria | 10089 |
| 179 | Ga0068855_100019504 | 3300005563 | Bacteria | 8149 |
| 180 | Ga0068855_100035485 | 3300005563 | Bacteria | 5939 |
| 181 | Ga0068855_100041514 | 3300005563 | Bacteria | 5452 |
| 182 | Ga0068855_100232692 | 3300005563 | Bacteria | 2062 |
| 183 | Ga0070664_100008108 | 3300005564 | Bacteria | 8491 |
| 184 | Ga0070664_100016133 | 3300005564 | Bacteria | 6122 |
| 185 | Ga0070664_100080024 | 3300005564 | Bacteria | 2814 |
| 186 | Ga0070664_100349949 | 3300005564 | Bacteria | 1344 |
| 187 | Ga0068857_100002221 | 3300005577 | Bacteria | 15818 |
| 188 | Ga0068857_100005689 | 3300005577 | Bacteria | 10657 |
| 189 | Ga0068857_100024303 | 3300005577 | Bacteria | 5332 |
| 190 | Ga0068857_100247318 | 3300005577 | Bacteria | 1634 |
| 191 | Ga0068854_100000137 | 3300005578 | Bacteria | 50696 |
| 192 | Ga0068854_100000245 | 3300005578 | Bacteria | 36812 |
| 193 | Ga0068854_100071487 | 3300005578 | Bacteria | 2538 |
| 194 | Ga0068854_100215853 | 3300005578 | Bacteria | 1515 |
| 195 | Ga0068856_100018557 | 3300005614 | Bacteria | 6740 |
| 196 | Ga0068856_100022481 | 3300005614 | Bacteria | 6131 |
| 197 | Ga0068856_100296549 | 3300005614 | Bacteria | 1634 |
| 198 | Ga0068856_100307374 | 3300005614 | Bacteria | 1603 |
| 199 | Ga0068856_100507566 | 3300005614 | Bacteria | 1227 |
| 200 | Ga0070702_100002883 | 3300005615 | Bacteria | 7557 |
| 201 | Ga0070702_100034939 | 3300005615 | Bacteria | 2774 |
| 202 | Ga0070702_100370516 | 3300005615 | Bacteria | 1015 |
| 203 | Ga0068852_100001092 | 3300005616 | Bacteria | 17912 |
| 204 | Ga0068852_100039624 | 3300005616 | Bacteria | 3968 |
| 205 | Ga0068852_100179574 | 3300005616 | Bacteria | 1989 |
| 206 | Ga0068859_100000315 | 3300005617 | Bacteria | 48378 |
| 207 | Ga0068859_100004442 | 3300005617 | Bacteria | 14311 |
| 208 | Ga0068859_100026110 | 3300005617 | Bacteria | 5859 |
| 209 | Ga0068859_100225844 | 3300005617 | Bacteria | 1960 |
| 210 | Ga0068859_100260452 | 3300005617 | Bacteria | 1825 |
| 211 | Ga0068859_100315560 | 3300005617 | Bacteria | 1657 |
| 212 | Ga0068864_100000998 | 3300005618 | Bacteria | 23675 |
| 213 | Ga0068864_100063762 | 3300005618 | Bacteria | 3194 |
| 214 | Ga0068864_100098788 | 3300005618 | Bacteria | 2586 |
| 215 | Ga0068864_100192620 | 3300005618 | Bacteria | 1870 |
| 216 | Ga0068864_100399043 | 3300005618 | Bacteria | 1306 |
| 217 | Ga0068866_10000101 | 3300005718 | Bacteria | 36354 |
| 218 | Ga0068866_10024804 | 3300005718 | Bacteria | 2811 |
| 219 | Ga0068866_10029954 | 3300005718 | Bacteria | 2607 |
| 220 | Ga0068866_10126540 | 3300005718 | Bacteria | 1447 |
| 221 | Ga0068866_10274385 | 3300005718 | Bacteria | 1042 |
| 222 | Ga0068861_100006034 | 3300005719 | Bacteria | 8239 |
| 223 | Ga0068861_100036380 | 3300005719 | Bacteria | 3653 |
| 224 | Ga0068861_100067590 | 3300005719 | Bacteria | 2759 |
| 225 | Ga0068861_100196107 | 3300005719 | Bacteria | 1692 |
| 226 | Ga0068851_10000245 | 3300005834 | Bacteria | 25653 |
| 227 | Ga0068851_10008832 | 3300005834 | Bacteria | 4671 |
| 228 | Ga0068870_10000036 | 3300005840 | Bacteria | 42809 |
| 229 | Ga0068863_100000343 | 3300005841 | Bacteria | 47460 |
| 230 | Ga0068863_100036062 | 3300005841 | Bacteria | 4709 |
| 231 | Ga0068863_100098324 | 3300005841 | Bacteria | 2779 |
| 232 | Ga0068858_100001254 | 3300005842 | Bacteria | 26256 |
| 233 | Ga0068858_100008638 | 3300005842 | Bacteria | 9781 |
| 234 | Ga0068858_100036297 | 3300005842 | Bacteria | 4570 |
| 235 | Ga0068858_100113223 | 3300005842 | Bacteria | 2534 |
| 236 | Ga0068858_100373013 | 3300005842 | Bacteria | 1369 |
| 237 | Ga0068858_100435265 | 3300005842 | Bacteria | 1262 |
| 238 | Ga0068860_100166724 | 3300005843 | Bacteria | 2127 |
| 239 | Ga0068860_100204933 | 3300005843 | Bacteria | 1912 |
| 240 | Ga0068860_100205882 | 3300005843 | Bacteria | 1908 |
| 241 | Ga0068860_100361999 | 3300005843 | Bacteria | 1429 |
| 242 | Ga0068860_100563070 | 3300005843 | Bacteria | 1143 |
| 243 | Ga0068862_100021021 | 3300005844 | Bacteria | 5453 |
| 244 | Ga0068862_100051237 | 3300005844 | Bacteria | 3530 |
| 245 | Ga0068862_100126963 | 3300005844 | Bacteria | 2253 |
| 246 | Ga0068862_100187532 | 3300005844 | Bacteria | 1859 |
| 247 | Ga0068862_100366282 | 3300005844 | Bacteria | 1340 |
| 248 | Ga0081455_10025866 | 3300005937 | Bacteria | 5409 |
| 249 | Ga0081538_10028271 | 3300005981 | Bacteria | 3861 |
| 250 | Ga0081540_1000264 | 3300005983 | Bacteria | 55128 |
| 251 | Ga0081540_1009729 | 3300005983 | Bacteria | 6593 |
| 252 | Ga0081540_1010957 | 3300005983 | Bacteria | 6089 |
| 253 | Ga0097621_100000177 | 3300006237 | Bacteria | 40430 |
| 254 | Ga0097621_100006061 | 3300006237 | Bacteria | 8549 |
| 255 | Ga0097621_100015176 | 3300006237 | Bacteria | 5787 |
| 256 | Ga0097621_100020231 | 3300006237 | Bacteria | 5126 |
| 257 | Ga0097621_100211650 | 3300006237 | Bacteria | 1686 |
| 258 | Ga0097621_100464583 | 3300006237 | Bacteria | 1142 |
| 259 | Ga0097621_100503003 | 3300006237 | Bacteria | 1098 |
| 260 | Ga0097621_100731126 | 3300006237 | Bacteria | 913 |
| 261 | Ga0068871_100001728 | 3300006358 | Bacteria | 14706 |
| 262 | Ga0068871_100006055 | 3300006358 | Bacteria | 8509 |
| 263 | Ga0068871_100006948 | 3300006358 | Bacteria | 8062 |
| 264 | Ga0068871_100061643 | 3300006358 | Bacteria | 3064 |
| 265 | Ga0068871_100088164 | 3300006358 | Bacteria | 2581 |
| 266 | Ga0068871_100286689 | 3300006358 | Bacteria | 1442 |
| 267 | Ga0075428_100000009 | 3300006844 | Bacteria | 266370 |
| 268 | Ga0075428_100055934 | 3300006844 | Bacteria | 4322 |
| 269 | Ga0075428_100413009 | 3300006844 | Bacteria | 1446 |
| 270 | Ga0075430_100370608 | 3300006846 | Unclassified | 1182 |
| 271 | Ga0075431_100167049 | 3300006847 | Bacteria | 2262 |
| 272 | Ga0075431_100173239 | 3300006847 | Bacteria | 2217 |
| 273 | Ga0075433_10052805 | 3300006852 | Bacteria | 3542 |
| 274 | Ga0075433_10114798 | 3300006852 | Bacteria | 2389 |
| 275 | Ga0075434_100007963 | 3300006871 | Bacteria | 9823 |
| 276 | Ga0075434_100123476 | 3300006871 | Bacteria | 2605 |
| 277 | Ga0075434_100128953 | 3300006871 | Bacteria | 2547 |
| 278 | Ga0075434_100146743 | 3300006871 | Bacteria | 2379 |
| 279 | Ga0075434_100183729 | 3300006871 | Bacteria | 2112 |
| 280 | Ga0075434_100214894 | 3300006871 | Bacteria | 1943 |
| 281 | Ga0075434_100240424 | 3300006871 | Bacteria | 1830 |
| 282 | Ga0075429_100087511 | 3300006880 | Bacteria | 2715 |
| 283 | Ga0068865_100015593 | 3300006881 | Bacteria | 4848 |
| 284 | Ga0068865_100152892 | 3300006881 | Bacteria | 1752 |
| 285 | Ga0075436_100006359 | 3300006914 | Bacteria | 8095 |
| 286 | Ga0075436_100014321 | 3300006914 | Bacteria | 5430 |
| 287 | Ga0075436_100019702 | 3300006914 | Bacteria | 4625 |
| 288 | Ga0075436_100020847 | 3300006914 | Bacteria | 4496 |
| 289 | Ga0075436_100028497 | 3300006914 | Bacteria | 3842 |
| 290 | Ga0075436_100049304 | 3300006914 | Bacteria | 2905 |
| 291 | Ga0075436_100058745 | 3300006914 | Bacteria | 2656 |
| 292 | Ga0075436_100108712 | 3300006914 | Bacteria | 1934 |
| 293 | Ga0075436_100109094 | 3300006914 | Bacteria | 1931 |
| 294 | Ga0097620_100000315 | 3300006931 | Bacteria | 48378 |
| 295 | Ga0097620_100004442 | 3300006931 | Bacteria | 14311 |
| 296 | Ga0097620_100026110 | 3300006931 | Bacteria | 5859 |
| 297 | Ga0097620_100225847 | 3300006931 | Bacteria | 1960 |
| 298 | Ga0097620_100260449 | 3300006931 | Bacteria | 1825 |
| 299 | Ga0097620_100315544 | 3300006931 | Bacteria | 1657 |
| 300 | Ga0075435_100001542 | 3300007076 | Bacteria | 14846 |
| 301 | Ga0075435_100001694 | 3300007076 | Bacteria | 14328 |
| 302 | Ga0075435_100004862 | 3300007076 | Bacteria | 9304 |
| 303 | Ga0075435_100008444 | 3300007076 | Bacteria | 7390 |
| 304 | Ga0075435_100021902 | 3300007076 | Bacteria | 4925 |
| 305 | Ga0075435_100070719 | 3300007076 | Bacteria | 2848 |
| 306 | Ga0075435_100072955 | 3300007076 | Bacteria | 2805 |
| 307 | Ga0075435_100083105 | 3300007076 | Bacteria | 2632 |
| 308 | Ga0099794_10061435 | 3300007265 | Bacteria | 1826 |
| 309 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 310 | Ga0105240_10001604 | 3300009093 | Bacteria | 38373 |
| 311 | Ga0105240_10012027 | 3300009093 | Bacteria | 11997 |
| 312 | Ga0105240_10012782 | 3300009093 | Bacteria | 11567 |
| 313 | Ga0105240_10077161 | 3300009093 | Bacteria | 4106 |
| 314 | Ga0105240_10114294 | 3300009093 | Bacteria | 3261 |
| 315 | Ga0105240_10224743 | 3300009093 | Bacteria | 2185 |
| 316 | Ga0105240_10297529 | 3300009093 | Bacteria | 1847 |
| 317 | Ga0105240_10393217 | 3300009093 | Bacteria | 1563 |
| 318 | Ga0111539_10000010 | 3300009094 | Bacteria | 366246 |
| 319 | Ga0111539_10000566 | 3300009094 | Bacteria | 47366 |
| 320 | Ga0111539_10005584 | 3300009094 | Bacteria | 16267 |
| 321 | Ga0111539_10380566 | 3300009094 | Bacteria | 1643 |
| 322 | Ga0111539_10541437 | 3300009094 | Bacteria | 1356 |
| 323 | Ga0105245_10000166 | 3300009098 | Bacteria | 62554 |
| 324 | Ga0105245_10026276 | 3300009098 | Bacteria | 5123 |
| 325 | Ga0105247_10001356 | 3300009101 | Bacteria | 17787 |
| 326 | Ga0105247_10028592 | 3300009101 | Bacteria | 3374 |
| 327 | Ga0114129_10004861 | 3300009147 | Bacteria | 18961 |
| 328 | Ga0114129_10033059 | 3300009147 | Bacteria | 7309 |
| 329 | Ga0114129_10060820 | 3300009147 | Bacteria | 5280 |
| 330 | Ga0114129_10078194 | 3300009147 | Bacteria | 4602 |
| 331 | Ga0114129_10081911 | 3300009147 | Bacteria | 4485 |
| 332 | Ga0114129_10106586 | 3300009147 | Bacteria | 3871 |
| 333 | Ga0114129_10294188 | 3300009147 | Bacteria | 2166 |
| 334 | Ga0105243_10071634 | 3300009148 | Bacteria | 2803 |
| 335 | Ga0105241_10001205 | 3300009174 | Bacteria | 19748 |
| 336 | Ga0105241_10087967 | 3300009174 | Bacteria | 2446 |
| 337 | Ga0105241_10484016 | 3300009174 | Bacteria | 1100 |
| 338 | Ga0105242_10003060 | 3300009176 | Bacteria | 13071 |
| 339 | Ga0105242_10060486 | 3300009176 | Bacteria | 3113 |
| 340 | Ga0105242_10465875 | 3300009176 | Bacteria | 1194 |
| 341 | Ga0105248_10006569 | 3300009177 | Bacteria | 12749 |
| 342 | Ga0105248_10012842 | 3300009177 | Bacteria | 9238 |
| 343 | Ga0105248_10013460 | 3300009177 | Bacteria | 9007 |
| 344 | Ga0105248_10019507 | 3300009177 | Bacteria | 7503 |
| 345 | Ga0105248_10089526 | 3300009177 | Bacteria | 3464 |
| 346 | Ga0105248_10094826 | 3300009177 | Bacteria | 3360 |
| 347 | Ga0105248_10135047 | 3300009177 | Bacteria | 2783 |
| 348 | Ga0105248_10169500 | 3300009177 | Bacteria | 2461 |
| 349 | Ga0105248_10371694 | 3300009177 | Bacteria | 1609 |
| 350 | Ga0105248_10428740 | 3300009177 | Bacteria | 1489 |
| 351 | Ga0105248_10564353 | 3300009177 | Bacteria | 1284 |
| 352 | Ga0105237_10001703 | 3300009545 | Bacteria | 28456 |
| 353 | Ga0105237_10004977 | 3300009545 | Bacteria | 15150 |
| 354 | Ga0105238_10000391 | 3300009551 | Bacteria | 46771 |
| 355 | Ga0105238_10008485 | 3300009551 | Bacteria | 10286 |
| 356 | Ga0105238_10070590 | 3300009551 | Bacteria | 3491 |
| 357 | Ga0105238_10101639 | 3300009551 | Bacteria | 2857 |
| 358 | Ga0105238_10146657 | 3300009551 | Bacteria | 2336 |
| 359 | Ga0105238_10184047 | 3300009551 | Bacteria | 2066 |
| 360 | Ga0105238_10360448 | 3300009551 | Bacteria | 1443 |
| 361 | Ga0105249_10000319 | 3300009553 | Bacteria | 48708 |
| 362 | Ga0105249_10233757 | 3300009553 | Bacteria | 1814 |
| 363 | Ga0105249_10261220 | 3300009553 | Bacteria | 1721 |
| 364 | Ga0105249_10483952 | 3300009553 | Bacteria | 1281 |
| 365 | Ga0105239_10000707 | 3300010375 | Bacteria | 47294 |
| 366 | Ga0105239_10111134 | 3300010375 | Bacteria | 3037 |
| 367 | Ga0105239_10198030 | 3300010375 | Bacteria | 2250 |
| 368 | Ga0105246_10000493 | 3300011119 | Bacteria | 21438 |
| 369 | Ga0105246_10048926 | 3300011119 | Bacteria | 2892 |
| 370 | Ga0157373_10025268 | 3300013100 | Bacteria | 4298 |
| 371 | Ga0157371_10000492 | 3300013102 | Bacteria | 47893 |
| 372 | Ga0157371_10260778 | 3300013102 | Bacteria | 1249 |
| 373 | Ga0157371_10562805 | 3300013102 | Unclassified | 846 |
| 374 | Ga0157370_10011397 | 3300013104 | Bacteria | 9301 |
| 375 | Ga0157370_10017703 | 3300013104 | Bacteria | 7183 |
| 376 | Ga0157370_10017947 | 3300013104 | Bacteria | 7125 |
| 377 | Ga0157370_10018903 | 3300013104 | Bacteria | 6929 |
| 378 | Ga0157370_10035941 | 3300013104 | Bacteria | 4811 |
| 379 | Ga0157370_10204238 | 3300013104 | Bacteria | 1832 |
| 380 | Ga0157369_10004814 | 3300013105 | Bacteria | 15850 |
| 381 | Ga0157369_10019707 | 3300013105 | Bacteria | 7549 |
| 382 | Ga0157369_10025443 | 3300013105 | Bacteria | 6573 |
| 383 | Ga0157369_10036798 | 3300013105 | Bacteria | 5361 |
| 384 | Ga0157369_10069128 | 3300013105 | Bacteria | 3794 |
| 385 | Ga0157369_10099587 | 3300013105 | Bacteria | 3098 |
| 386 | Ga0157369_10156301 | 3300013105 | Bacteria | 2409 |
| 387 | Ga0157369_10405426 | 3300013105 | Bacteria | 1414 |
| 388 | Ga0157374_10001527 | 3300013296 | Bacteria | 19489 |
| 389 | Ga0157374_10016453 | 3300013296 | Bacteria | 6502 |
| 390 | Ga0157374_10054566 | 3300013296 | Bacteria | 3728 |
| 391 | Ga0157374_10064149 | 3300013296 | Bacteria | 3446 |
| 392 | Ga0157374_10066771 | 3300013296 | Bacteria | 3380 |
| 393 | Ga0157374_10095902 | 3300013296 | Bacteria | 2837 |
| 394 | Ga0157374_10293282 | 3300013296 | Bacteria | 1608 |
| 395 | Ga0157378_10000975 | 3300013297 | Bacteria | 26209 |
| 396 | Ga0157378_10083535 | 3300013297 | Bacteria | 2890 |
| 397 | Ga0157378_10250405 | 3300013297 | Bacteria | 1696 |
| 398 | Ga0163162_10001548 | 3300013306 | Bacteria | 21476 |
| 399 | Ga0163162_10023636 | 3300013306 | Bacteria | 6068 |
| 400 | Ga0163162_10071217 | 3300013306 | Bacteria | 3529 |
| 401 | Ga0163162_10258213 | 3300013306 | Bacteria | 1874 |
| 402 | Ga0157372_10002029 | 3300013307 | Bacteria | 22018 |
| 403 | Ga0157372_10006518 | 3300013307 | Bacteria | 12426 |
| 404 | Ga0157372_10019768 | 3300013307 | Bacteria | 7258 |
| 405 | Ga0157372_10026761 | 3300013307 | Bacteria | 6278 |
| 406 | Ga0157372_10096890 | 3300013307 | Bacteria | 3363 |
| 407 | Ga0157372_10177561 | 3300013307 | Bacteria | 2465 |
| 408 | Ga0157372_10345978 | 3300013307 | Bacteria | 1732 |
| 409 | Ga0157372_10520950 | 3300013307 | Bacteria | 1386 |
| 410 | Ga0157375_10059650 | 3300013308 | Bacteria | 3781 |
| 411 | Ga0157375_10185394 | 3300013308 | Bacteria | 2234 |
| 412 | Ga0157375_10544408 | 3300013308 | Bacteria | 1323 |
| 413 | Ga0157375_11026482 | 3300013308 | Bacteria | 963 |
| 414 | Ga0163163_10001027 | 3300014325 | Bacteria | 23654 |
| 415 | Ga0163163_10039817 | 3300014325 | Bacteria | 4588 |
| 416 | Ga0163163_10058152 | 3300014325 | Bacteria | 3823 |
| 417 | Ga0163163_10064535 | 3300014325 | Bacteria | 3633 |
| 418 | Ga0163163_10070157 | 3300014325 | Bacteria | 3489 |
| 419 | Ga0163163_10146285 | 3300014325 | Bacteria | 2407 |
| 420 | Ga0163163_10319719 | 3300014325 | Bacteria | 1606 |
| 421 | Ga0157380_10052717 | 3300014326 | Bacteria | 3222 |
| 422 | Ga0157380_10186521 | 3300014326 | Bacteria | 1827 |
| 423 | Ga0157377_10000364 | 3300014745 | Bacteria | 20226 |
| 424 | Ga0157377_10078424 | 3300014745 | Bacteria | 1925 |
| 425 | Ga0157377_10146525 | 3300014745 | Bacteria | 1456 |
| 426 | Ga0157379_10000136 | 3300014968 | Bacteria | 52716 |
| 427 | Ga0157379_10082081 | 3300014968 | Bacteria | 2888 |
| 428 | Ga0157379_10144530 | 3300014968 | Bacteria | 2145 |
| 429 | Ga0157376_10000282 | 3300014969 | Bacteria | 34358 |
| 430 | Ga0157376_10019471 | 3300014969 | Bacteria | 5233 |
| 431 | Ga0157376_10030126 | 3300014969 | Bacteria | 4329 |
| 432 | Ga0157376_10042534 | 3300014969 | Bacteria | 3724 |
| 433 | Ga0157376_10045847 | 3300014969 | Bacteria | 3602 |
| 434 | Ga0157376_10068436 | 3300014969 | Bacteria | 3007 |
| 435 | Ga0157376_10136940 | 3300014969 | Bacteria | 2192 |
| 436 | Ga0157376_10158816 | 3300014969 | Bacteria | 2047 |
| 437 | Ga0157376_10207123 | 3300014969 | Bacteria | 1808 |
| 438 | Ga0157376_10235850 | 3300014969 | Bacteria | 1702 |
| 439 | Ga0157376_10243650 | 3300014969 | Bacteria | 1676 |
| 440 | Ga0157376_10258253 | 3300014969 | Unclassified | 1631 |
| 441 | Ga0157376_10576190 | 3300014969 | Bacteria | 1117 |
| 442 | Ga0157376_10629810 | 3300014969 | Bacteria | 1071 |
| 443 | Ga0163161_10003977 | 3300017792 | Bacteria | 10351 |
| 444 | Ga0228598_1004988 | 3300024227 | Bacteria | 2791 |
| 445 | Ga0228598_1007435 | 3300024227 | Bacteria | 2230 |
| 446 | Ga0209233_1007528 | 3300025261 | Bacteria | 3444 |
| 447 | Ga0207697_10001780 | 3300025315 | Bacteria | 11536 |
| 448 | Ga0207656_10023292 | 3300025321 | Bacteria | 2492 |
| 449 | Ga0207682_10000392 | 3300025893 | Bacteria | 20119 |
| 450 | Ga0207642_10020722 | 3300025899 | Bacteria | 2573 |
| 451 | Ga0207642_10026880 | 3300025899 | Bacteria | 2348 |
| 452 | Ga0207710_10014776 | 3300025900 | Bacteria | 3296 |
| 453 | Ga0207710_10015930 | 3300025900 | Bacteria | 3179 |
| 454 | Ga0207688_10000089 | 3300025901 | Bacteria | 35353 |
| 455 | Ga0207680_10006153 | 3300025903 | Bacteria | 5788 |
| 456 | Ga0207680_10014898 | 3300025903 | Bacteria | 4041 |
| 457 | Ga0207680_10033225 | 3300025903 | Bacteria | 2941 |
| 458 | Ga0207680_10049998 | 3300025903 | Bacteria | 2492 |
| 459 | Ga0207680_10158383 | 3300025903 | Bacteria | 1516 |
| 460 | Ga0207647_10000810 | 3300025904 | Bacteria | 24235 |
| 461 | Ga0207647_10003459 | 3300025904 | Bacteria | 11851 |
| 462 | Ga0207647_10042476 | 3300025904 | Bacteria | 2852 |
| 463 | Ga0207645_10003099 | 3300025907 | Bacteria | 12749 |
| 464 | Ga0207645_10174320 | 3300025907 | Bacteria | 1410 |
| 465 | Ga0207645_10266741 | 3300025907 | Bacteria | 1135 |
| 466 | Ga0207643_10000030 | 3300025908 | Bacteria | 97831 |
| 467 | Ga0207705_10000048 | 3300025909 | Bacteria | 171848 |
| 468 | Ga0207705_10003131 | 3300025909 | Bacteria | 12595 |
| 469 | Ga0207705_10003420 | 3300025909 | Bacteria | 12069 |
| 470 | Ga0207705_10009158 | 3300025909 | Bacteria | 7213 |
| 471 | Ga0207705_10080739 | 3300025909 | Bacteria | 2370 |
| 472 | Ga0207705_10156854 | 3300025909 | Bacteria | 1708 |
| 473 | Ga0207705_10190806 | 3300025909 | Bacteria | 1549 |
| 474 | Ga0207705_10251566 | 3300025909 | Bacteria | 1348 |
| 475 | Ga0207654_10003953 | 3300025911 | Bacteria | 7464 |
| 476 | Ga0207654_10040688 | 3300025911 | Bacteria | 2620 |
| 477 | Ga0207707_10042746 | 3300025912 | Bacteria | 3954 |
| 478 | Ga0207707_10106078 | 3300025912 | Bacteria | 2456 |
| 479 | Ga0207707_10176404 | 3300025912 | Bacteria | 1867 |
| 480 | Ga0207707_10208335 | 3300025912 | Bacteria | 1703 |
| 481 | Ga0207707_10223257 | 3300025912 | Bacteria | 1640 |
| 482 | Ga0207707_10319707 | 3300025912 | Bacteria | 1340 |
| 483 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 484 | Ga0207695_10000354 | 3300025913 | Bacteria | 105275 |
| 485 | Ga0207695_10071412 | 3300025913 | Bacteria | 3546 |
| 486 | Ga0207695_10236616 | 3300025913 | Bacteria | 1729 |
| 487 | Ga0207695_10345777 | 3300025913 | Bacteria | 1375 |
| 488 | Ga0207695_10523965 | 3300025913 | Bacteria | 1067 |
| 489 | Ga0207671_10002141 | 3300025914 | Bacteria | 21552 |
| 490 | Ga0207663_10501109 | 3300025916 | Bacteria | 943 |
| 491 | Ga0207660_10033197 | 3300025917 | Bacteria | 3568 |
| 492 | Ga0207660_10089871 | 3300025917 | Bacteria | 2274 |
| 493 | Ga0207660_10162028 | 3300025917 | Bacteria | 1726 |
| 494 | Ga0207660_10233607 | 3300025917 | Bacteria | 1446 |
| 495 | Ga0207660_10279115 | 3300025917 | Bacteria | 1325 |
| 496 | Ga0207662_10000128 | 3300025918 | Bacteria | 36490 |
| 497 | Ga0207662_10061436 | 3300025918 | Bacteria | 2256 |
| 498 | Ga0207662_10119494 | 3300025918 | Bacteria | 1652 |
| 499 | Ga0207657_10000011 | 3300025919 | Bacteria | 186233 |
| 500 | Ga0207657_10000823 | 3300025919 | Bacteria | 32798 |
| 501 | Ga0207657_10017050 | 3300025919 | Bacteria | 6985 |
| 502 | Ga0207657_10069052 | 3300025919 | Bacteria | 3000 |
| 503 | Ga0207649_10002988 | 3300025920 | Bacteria | 9318 |
| 504 | Ga0207649_10007381 | 3300025920 | Bacteria | 5981 |
| 505 | Ga0207649_10167624 | 3300025920 | Bacteria | 1527 |
| 506 | Ga0207649_10207470 | 3300025920 | Bacteria | 1388 |
| 507 | Ga0207652_10016976 | 3300025921 | Bacteria | 5954 |
| 508 | Ga0207652_10017745 | 3300025921 | Bacteria | 5829 |
| 509 | Ga0207652_10019825 | 3300025921 | Bacteria | 5536 |
| 510 | Ga0207652_10077073 | 3300025921 | Bacteria | 2908 |
| 511 | Ga0207652_10117046 | 3300025921 | Bacteria | 2368 |
| 512 | Ga0207652_10243248 | 3300025921 | Bacteria | 1622 |
| 513 | Ga0207646_10000037 | 3300025922 | Bacteria | 196362 |
| 514 | Ga0207646_10000343 | 3300025922 | Bacteria | 62896 |
| 515 | Ga0207646_10513079 | 3300025922 | Bacteria | 1079 |
| 516 | Ga0207646_10550266 | 3300025922 | Bacteria | 1038 |
| 517 | Ga0207681_10000822 | 3300025923 | Bacteria | 20467 |
| 518 | Ga0207681_10118269 | 3300025923 | Bacteria | 1939 |
| 519 | Ga0207681_10180816 | 3300025923 | Bacteria | 1606 |
| 520 | Ga0207694_10010372 | 3300025924 | Bacteria | 7023 |
| 521 | Ga0207694_10012007 | 3300025924 | Bacteria | 6531 |
| 522 | Ga0207694_10033732 | 3300025924 | Bacteria | 3921 |
| 523 | Ga0207694_10097950 | 3300025924 | Bacteria | 2321 |
| 524 | Ga0207694_10210222 | 3300025924 | Bacteria | 1585 |
| 525 | Ga0207694_10360249 | 3300025924 | Bacteria | 1205 |
| 526 | Ga0207650_10000283 | 3300025925 | Bacteria | 52381 |
| 527 | Ga0207650_10029449 | 3300025925 | Bacteria | 3947 |
| 528 | Ga0207650_10267387 | 3300025925 | Bacteria | 1389 |
| 529 | Ga0207659_10000996 | 3300025926 | Bacteria | 16842 |
| 530 | Ga0207659_10001213 | 3300025926 | Bacteria | 15413 |
| 531 | Ga0207659_10113563 | 3300025926 | Bacteria | 2063 |
| 532 | Ga0207659_10117776 | 3300025926 | Bacteria | 2030 |
| 533 | Ga0207659_10359411 | 3300025926 | Bacteria | 1210 |
| 534 | Ga0207659_10453394 | 3300025926 | Bacteria | 1080 |
| 535 | Ga0207687_10007299 | 3300025927 | Bacteria | 7291 |
| 536 | Ga0207687_10107619 | 3300025927 | Bacteria | 2063 |
| 537 | Ga0207700_10003657 | 3300025928 | Bacteria | 8964 |
| 538 | Ga0207700_10130792 | 3300025928 | Bacteria | 2049 |
| 539 | Ga0207664_10359771 | 3300025929 | Bacteria | 1289 |
| 540 | Ga0207644_10020458 | 3300025931 | Bacteria | 4499 |
| 541 | Ga0207644_10029897 | 3300025931 | Bacteria | 3782 |
| 542 | Ga0207690_10002489 | 3300025932 | Bacteria | 11132 |
| 543 | Ga0207690_10118262 | 3300025932 | Bacteria | 1920 |
| 544 | Ga0207690_10279237 | 3300025932 | Bacteria | 1300 |
| 545 | Ga0207706_10000365 | 3300025933 | Bacteria | 48957 |
| 546 | Ga0207706_10113218 | 3300025933 | Bacteria | 2387 |
| 547 | Ga0207706_10126975 | 3300025933 | Bacteria | 2243 |
| 548 | Ga0207706_10552701 | 3300025933 | Bacteria | 991 |
| 549 | Ga0207686_10004734 | 3300025934 | Bacteria | 7303 |
| 550 | Ga0207686_10150260 | 3300025934 | Bacteria | 1621 |
| 551 | Ga0207686_10229107 | 3300025934 | Bacteria | 1346 |
| 552 | Ga0207670_10000186 | 3300025936 | Bacteria | 41273 |
| 553 | Ga0207670_10141333 | 3300025936 | Bacteria | 1776 |
| 554 | Ga0207670_10191489 | 3300025936 | Bacteria | 1548 |
| 555 | Ga0207669_10005330 | 3300025937 | Bacteria | 5759 |
| 556 | Ga0207704_10000310 | 3300025938 | Bacteria | 22888 |
| 557 | Ga0207704_10005824 | 3300025938 | Bacteria | 5702 |
| 558 | Ga0207665_10058141 | 3300025939 | Bacteria | 2613 |
| 559 | Ga0207665_10152862 | 3300025939 | Bacteria | 1654 |
| 560 | Ga0207691_10000341 | 3300025940 | Bacteria | 46943 |
| 561 | Ga0207691_10033820 | 3300025940 | Bacteria | 4759 |
| 562 | Ga0207691_10079684 | 3300025940 | Bacteria | 2947 |
| 563 | Ga0207691_10347585 | 3300025940 | Bacteria | 1269 |
| 564 | Ga0207711_10003067 | 3300025941 | Bacteria | 14585 |
| 565 | Ga0207711_10007764 | 3300025941 | Bacteria | 8964 |
| 566 | Ga0207711_10036970 | 3300025941 | Bacteria | 4144 |
| 567 | Ga0207711_10039221 | 3300025941 | Bacteria | 4028 |
| 568 | Ga0207711_10041117 | 3300025941 | Bacteria | 3936 |
| 569 | Ga0207711_10077530 | 3300025941 | Bacteria | 2897 |
| 570 | Ga0207711_10087655 | 3300025941 | Bacteria | 2731 |
| 571 | Ga0207711_10162404 | 3300025941 | Bacteria | 2023 |
| 572 | Ga0207711_10380065 | 3300025941 | Bacteria | 1310 |
| 573 | Ga0207711_10393153 | 3300025941 | Bacteria | 1288 |
| 574 | Ga0207711_10405682 | 3300025941 | Bacteria | 1266 |
| 575 | Ga0207711_10522921 | 3300025941 | Bacteria | 1106 |
| 576 | Ga0207689_10000224 | 3300025942 | Bacteria | 50152 |
| 577 | Ga0207689_10051675 | 3300025942 | Bacteria | 3388 |
| 578 | Ga0207689_10107787 | 3300025942 | Bacteria | 2289 |
| 579 | Ga0207689_10138408 | 3300025942 | Bacteria | 2005 |
| 580 | Ga0207689_10402049 | 3300025942 | Bacteria | 1142 |
| 581 | Ga0207661_10005036 | 3300025944 | Bacteria | 9269 |
| 582 | Ga0207661_10215005 | 3300025944 | Bacteria | 1696 |
| 583 | Ga0207679_10000998 | 3300025945 | Bacteria | 18155 |
| 584 | Ga0207679_10001873 | 3300025945 | Bacteria | 13076 |
| 585 | Ga0207679_10358349 | 3300025945 | Bacteria | 1273 |
| 586 | Ga0207667_10000647 | 3300025949 | Bacteria | 45083 |
| 587 | Ga0207667_10008444 | 3300025949 | Bacteria | 12232 |
| 588 | Ga0207667_10023790 | 3300025949 | Bacteria | 6741 |
| 589 | Ga0207667_10027233 | 3300025949 | Bacteria | 6227 |
| 590 | Ga0207667_10038353 | 3300025949 | Bacteria | 5118 |
| 591 | Ga0207667_10068300 | 3300025949 | Bacteria | 3701 |
| 592 | Ga0207667_10108232 | 3300025949 | Bacteria | 2868 |
| 593 | Ga0207667_10620245 | 3300025949 | Bacteria | 1089 |
| 594 | Ga0207651_10000056 | 3300025960 | Bacteria | 49478 |
| 595 | Ga0207651_10061070 | 3300025960 | Bacteria | 2619 |
| 596 | Ga0207651_10317438 | 3300025960 | Bacteria | 1301 |
| 597 | Ga0207651_10598290 | 3300025960 | Bacteria | 964 |
| 598 | Ga0207668_10014382 | 3300025972 | Bacteria | 4896 |
| 599 | Ga0207668_10017365 | 3300025972 | Bacteria | 4508 |
| 600 | Ga0207640_10000023 | 3300025981 | Bacteria | 160979 |
| 601 | Ga0207640_10001784 | 3300025981 | Bacteria | 11559 |
| 602 | Ga0207640_10017290 | 3300025981 | Bacteria | 4218 |
| 603 | Ga0207658_10000630 | 3300025986 | Bacteria | 31077 |
| 604 | Ga0207658_10283792 | 3300025986 | Bacteria | 1420 |
| 605 | Ga0207677_10000047 | 3300026023 | Bacteria | 104149 |
| 606 | Ga0207677_10076376 | 3300026023 | Bacteria | 2385 |
| 607 | Ga0207677_10136423 | 3300026023 | Bacteria | 1871 |
| 608 | Ga0207677_10544341 | 3300026023 | Bacteria | 1011 |
| 609 | Ga0207703_10000494 | 3300026035 | Bacteria | 40942 |
| 610 | Ga0207703_10012018 | 3300026035 | Bacteria | 6743 |
| 611 | Ga0207703_10032738 | 3300026035 | Bacteria | 4115 |
| 612 | Ga0207703_10067170 | 3300026035 | Bacteria | 2951 |
| 613 | Ga0207639_10000034 | 3300026041 | Bacteria | 154355 |
| 614 | Ga0207639_10000846 | 3300026041 | Bacteria | 20822 |
| 615 | Ga0207639_10087391 | 3300026041 | Bacteria | 2485 |
| 616 | Ga0207639_10175476 | 3300026041 | Bacteria | 1819 |
| 617 | Ga0207678_10001665 | 3300026067 | Bacteria | 20379 |
| 618 | Ga0207678_10009274 | 3300026067 | Bacteria | 8658 |
| 619 | Ga0207708_10057081 | 3300026075 | Bacteria | 2978 |
| 620 | Ga0207708_10071363 | 3300026075 | Bacteria | 2660 |
| 621 | Ga0207708_10100053 | 3300026075 | Bacteria | 2243 |
| 622 | Ga0207708_10337013 | 3300026075 | Bacteria | 1234 |
| 623 | Ga0207702_10005139 | 3300026078 | Bacteria | 11514 |
| 624 | Ga0207641_10000554 | 3300026088 | Bacteria | 41888 |
| 625 | Ga0207641_10001674 | 3300026088 | Bacteria | 21561 |
| 626 | Ga0207641_10007294 | 3300026088 | Bacteria | 9214 |
| 627 | Ga0207641_10187187 | 3300026088 | Bacteria | 1900 |
| 628 | Ga0207641_10281307 | 3300026088 | Bacteria | 1565 |
| 629 | Ga0207648_10002554 | 3300026089 | Bacteria | 19510 |
| 630 | Ga0207648_10038262 | 3300026089 | Bacteria | 4222 |
| 631 | Ga0207648_10096571 | 3300026089 | Bacteria | 2586 |
| 632 | Ga0207648_10135195 | 3300026089 | Bacteria | 2172 |
| 633 | Ga0207648_10190814 | 3300026089 | Bacteria | 1816 |
| 634 | Ga0207676_10001365 | 3300026095 | Bacteria | 18169 |
| 635 | Ga0207676_10047359 | 3300026095 | Bacteria | 3331 |
| 636 | Ga0207676_10076735 | 3300026095 | Bacteria | 2701 |
| 637 | Ga0207676_10363422 | 3300026095 | Bacteria | 1342 |
| 638 | Ga0207674_10000532 | 3300026116 | Bacteria | 49916 |
| 639 | Ga0207674_10021388 | 3300026116 | Bacteria | 6967 |
| 640 | Ga0207674_10032281 | 3300026116 | Bacteria | 5494 |
| 641 | Ga0207674_10184270 | 3300026116 | Bacteria | 2038 |
| 642 | Ga0207674_10209419 | 3300026116 | Bacteria | 1899 |
| 643 | Ga0207674_10301449 | 3300026116 | Bacteria | 1551 |
| 644 | Ga0207674_10327989 | 3300026116 | Bacteria | 1480 |
| 645 | Ga0207674_10431436 | 3300026116 | Bacteria | 1274 |
| 646 | Ga0207675_100000009 | 3300026118 | Bacteria | 163023 |
| 647 | Ga0207675_100017733 | 3300026118 | Bacteria | 6641 |
| 648 | Ga0207675_100075425 | 3300026118 | Bacteria | 3157 |
| 649 | Ga0207675_100082556 | 3300026118 | Bacteria | 3014 |
| 650 | Ga0207675_100121913 | 3300026118 | Bacteria | 2468 |
| 651 | Ga0207675_100273429 | 3300026118 | Bacteria | 1640 |
| 652 | Ga0207683_10010789 | 3300026121 | Bacteria | 7791 |
| 653 | Ga0207683_10032201 | 3300026121 | Bacteria | 4554 |
| 654 | Ga0207683_10037219 | 3300026121 | Bacteria | 4237 |
| 655 | Ga0207683_10080588 | 3300026121 | Bacteria | 2888 |
| 656 | Ga0207683_10240809 | 3300026121 | Bacteria | 1650 |
| 657 | Ga0207683_10350096 | 3300026121 | Bacteria | 1356 |
| 658 | Ga0207683_10393482 | 3300026121 | Bacteria | 1274 |
| 659 | Ga0207698_10002960 | 3300026142 | Bacteria | 10169 |
| 660 | Ga0207428_10000034 | 3300027907 | Bacteria | 231306 |
| 661 | Ga0207428_10045568 | 3300027907 | Bacteria | 3531 |
| 662 | Ga0207428_10070330 | 3300027907 | Bacteria | 2751 |
| 663 | Ga0207428_10110383 | 3300027907 | Bacteria | 2118 |
| 664 | Ga0207428_10111063 | 3300027907 | Bacteria | 2110 |
| 665 | Ga0268266_10001917 | 3300028379 | Bacteria | 23380 |
| 666 | Ga0268266_10005896 | 3300028379 | Bacteria | 11335 |
| 667 | Ga0268266_10007930 | 3300028379 | Bacteria | 9500 |
| 668 | Ga0268266_10029767 | 3300028379 | Bacteria | 4639 |
| 669 | Ga0268266_10398012 | 3300028379 | Bacteria | 1302 |
| 670 | Ga0268265_10183463 | 3300028380 | Bacteria | 1800 |
| 671 | Ga0268265_10196615 | 3300028380 | Bacteria | 1745 |
| 672 | Ga0268265_10626017 | 3300028380 | Bacteria | 1032 |
| 673 | Ga0268264_10005545 | 3300028381 | Bacteria | 10695 |
| 674 | Ga0268264_10111054 | 3300028381 | Bacteria | 2401 |
| 675 | Ga0268264_10145483 | 3300028381 | Bacteria | 2119 |
| 676 | Ga0268264_10234483 | 3300028381 | Bacteria | 1696 |
| 677 | Ga0268264_10656117 | 3300028381 | Bacteria | 1039 |
| 678 | Ga0268264_10732567 | 3300028381 | Bacteria | 984 |
| 679 | Ga0265338_10083576 | 3300028800 | Bacteria | 2670 |
| 680 | Ga0265760_10012291 | 3300031090 | Bacteria | 2447 |
| 681 | Ga0265760_10014127 | 3300031090 | Bacteria | 2285 |
| 682 | Ga0265760_10020278 | 3300031090 | Bacteria | 1918 |
| 683 | Ga0265320_10084511 | 3300031240 | Bacteria | 1478 |
| 684 | Ga0265325_10057154 | 3300031241 | Bacteria | 1990 |
| 685 | Ga0265325_10176116 | 3300031241 | Bacteria | 998 |
| 686 | Ga0265316_10061401 | 3300031344 | Bacteria | 2919 |
| 687 | Ga0265316_10069991 | 3300031344 | Bacteria | 2707 |
| 688 | Ga0265316_10170685 | 3300031344 | Bacteria | 1623 |
| 689 | Ga0307408_100087781 | 3300031548 | Bacteria | 2341 |
| 690 | Ga0307408_100252141 | 3300031548 | Bacteria | 1456 |
| 691 | Ga0265314_10013729 | 3300031711 | Bacteria | 6530 |
| 692 | Ga0307410_10077593 | 3300031852 | Bacteria | 2323 |
| 693 | Ga0307409_100229704 | 3300031995 | Bacteria | 1681 |
| 694 | Ga0307409_100516677 | 3300031995 | Bacteria | 1166 |
| 695 | Ga0307416_100092003 | 3300032002 | Bacteria | 2607 |
| 696 | Ga0307416_100202969 | 3300032002 | Bacteria | 1883 |
| 697 | Ga0307416_100382062 | 3300032002 | Bacteria | 1439 |
| 698 | Ga0307414_10202208 | 3300032004 | Bacteria | 1617 |
| 699 | Ga0307411_10041711 | 3300032005 | Bacteria | 2923 |
| 700 | Ga0307415_100423547 | 3300032126 | Bacteria | 1143 |
| 701 | Ga0307415_100717358 | 3300032126 | Bacteria | 904 |
| 702 | Ga0307510_10118139 | 3300033180 | Bacteria | 2366 |
| 703 | Ga0373950_0016784 | 3300034818 | Bacteria | 1255 |
| 704 | Ga0373959_0000924 | 3300034820 | Bacteria | 4951 |
| 705 | Ga0373938_0017018 | 3300034957 | Bacteria | 1427 |
| 706 | Ga0373926_0070487 | 3300035083 | Bacteria | 1284 |
| 707 | Ga0373928_0003435 | 3300035084 | Bacteria | 3015 |
| 708 | Ga0373929_0000116 | 3300035085 | Bacteria | 13311 |
| 709 | Ga0373934_0105921 | 3300035086 | Bacteria | 1138 |
| 710 | Ga0373940_0000084 | 3300035088 | Bacteria | 11367 |
| 711 | Ga0373944_0029297 | 3300035089 | Bacteria | 1645 |
| 712 | Ga0373949_0019342 | 3300035090 | Bacteria | 1550 |
| 713 | Ga0373952_0027059 | 3300035092 | Bacteria | 1249 |
| 714 | Ga0373952_0037917 | 3300035092 | Bacteria | 1102 |
| 715 | Ga0373952_0060887 | 3300035092 | Bacteria | 923 |
| 716 | Ga0373932_0000807 | 3300035112 | Bacteria | 9293 |
| 717 | Ga0373932_0009460 | 3300035112 | Bacteria | 2344 |
| 718 | Ga0373936_0048513 | 3300035113 | Bacteria | 1714 |
| 719 | Ga0373939_0096860 | 3300035114 | Bacteria | 1006 |
| 720 | Ga0373941_0000161 | 3300035115 | Bacteria | 12224 |
| 721 | Ga0373945_0107256 | 3300035116 | Bacteria | 1099 |
| 722 | Ga0373945_0117583 | 3300035116 | Bacteria | 1054 |
| 723 | Ga0373953_0112914 | 3300035117 | Bacteria | 1150 |
| 724 | Ga0373954_0158733 | 3300035118 | Bacteria | 1106 |
| 725 | Ga0373954_0261659 | 3300035118 | Bacteria | 852 |
| 726 | Ga0373960_0000753 | 3300035121 | Bacteria | 6755 |
| 727 | Ga0373943_0045705 | 3300035170 | Bacteria | 2135 |
| 728 | Ga0373946_0045683 | 3300035171 | Bacteria | 1813 |
| 729 | Ga0373955_0103149 | 3300035172 | Bacteria | 1640 |
| 730 | Ga0373942_0001757 | 3300035207 | Bacteria | 5486 |
| 731 | Ga0373961_0001371 | 3300035241 | Bacteria | 7313 |
| 732 | Ga0373962_0000245 | 3300035242 | Bacteria | 11519 |
| 733 | Ga0373924_0013554 | 3300035410 | Bacteria | 3064 |
| 734 | Ga0373931_0004378 | 3300035691 | Bacteria | 6449 |
| 735 | Ga0373935_0038030 | 3300035692 | Bacteria | 3012 |
| 736 | Ga0373935_0045541 | 3300035692 | Bacteria | 2768 |
| 737 | Ga0373935_0053767 | 3300035692 | Bacteria | 2562 |
| 738 | Ga0373935_0510763 | 3300035692 | Bacteria | 873 |
| 739 | Ga0373927_0117868 | 3300035695 | Bacteria | 1732 |
| 740 | Ga0373947_0040913 | 3300035725 | Bacteria | 2762 |
| 741 | Ga0373937_0029266 | 3300036401 | Bacteria | 4988 |
| 742 | Ga0373937_0103229 | 3300036401 | Bacteria | 2648 |
| 743 | Ga0373937_0120726 | 3300036401 | Bacteria | 2442 |
| 744 | Ga0373937_0202959 | 3300036401 | Bacteria | 1864 |
| 745 | Ga0373937_0274871 | 3300036401 | Bacteria | 1590 |
| 746 | Ga0373937_0554909 | 3300036401 | Bacteria | 1091 |
| 747 | Ga0373925_0005941 | 3300037068 | Bacteria | 9044 |
| 748 | Ga0373925_0046585 | 3300037068 | Bacteria | 3225 |
| 749 | Ga0373925_0173403 | 3300037068 | Bacteria | 1703 |
| 750 | Ga0395905_0001744 | 3300037471 | Bacteria | 25404 |
| 751 | Ga0395905_0007578 | 3300037471 | Bacteria | 10786 |
| 752 | Ga0395905_0014151 | 3300037471 | Bacteria | 7623 |
| 753 | Ga0395905_0033731 | 3300037471 | Bacteria | 4808 |
| 754 | Ga0436364_1357538 | 3300037853 | Bacteria | 1887 |
| 755 | Ga0395901_0728164 | 3300038443 | Bacteria | 987 |
| 756 | Ga0436361_0277179 | 3300039447 | Unclassified | 931 |
| 757 | Ga0436363_1450178 | 3300039450 | Bacteria | 1085 |
| 758 | Ga0450917_003592 | 3300042120 | Bacteria | 1124 |
| 759 | Ga0450891_003545 | 3300042129 | Bacteria | 1497 |
| 760 | Ga0450902_021445 | 3300042137 | Bacteria | 1068 |
| 761 | Ga0439435_0019796 | 3300042436 | Bacteria | 1729 |
| 762 | Ga0451577_0000033 | 3300042876 | Bacteria | 378714 |
| 763 | Ga0451577_0001113 | 3300042876 | Bacteria | 38143 |
| 764 | Ga0451577_0006345 | 3300042876 | Bacteria | 11810 |
| 765 | Ga0451577_0019789 | 3300042876 | Bacteria | 6184 |
| 766 | Ga0451577_0066882 | 3300042876 | Bacteria | 3204 |
| 767 | Ga0451577_0097736 | 3300042876 | Bacteria | 2622 |
| 768 | Ga0451577_0114827 | 3300042876 | Bacteria | 2410 |
| 769 | Ga0451577_0127100 | 3300042876 | Bacteria | 2284 |
| 770 | Ga0451577_0150505 | 3300042876 | Bacteria | 2094 |
| 771 | Ga0451577_0439764 | 3300042876 | Bacteria | 1184 |
| 772 | Ga0453683_0000086 | 3300044673 | Bacteria | 139689 |
| 773 | Ga0453683_0001684 | 3300044673 | Bacteria | 18427 |
| 774 | Ga0453683_0005105 | 3300044673 | Bacteria | 9213 |
| 775 | Ga0453683_0005320 | 3300044673 | Bacteria | 8994 |
| 776 | Ga0453683_0009861 | 3300044673 | Bacteria | 6363 |
| 777 | Ga0453683_0094013 | 3300044673 | Bacteria | 1880 |
| 778 | Ga0453683_0101306 | 3300044673 | Bacteria | 1808 |
| 779 | Ga0453683_0119218 | 3300044673 | Bacteria | 1661 |
| 780 | Ga0466966_0072934 | 3300044684 | Bacteria | 2148 |
| 781 | Ga0466961_0161787 | 3300044693 | Bacteria | 1395 |
| 782 | Ga0466961_0230596 | 3300044693 | Bacteria | 1140 |
| 783 | Ga0466963_0016278 | 3300044694 | Bacteria | 4622 |
| 784 | Ga0466963_0024269 | 3300044694 | Bacteria | 3860 |
| 785 | Ga0466963_0061019 | 3300044694 | Bacteria | 2519 |
| 786 | Ga0466963_0085217 | 3300044694 | Bacteria | 2145 |
| 787 | Ga0466963_0170099 | 3300044694 | Bacteria | 1519 |
| 788 | Ga0453684_0000109 | 3300044712 | Bacteria | 361015 |
| 789 | Ga0453684_0000258 | 3300044712 | Bacteria | 228312 |
| 790 | Ga0453684_0003980 | 3300044712 | Bacteria | 32269 |
| 791 | Ga0453684_0008349 | 3300044712 | Bacteria | 18610 |
| 792 | Ga0453684_0029625 | 3300044712 | Bacteria | 7762 |
| 793 | Ga0453684_0032203 | 3300044712 | Bacteria | 7346 |
| 794 | Ga0453684_0153937 | 3300044712 | Bacteria | 2728 |
| 795 | Ga0453684_0293217 | 3300044712 | Bacteria | 1851 |
| 796 | Ga0466971_0237341 | 3300044719 | Bacteria | 867 |
| 797 | Ga0466959_0118527 | 3300045049 | Bacteria | 1884 |
| 798 | Ga0466959_0131729 | 3300045049 | Bacteria | 1772 |
| 799 | Ga0451576_0003523 | 3300045051 | Bacteria | 21376 |
| 800 | Ga0451576_0005411 | 3300045051 | Bacteria | 16028 |
| 801 | Ga0451576_0017930 | 3300045051 | Bacteria | 7771 |
| 802 | Ga0451576_0027325 | 3300045051 | Bacteria | 6130 |
| 803 | Ga0451576_0030890 | 3300045051 | Bacteria | 5715 |
| 804 | Ga0451576_0050576 | 3300045051 | Bacteria | 4358 |
| 805 | Ga0451576_0055322 | 3300045051 | Bacteria | 4152 |
| 806 | Ga0451576_0268735 | 3300045051 | Bacteria | 1782 |
| 807 | Ga0451576_0447668 | 3300045051 | Bacteria | 1356 |
| 808 | Ga0451576_0582350 | 3300045051 | Bacteria | 1176 |
| 809 | Ga0451576_0640120 | 3300045051 | Bacteria | 1117 |
| 810 | Ga0466967_0046975 | 3300045976 | Bacteria | 3762 |
| 811 | Ga0466967_0542458 | 3300045976 | Bacteria | 1144 |
| 812 | Ga0466967_0769867 | 3300045976 | Bacteria | 955 |
| 813 | Ga0495592_0014907 | 3300046454 | Bacteria | 5899 |
| 814 | Ga0495592_0134880 | 3300046454 | Bacteria | 1723 |
| 815 | Ga0495592_0176304 | 3300046454 | Bacteria | 1460 |
| 816 | Ga0495592_0342953 | 3300046454 | Bacteria | 960 |
| 817 | Ga0495603_0054967 | 3300046455 | Bacteria | 2359 |
| 818 | Ga0495629_0019600 | 3300046459 | Bacteria | 4831 |
| 819 | Ga0495629_0056581 | 3300046459 | Bacteria | 2742 |
| 820 | Ga0495629_0101592 | 3300046459 | Bacteria | 2006 |
| 821 | Ga0495629_0161589 | 3300046459 | Bacteria | 1556 |
| 822 | Ga0495629_0445729 | 3300046459 | Bacteria | 877 |
| 823 | Ga0495638_0125130 | 3300046460 | Bacteria | 1515 |
| 824 | Ga0495651_0029420 | 3300046462 | Bacteria | 4283 |
| 825 | Ga0495651_0117887 | 3300046462 | Bacteria | 1954 |
| 826 | Ga0495651_0211321 | 3300046462 | Bacteria | 1350 |
| 827 | Ga0495653_0002196 | 3300046463 | Bacteria | 15433 |
| 828 | Ga0495653_0382720 | 3300046463 | Bacteria | 898 |
| 829 | Ga0495650_0000010 | 3300046471 | Bacteria | 645599 |
| 830 | Ga0495650_0001875 | 3300046471 | Bacteria | 18731 |
| 831 | Ga0495580_0045055 | 3300046472 | Bacteria | 3134 |
| 832 | Ga0495580_0101580 | 3300046472 | Bacteria | 2000 |
| 833 | Ga0495580_0220030 | 3300046472 | Bacteria | 1305 |
| 834 | Ga0495580_0434515 | 3300046472 | Bacteria | 882 |
| 835 | Ga0495582_0016241 | 3300046473 | Bacteria | 4078 |
| 836 | Ga0495582_0105380 | 3300046473 | Bacteria | 1581 |
| 837 | Ga0495582_0274329 | 3300046473 | Bacteria | 968 |
| 838 | Ga0495639_0003617 | 3300046475 | Bacteria | 6665 |
| 839 | Ga0495662_0047152 | 3300046476 | Bacteria | 2080 |
| 840 | Ga0495664_0089384 | 3300046477 | Bacteria | 1851 |
| 841 | Ga0495664_0133863 | 3300046477 | Bacteria | 1502 |
| 842 | Ga0495585_0038359 | 3300046492 | Bacteria | 2697 |
| 843 | Ga0495594_0005255 | 3300046499 | Bacteria | 6657 |
| 844 | Ga0495594_0025822 | 3300046499 | Bacteria | 3158 |
| 845 | Ga0495596_0041323 | 3300046500 | Bacteria | 1818 |
| 846 | Ga0495583_0005362 | 3300046506 | Bacteria | 8743 |
| 847 | Ga0495606_0011222 | 3300046507 | Bacteria | 7332 |
| 848 | Ga0495606_0054290 | 3300046507 | Bacteria | 2595 |
| 849 | Ga0495606_0177239 | 3300046507 | Bacteria | 1232 |
| 850 | Ga0495608_0004188 | 3300046511 | Bacteria | 10337 |
| 851 | Ga0495628_0004868 | 3300046516 | Bacteria | 11820 |
| 852 | Ga0495628_0118357 | 3300046516 | Bacteria | 2034 |
| 853 | Ga0495628_0247535 | 3300046516 | Bacteria | 1332 |
| 854 | Ga0495628_0412216 | 3300046516 | Bacteria | 986 |
| 855 | Ga0495630_0010900 | 3300046517 | Bacteria | 6565 |
| 856 | Ga0495630_0057928 | 3300046517 | Bacteria | 2904 |
| 857 | Ga0495630_0281019 | 3300046517 | Bacteria | 1272 |
| 858 | Ga0495631_0055316 | 3300046518 | Bacteria | 1729 |
| 859 | Ga0495643_0038186 | 3300046522 | Bacteria | 2631 |
| 860 | Ga0495644_0000777 | 3300046523 | Bacteria | 13129 |
| 861 | Ga0495666_0000717 | 3300046526 | Bacteria | 15137 |
| 862 | Ga0495652_0081707 | 3300046529 | Bacteria | 2665 |
| 863 | Ga0495665_0006456 | 3300046531 | Bacteria | 6332 |
| 864 | Ga0495640_0028932 | 3300046533 | Bacteria | 3984 |
| 865 | Ga0495640_0111910 | 3300046533 | Bacteria | 1783 |
| 866 | Ga0495586_0005179 | 3300046535 | Bacteria | 6976 |
| 867 | Ga0495586_0107871 | 3300046535 | Bacteria | 1549 |
| 868 | Ga0495587_0071108 | 3300046536 | Bacteria | 2024 |
| 869 | Ga0495609_0064869 | 3300046538 | Bacteria | 1610 |
| 870 | Ga0495645_0004427 | 3300046543 | Bacteria | 9593 |
| 871 | Ga0495645_0008980 | 3300046543 | Bacteria | 6981 |
| 872 | Ga0495645_0027506 | 3300046543 | Bacteria | 4132 |
| 873 | Ga0495645_0164427 | 3300046543 | Bacteria | 1532 |
| 874 | Ga0495645_0222475 | 3300046543 | Bacteria | 1269 |
| 875 | Ga0495667_0007451 | 3300046559 | Bacteria | 7419 |
| 876 | Ga0495667_0023465 | 3300046559 | Bacteria | 4157 |
| 877 | Ga0495667_0266452 | 3300046559 | Bacteria | 1089 |
| 878 | Ga0495656_0051535 | 3300046615 | Bacteria | 1762 |
| 879 | Ga0495656_0184261 | 3300046615 | Bacteria | 1028 |
| 880 | Ga0495668_0031504 | 3300046616 | Bacteria | 2988 |
| 881 | Ga0495668_0138011 | 3300046616 | Bacteria | 1334 |
| 882 | Ga0495634_0001003 | 3300046642 | Bacteria | 26591 |
| 883 | Ga0495634_0057828 | 3300046642 | Bacteria | 2587 |
| 884 | Ga0495625_0003213 | 3300046660 | Bacteria | 16576 |
| 885 | Ga0495625_0038577 | 3300046660 | Bacteria | 3496 |
| 886 | Ga0495635_0054696 | 3300046663 | Bacteria | 2749 |
| 887 | Ga0495635_0104808 | 3300046663 | Bacteria | 1933 |
| 888 | Ga0495635_0252379 | 3300046663 | Bacteria | 1189 |
| 889 | Ga0495661_0051415 | 3300046665 | Bacteria | 2488 |
| 890 | Ga0495588_0058761 | 3300046674 | Bacteria | 1988 |
| 891 | Ga0495657_0103606 | 3300046675 | Bacteria | 1810 |
| 892 | Ga0495599_0068521 | 3300046678 | Bacteria | 2215 |
| 893 | Ga0495599_0090734 | 3300046678 | Bacteria | 1906 |
| 894 | Ga0495623_0016239 | 3300046679 | Bacteria | 4808 |
| 895 | Ga0495623_0059574 | 3300046679 | Bacteria | 2397 |
| 896 | Ga0495646_0027537 | 3300046680 | Bacteria | 3566 |
| 897 | Ga0495646_0078441 | 3300046680 | Bacteria | 1930 |
| 898 | Ga0495646_0247826 | 3300046680 | Bacteria | 955 |
| 899 | Ga0495647_0112442 | 3300046681 | Bacteria | 1138 |
| 900 | Ga0495647_0130370 | 3300046681 | Bacteria | 1065 |
| 901 | Ga0495658_0022257 | 3300046683 | Bacteria | 3349 |
| 902 | Ga0495658_0029349 | 3300046683 | Bacteria | 2977 |
| 903 | Ga0495658_0077780 | 3300046683 | Bacteria | 1941 |
| 904 | Ga0495658_0124747 | 3300046683 | Bacteria | 1561 |
| 905 | Ga0495658_0232635 | 3300046683 | Bacteria | 1156 |
| 906 | Ga0495669_0000560 | 3300046684 | Bacteria | 16456 |
| 907 | Ga0495669_0000955 | 3300046684 | Bacteria | 12075 |
| 908 | Ga0495669_0009730 | 3300046684 | Bacteria | 4058 |
| 909 | Ga0495613_0013985 | 3300046689 | Bacteria | 5957 |
| 910 | Ga0495613_0018272 | 3300046689 | Bacteria | 5228 |
| 911 | Ga0495613_0295590 | 3300046689 | Bacteria | 1122 |
| 912 | Ga0495624_0005609 | 3300046690 | Bacteria | 9009 |
| 913 | Ga0495624_0237689 | 3300046690 | Bacteria | 1103 |
| 914 | Ga0495670_0032429 | 3300046691 | Bacteria | 2599 |
| 915 | Ga0495670_0311325 | 3300046691 | Bacteria | 845 |
| 916 | Ga0495670_0341633 | 3300046691 | Bacteria | 805 |
| 917 | Ga0495649_0074711 | 3300046694 | Bacteria | 1816 |
| 918 | Ga0495600_0056708 | 3300046809 | Bacteria | 2559 |
| 919 | Ga0495600_0370358 | 3300046809 | Unclassified | 895 |
| 920 | Ga0495581_0000275 | 3300047315 | Bacteria | 24951 |
| 921 | Ga0495581_0088019 | 3300047315 | Unclassified | 1801 |
| 922 | Ga0495581_0211960 | 3300047315 | Bacteria | 1133 |
| 923 | Ga0495581_0237560 | 3300047315 | Bacteria | 1066 |
| 924 | Ga0495604_0009860 | 3300047317 | Bacteria | 7560 |
| 925 | Ga0495604_0027117 | 3300047317 | Bacteria | 4558 |
| 926 | Ga0495604_0073444 | 3300047317 | Bacteria | 2582 |
| 927 | Ga0495636_0043935 | 3300047318 | Bacteria | 1860 |
| 928 | Ga0495674_0009564 | 3300047319 | Bacteria | 9205 |
| 929 | Ga0495674_0088249 | 3300047319 | Bacteria | 2653 |
| 930 | Ga0495674_0206302 | 3300047319 | Bacteria | 1629 |
| 931 | Ga0495672_0005628 | 3300047320 | Bacteria | 9887 |
| 932 | Ga0495672_0072052 | 3300047320 | Bacteria | 1953 |
| 933 | Ga0495672_0265726 | 3300047320 | Bacteria | 826 |
| 934 | Ga0495676_0014477 | 3300047321 | Bacteria | 7058 |
| 935 | Ga0495680_0030110 | 3300047322 | Bacteria | 4436 |
| 936 | Ga0495680_0084304 | 3300047322 | Bacteria | 2395 |
| 937 | Ga0495687_040759 | 3300047443 | Bacteria | 2043 |
| 938 | Ga0495675_0010737 | 3300047444 | Bacteria | 5734 |
| 939 | Ga0495675_0170815 | 3300047444 | Bacteria | 1335 |
| 940 | Ga0495677_0014034 | 3300047445 | Bacteria | 2917 |
| 941 | Ga0495684_0009393 | 3300047471 | Bacteria | 7549 |
| 942 | Ga0495684_0037444 | 3300047471 | Bacteria | 3720 |
| 943 | Ga0495684_0198973 | 3300047471 | Bacteria | 1478 |
| 944 | Ga0495684_0244071 | 3300047471 | Bacteria | 1309 |
| 945 | Ga0495686_0000545 | 3300047472 | Bacteria | 53866 |
| 946 | Ga0495686_0002881 | 3300047472 | Bacteria | 15450 |
| 947 | Ga0495686_0011954 | 3300047472 | Bacteria | 6100 |
| 948 | Ga0495686_0012883 | 3300047472 | Bacteria | 5830 |
| 949 | Ga0495593_0119123 | 3300047673 | Unclassified | 1344 |
| 950 | Ga0495602_0030031 | 3300048088 | Bacteria | 5164 |
| 951 | Ga0495602_0130089 | 3300048088 | Bacteria | 2009 |
| 952 | Ga0495602_0167932 | 3300048088 | Bacteria | 1706 |
| 953 | Ga0495602_0274329 | 3300048088 | Bacteria | 1245 |
| 954 | Ga0495614_0006159 | 3300048089 | Bacteria | 5391 |
| 955 | Ga0495614_0018911 | 3300048089 | Bacteria | 2983 |
| 956 | Ga0496100_0004796 | 3300048903 | Bacteria | 7222 |
| 957 | Ga0496102_0092046 | 3300048905 | Bacteria | 2808 |
| 958 | Ga0496102_0186737 | 3300048905 | Bacteria | 1953 |
| 959 | Ga0496102_0213964 | 3300048905 | Bacteria | 1817 |
| 960 | Ga0496102_0390029 | 3300048905 | Bacteria | 1310 |
| 961 | Ga0496103_0028809 | 3300048906 | Bacteria | 3373 |
| 962 | Ga0496104_0000247 | 3300048907 | Bacteria | 47765 |
| 963 | Ga0496104_0017385 | 3300048907 | Bacteria | 6549 |
| 964 | Ga0496104_0040982 | 3300048907 | Bacteria | 4342 |
| 965 | Ga0496104_0076019 | 3300048907 | Bacteria | 3198 |
| 966 | Ga0496104_0257159 | 3300048907 | Bacteria | 1659 |
| 967 | Ga0496105_0223881 | 3300048908 | Bacteria | 1531 |
| 968 | Ga0496105_0375953 | 3300048908 | Bacteria | 1131 |
| 969 | Ga0496106_0239861 | 3300048909 | Bacteria | 1448 |
| 970 | Ga0496107_0028952 | 3300048910 | Bacteria | 3939 |
| 971 | Ga0496108_0250451 | 3300048911 | Bacteria | 1541 |
| 972 | Ga0496108_0267599 | 3300048911 | Bacteria | 1488 |
| 973 | Ga0496108_0517993 | 3300048911 | Bacteria | 1041 |
| 974 | Ga0496109_0006179 | 3300048912 | Bacteria | 10067 |
| 975 | Ga0496109_0062051 | 3300048912 | Bacteria | 3418 |
| 976 | Ga0496109_0089902 | 3300048912 | Bacteria | 2840 |
| 977 | Ga0496109_0206954 | 3300048912 | Bacteria | 1845 |
| 978 | Ga0496109_0457255 | 3300048912 | Bacteria | 1206 |
| 979 | Ga0496109_0639190 | 3300048912 | Bacteria | 1001 |
| 980 | Ga0496110_0416811 | 3300048913 | Bacteria | 1224 |
| 981 | Ga0496110_0597161 | 3300048913 | Bacteria | 1002 |
| 982 | Ga0496111_0238753 | 3300048914 | Bacteria | 1350 |
| 983 | Ga0496111_0258881 | 3300048914 | Bacteria | 1291 |
| 984 | Ga0496112_0002572 | 3300048915 | Bacteria | 14656 |
| 985 | Ga0496112_0016237 | 3300048915 | Bacteria | 6967 |
| 986 | Ga0496112_0035136 | 3300048915 | Bacteria | 4879 |
| 987 | Ga0496112_0093303 | 3300048915 | Bacteria | 2981 |
| 988 | Ga0496112_0135829 | 3300048915 | Bacteria | 2430 |
| 989 | Ga0496112_0240404 | 3300048915 | Bacteria | 1764 |
| 990 | Ga0496112_0383151 | 3300048915 | Bacteria | 1347 |
| 991 | Ga0496112_0428668 | 3300048915 | Bacteria | 1261 |
| 992 | Ga0496112_0524600 | 3300048915 | Bacteria | 1119 |
| 993 | Ga0496113_0085556 | 3300048916 | Bacteria | 2422 |
| 994 | Ga0496113_0109304 | 3300048916 | Bacteria | 2150 |
| 995 | Ga0496114_0000246 | 3300048917 | Bacteria | 39480 |
| 996 | Ga0496114_0098572 | 3300048917 | Bacteria | 2492 |
| 997 | Ga0496114_0105369 | 3300048917 | Bacteria | 2412 |
| 998 | Ga0496114_0147568 | 3300048917 | Bacteria | 2039 |
| 999 | Ga0496114_0213426 | 3300048917 | Bacteria | 1693 |
| 1000 | Ga0496114_0640718 | 3300048917 | Bacteria | 935 |
| 1001 | Ga0496115_0162341 | 3300048918 | Bacteria | 1847 |
| 1002 | Ga0496116_0009398 | 3300048919 | Bacteria | 8336 |
| 1003 | Ga0496117_0183529 | 3300048920 | Bacteria | 1200 |
| 1004 | Ga0496126_0000005 | 3300048929 | Bacteria | 891906 |
| 1005 | Ga0496126_0000209 | 3300048929 | Bacteria | 131440 |
| 1006 | Ga0496126_0000560 | 3300048929 | Bacteria | 71370 |
| 1007 | Ga0496126_0076168 | 3300048929 | Bacteria | 2976 |
| 1008 | Ga0501031_0035078 | 3300049568 | Bacteria | 3272 |
| 1009 | Ga0501032_0005510 | 3300049569 | Bacteria | 9390 |
| 1010 | Ga0501033_0088222 | 3300049570 | Bacteria | 2269 |
| 1011 | Ga0501034_0018923 | 3300049571 | Bacteria | 7055 |
| 1012 | Ga0501034_0024414 | 3300049571 | Bacteria | 6150 |
| 1013 | Ga0501034_0038818 | 3300049571 | Bacteria | 4823 |
| 1014 | Ga0501036_0001574 | 3300049572 | Bacteria | 17653 |
| 1015 | Ga0501037_0029947 | 3300049573 | Bacteria | 4021 |
| 1016 | Ga0501037_0219280 | 3300049573 | Bacteria | 1339 |
| 1017 | Ga0501038_0021851 | 3300049574 | Bacteria | 5738 |
| 1018 | Ga0501041_0422723 | 3300049577 | Bacteria | 845 |
| 1019 | Ga0501043_0002607 | 3300049579 | Bacteria | 15212 |
| 1020 | Ga0501043_0193740 | 3300049579 | Bacteria | 1580 |
| 1021 | Ga0501043_0242034 | 3300049579 | Bacteria | 1391 |
| 1022 | Ga0501046_0000150 | 3300049580 | Bacteria | 72900 |
| 1023 | Ga0501047_0003876 | 3300049581 | Bacteria | 14071 |
| 1024 | Ga0501047_0015370 | 3300049581 | Bacteria | 7290 |
| 1025 | Ga0501047_0037910 | 3300049581 | Bacteria | 4662 |
| 1026 | Ga0501067_0162452 | 3300049583 | Bacteria | 1244 |
| 1027 | Ga0501068_0301652 | 3300049584 | Bacteria | 1025 |
| 1028 | Ga0501072_0246551 | 3300049588 | Bacteria | 1423 |
| 1029 | Ga0501074_0289035 | 3300049590 | Bacteria | 1165 |
| 1030 | Ga0501076_0605369 | 3300049592 | Bacteria | 904 |
| 1031 | Ga0501077_0068406 | 3300049593 | Bacteria | 2251 |
| 1032 | Ga0501080_0051685 | 3300049742 | Bacteria | 3825 |
| 1033 | Ga0501080_0052843 | 3300049742 | Bacteria | 3782 |
| 1034 | Ga0501081_0272372 | 3300049743 | Bacteria | 1238 |
| 1035 | Ga0501083_0055182 | 3300049744 | Bacteria | 2665 |
| 1036 | Ga0501035_0004457 | 3300049822 | Bacteria | 13282 |
| 1037 | Ga0501044_0001681 | 3300049823 | Bacteria | 25990 |
| 1038 | Ga0501044_0005372 | 3300049823 | Bacteria | 14234 |
| 1039 | nmdc:mga05p37_20610_c1 | 3300050507 | Bacteria | 7977 |
| 1040 | nmdc:mga05p37_25099_c1 | 3300050507 | Bacteria | 7247 |
| 1041 | nmdc:mga05p37_279225_c1 | 3300050507 | Bacteria | 1993 |
| 1042 | nmdc:mga05p37_3048_c1 | 3300050507 | Bacteria | 19460 |
| 1043 | nmdc:mga05p37_46662_c1 | 3300050507 | Bacteria | 5326 |
| 1044 | nmdc:mga05p37_549024_c1 | 3300050507 | Bacteria | 1316 |
| 1045 | nmdc:mga05p37_595_c1 | 3300050507 | Bacteria | 25325 |
| 1046 | nmdc:mga05p37_6561_c1 | 3300050507 | Bacteria | 13712 |
| 1047 | nmdc:mga05p37_78337_c2 | 3300050507 | Bacteria | 3598 |
| 1048 | nmdc:mga09592_168412_c1 | 3300050508 | Unclassified | 1894 |
| 1049 | nmdc:mga09592_253645_c1 | 3300050508 | Bacteria | 1525 |
| 1050 | nmdc:mga09592_428202_c1 | 3300050508 | Bacteria | 1142 |
| 1051 | nmdc:mga06r32_27167_c2 | 3300050510 | Bacteria | 4222 |
| 1052 | nmdc:mga06r32_77561_c1 | 3300050510 | Bacteria | 3228 |
| 1053 | nmdc:mga08y16_10_c1 | 3300050511 | Bacteria | 470512 |
| 1054 | nmdc:mga08y16_169354_c1 | 3300050511 | Bacteria | 2269 |
| 1055 | nmdc:mga08y16_17177_c1 | 3300050511 | Bacteria | 7617 |
| 1056 | nmdc:mga08y16_59748_c1 | 3300050511 | Bacteria | 3982 |
| 1057 | nmdc:mga0n895_12870_c1 | 3300050512 | Bacteria | 7518 |
| 1058 | nmdc:mga0n895_134377_c1 | 3300050512 | Bacteria | 2500 |
| 1059 | nmdc:mga0n895_140501_c1 | 3300050512 | Bacteria | 2443 |
| 1060 | nmdc:mga0n895_142639_c1 | 3300050512 | Bacteria | 2424 |
| 1061 | nmdc:mga0n895_7101_c1 | 3300050512 | Bacteria | 9574 |
| 1062 | nmdc:mga0n895_71180_c1 | 3300050512 | Bacteria | 3448 |
| 1063 | nmdc:mga0n895_735049_c1 | 3300050512 | Bacteria | 981 |
| 1064 | nmdc:mga0rr50_139029_c1 | 3300050513 | Bacteria | 1952 |
| 1065 | nmdc:mga0rr50_21352_c1 | 3300050513 | Bacteria | 4418 |
| 1066 | nmdc:mga0rr50_2205_c1 | 3300050513 | Bacteria | 10927 |
| 1067 | nmdc:mga0rr50_23085_c1 | 3300050513 | Bacteria | 4283 |
| 1068 | nmdc:mga0rr50_3252_c1 | 3300050513 | Bacteria | 9311 |
| 1069 | nmdc:mga0rr50_373_c1 | 3300050513 | Bacteria | 24506 |
| 1070 | nmdc:mga0rr50_39611_c1 | 3300050513 | Bacteria | 3420 |
| 1071 | nmdc:mga0rr50_60229_c1 | 3300050513 | Bacteria | 2855 |
| 1072 | nmdc:mga0rr50_9864_c1 | 3300050513 | Bacteria | 6035 |
| 1073 | nmdc:mga08x19_15605_c1 | 3300050514 | Bacteria | 4622 |
| 1074 | nmdc:mga08x19_22597_c1 | 3300050514 | Bacteria | 3896 |
| 1075 | nmdc:mga08x19_34220_c1 | 3300050514 | Bacteria | 3210 |
| 1076 | nmdc:mga08x19_51928_c1 | 3300050514 | Bacteria | 2635 |
| 1077 | nmdc:mga08x19_78043_c1 | 3300050514 | Bacteria | 2170 |
| 1078 | nmdc:mga08x19_90727_c1 | 3300050514 | Bacteria | 2017 |
| 1079 | nmdc:mga0a205_10346_c1 | 3300050515 | Bacteria | 8575 |
| 1080 | nmdc:mga0a205_47564_c1 | 3300050515 | Bacteria | 4140 |
| 1081 | nmdc:mga0a205_6655_c1 | 3300050515 | Bacteria | 10458 |
| 1082 | nmdc:mga0a205_72605_c1 | 3300050515 | Bacteria | 3325 |
| 1083 | Ga0495601_0019915 | 3300053077 | Bacteria | 4096 |
| 1084 | Ga0495601_0063448 | 3300053077 | Bacteria | 2348 |
| 1085 | Ga0495601_0126279 | 3300053077 | Bacteria | 1664 |
| 1086 | Ga0495601_0442679 | 3300053077 | Bacteria | 841 |
| 1087 | Ga0495655_0010860 | 3300053083 | Bacteria | 1812 |
| 1088 | Ga0495595_0030502 | 3300053084 | Bacteria | 2419 |
| 1089 | Ga0495595_0102853 | 3300053084 | Bacteria | 1380 |
| 1090 | Ga0495619_0004075 | 3300053085 | Bacteria | 9360 |
| 1091 | Ga0495619_0029701 | 3300053085 | Bacteria | 3534 |
| 1092 | Ga0495619_0062284 | 3300053085 | Bacteria | 2483 |
| 1093 | Ga0495619_0105732 | 3300053085 | Bacteria | 1919 |
| 1094 | Ga0500651_0000049 | 3300053093 | Bacteria | 83361 |
| 1095 | Ga0500595_000014 | 3300053119 | Bacteria | 247996 |
| 1096 | Ga0590074_001275 | 3300059423 | Bacteria | 4003 |
| 1097 | Ga0590075_002910 | 3300059424 | Bacteria | 4072 |
| 1098 | Ga0590077_004195 | 3300059426 | Bacteria | 2969 |
| 1099 | Ga0590077_027574 | 3300059426 | Bacteria | 1231 |
| 1100 | Ga0501082_0175766 | 3300060353 | Bacteria | 1862 |
| 1101 | Ga0530510_0015081 | 3300061734 | Bacteria | 5459 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005536 | Ga0070697_100386456 | Ga0070697_1003864562 | 229 |
| 2 | 3300025922 | Ga0207646_10550266 | Ga0207646_105502662 | 229 |
| 3 | 3300046459 | Ga0495629_0445729 | Ga0495629_0445729_156_863 | 230 |
| 4 | 3300025261 | Ga0209233_1007528 | Ga0209233_10075281 | 236 |
| 5 | 3300046459 | Ga0495629_0161589 | Ga0495629_0161589_272_997 | 236 |
| 6 | 3300046462 | Ga0495651_0117887 | Ga0495651_0117887_1207_1917 | 236 |
| 7 | 3300046477 | Ga0495664_0089384 | Ga0495664_0089384_38_748 | 236 |
| 8 | 3300048915 | Ga0496112_0035136 | Ga0496112_0035136_22_732 | 236 |
| 9 | 3300006914 | Ga0075436_100028497 | Ga0075436_1000284975 | 237 |
| 10 | 3300025926 | Ga0207659_10359411 | Ga0207659_103594112 | 237 |
| 11 | 3300046615 | Ga0495656_0051535 | Ga0495656_0051535_22_747 | 237 |
| 12 | 3300049593 | Ga0501077_0068406 | Ga0501077_0068406_931_1734 | 237 |
| 13 | 3300050514 | nmdc:mga08x19_34220_c1 | nmdc:mga08x19_34220_c1_1604_2371 | 237 |
| 14 | 3300025907 | Ga0207645_10266741 | Ga0207645_102667412 | 238 |
| 15 | 3300005468 | Ga0070707_100000221 | Ga0070707_10000022130 | 239 |
| 16 | 3300024227 | Ga0228598_1004988 | Ga0228598_10049884 | 239 |
| 17 | 3300025922 | Ga0207646_10000037 | Ga0207646_10000037154 | 239 |
| 18 | 3300005338 | Ga0068868_100181756 | Ga0068868_1001817562 | 240 |
| 19 | 3300005338 | Ga0068868_100645934 | Ga0068868_1006459342 | 240 |
| 20 | 3300005341 | Ga0070691_10004188 | Ga0070691_1000418811 | 240 |
| 21 | 3300005343 | Ga0070687_100030822 | Ga0070687_1000308223 | 240 |
| 22 | 3300005345 | Ga0070692_10038405 | Ga0070692_100384053 | 240 |
| 23 | 3300005347 | Ga0070668_100054493 | Ga0070668_1000544935 | 240 |
| 24 | 3300005347 | Ga0070668_100206939 | Ga0070668_1002069392 | 240 |
| 25 | 3300005353 | Ga0070669_100051867 | Ga0070669_1000518673 | 240 |
| 26 | 3300005353 | Ga0070669_100178091 | Ga0070669_1001780912 | 240 |
| 27 | 3300005364 | Ga0070673_100197094 | Ga0070673_1001970943 | 240 |
| 28 | 3300005440 | Ga0070705_100121105 | Ga0070705_1001211052 | 240 |
| 29 | 3300005441 | Ga0070700_100028280 | Ga0070700_1000282803 | 240 |
| 30 | 3300005441 | Ga0070700_100071314 | Ga0070700_1000713143 | 240 |
| 31 | 3300005456 | Ga0070678_100066041 | Ga0070678_1000660414 | 240 |
| 32 | 3300005471 | Ga0070698_100034124 | Ga0070698_1000341248 | 240 |
| 33 | 3300005530 | Ga0070679_100124874 | Ga0070679_1001248743 | 240 |
| 34 | 3300005543 | Ga0070672_100150676 | Ga0070672_1001506764 | 240 |
| 35 | 3300005544 | Ga0070686_100002243 | Ga0070686_1000022431 | 240 |
| 36 | 3300005545 | Ga0070695_100003541 | Ga0070695_1000035413 | 240 |
| 37 | 3300005546 | Ga0070696_100130833 | Ga0070696_1001308332 | 240 |
| 38 | 3300005548 | Ga0070665_100005447 | Ga0070665_1000054478 | 240 |
| 39 | 3300005549 | Ga0070704_100019087 | Ga0070704_1000190873 | 240 |
| 40 | 3300005614 | Ga0068856_100018557 | Ga0068856_1000185572 | 240 |
| 41 | 3300005615 | Ga0070702_100002883 | Ga0070702_10000288310 | 240 |
| 42 | 3300005617 | Ga0068859_100225844 | Ga0068859_1002258445 | 240 |
| 43 | 3300005618 | Ga0068864_100063762 | Ga0068864_1000637624 | 240 |
| 44 | 3300005618 | Ga0068864_100399043 | Ga0068864_1003990432 | 240 |
| 45 | 3300005718 | Ga0068866_10126540 | Ga0068866_101265402 | 240 |
| 46 | 3300005719 | Ga0068861_100036380 | Ga0068861_1000363804 | 240 |
| 47 | 3300005719 | Ga0068861_100067590 | Ga0068861_1000675903 | 240 |
| 48 | 3300005842 | Ga0068858_100001254 | Ga0068858_10000125432 | 240 |
| 49 | 3300005842 | Ga0068858_100036297 | Ga0068858_1000362973 | 240 |
| 50 | 3300005842 | Ga0068858_100113223 | Ga0068858_1001132232 | 240 |
| 51 | 3300006237 | Ga0097621_100731126 | Ga0097621_1007311262 | 240 |
| 52 | 3300006847 | Ga0075431_100173239 | Ga0075431_1001732392 | 240 |
| 53 | 3300006871 | Ga0075434_100183729 | Ga0075434_1001837293 | 240 |
| 54 | 3300006871 | Ga0075434_100214894 | Ga0075434_1002148943 | 240 |
| 55 | 3300006914 | Ga0075436_100006359 | Ga0075436_1000063599 | 240 |
| 56 | 3300006914 | Ga0075436_100109094 | Ga0075436_1001090943 | 240 |
| 57 | 3300006931 | Ga0097620_100225847 | Ga0097620_1002258472 | 240 |
| 58 | 3300007076 | Ga0075435_100001542 | Ga0075435_10000154210 | 240 |
| 59 | 3300007076 | Ga0075435_100070719 | Ga0075435_1000707193 | 240 |
| 60 | 3300007076 | Ga0075435_100083105 | Ga0075435_1000831053 | 240 |
| 61 | 3300009176 | Ga0105242_10060486 | Ga0105242_100604863 | 240 |
| 62 | 3300009176 | Ga0105242_10465875 | Ga0105242_104658752 | 240 |
| 63 | 3300014325 | Ga0163163_10058152 | Ga0163163_100581522 | 240 |
| 64 | 3300014745 | Ga0157377_10146525 | Ga0157377_101465251 | 240 |
| 65 | 3300014969 | Ga0157376_10019471 | Ga0157376_100194713 | 240 |
| 66 | 3300025900 | Ga0207710_10014776 | Ga0207710_100147766 | 240 |
| 67 | 3300025900 | Ga0207710_10015930 | Ga0207710_100159306 | 240 |
| 68 | 3300025903 | Ga0207680_10006153 | Ga0207680_100061538 | 240 |
| 69 | 3300025911 | Ga0207654_10040688 | Ga0207654_100406883 | 240 |
| 70 | 3300025912 | Ga0207707_10223257 | Ga0207707_102232572 | 240 |
| 71 | 3300025913 | Ga0207695_10523965 | Ga0207695_105239651 | 240 |
| 72 | 3300025917 | Ga0207660_10233607 | Ga0207660_102336072 | 240 |
| 73 | 3300025918 | Ga0207662_10061436 | Ga0207662_100614363 | 240 |
| 74 | 3300025921 | Ga0207652_10077073 | Ga0207652_100770734 | 240 |
| 75 | 3300025923 | Ga0207681_10118269 | Ga0207681_101182693 | 240 |
| 76 | 3300025923 | Ga0207681_10180816 | Ga0207681_101808162 | 240 |
| 77 | 3300025926 | Ga0207659_10113563 | Ga0207659_101135633 | 240 |
| 78 | 3300025926 | Ga0207659_10117776 | Ga0207659_101177762 | 240 |
| 79 | 3300025927 | Ga0207687_10107619 | Ga0207687_101076193 | 240 |
| 80 | 3300025933 | Ga0207706_10113218 | Ga0207706_101132181 | 240 |
| 81 | 3300025937 | Ga0207669_10005330 | Ga0207669_100053303 | 240 |
| 82 | 3300025939 | Ga0207665_10152862 | Ga0207665_101528622 | 240 |
| 83 | 3300025941 | Ga0207711_10036970 | Ga0207711_100369705 | 240 |
| 84 | 3300025941 | Ga0207711_10041117 | Ga0207711_100411173 | 240 |
| 85 | 3300025941 | Ga0207711_10087655 | Ga0207711_100876553 | 240 |
| 86 | 3300025941 | Ga0207711_10162404 | Ga0207711_101624044 | 240 |
| 87 | 3300025972 | Ga0207668_10017365 | Ga0207668_100173652 | 240 |
| 88 | 3300025981 | Ga0207640_10017290 | Ga0207640_100172905 | 240 |
| 89 | 3300026023 | Ga0207677_10076376 | Ga0207677_100763765 | 240 |
| 90 | 3300026035 | Ga0207703_10012018 | Ga0207703_100120187 | 240 |
| 91 | 3300026035 | Ga0207703_10067170 | Ga0207703_100671705 | 240 |
| 92 | 3300026075 | Ga0207708_10057081 | Ga0207708_100570815 | 240 |
| 93 | 3300026075 | Ga0207708_10100053 | Ga0207708_101000533 | 240 |
| 94 | 3300026089 | Ga0207648_10038262 | Ga0207648_100382626 | 240 |
| 95 | 3300026095 | Ga0207676_10047359 | Ga0207676_100473592 | 240 |
| 96 | 3300026118 | Ga0207675_100017733 | Ga0207675_1000177333 | 240 |
| 97 | 3300026118 | Ga0207675_100075425 | Ga0207675_1000754254 | 240 |
| 98 | 3300026118 | Ga0207675_100082556 | Ga0207675_1000825563 | 240 |
| 99 | 3300026121 | Ga0207683_10037219 | Ga0207683_100372195 | 240 |
| 100 | 3300026121 | Ga0207683_10080588 | Ga0207683_100805882 | 240 |
| 101 | 3300027907 | Ga0207428_10045568 | Ga0207428_100455685 | 240 |
| 102 | 3300027907 | Ga0207428_10110383 | Ga0207428_101103832 | 240 |
| 103 | 3300028379 | Ga0268266_10398012 | Ga0268266_103980123 | 240 |
| 104 | 3300028380 | Ga0268265_10196615 | Ga0268265_101966153 | 240 |
| 105 | 3300028381 | Ga0268264_10656117 | Ga0268264_106561171 | 240 |
| 106 | 3300032002 | Ga0307416_100382062 | Ga0307416_1003820622 | 240 |
| 107 | 3300034818 | Ga0373950_0016784 | Ga0373950_0016784_24_761 | 240 |
| 108 | 3300035083 | Ga0373926_0070487 | Ga0373926_0070487_242_979 | 240 |
| 109 | 3300035086 | Ga0373934_0105921 | Ga0373934_0105921_303_1040 | 240 |
| 110 | 3300035089 | Ga0373944_0029297 | Ga0373944_0029297_865_1617 | 240 |
| 111 | 3300035092 | Ga0373952_0027059 | Ga0373952_0027059_25_762 | 240 |
| 112 | 3300035092 | Ga0373952_0060887 | Ga0373952_0060887_169_906 | 240 |
| 113 | 3300035116 | Ga0373945_0117583 | Ga0373945_0117583_79_816 | 240 |
| 114 | 3300035117 | Ga0373953_0112914 | Ga0373953_0112914_236_976 | 240 |
| 115 | 3300035170 | Ga0373943_0045705 | Ga0373943_0045705_1262_1999 | 240 |
| 116 | 3300035171 | Ga0373946_0045683 | Ga0373946_0045683_327_1079 | 240 |
| 117 | 3300035692 | Ga0373935_0038030 | Ga0373935_0038030_1499_2236 | 240 |
| 118 | 3300035692 | Ga0373935_0510763 | Ga0373935_0510763_122_859 | 240 |
| 119 | 3300035695 | Ga0373927_0117868 | Ga0373927_0117868_614_1351 | 240 |
| 120 | 3300036401 | Ga0373937_0202959 | Ga0373937_0202959_539_1276 | 240 |
| 121 | 3300037068 | Ga0373925_0173403 | Ga0373925_0173403_923_1660 | 240 |
| 122 | 3300045051 | Ga0451576_0640120 | Ga0451576_0640120_200_937 | 240 |
| 123 | 3300045976 | Ga0466967_0769867 | Ga0466967_0769867_181_918 | 240 |
| 124 | 3300046454 | Ga0495592_0176304 | Ga0495592_0176304_486_1223 | 240 |
| 125 | 3300046516 | Ga0495628_0412216 | Ga0495628_0412216_79_816 | 240 |
| 126 | 3300046517 | Ga0495630_0057928 | Ga0495630_0057928_1988_2725 | 240 |
| 127 | 3300046517 | Ga0495630_0281019 | Ga0495630_0281019_159_896 | 240 |
| 128 | 3300046535 | Ga0495586_0107871 | Ga0495586_0107871_680_1432 | 240 |
| 129 | 3300046543 | Ga0495645_0164427 | Ga0495645_0164427_720_1457 | 240 |
| 130 | 3300046559 | Ga0495667_0266452 | Ga0495667_0266452_264_1001 | 240 |
| 131 | 3300046642 | Ga0495634_0057828 | Ga0495634_0057828_1668_2405 | 240 |
| 132 | 3300046681 | Ga0495647_0112442 | Ga0495647_0112442_230_967 | 240 |
| 133 | 3300046683 | Ga0495658_0022257 | Ga0495658_0022257_2031_2768 | 240 |
| 134 | 3300046683 | Ga0495658_0077780 | Ga0495658_0077780_1107_1859 | 240 |
| 135 | 3300046683 | Ga0495658_0232635 | Ga0495658_0232635_409_1146 | 240 |
| 136 | 3300046689 | Ga0495613_0295590 | Ga0495613_0295590_211_960 | 240 |
| 137 | 3300046691 | Ga0495670_0341633 | Ga0495670_0341633_24_761 | 240 |
| 138 | 3300048088 | Ga0495602_0167932 | Ga0495602_0167932_184_921 | 240 |
| 139 | 3300048088 | Ga0495602_0274329 | Ga0495602_0274329_163_900 | 240 |
| 140 | 3300048912 | Ga0496109_0639190 | Ga0496109_0639190_234_983 | 240 |
| 141 | 3300048917 | Ga0496114_0105369 | Ga0496114_0105369_133_870 | 240 |
| 142 | 3300048917 | Ga0496114_0147568 | Ga0496114_0147568_28_765 | 240 |
| 143 | 3300049571 | Ga0501034_0038818 | Ga0501034_0038818_2675_3412 | 240 |
| 144 | 3300049573 | Ga0501037_0219280 | Ga0501037_0219280_246_983 | 240 |
| 145 | 3300049577 | Ga0501041_0422723 | Ga0501041_0422723_27_761 | 240 |
| 146 | 3300049579 | Ga0501043_0242034 | Ga0501043_0242034_236_973 | 240 |
| 147 | 3300049581 | Ga0501047_0015370 | Ga0501047_0015370_3006_3743 | 240 |
| 148 | 3300049592 | Ga0501076_0605369 | Ga0501076_0605369_25_762 | 240 |
| 149 | 3300049823 | Ga0501044_0001681 | Ga0501044_0001681_24096_24833 | 240 |
| 150 | 3300050508 | nmdc:mga09592_253645_c1 | nmdc:mga09592_253645_c1_322_1059 | 240 |
| 151 | 3300050510 | nmdc:mga06r32_77561_c1 | nmdc:mga06r32_77561_c1_2063_2800 | 240 |
| 152 | 3300050512 | nmdc:mga0n895_7101_c1 | nmdc:mga0n895_7101_c1_6556_7293 | 240 |
| 153 | 3300050513 | nmdc:mga0rr50_39611_c1 | nmdc:mga0rr50_39611_c1_1295_2032 | 240 |
| 154 | 3300050514 | nmdc:mga08x19_22597_c1 | nmdc:mga08x19_22597_c1_1389_2126 | 240 |
| 155 | 3300050515 | nmdc:mga0a205_6655_c1 | nmdc:mga0a205_6655_c1_1040_1777 | 240 |
| 156 | 3300053077 | Ga0495601_0442679 | Ga0495601_0442679_74_811 | 240 |
| 157 | 3300053085 | Ga0495619_0105732 | Ga0495619_0105732_552_1289 | 240 |
| 158 | 3300005718 | Ga0068866_10029954 | Ga0068866_100299543 | 241 |
| 159 | 3300026075 | Ga0207708_10071363 | Ga0207708_100713633 | 241 |
| 160 | 3300046691 | Ga0495670_0311325 | Ga0495670_0311325_12_758 | 241 |
| 161 | 3300005334 | Ga0068869_100410718 | Ga0068869_1004107181 | 245 |
| 162 | 3300005718 | Ga0068866_10274385 | Ga0068866_102743852 | 245 |
| 163 | 3300025942 | Ga0207689_10402049 | Ga0207689_104020491 | 245 |
| 164 | 3300026023 | Ga0207677_10136423 | Ga0207677_101364234 | 245 |
| 165 | 3300050512 | nmdc:mga0n895_140501_c1 | nmdc:mga0n895_140501_c1_590_1342 | 245 |
| 166 | iso_pu_bacteria | 2884215851 | 2884219651 | 245 |
| 167 | 3300006914 | Ga0075436_100049304 | Ga0075436_1000493045 | 246 |
| 168 | 3300042876 | Ga0451577_0097736 | Ga0451577_0097736_809_1561 | 247 |
| 169 | 3300042876 | Ga0451577_0439764 | Ga0451577_0439764_70_819 | 247 |
| 170 | 3300044673 | Ga0453683_0000086 | Ga0453683_0000086_77891_78643 | 247 |
| 171 | 3300044673 | Ga0453683_0101306 | Ga0453683_0101306_172_924 | 247 |
| 172 | 3300044712 | Ga0453684_0003980 | Ga0453684_0003980_5262_6011 | 247 |
| 173 | 3300044712 | Ga0453684_0029625 | Ga0453684_0029625_1025_1777 | 247 |
| 174 | 3300045051 | Ga0451576_0447668 | Ga0451576_0447668_114_866 | 247 |
| 175 | 3300013297 | Ga0157378_10250405 | Ga0157378_102504052 | 248 |
| 176 | 3300025921 | Ga0207652_10117046 | Ga0207652_101170462 | 248 |
| 177 | 3300042876 | Ga0451577_0114827 | Ga0451577_0114827_766_1518 | 248 |
| 178 | 3300044712 | Ga0453684_0293217 | Ga0453684_0293217_744_1496 | 248 |
| 179 | 3300049571 | Ga0501034_0018923 | Ga0501034_0018923_529_1293 | 248 |
| 180 | 3300005327 | Ga0070658_10000766 | Ga0070658_1000076620 | 249 |
| 181 | 3300005327 | Ga0070658_10070625 | Ga0070658_100706254 | 249 |
| 182 | 3300005327 | Ga0070658_10103382 | Ga0070658_101033822 | 249 |
| 183 | 3300005327 | Ga0070658_10169859 | Ga0070658_101698593 | 249 |
| 184 | 3300005329 | Ga0070683_100048913 | Ga0070683_1000489133 | 249 |
| 185 | 3300005335 | Ga0070666_10021119 | Ga0070666_100211194 | 249 |
| 186 | 3300005336 | Ga0070680_100014163 | Ga0070680_1000141632 | 249 |
| 187 | 3300005339 | Ga0070660_100009153 | Ga0070660_1000091533 | 249 |
| 188 | 3300005339 | Ga0070660_100211410 | Ga0070660_1002114102 | 249 |
| 189 | 3300005347 | Ga0070668_100188378 | Ga0070668_1001883782 | 249 |
| 190 | 3300005355 | Ga0070671_100001676 | Ga0070671_10000167613 | 249 |
| 191 | 3300005355 | Ga0070671_100207169 | Ga0070671_1002071693 | 249 |
| 192 | 3300005364 | Ga0070673_100176401 | Ga0070673_1001764013 | 249 |
| 193 | 3300005366 | Ga0070659_100001021 | Ga0070659_10000102110 | 249 |
| 194 | 3300005366 | Ga0070659_100064943 | Ga0070659_1000649434 | 249 |
| 195 | 3300005366 | Ga0070659_100149861 | Ga0070659_1001498611 | 249 |
| 196 | 3300005435 | Ga0070714_100101561 | Ga0070714_1001015613 | 249 |
| 197 | 3300005435 | Ga0070714_100315339 | Ga0070714_1003153391 | 249 |
| 198 | 3300005435 | Ga0070714_100492224 | Ga0070714_1004922242 | 249 |
| 199 | 3300005455 | Ga0070663_100067372 | Ga0070663_1000673723 | 249 |
| 200 | 3300005455 | Ga0070663_100169091 | Ga0070663_1001690911 | 249 |
| 201 | 3300005455 | Ga0070663_100213585 | Ga0070663_1002135853 | 249 |
| 202 | 3300005456 | Ga0070678_100193215 | Ga0070678_1001932152 | 249 |
| 203 | 3300005458 | Ga0070681_10045035 | Ga0070681_100450354 | 249 |
| 204 | 3300005530 | Ga0070679_100056981 | Ga0070679_1000569813 | 249 |
| 205 | 3300005530 | Ga0070679_100171866 | Ga0070679_1001718663 | 249 |
| 206 | 3300005535 | Ga0070684_100078274 | Ga0070684_1000782742 | 249 |
| 207 | 3300005535 | Ga0070684_100194820 | Ga0070684_1001948202 | 249 |
| 208 | 3300005539 | Ga0068853_100000054 | Ga0068853_10000005425 | 249 |
| 209 | 3300005548 | Ga0070665_100008632 | Ga0070665_1000086325 | 249 |
| 210 | 3300005548 | Ga0070665_100039128 | Ga0070665_1000391283 | 249 |
| 211 | 3300005563 | Ga0068855_100000913 | Ga0068855_10000091324 | 249 |
| 212 | 3300005563 | Ga0068855_100003825 | Ga0068855_10000382520 | 249 |
| 213 | 3300005563 | Ga0068855_100012883 | Ga0068855_1000128838 | 249 |
| 214 | 3300005563 | Ga0068855_100035485 | Ga0068855_1000354858 | 249 |
| 215 | 3300005563 | Ga0068855_100041514 | Ga0068855_1000415142 | 249 |
| 216 | 3300005563 | Ga0068855_100232692 | Ga0068855_1002326922 | 249 |
| 217 | 3300005564 | Ga0070664_100349949 | Ga0070664_1003499493 | 249 |
| 218 | 3300005577 | Ga0068857_100002221 | Ga0068857_1000022214 | 249 |
| 219 | 3300005578 | Ga0068854_100000137 | Ga0068854_10000013735 | 249 |
| 220 | 3300005578 | Ga0068854_100071487 | Ga0068854_1000714873 | 249 |
| 221 | 3300005614 | Ga0068856_100296549 | Ga0068856_1002965493 | 249 |
| 222 | 3300005614 | Ga0068856_100307374 | Ga0068856_1003073742 | 249 |
| 223 | 3300005616 | Ga0068852_100039624 | Ga0068852_1000396244 | 249 |
| 224 | 3300005616 | Ga0068852_100179574 | Ga0068852_1001795744 | 249 |
| 225 | 3300005618 | Ga0068864_100192620 | Ga0068864_1001926204 | 249 |
| 226 | 3300005834 | Ga0068851_10008832 | Ga0068851_100088321 | 249 |
| 227 | 3300005841 | Ga0068863_100036062 | Ga0068863_1000360622 | 249 |
| 228 | 3300009093 | Ga0105240_10000001 | Ga0105240_10000001907 | 249 |
| 229 | 3300009093 | Ga0105240_10012027 | Ga0105240_1001202715 | 249 |
| 230 | 3300009093 | Ga0105240_10012782 | Ga0105240_100127823 | 249 |
| 231 | 3300009093 | Ga0105240_10114294 | Ga0105240_101142943 | 249 |
| 232 | 3300009093 | Ga0105240_10224743 | Ga0105240_102247432 | 249 |
| 233 | 3300009093 | Ga0105240_10297529 | Ga0105240_102975292 | 249 |
| 234 | 3300009174 | Ga0105241_10484016 | Ga0105241_104840162 | 249 |
| 235 | 3300009177 | Ga0105248_10012842 | Ga0105248_100128424 | 249 |
| 236 | 3300009545 | Ga0105237_10004977 | Ga0105237_1000497714 | 249 |
| 237 | 3300009551 | Ga0105238_10008485 | Ga0105238_1000848516 | 249 |
| 238 | 3300009551 | Ga0105238_10070590 | Ga0105238_100705903 | 249 |
| 239 | 3300009551 | Ga0105238_10101639 | Ga0105238_101016393 | 249 |
| 240 | 3300009551 | Ga0105238_10184047 | Ga0105238_101840472 | 249 |
| 241 | 3300010375 | Ga0105239_10111134 | Ga0105239_101111344 | 249 |
| 242 | 3300013102 | Ga0157371_10562805 | Ga0157371_105628051 | 249 |
| 243 | 3300013104 | Ga0157370_10011397 | Ga0157370_1001139713 | 249 |
| 244 | 3300013104 | Ga0157370_10017703 | Ga0157370_100177038 | 249 |
| 245 | 3300013104 | Ga0157370_10017947 | Ga0157370_100179476 | 249 |
| 246 | 3300013104 | Ga0157370_10018903 | Ga0157370_100189039 | 249 |
| 247 | 3300013104 | Ga0157370_10035941 | Ga0157370_100359414 | 249 |
| 248 | 3300013104 | Ga0157370_10204238 | Ga0157370_102042382 | 249 |
| 249 | 3300013105 | Ga0157369_10019707 | Ga0157369_100197074 | 249 |
| 250 | 3300013105 | Ga0157369_10025443 | Ga0157369_100254434 | 249 |
| 251 | 3300013105 | Ga0157369_10036798 | Ga0157369_100367985 | 249 |
| 252 | 3300013105 | Ga0157369_10069128 | Ga0157369_100691283 | 249 |
| 253 | 3300013105 | Ga0157369_10099587 | Ga0157369_100995872 | 249 |
| 254 | 3300013105 | Ga0157369_10156301 | Ga0157369_101563015 | 249 |
| 255 | 3300013105 | Ga0157369_10405426 | Ga0157369_104054262 | 249 |
| 256 | 3300013296 | Ga0157374_10016453 | Ga0157374_100164538 | 249 |
| 257 | 3300013296 | Ga0157374_10064149 | Ga0157374_100641492 | 249 |
| 258 | 3300013296 | Ga0157374_10066771 | Ga0157374_100667713 | 249 |
| 259 | 3300013296 | Ga0157374_10095902 | Ga0157374_100959022 | 249 |
| 260 | 3300013296 | Ga0157374_10293282 | Ga0157374_102932822 | 249 |
| 261 | 3300013306 | Ga0163162_10023636 | Ga0163162_100236362 | 249 |
| 262 | 3300013306 | Ga0163162_10071217 | Ga0163162_100712173 | 249 |
| 263 | 3300013306 | Ga0163162_10258213 | Ga0163162_102582133 | 249 |
| 264 | 3300013307 | Ga0157372_10006518 | Ga0157372_100065185 | 249 |
| 265 | 3300013307 | Ga0157372_10019768 | Ga0157372_1001976811 | 249 |
| 266 | 3300013307 | Ga0157372_10026761 | Ga0157372_100267616 | 249 |
| 267 | 3300013307 | Ga0157372_10096890 | Ga0157372_100968903 | 249 |
| 268 | 3300013307 | Ga0157372_10177561 | Ga0157372_101775612 | 249 |
| 269 | 3300013307 | Ga0157372_10520950 | Ga0157372_105209501 | 249 |
| 270 | 3300013308 | Ga0157375_10544408 | Ga0157375_105444082 | 249 |
| 271 | 3300014325 | Ga0163163_10039817 | Ga0163163_100398174 | 249 |
| 272 | 3300014325 | Ga0163163_10070157 | Ga0163163_100701573 | 249 |
| 273 | 3300014969 | Ga0157376_10042534 | Ga0157376_100425344 | 249 |
| 274 | 3300014969 | Ga0157376_10136940 | Ga0157376_101369402 | 249 |
| 275 | 3300014969 | Ga0157376_10258253 | Ga0157376_102582532 | 249 |
| 276 | 3300014969 | Ga0157376_10629810 | Ga0157376_106298102 | 249 |
| 277 | 3300024227 | Ga0228598_1007435 | Ga0228598_10074352 | 249 |
| 278 | 3300025903 | Ga0207680_10033225 | Ga0207680_100332254 | 249 |
| 279 | 3300025904 | Ga0207647_10003459 | Ga0207647_1000345910 | 249 |
| 280 | 3300025904 | Ga0207647_10042476 | Ga0207647_100424762 | 249 |
| 281 | 3300025909 | Ga0207705_10000048 | Ga0207705_10000048147 | 249 |
| 282 | 3300025909 | Ga0207705_10003420 | Ga0207705_100034209 | 249 |
| 283 | 3300025909 | Ga0207705_10009158 | Ga0207705_100091582 | 249 |
| 284 | 3300025909 | Ga0207705_10080739 | Ga0207705_100807392 | 249 |
| 285 | 3300025909 | Ga0207705_10156854 | Ga0207705_101568542 | 249 |
| 286 | 3300025912 | Ga0207707_10319707 | Ga0207707_103197071 | 249 |
| 287 | 3300025913 | Ga0207695_10000001 | Ga0207695_10000001910 | 249 |
| 288 | 3300025913 | Ga0207695_10000354 | Ga0207695_10000354100 | 249 |
| 289 | 3300025913 | Ga0207695_10071412 | Ga0207695_100714124 | 249 |
| 290 | 3300025913 | Ga0207695_10236616 | Ga0207695_102366163 | 249 |
| 291 | 3300025917 | Ga0207660_10162028 | Ga0207660_101620282 | 249 |
| 292 | 3300025919 | Ga0207657_10000823 | Ga0207657_100008239 | 249 |
| 293 | 3300025919 | Ga0207657_10017050 | Ga0207657_1001705010 | 249 |
| 294 | 3300025920 | Ga0207649_10007381 | Ga0207649_100073812 | 249 |
| 295 | 3300025920 | Ga0207649_10207470 | Ga0207649_102074702 | 249 |
| 296 | 3300025924 | Ga0207694_10010372 | Ga0207694_100103727 | 249 |
| 297 | 3300025924 | Ga0207694_10012007 | Ga0207694_1001200710 | 249 |
| 298 | 3300025924 | Ga0207694_10097950 | Ga0207694_100979502 | 249 |
| 299 | 3300025924 | Ga0207694_10210222 | Ga0207694_102102222 | 249 |
| 300 | 3300025924 | Ga0207694_10360249 | Ga0207694_103602491 | 249 |
| 301 | 3300025925 | Ga0207650_10267387 | Ga0207650_102673871 | 249 |
| 302 | 3300025928 | Ga0207700_10003657 | Ga0207700_1000365711 | 249 |
| 303 | 3300025929 | Ga0207664_10359771 | Ga0207664_103597712 | 249 |
| 304 | 3300025931 | Ga0207644_10029897 | Ga0207644_100298974 | 249 |
| 305 | 3300025932 | Ga0207690_10279237 | Ga0207690_102792371 | 249 |
| 306 | 3300025941 | Ga0207711_10405682 | Ga0207711_104056822 | 249 |
| 307 | 3300025945 | Ga0207679_10358349 | Ga0207679_103583492 | 249 |
| 308 | 3300025949 | Ga0207667_10000647 | Ga0207667_1000064730 | 249 |
| 309 | 3300025949 | Ga0207667_10008444 | Ga0207667_100084448 | 249 |
| 310 | 3300025949 | Ga0207667_10027233 | Ga0207667_100272339 | 249 |
| 311 | 3300025949 | Ga0207667_10038353 | Ga0207667_100383537 | 249 |
| 312 | 3300025949 | Ga0207667_10068300 | Ga0207667_100683003 | 249 |
| 313 | 3300025949 | Ga0207667_10108232 | Ga0207667_101082324 | 249 |
| 314 | 3300025981 | Ga0207640_10000023 | Ga0207640_1000002325 | 249 |
| 315 | 3300026023 | Ga0207677_10544341 | Ga0207677_105443411 | 249 |
| 316 | 3300026041 | Ga0207639_10000034 | Ga0207639_1000003468 | 249 |
| 317 | 3300026041 | Ga0207639_10087391 | Ga0207639_100873912 | 249 |
| 318 | 3300026067 | Ga0207678_10001665 | Ga0207678_100016659 | 249 |
| 319 | 3300026088 | Ga0207641_10007294 | Ga0207641_100072943 | 249 |
| 320 | 3300026116 | Ga0207674_10000532 | Ga0207674_1000053225 | 249 |
| 321 | 3300028379 | Ga0268266_10007930 | Ga0268266_1000793013 | 249 |
| 322 | 3300031344 | Ga0265316_10061401 | Ga0265316_100614012 | 249 |
| 323 | 3300033180 | Ga0307510_10118139 | Ga0307510_101181392 | 249 |
| 324 | 3300037471 | Ga0395905_0001744 | Ga0395905_0001744_7630_8382 | 249 |
| 325 | 3300037471 | Ga0395905_0007578 | Ga0395905_0007578_3949_4701 | 249 |
| 326 | 3300037471 | Ga0395905_0014151 | Ga0395905_0014151_669_1421 | 249 |
| 327 | 3300037471 | Ga0395905_0033731 | Ga0395905_0033731_3136_3888 | 249 |
| 328 | 3300037853 | Ga0436364_1357538 | Ga0436364_1357538_612_1361 | 249 |
| 329 | 3300039447 | Ga0436361_0277179 | Ga0436361_0277179_103_852 | 249 |
| 330 | 3300044684 | Ga0466966_0072934 | Ga0466966_0072934_1232_1981 | 249 |
| 331 | 3300044693 | Ga0466961_0161787 | Ga0466961_0161787_58_807 | 249 |
| 332 | 3300044694 | Ga0466963_0016278 | Ga0466963_0016278_3690_4439 | 249 |
| 333 | 3300044694 | Ga0466963_0024269 | Ga0466963_0024269_2648_3397 | 249 |
| 334 | 3300044694 | Ga0466963_0061019 | Ga0466963_0061019_1178_1927 | 249 |
| 335 | 3300044719 | Ga0466971_0237341 | Ga0466971_0237341_43_792 | 249 |
| 336 | 3300045049 | Ga0466959_0131729 | Ga0466959_0131729_431_1180 | 249 |
| 337 | 3300045976 | Ga0466967_0046975 | Ga0466967_0046975_113_862 | 249 |
| 338 | 3300045976 | Ga0466967_0542458 | Ga0466967_0542458_371_1120 | 249 |
| 339 | 3300046454 | Ga0495592_0014907 | Ga0495592_0014907_3504_4253 | 249 |
| 340 | 3300046455 | Ga0495603_0054967 | Ga0495603_0054967_993_1742 | 249 |
| 341 | 3300046459 | Ga0495629_0019600 | Ga0495629_0019600_3666_4415 | 249 |
| 342 | 3300046459 | Ga0495629_0101592 | Ga0495629_0101592_747_1496 | 249 |
| 343 | 3300046460 | Ga0495638_0125130 | Ga0495638_0125130_600_1349 | 249 |
| 344 | 3300046462 | Ga0495651_0029420 | Ga0495651_0029420_672_1421 | 249 |
| 345 | 3300046462 | Ga0495651_0211321 | Ga0495651_0211321_583_1332 | 249 |
| 346 | 3300046463 | Ga0495653_0002196 | Ga0495653_0002196_6346_7095 | 249 |
| 347 | 3300046463 | Ga0495653_0382720 | Ga0495653_0382720_10_759 | 249 |
| 348 | 3300046471 | Ga0495650_0000010 | Ga0495650_0000010_631628_632377 | 249 |
| 349 | 3300046471 | Ga0495650_0001875 | Ga0495650_0001875_4592_5341 | 249 |
| 350 | 3300046472 | Ga0495580_0045055 | Ga0495580_0045055_539_1288 | 249 |
| 351 | 3300046472 | Ga0495580_0101580 | Ga0495580_0101580_253_1002 | 249 |
| 352 | 3300046473 | Ga0495582_0016241 | Ga0495582_0016241_722_1471 | 249 |
| 353 | 3300046475 | Ga0495639_0003617 | Ga0495639_0003617_1487_2236 | 249 |
| 354 | 3300046476 | Ga0495662_0047152 | Ga0495662_0047152_925_1674 | 249 |
| 355 | 3300046492 | Ga0495585_0038359 | Ga0495585_0038359_967_1716 | 249 |
| 356 | 3300046499 | Ga0495594_0005255 | Ga0495594_0005255_993_1742 | 249 |
| 357 | 3300046499 | Ga0495594_0025822 | Ga0495594_0025822_2019_2768 | 249 |
| 358 | 3300046500 | Ga0495596_0041323 | Ga0495596_0041323_433_1182 | 249 |
| 359 | 3300046506 | Ga0495583_0005362 | Ga0495583_0005362_6924_7673 | 249 |
| 360 | 3300046507 | Ga0495606_0011222 | Ga0495606_0011222_6501_7250 | 249 |
| 361 | 3300046507 | Ga0495606_0054290 | Ga0495606_0054290_1580_2329 | 249 |
| 362 | 3300046507 | Ga0495606_0177239 | Ga0495606_0177239_21_770 | 249 |
| 363 | 3300046516 | Ga0495628_0004868 | Ga0495628_0004868_4654_5403 | 249 |
| 364 | 3300046518 | Ga0495631_0055316 | Ga0495631_0055316_945_1694 | 249 |
| 365 | 3300046522 | Ga0495643_0038186 | Ga0495643_0038186_151_900 | 249 |
| 366 | 3300046523 | Ga0495644_0000777 | Ga0495644_0000777_295_1044 | 249 |
| 367 | 3300046526 | Ga0495666_0000717 | Ga0495666_0000717_2961_3710 | 249 |
| 368 | 3300046531 | Ga0495665_0006456 | Ga0495665_0006456_4704_5453 | 249 |
| 369 | 3300046533 | Ga0495640_0111910 | Ga0495640_0111910_297_1046 | 249 |
| 370 | 3300046535 | Ga0495586_0005179 | Ga0495586_0005179_1064_1813 | 249 |
| 371 | 3300046536 | Ga0495587_0071108 | Ga0495587_0071108_449_1198 | 249 |
| 372 | 3300046538 | Ga0495609_0064869 | Ga0495609_0064869_21_770 | 249 |
| 373 | 3300046543 | Ga0495645_0008980 | Ga0495645_0008980_4712_5461 | 249 |
| 374 | 3300046559 | Ga0495667_0007451 | Ga0495667_0007451_6290_7039 | 249 |
| 375 | 3300046616 | Ga0495668_0031504 | Ga0495668_0031504_2212_2961 | 249 |
| 376 | 3300046616 | Ga0495668_0138011 | Ga0495668_0138011_284_1033 | 249 |
| 377 | 3300046642 | Ga0495634_0001003 | Ga0495634_0001003_11431_12180 | 249 |
| 378 | 3300046660 | Ga0495625_0003213 | Ga0495625_0003213_6895_7644 | 249 |
| 379 | 3300046660 | Ga0495625_0038577 | Ga0495625_0038577_177_926 | 249 |
| 380 | 3300046663 | Ga0495635_0054696 | Ga0495635_0054696_1490_2239 | 249 |
| 381 | 3300046665 | Ga0495661_0051415 | Ga0495661_0051415_934_1683 | 249 |
| 382 | 3300046674 | Ga0495588_0058761 | Ga0495588_0058761_210_959 | 249 |
| 383 | 3300046678 | Ga0495599_0090734 | Ga0495599_0090734_1022_1771 | 249 |
| 384 | 3300046679 | Ga0495623_0016239 | Ga0495623_0016239_2458_3207 | 249 |
| 385 | 3300046679 | Ga0495623_0059574 | Ga0495623_0059574_207_956 | 249 |
| 386 | 3300046680 | Ga0495646_0027537 | Ga0495646_0027537_1903_2652 | 249 |
| 387 | 3300046680 | Ga0495646_0078441 | Ga0495646_0078441_323_1072 | 249 |
| 388 | 3300046684 | Ga0495669_0000955 | Ga0495669_0000955_7675_8424 | 249 |
| 389 | 3300046684 | Ga0495669_0009730 | Ga0495669_0009730_587_1336 | 249 |
| 390 | 3300046689 | Ga0495613_0018272 | Ga0495613_0018272_2619_3368 | 249 |
| 391 | 3300046690 | Ga0495624_0005609 | Ga0495624_0005609_628_1377 | 249 |
| 392 | 3300046694 | Ga0495649_0074711 | Ga0495649_0074711_391_1140 | 249 |
| 393 | 3300046809 | Ga0495600_0056708 | Ga0495600_0056708_58_807 | 249 |
| 394 | 3300046809 | Ga0495600_0370358 | Ga0495600_0370358_61_810 | 249 |
| 395 | 3300047315 | Ga0495581_0000275 | Ga0495581_0000275_12746_13495 | 249 |
| 396 | 3300047315 | Ga0495581_0088019 | Ga0495581_0088019_131_880 | 249 |
| 397 | 3300047317 | Ga0495604_0009860 | Ga0495604_0009860_5378_6127 | 249 |
| 398 | 3300047317 | Ga0495604_0027117 | Ga0495604_0027117_3721_4470 | 249 |
| 399 | 3300047318 | Ga0495636_0043935 | Ga0495636_0043935_27_776 | 249 |
| 400 | 3300047319 | Ga0495674_0009564 | Ga0495674_0009564_3270_4019 | 249 |
| 401 | 3300047319 | Ga0495674_0206302 | Ga0495674_0206302_652_1401 | 249 |
| 402 | 3300047320 | Ga0495672_0005628 | Ga0495672_0005628_5337_6086 | 249 |
| 403 | 3300047320 | Ga0495672_0072052 | Ga0495672_0072052_1079_1828 | 249 |
| 404 | 3300047320 | Ga0495672_0265726 | Ga0495672_0265726_46_795 | 249 |
| 405 | 3300047321 | Ga0495676_0014477 | Ga0495676_0014477_1221_1970 | 249 |
| 406 | 3300047443 | Ga0495687_040759 | Ga0495687_040759_659_1408 | 249 |
| 407 | 3300047444 | Ga0495675_0010737 | Ga0495675_0010737_417_1166 | 249 |
| 408 | 3300047445 | Ga0495677_0014034 | Ga0495677_0014034_260_1009 | 249 |
| 409 | 3300047471 | Ga0495684_0037444 | Ga0495684_0037444_555_1304 | 249 |
| 410 | 3300047471 | Ga0495684_0198973 | Ga0495684_0198973_92_841 | 249 |
| 411 | 3300047472 | Ga0495686_0000545 | Ga0495686_0000545_16264_17013 | 249 |
| 412 | 3300047472 | Ga0495686_0002881 | Ga0495686_0002881_169_918 | 249 |
| 413 | 3300047472 | Ga0495686_0011954 | Ga0495686_0011954_1448_2197 | 249 |
| 414 | 3300047472 | Ga0495686_0012883 | Ga0495686_0012883_5011_5760 | 249 |
| 415 | 3300047673 | Ga0495593_0119123 | Ga0495593_0119123_174_923 | 249 |
| 416 | 3300048088 | Ga0495602_0030031 | Ga0495602_0030031_3348_4097 | 249 |
| 417 | 3300048089 | Ga0495614_0006159 | Ga0495614_0006159_2456_3205 | 249 |
| 418 | 3300048089 | Ga0495614_0018911 | Ga0495614_0018911_273_1022 | 249 |
| 419 | 3300048905 | Ga0496102_0390029 | Ga0496102_0390029_366_1115 | 249 |
| 420 | 3300048907 | Ga0496104_0000247 | Ga0496104_0000247_40200_40949 | 249 |
| 421 | 3300048907 | Ga0496104_0257159 | Ga0496104_0257159_357_1106 | 249 |
| 422 | 3300048908 | Ga0496105_0375953 | Ga0496105_0375953_189_938 | 249 |
| 423 | 3300048911 | Ga0496108_0517993 | Ga0496108_0517993_31_780 | 249 |
| 424 | 3300048912 | Ga0496109_0089902 | Ga0496109_0089902_1647_2396 | 249 |
| 425 | 3300048915 | Ga0496112_0135829 | Ga0496112_0135829_790_1539 | 249 |
| 426 | 3300048916 | Ga0496113_0085556 | Ga0496113_0085556_1238_1987 | 249 |
| 427 | 3300048918 | Ga0496115_0162341 | Ga0496115_0162341_659_1408 | 249 |
| 428 | 3300048919 | Ga0496116_0009398 | Ga0496116_0009398_4635_5384 | 249 |
| 429 | 3300048920 | Ga0496117_0183529 | Ga0496117_0183529_47_796 | 249 |
| 430 | 3300048929 | Ga0496126_0000005 | Ga0496126_0000005_869047_869796 | 249 |
| 431 | 3300048929 | Ga0496126_0000209 | Ga0496126_0000209_117422_118171 | 249 |
| 432 | 3300048929 | Ga0496126_0000560 | Ga0496126_0000560_13321_14070 | 249 |
| 433 | 3300048929 | Ga0496126_0076168 | Ga0496126_0076168_1129_1878 | 249 |
| 434 | 3300049568 | Ga0501031_0035078 | Ga0501031_0035078_2407_3156 | 249 |
| 435 | 3300049569 | Ga0501032_0005510 | Ga0501032_0005510_547_1296 | 249 |
| 436 | 3300049570 | Ga0501033_0088222 | Ga0501033_0088222_639_1388 | 249 |
| 437 | 3300049571 | Ga0501034_0024414 | Ga0501034_0024414_162_911 | 249 |
| 438 | 3300049572 | Ga0501036_0001574 | Ga0501036_0001574_11975_12724 | 249 |
| 439 | 3300049573 | Ga0501037_0029947 | Ga0501037_0029947_1506_2255 | 249 |
| 440 | 3300049574 | Ga0501038_0021851 | Ga0501038_0021851_3568_4317 | 249 |
| 441 | 3300049579 | Ga0501043_0002607 | Ga0501043_0002607_1260_2009 | 249 |
| 442 | 3300049579 | Ga0501043_0193740 | Ga0501043_0193740_203_952 | 249 |
| 443 | 3300049580 | Ga0501046_0000150 | Ga0501046_0000150_13254_14003 | 249 |
| 444 | 3300049581 | Ga0501047_0003876 | Ga0501047_0003876_13166_13915 | 249 |
| 445 | 3300049581 | Ga0501047_0037910 | Ga0501047_0037910_2190_2939 | 249 |
| 446 | 3300049584 | Ga0501068_0301652 | Ga0501068_0301652_119_868 | 249 |
| 447 | 3300049590 | Ga0501074_0289035 | Ga0501074_0289035_129_878 | 249 |
| 448 | 3300049742 | Ga0501080_0051685 | Ga0501080_0051685_1237_1986 | 249 |
| 449 | 3300049742 | Ga0501080_0052843 | Ga0501080_0052843_2494_3243 | 249 |
| 450 | 3300049822 | Ga0501035_0004457 | Ga0501035_0004457_9462_10211 | 249 |
| 451 | 3300049823 | Ga0501044_0005372 | Ga0501044_0005372_139_888 | 249 |
| 452 | 3300053077 | Ga0495601_0019915 | Ga0495601_0019915_666_1415 | 249 |
| 453 | 3300053093 | Ga0500651_0000049 | Ga0500651_0000049_13250_13999 | 249 |
| 454 | 3300053119 | Ga0500595_000014 | Ga0500595_000014_13223_13972 | 249 |
| 455 | 3300059423 | Ga0590074_001275 | Ga0590074_001275_686_1471 | 249 |
| 456 | 3300059424 | Ga0590075_002910 | Ga0590075_002910_21_806 | 249 |
| 457 | 3300059426 | Ga0590077_004195 | Ga0590077_004195_1768_2553 | 249 |
| 458 | 3300005327 | Ga0070658_10615310 | Ga0070658_106153101 | 250 |
| 459 | 3300005329 | Ga0070683_100139567 | Ga0070683_1001395672 | 250 |
| 460 | 3300005336 | Ga0070680_100181162 | Ga0070680_1001811622 | 250 |
| 461 | 3300005344 | Ga0070661_100677188 | Ga0070661_1006771881 | 250 |
| 462 | 3300005445 | Ga0070708_100074375 | Ga0070708_1000743754 | 250 |
| 463 | 3300005458 | Ga0070681_10258473 | Ga0070681_102584731 | 250 |
| 464 | 3300005530 | Ga0070679_100129389 | Ga0070679_1001293892 | 250 |
| 465 | 3300005530 | Ga0070679_100136540 | Ga0070679_1001365403 | 250 |
| 466 | 3300005535 | Ga0070684_100192829 | Ga0070684_1001928293 | 250 |
| 467 | 3300006237 | Ga0097621_100211650 | Ga0097621_1002116502 | 250 |
| 468 | 3300006844 | Ga0075428_100413009 | Ga0075428_1004130092 | 250 |
| 469 | 3300006846 | Ga0075430_100370608 | Ga0075430_1003706082 | 250 |
| 470 | 3300006852 | Ga0075433_10052805 | Ga0075433_100528055 | 250 |
| 471 | 3300006871 | Ga0075434_100007963 | Ga0075434_10000796314 | 250 |
| 472 | 3300006914 | Ga0075436_100020847 | Ga0075436_1000208473 | 250 |
| 473 | 3300006914 | Ga0075436_100108712 | Ga0075436_1001087122 | 250 |
| 474 | 3300007076 | Ga0075435_100008444 | Ga0075435_1000084449 | 250 |
| 475 | 3300009551 | Ga0105238_10146657 | Ga0105238_101466572 | 250 |
| 476 | 3300013296 | Ga0157374_10054566 | Ga0157374_100545666 | 250 |
| 477 | 3300014325 | Ga0163163_10319719 | Ga0163163_103197192 | 250 |
| 478 | 3300014969 | Ga0157376_10243650 | Ga0157376_102436503 | 250 |
| 479 | 3300025909 | Ga0207705_10190806 | Ga0207705_101908062 | 250 |
| 480 | 3300025909 | Ga0207705_10251566 | Ga0207705_102515663 | 250 |
| 481 | 3300025912 | Ga0207707_10176404 | Ga0207707_101764043 | 250 |
| 482 | 3300025912 | Ga0207707_10208335 | Ga0207707_102083352 | 250 |
| 483 | 3300025917 | Ga0207660_10089871 | Ga0207660_100898712 | 250 |
| 484 | 3300025917 | Ga0207660_10279115 | Ga0207660_102791153 | 250 |
| 485 | 3300025921 | Ga0207652_10019825 | Ga0207652_100198259 | 250 |
| 486 | 3300025921 | Ga0207652_10243248 | Ga0207652_102432483 | 250 |
| 487 | 3300025944 | Ga0207661_10215005 | Ga0207661_102150052 | 250 |
| 488 | 3300025949 | Ga0207667_10620245 | Ga0207667_106202451 | 250 |
| 489 | 3300026041 | Ga0207639_10175476 | Ga0207639_101754762 | 250 |
| 490 | 3300026116 | Ga0207674_10184270 | Ga0207674_101842703 | 250 |
| 491 | 3300026116 | Ga0207674_10301449 | Ga0207674_103014493 | 250 |
| 492 | 3300031995 | Ga0307409_100516677 | Ga0307409_1005166772 | 250 |
| 493 | 3300035692 | Ga0373935_0045541 | Ga0373935_0045541_265_1017 | 250 |
| 494 | 3300036401 | Ga0373937_0120726 | Ga0373937_0120726_524_1276 | 250 |
| 495 | 3300037068 | Ga0373925_0046585 | Ga0373925_0046585_387_1139 | 250 |
| 496 | 3300039450 | Ga0436363_1450178 | Ga0436363_1450178_32_790 | 250 |
| 497 | 3300042876 | Ga0451577_0001113 | Ga0451577_0001113_11081_11848 | 250 |
| 498 | 3300042876 | Ga0451577_0006345 | Ga0451577_0006345_7630_8397 | 250 |
| 499 | 3300042876 | Ga0451577_0066882 | Ga0451577_0066882_1990_2763 | 250 |
| 500 | 3300042876 | Ga0451577_0127100 | Ga0451577_0127100_990_1757 | 250 |
| 501 | 3300044673 | Ga0453683_0001684 | Ga0453683_0001684_11081_11848 | 250 |
| 502 | 3300044673 | Ga0453683_0005320 | Ga0453683_0005320_2052_2825 | 250 |
| 503 | 3300044673 | Ga0453683_0009861 | Ga0453683_0009861_3866_4633 | 250 |
| 504 | 3300044673 | Ga0453683_0119218 | Ga0453683_0119218_122_895 | 250 |
| 505 | 3300044693 | Ga0466961_0230596 | Ga0466961_0230596_113_871 | 250 |
| 506 | 3300044712 | Ga0453684_0000258 | Ga0453684_0000258_216465_217232 | 250 |
| 507 | 3300044712 | Ga0453684_0032203 | Ga0453684_0032203_1849_2622 | 250 |
| 508 | 3300044712 | Ga0453684_0153937 | Ga0453684_0153937_1167_1943 | 250 |
| 509 | 3300045049 | Ga0466959_0118527 | Ga0466959_0118527_944_1702 | 250 |
| 510 | 3300045051 | Ga0451576_0003523 | Ga0451576_0003523_14435_15208 | 250 |
| 511 | 3300045051 | Ga0451576_0005411 | Ga0451576_0005411_8838_9605 | 250 |
| 512 | 3300045051 | Ga0451576_0017930 | Ga0451576_0017930_987_1754 | 250 |
| 513 | 3300045051 | Ga0451576_0268735 | Ga0451576_0268735_400_1176 | 250 |
| 514 | 3300046454 | Ga0495592_0134880 | Ga0495592_0134880_381_1139 | 250 |
| 515 | 3300046543 | Ga0495645_0222475 | Ga0495645_0222475_325_1083 | 250 |
| 516 | 3300046678 | Ga0495599_0068521 | Ga0495599_0068521_545_1303 | 250 |
| 517 | 3300046691 | Ga0495670_0032429 | Ga0495670_0032429_1403_2155 | 250 |
| 518 | 3300047317 | Ga0495604_0073444 | Ga0495604_0073444_1197_1955 | 250 |
| 519 | 3300047471 | Ga0495684_0244071 | Ga0495684_0244071_437_1195 | 250 |
| 520 | 3300048088 | Ga0495602_0130089 | Ga0495602_0130089_730_1488 | 250 |
| 521 | 3300048913 | Ga0496110_0597161 | Ga0496110_0597161_54_806 | 250 |
| 522 | 3300048915 | Ga0496112_0240404 | Ga0496112_0240404_379_1137 | 250 |
| 523 | 3300050512 | nmdc:mga0n895_71180_c1 | nmdc:mga0n895_71180_c1_986_1744 | 250 |
| 524 | 3300050513 | nmdc:mga0rr50_23085_c1 | nmdc:mga0rr50_23085_c1_1181_1939 | 250 |
| 525 | 3300050514 | nmdc:mga08x19_51928_c1 | nmdc:mga08x19_51928_c1_461_1219 | 250 |
| 526 | 3300005444 | Ga0070694_100338305 | Ga0070694_1003383052 | 251 |
| 527 | 3300005468 | Ga0070707_100337037 | Ga0070707_1003370373 | 251 |
| 528 | 3300005471 | Ga0070698_100015478 | Ga0070698_1000154786 | 251 |
| 529 | 3300005981 | Ga0081538_10028271 | Ga0081538_100282713 | 251 |
| 530 | 3300014326 | Ga0157380_10186521 | Ga0157380_101865212 | 251 |
| 531 | 3300025916 | Ga0207663_10501109 | Ga0207663_105011092 | 251 |
| 532 | 3300025922 | Ga0207646_10513079 | Ga0207646_105130791 | 251 |
| 533 | 3300031090 | Ga0265760_10012291 | Ga0265760_100122912 | 251 |
| 534 | 3300031090 | Ga0265760_10014127 | Ga0265760_100141274 | 251 |
| 535 | 3300031090 | Ga0265760_10020278 | Ga0265760_100202782 | 251 |
| 536 | 3300031241 | Ga0265325_10057154 | Ga0265325_100571542 | 251 |
| 537 | 3300031241 | Ga0265325_10176116 | Ga0265325_101761161 | 251 |
| 538 | 3300031344 | Ga0265316_10069991 | Ga0265316_100699913 | 251 |
| 539 | 3300031344 | Ga0265316_10170685 | Ga0265316_101706853 | 251 |
| 540 | 3300031852 | Ga0307410_10077593 | Ga0307410_100775933 | 251 |
| 541 | 3300031995 | Ga0307409_100229704 | Ga0307409_1002297044 | 251 |
| 542 | 3300032002 | Ga0307416_100092003 | Ga0307416_1000920033 | 251 |
| 543 | 3300032004 | Ga0307414_10202208 | Ga0307414_102022082 | 251 |
| 544 | 3300042876 | Ga0451577_0000033 | Ga0451577_0000033_349602_350363 | 251 |
| 545 | 3300044673 | Ga0453683_0094013 | Ga0453683_0094013_356_1129 | 251 |
| 546 | 3300044712 | Ga0453684_0000109 | Ga0453684_0000109_11723_12484 | 251 |
| 547 | 3300046473 | Ga0495582_0274329 | Ga0495582_0274329_82_849 | 251 |
| 548 | 3300049588 | Ga0501072_0246551 | Ga0501072_0246551_378_1157 | 251 |
| 549 | 3300059426 | Ga0590077_027574 | Ga0590077_027574_207_998 | 251 |
| 550 | 3300002459 | JGI24751J29686_10025647 | JGI24751J29686_100256472 | 252 |
| 551 | 3300004803 | Ga0058862_12783239 | Ga0058862_127832393 | 252 |
| 552 | 3300005290 | Ga0065712_10010472 | Ga0065712_100104722 | 252 |
| 553 | 3300005290 | Ga0065712_10071314 | Ga0065712_100713143 | 252 |
| 554 | 3300005327 | Ga0070658_10239990 | Ga0070658_102399902 | 252 |
| 555 | 3300005328 | Ga0070676_10078880 | Ga0070676_100788802 | 252 |
| 556 | 3300005329 | Ga0070683_100116656 | Ga0070683_1001166563 | 252 |
| 557 | 3300005330 | Ga0070690_100006534 | Ga0070690_1000065343 | 252 |
| 558 | 3300005331 | Ga0070670_100047369 | Ga0070670_1000473695 | 252 |
| 559 | 3300005331 | Ga0070670_100345458 | Ga0070670_1003454582 | 252 |
| 560 | 3300005334 | Ga0068869_100175092 | Ga0068869_1001750922 | 252 |
| 561 | 3300005335 | Ga0070666_10007809 | Ga0070666_100078098 | 252 |
| 562 | 3300005335 | Ga0070666_10069715 | Ga0070666_100697154 | 252 |
| 563 | 3300005335 | Ga0070666_10236804 | Ga0070666_102368042 | 252 |
| 564 | 3300005338 | Ga0068868_100227577 | Ga0068868_1002275772 | 252 |
| 565 | 3300005339 | Ga0070660_100002987 | Ga0070660_1000029875 | 252 |
| 566 | 3300005339 | Ga0070660_100075797 | Ga0070660_1000757972 | 252 |
| 567 | 3300005340 | Ga0070689_100064561 | Ga0070689_1000645612 | 252 |
| 568 | 3300005344 | Ga0070661_100085265 | Ga0070661_1000852654 | 252 |
| 569 | 3300005354 | Ga0070675_100000056 | Ga0070675_10000005633 | 252 |
| 570 | 3300005355 | Ga0070671_100141666 | Ga0070671_1001416662 | 252 |
| 571 | 3300005356 | Ga0070674_100008546 | Ga0070674_1000085467 | 252 |
| 572 | 3300005356 | Ga0070674_100219684 | Ga0070674_1002196842 | 252 |
| 573 | 3300005364 | Ga0070673_100003427 | Ga0070673_1000034273 | 252 |
| 574 | 3300005365 | Ga0070688_100070904 | Ga0070688_1000709043 | 252 |
| 575 | 3300005366 | Ga0070659_100059884 | Ga0070659_1000598843 | 252 |
| 576 | 3300005367 | Ga0070667_100315003 | Ga0070667_1003150031 | 252 |
| 577 | 3300005436 | Ga0070713_100025501 | Ga0070713_1000255012 | 252 |
| 578 | 3300005438 | Ga0070701_10100710 | Ga0070701_101007102 | 252 |
| 579 | 3300005438 | Ga0070701_10194700 | Ga0070701_101947002 | 252 |
| 580 | 3300005441 | Ga0070700_100563804 | Ga0070700_1005638041 | 252 |
| 581 | 3300005445 | Ga0070708_100100566 | Ga0070708_1001005665 | 252 |
| 582 | 3300005445 | Ga0070708_100236502 | Ga0070708_1002365022 | 252 |
| 583 | 3300005458 | Ga0070681_10047185 | Ga0070681_100471855 | 252 |
| 584 | 3300005459 | Ga0068867_100178546 | Ga0068867_1001785462 | 252 |
| 585 | 3300005466 | Ga0070685_10261157 | Ga0070685_102611572 | 252 |
| 586 | 3300005467 | Ga0070706_100014444 | Ga0070706_1000144443 | 252 |
| 587 | 3300005467 | Ga0070706_100386616 | Ga0070706_1003866162 | 252 |
| 588 | 3300005468 | Ga0070707_100012972 | Ga0070707_1000129724 | 252 |
| 589 | 3300005471 | Ga0070698_100040017 | Ga0070698_1000400177 | 252 |
| 590 | 3300005471 | Ga0070698_100324402 | Ga0070698_1003244021 | 252 |
| 591 | 3300005471 | Ga0070698_100348933 | Ga0070698_1003489333 | 252 |
| 592 | 3300005518 | Ga0070699_100004496 | Ga0070699_1000044964 | 252 |
| 593 | 3300005518 | Ga0070699_100006991 | Ga0070699_1000069915 | 252 |
| 594 | 3300005518 | Ga0070699_100200625 | Ga0070699_1002006252 | 252 |
| 595 | 3300005518 | Ga0070699_100333055 | Ga0070699_1003330552 | 252 |
| 596 | 3300005530 | Ga0070679_100044653 | Ga0070679_1000446536 | 252 |
| 597 | 3300005536 | Ga0070697_100059883 | Ga0070697_1000598833 | 252 |
| 598 | 3300005536 | Ga0070697_100111457 | Ga0070697_1001114572 | 252 |
| 599 | 3300005543 | Ga0070672_100306641 | Ga0070672_1003066412 | 252 |
| 600 | 3300005543 | Ga0070672_100549363 | Ga0070672_1005493632 | 252 |
| 601 | 3300005544 | Ga0070686_100095531 | Ga0070686_1000955312 | 252 |
| 602 | 3300005548 | Ga0070665_100004733 | Ga0070665_1000047336 | 252 |
| 603 | 3300005548 | Ga0070665_100010437 | Ga0070665_10001043710 | 252 |
| 604 | 3300005549 | Ga0070704_100176447 | Ga0070704_1001764472 | 252 |
| 605 | 3300005549 | Ga0070704_100365659 | Ga0070704_1003656592 | 252 |
| 606 | 3300005563 | Ga0068855_100019504 | Ga0068855_1000195044 | 252 |
| 607 | 3300005564 | Ga0070664_100080024 | Ga0070664_1000800243 | 252 |
| 608 | 3300005577 | Ga0068857_100247318 | Ga0068857_1002473182 | 252 |
| 609 | 3300005578 | Ga0068854_100215853 | Ga0068854_1002158532 | 252 |
| 610 | 3300005614 | Ga0068856_100507566 | Ga0068856_1005075662 | 252 |
| 611 | 3300005615 | Ga0070702_100034939 | Ga0070702_1000349392 | 252 |
| 612 | 3300005617 | Ga0068859_100026110 | Ga0068859_1000261103 | 252 |
| 613 | 3300005617 | Ga0068859_100260452 | Ga0068859_1002604523 | 252 |
| 614 | 3300005617 | Ga0068859_100315560 | Ga0068859_1003155602 | 252 |
| 615 | 3300005618 | Ga0068864_100098788 | Ga0068864_1000987885 | 252 |
| 616 | 3300005718 | Ga0068866_10024804 | Ga0068866_100248046 | 252 |
| 617 | 3300005842 | Ga0068858_100008638 | Ga0068858_10000863819 | 252 |
| 618 | 3300005842 | Ga0068858_100373013 | Ga0068858_1003730131 | 252 |
| 619 | 3300005842 | Ga0068858_100435265 | Ga0068858_1004352652 | 252 |
| 620 | 3300005843 | Ga0068860_100166724 | Ga0068860_1001667244 | 252 |
| 621 | 3300005843 | Ga0068860_100361999 | Ga0068860_1003619992 | 252 |
| 622 | 3300005843 | Ga0068860_100563070 | Ga0068860_1005630702 | 252 |
| 623 | 3300005844 | Ga0068862_100126963 | Ga0068862_1001269632 | 252 |
| 624 | 3300005844 | Ga0068862_100187532 | Ga0068862_1001875322 | 252 |
| 625 | 3300005844 | Ga0068862_100366282 | Ga0068862_1003662822 | 252 |
| 626 | 3300006237 | Ga0097621_100006061 | Ga0097621_1000060619 | 252 |
| 627 | 3300006237 | Ga0097621_100015176 | Ga0097621_1000151763 | 252 |
| 628 | 3300006237 | Ga0097621_100020231 | Ga0097621_1000202316 | 252 |
| 629 | 3300006237 | Ga0097621_100464583 | Ga0097621_1004645832 | 252 |
| 630 | 3300006237 | Ga0097621_100503003 | Ga0097621_1005030032 | 252 |
| 631 | 3300006358 | Ga0068871_100001728 | Ga0068871_10000172813 | 252 |
| 632 | 3300006358 | Ga0068871_100006055 | Ga0068871_1000060554 | 252 |
| 633 | 3300006358 | Ga0068871_100061643 | Ga0068871_1000616436 | 252 |
| 634 | 3300006358 | Ga0068871_100088164 | Ga0068871_1000881643 | 252 |
| 635 | 3300006847 | Ga0075431_100167049 | Ga0075431_1001670494 | 252 |
| 636 | 3300006871 | Ga0075434_100123476 | Ga0075434_1001234763 | 252 |
| 637 | 3300006871 | Ga0075434_100128953 | Ga0075434_1001289532 | 252 |
| 638 | 3300006871 | Ga0075434_100146743 | Ga0075434_1001467432 | 252 |
| 639 | 3300006880 | Ga0075429_100087511 | Ga0075429_1000875114 | 252 |
| 640 | 3300006881 | Ga0068865_100015593 | Ga0068865_1000155936 | 252 |
| 641 | 3300006881 | Ga0068865_100152892 | Ga0068865_1001528925 | 252 |
| 642 | 3300006914 | Ga0075436_100014321 | Ga0075436_1000143213 | 252 |
| 643 | 3300006914 | Ga0075436_100019702 | Ga0075436_1000197028 | 252 |
| 644 | 3300006914 | Ga0075436_100058745 | Ga0075436_1000587453 | 252 |
| 645 | 3300006931 | Ga0097620_100026110 | Ga0097620_1000261108 | 252 |
| 646 | 3300006931 | Ga0097620_100260449 | Ga0097620_1002604493 | 252 |
| 647 | 3300006931 | Ga0097620_100315544 | Ga0097620_1003155442 | 252 |
| 648 | 3300007076 | Ga0075435_100001694 | Ga0075435_10000169424 | 252 |
| 649 | 3300007076 | Ga0075435_100004862 | Ga0075435_10000486211 | 252 |
| 650 | 3300007076 | Ga0075435_100021902 | Ga0075435_1000219028 | 252 |
| 651 | 3300007076 | Ga0075435_100072955 | Ga0075435_1000729553 | 252 |
| 652 | 3300007265 | Ga0099794_10061435 | Ga0099794_100614353 | 252 |
| 653 | 3300009093 | Ga0105240_10077161 | Ga0105240_100771615 | 252 |
| 654 | 3300009093 | Ga0105240_10393217 | Ga0105240_103932172 | 252 |
| 655 | 3300009094 | Ga0111539_10000566 | Ga0111539_1000056617 | 252 |
| 656 | 3300009094 | Ga0111539_10005584 | Ga0111539_1000558414 | 252 |
| 657 | 3300009094 | Ga0111539_10541437 | Ga0111539_105414372 | 252 |
| 658 | 3300009098 | Ga0105245_10026276 | Ga0105245_100262766 | 252 |
| 659 | 3300009101 | Ga0105247_10028592 | Ga0105247_100285922 | 252 |
| 660 | 3300009147 | Ga0114129_10004861 | Ga0114129_100048614 | 252 |
| 661 | 3300009147 | Ga0114129_10060820 | Ga0114129_100608204 | 252 |
| 662 | 3300009147 | Ga0114129_10081911 | Ga0114129_100819112 | 252 |
| 663 | 3300009147 | Ga0114129_10106586 | Ga0114129_101065863 | 252 |
| 664 | 3300009147 | Ga0114129_10294188 | Ga0114129_102941882 | 252 |
| 665 | 3300009148 | Ga0105243_10071634 | Ga0105243_100716343 | 252 |
| 666 | 3300009174 | Ga0105241_10087967 | Ga0105241_100879673 | 252 |
| 667 | 3300009177 | Ga0105248_10019507 | Ga0105248_100195075 | 252 |
| 668 | 3300009177 | Ga0105248_10089526 | Ga0105248_100895263 | 252 |
| 669 | 3300009177 | Ga0105248_10094826 | Ga0105248_100948266 | 252 |
| 670 | 3300009177 | Ga0105248_10135047 | Ga0105248_101350473 | 252 |
| 671 | 3300009177 | Ga0105248_10169500 | Ga0105248_101695003 | 252 |
| 672 | 3300009177 | Ga0105248_10428740 | Ga0105248_104287402 | 252 |
| 673 | 3300009177 | Ga0105248_10564353 | Ga0105248_105643532 | 252 |
| 674 | 3300009551 | Ga0105238_10360448 | Ga0105238_103604482 | 252 |
| 675 | 3300009553 | Ga0105249_10483952 | Ga0105249_104839522 | 252 |
| 676 | 3300010375 | Ga0105239_10198030 | Ga0105239_101980301 | 252 |
| 677 | 3300011119 | Ga0105246_10048926 | Ga0105246_100489262 | 252 |
| 678 | 3300013307 | Ga0157372_10345978 | Ga0157372_103459782 | 252 |
| 679 | 3300013308 | Ga0157375_10185394 | Ga0157375_101853944 | 252 |
| 680 | 3300013308 | Ga0157375_11026482 | Ga0157375_110264822 | 252 |
| 681 | 3300014325 | Ga0163163_10064535 | Ga0163163_100645354 | 252 |
| 682 | 3300014325 | Ga0163163_10146285 | Ga0163163_101462853 | 252 |
| 683 | 3300014326 | Ga0157380_10052717 | Ga0157380_100527174 | 252 |
| 684 | 3300014745 | Ga0157377_10078424 | Ga0157377_100784242 | 252 |
| 685 | 3300014968 | Ga0157379_10144530 | Ga0157379_101445304 | 252 |
| 686 | 3300014969 | Ga0157376_10030126 | Ga0157376_100301262 | 252 |
| 687 | 3300014969 | Ga0157376_10045847 | Ga0157376_100458475 | 252 |
| 688 | 3300014969 | Ga0157376_10068436 | Ga0157376_100684363 | 252 |
| 689 | 3300014969 | Ga0157376_10158816 | Ga0157376_101588162 | 252 |
| 690 | 3300014969 | Ga0157376_10207123 | Ga0157376_102071233 | 252 |
| 691 | 3300014969 | Ga0157376_10576190 | Ga0157376_105761902 | 252 |
| 692 | 3300025899 | Ga0207642_10020722 | Ga0207642_100207226 | 252 |
| 693 | 3300025903 | Ga0207680_10049998 | Ga0207680_100499983 | 252 |
| 694 | 3300025903 | Ga0207680_10158383 | Ga0207680_101583832 | 252 |
| 695 | 3300025912 | Ga0207707_10042746 | Ga0207707_100427462 | 252 |
| 696 | 3300025913 | Ga0207695_10345777 | Ga0207695_103457772 | 252 |
| 697 | 3300025917 | Ga0207660_10033197 | Ga0207660_100331972 | 252 |
| 698 | 3300025919 | Ga0207657_10069052 | Ga0207657_100690522 | 252 |
| 699 | 3300025920 | Ga0207649_10167624 | Ga0207649_101676242 | 252 |
| 700 | 3300025921 | Ga0207652_10016976 | Ga0207652_100169768 | 252 |
| 701 | 3300025921 | Ga0207652_10017745 | Ga0207652_100177452 | 252 |
| 702 | 3300025922 | Ga0207646_10000343 | Ga0207646_1000034326 | 252 |
| 703 | 3300025925 | Ga0207650_10029449 | Ga0207650_100294492 | 252 |
| 704 | 3300025926 | Ga0207659_10001213 | Ga0207659_1000121313 | 252 |
| 705 | 3300025926 | Ga0207659_10453394 | Ga0207659_104533942 | 252 |
| 706 | 3300025928 | Ga0207700_10130792 | Ga0207700_101307922 | 252 |
| 707 | 3300025932 | Ga0207690_10118262 | Ga0207690_101182624 | 252 |
| 708 | 3300025934 | Ga0207686_10004734 | Ga0207686_100047345 | 252 |
| 709 | 3300025934 | Ga0207686_10150260 | Ga0207686_101502604 | 252 |
| 710 | 3300025934 | Ga0207686_10229107 | Ga0207686_102291073 | 252 |
| 711 | 3300025936 | Ga0207670_10191489 | Ga0207670_101914892 | 252 |
| 712 | 3300025938 | Ga0207704_10005824 | Ga0207704_100058248 | 252 |
| 713 | 3300025939 | Ga0207665_10058141 | Ga0207665_100581414 | 252 |
| 714 | 3300025940 | Ga0207691_10079684 | Ga0207691_100796846 | 252 |
| 715 | 3300025940 | Ga0207691_10347585 | Ga0207691_103475852 | 252 |
| 716 | 3300025941 | Ga0207711_10007764 | Ga0207711_100077644 | 252 |
| 717 | 3300025941 | Ga0207711_10039221 | Ga0207711_100392217 | 252 |
| 718 | 3300025941 | Ga0207711_10077530 | Ga0207711_100775303 | 252 |
| 719 | 3300025941 | Ga0207711_10380065 | Ga0207711_103800652 | 252 |
| 720 | 3300025941 | Ga0207711_10393153 | Ga0207711_103931532 | 252 |
| 721 | 3300025941 | Ga0207711_10522921 | Ga0207711_105229212 | 252 |
| 722 | 3300025942 | Ga0207689_10051675 | Ga0207689_100516756 | 252 |
| 723 | 3300025942 | Ga0207689_10107787 | Ga0207689_101077872 | 252 |
| 724 | 3300025942 | Ga0207689_10138408 | Ga0207689_101384082 | 252 |
| 725 | 3300025949 | Ga0207667_10023790 | Ga0207667_100237904 | 252 |
| 726 | 3300025960 | Ga0207651_10061070 | Ga0207651_100610706 | 252 |
| 727 | 3300025960 | Ga0207651_10598290 | Ga0207651_105982902 | 252 |
| 728 | 3300025986 | Ga0207658_10283792 | Ga0207658_102837921 | 252 |
| 729 | 3300026035 | Ga0207703_10032738 | Ga0207703_100327386 | 252 |
| 730 | 3300026088 | Ga0207641_10187187 | Ga0207641_101871873 | 252 |
| 731 | 3300026088 | Ga0207641_10281307 | Ga0207641_102813072 | 252 |
| 732 | 3300026089 | Ga0207648_10096571 | Ga0207648_100965712 | 252 |
| 733 | 3300026089 | Ga0207648_10135195 | Ga0207648_101351952 | 252 |
| 734 | 3300026095 | Ga0207676_10076735 | Ga0207676_100767353 | 252 |
| 735 | 3300026095 | Ga0207676_10363422 | Ga0207676_103634222 | 252 |
| 736 | 3300026116 | Ga0207674_10209419 | Ga0207674_102094191 | 252 |
| 737 | 3300026116 | Ga0207674_10327989 | Ga0207674_103279892 | 252 |
| 738 | 3300026116 | Ga0207674_10431436 | Ga0207674_104314362 | 252 |
| 739 | 3300026118 | Ga0207675_100273429 | Ga0207675_1002734292 | 252 |
| 740 | 3300026121 | Ga0207683_10032201 | Ga0207683_100322016 | 252 |
| 741 | 3300026121 | Ga0207683_10240809 | Ga0207683_102408092 | 252 |
| 742 | 3300026121 | Ga0207683_10350096 | Ga0207683_103500962 | 252 |
| 743 | 3300027907 | Ga0207428_10111063 | Ga0207428_101110631 | 252 |
| 744 | 3300028379 | Ga0268266_10005896 | Ga0268266_1000589615 | 252 |
| 745 | 3300028379 | Ga0268266_10029767 | Ga0268266_100297678 | 252 |
| 746 | 3300028380 | Ga0268265_10183463 | Ga0268265_101834633 | 252 |
| 747 | 3300028380 | Ga0268265_10626017 | Ga0268265_106260172 | 252 |
| 748 | 3300028381 | Ga0268264_10145483 | Ga0268264_101454832 | 252 |
| 749 | 3300028381 | Ga0268264_10732567 | Ga0268264_107325672 | 252 |
| 750 | 3300028800 | Ga0265338_10083576 | Ga0265338_100835764 | 252 |
| 751 | 3300031240 | Ga0265320_10084511 | Ga0265320_100845112 | 252 |
| 752 | 3300031711 | Ga0265314_10013729 | Ga0265314_100137292 | 252 |
| 753 | 3300032002 | Ga0307416_100202969 | Ga0307416_1002029691 | 252 |
| 754 | 3300032126 | Ga0307415_100717358 | Ga0307415_1007173582 | 252 |
| 755 | 3300034820 | Ga0373959_0000924 | Ga0373959_0000924_1591_2364 | 252 |
| 756 | 3300034957 | Ga0373938_0017018 | Ga0373938_0017018_143_916 | 252 |
| 757 | 3300035084 | Ga0373928_0003435 | Ga0373928_0003435_1475_2248 | 252 |
| 758 | 3300035085 | Ga0373929_0000116 | Ga0373929_0000116_5324_6097 | 252 |
| 759 | 3300035088 | Ga0373940_0000084 | Ga0373940_0000084_9205_9978 | 252 |
| 760 | 3300035090 | Ga0373949_0019342 | Ga0373949_0019342_388_1161 | 252 |
| 761 | 3300035112 | Ga0373932_0000807 | Ga0373932_0000807_5504_6277 | 252 |
| 762 | 3300035113 | Ga0373936_0048513 | Ga0373936_0048513_116_889 | 252 |
| 763 | 3300035114 | Ga0373939_0096860 | Ga0373939_0096860_175_948 | 252 |
| 764 | 3300035115 | Ga0373941_0000161 | Ga0373941_0000161_10384_11157 | 252 |
| 765 | 3300035116 | Ga0373945_0107256 | Ga0373945_0107256_89_862 | 252 |
| 766 | 3300035118 | Ga0373954_0158733 | Ga0373954_0158733_293_1066 | 252 |
| 767 | 3300035118 | Ga0373954_0261659 | Ga0373954_0261659_61_834 | 252 |
| 768 | 3300035121 | Ga0373960_0000753 | Ga0373960_0000753_3154_3927 | 252 |
| 769 | 3300035172 | Ga0373955_0103149 | Ga0373955_0103149_753_1526 | 252 |
| 770 | 3300035207 | Ga0373942_0001757 | Ga0373942_0001757_143_916 | 252 |
| 771 | 3300035241 | Ga0373961_0001371 | Ga0373961_0001371_1237_2010 | 252 |
| 772 | 3300035242 | Ga0373962_0000245 | Ga0373962_0000245_144_917 | 252 |
| 773 | 3300035410 | Ga0373924_0013554 | Ga0373924_0013554_2042_2815 | 252 |
| 774 | 3300035691 | Ga0373931_0004378 | Ga0373931_0004378_5632_6405 | 252 |
| 775 | 3300035692 | Ga0373935_0053767 | Ga0373935_0053767_1368_2141 | 252 |
| 776 | 3300035725 | Ga0373947_0040913 | Ga0373947_0040913_814_1587 | 252 |
| 777 | 3300036401 | Ga0373937_0029266 | Ga0373937_0029266_1634_2419 | 252 |
| 778 | 3300036401 | Ga0373937_0103229 | Ga0373937_0103229_888_1661 | 252 |
| 779 | 3300036401 | Ga0373937_0274871 | Ga0373937_0274871_558_1331 | 252 |
| 780 | 3300036401 | Ga0373937_0554909 | Ga0373937_0554909_179_952 | 252 |
| 781 | 3300037068 | Ga0373925_0005941 | Ga0373925_0005941_8069_8842 | 252 |
| 782 | 3300038443 | Ga0395901_0728164 | Ga0395901_0728164_69_842 | 252 |
| 783 | 3300042120 | Ga0450917_003592 | Ga0450917_003592_283_1053 | 252 |
| 784 | 3300042129 | Ga0450891_003545 | Ga0450891_003545_354_1124 | 252 |
| 785 | 3300042436 | Ga0439435_0019796 | Ga0439435_0019796_146_916 | 252 |
| 786 | 3300042876 | Ga0451577_0019789 | Ga0451577_0019789_3061_3837 | 252 |
| 787 | 3300044673 | Ga0453683_0005105 | Ga0453683_0005105_5192_5968 | 252 |
| 788 | 3300044694 | Ga0466963_0085217 | Ga0466963_0085217_1090_1863 | 252 |
| 789 | 3300044694 | Ga0466963_0170099 | Ga0466963_0170099_81_854 | 252 |
| 790 | 3300044712 | Ga0453684_0008349 | Ga0453684_0008349_5619_6395 | 252 |
| 791 | 3300045051 | Ga0451576_0027325 | Ga0451576_0027325_3396_4172 | 252 |
| 792 | 3300045051 | Ga0451576_0030890 | Ga0451576_0030890_4377_5150 | 252 |
| 793 | 3300045051 | Ga0451576_0055322 | Ga0451576_0055322_698_1471 | 252 |
| 794 | 3300045051 | Ga0451576_0582350 | Ga0451576_0582350_167_940 | 252 |
| 795 | 3300046459 | Ga0495629_0056581 | Ga0495629_0056581_243_1016 | 252 |
| 796 | 3300046472 | Ga0495580_0220030 | Ga0495580_0220030_41_814 | 252 |
| 797 | 3300046472 | Ga0495580_0434515 | Ga0495580_0434515_60_833 | 252 |
| 798 | 3300046473 | Ga0495582_0105380 | Ga0495582_0105380_237_1010 | 252 |
| 799 | 3300046477 | Ga0495664_0133863 | Ga0495664_0133863_153_926 | 252 |
| 800 | 3300046511 | Ga0495608_0004188 | Ga0495608_0004188_7847_8620 | 252 |
| 801 | 3300046516 | Ga0495628_0118357 | Ga0495628_0118357_667_1440 | 252 |
| 802 | 3300046516 | Ga0495628_0247535 | Ga0495628_0247535_234_1019 | 252 |
| 803 | 3300046517 | Ga0495630_0010900 | Ga0495630_0010900_3531_4304 | 252 |
| 804 | 3300046529 | Ga0495652_0081707 | Ga0495652_0081707_523_1296 | 252 |
| 805 | 3300046533 | Ga0495640_0028932 | Ga0495640_0028932_1032_1805 | 252 |
| 806 | 3300046543 | Ga0495645_0004427 | Ga0495645_0004427_6797_7582 | 252 |
| 807 | 3300046543 | Ga0495645_0027506 | Ga0495645_0027506_1341_2114 | 252 |
| 808 | 3300046559 | Ga0495667_0023465 | Ga0495667_0023465_1550_2323 | 252 |
| 809 | 3300046663 | Ga0495635_0104808 | Ga0495635_0104808_365_1138 | 252 |
| 810 | 3300046663 | Ga0495635_0252379 | Ga0495635_0252379_18_791 | 252 |
| 811 | 3300046675 | Ga0495657_0103606 | Ga0495657_0103606_1010_1783 | 252 |
| 812 | 3300046680 | Ga0495646_0247826 | Ga0495646_0247826_55_828 | 252 |
| 813 | 3300046681 | Ga0495647_0130370 | Ga0495647_0130370_200_973 | 252 |
| 814 | 3300046683 | Ga0495658_0124747 | Ga0495658_0124747_760_1533 | 252 |
| 815 | 3300046684 | Ga0495669_0000560 | Ga0495669_0000560_10095_10868 | 252 |
| 816 | 3300046689 | Ga0495613_0013985 | Ga0495613_0013985_3446_4219 | 252 |
| 817 | 3300046690 | Ga0495624_0237689 | Ga0495624_0237689_103_876 | 252 |
| 818 | 3300047315 | Ga0495581_0211960 | Ga0495581_0211960_350_1123 | 252 |
| 819 | 3300047315 | Ga0495581_0237560 | Ga0495581_0237560_128_901 | 252 |
| 820 | 3300047319 | Ga0495674_0088249 | Ga0495674_0088249_692_1477 | 252 |
| 821 | 3300047322 | Ga0495680_0030110 | Ga0495680_0030110_1813_2586 | 252 |
| 822 | 3300047322 | Ga0495680_0084304 | Ga0495680_0084304_943_1716 | 252 |
| 823 | 3300047444 | Ga0495675_0170815 | Ga0495675_0170815_77_850 | 252 |
| 824 | 3300047471 | Ga0495684_0009393 | Ga0495684_0009393_4030_4803 | 252 |
| 825 | 3300048903 | Ga0496100_0004796 | Ga0496100_0004796_6414_7187 | 252 |
| 826 | 3300048905 | Ga0496102_0186737 | Ga0496102_0186737_164_940 | 252 |
| 827 | 3300048907 | Ga0496104_0017385 | Ga0496104_0017385_1444_2229 | 252 |
| 828 | 3300048907 | Ga0496104_0040982 | Ga0496104_0040982_391_1164 | 252 |
| 829 | 3300048907 | Ga0496104_0076019 | Ga0496104_0076019_911_1684 | 252 |
| 830 | 3300048908 | Ga0496105_0223881 | Ga0496105_0223881_339_1112 | 252 |
| 831 | 3300048909 | Ga0496106_0239861 | Ga0496106_0239861_291_1064 | 252 |
| 832 | 3300048910 | Ga0496107_0028952 | Ga0496107_0028952_498_1271 | 252 |
| 833 | 3300048911 | Ga0496108_0250451 | Ga0496108_0250451_385_1158 | 252 |
| 834 | 3300048911 | Ga0496108_0267599 | Ga0496108_0267599_354_1139 | 252 |
| 835 | 3300048912 | Ga0496109_0062051 | Ga0496109_0062051_2435_3208 | 252 |
| 836 | 3300048912 | Ga0496109_0457255 | Ga0496109_0457255_67_840 | 252 |
| 837 | 3300048913 | Ga0496110_0416811 | Ga0496110_0416811_333_1106 | 252 |
| 838 | 3300048914 | Ga0496111_0238753 | Ga0496111_0238753_512_1285 | 252 |
| 839 | 3300048914 | Ga0496111_0258881 | Ga0496111_0258881_82_855 | 252 |
| 840 | 3300048915 | Ga0496112_0016237 | Ga0496112_0016237_2719_3504 | 252 |
| 841 | 3300048915 | Ga0496112_0093303 | Ga0496112_0093303_1618_2391 | 252 |
| 842 | 3300048915 | Ga0496112_0383151 | Ga0496112_0383151_278_1051 | 252 |
| 843 | 3300048915 | Ga0496112_0428668 | Ga0496112_0428668_426_1199 | 252 |
| 844 | 3300048915 | Ga0496112_0524600 | Ga0496112_0524600_255_1028 | 252 |
| 845 | 3300048917 | Ga0496114_0000246 | Ga0496114_0000246_8246_9019 | 252 |
| 846 | 3300048917 | Ga0496114_0098572 | Ga0496114_0098572_224_1009 | 252 |
| 847 | 3300048917 | Ga0496114_0213426 | Ga0496114_0213426_582_1370 | 252 |
| 848 | 3300048917 | Ga0496114_0640718 | Ga0496114_0640718_113_886 | 252 |
| 849 | 3300049583 | Ga0501067_0162452 | Ga0501067_0162452_120_893 | 252 |
| 850 | 3300049743 | Ga0501081_0272372 | Ga0501081_0272372_68_841 | 252 |
| 851 | 3300049744 | Ga0501083_0055182 | Ga0501083_0055182_1169_1942 | 252 |
| 852 | 3300050507 | nmdc:mga05p37_279225_c1 | nmdc:mga05p37_279225_c1_857_1627 | 252 |
| 853 | 3300050507 | nmdc:mga05p37_3048_c1 | nmdc:mga05p37_3048_c1_17459_18232 | 252 |
| 854 | 3300050507 | nmdc:mga05p37_46662_c1 | nmdc:mga05p37_46662_c1_1602_2372 | 252 |
| 855 | 3300050507 | nmdc:mga05p37_549024_c1 | nmdc:mga05p37_549024_c1_206_982 | 252 |
| 856 | 3300050507 | nmdc:mga05p37_595_c1 | nmdc:mga05p37_595_c1_11669_12442 | 252 |
| 857 | 3300050507 | nmdc:mga05p37_78337_c2 | nmdc:mga05p37_78337_c2_2193_2966 | 252 |
| 858 | 3300050508 | nmdc:mga09592_168412_c1 | nmdc:mga09592_168412_c1_765_1541 | 252 |
| 859 | 3300050510 | nmdc:mga06r32_27167_c2 | nmdc:mga06r32_27167_c2_2671_3447 | 252 |
| 860 | 3300050511 | nmdc:mga08y16_17177_c1 | nmdc:mga08y16_17177_c1_5873_6646 | 252 |
| 861 | 3300050511 | nmdc:mga08y16_59748_c1 | nmdc:mga08y16_59748_c1_1269_2042 | 252 |
| 862 | 3300050512 | nmdc:mga0n895_12870_c1 | nmdc:mga0n895_12870_c1_4778_5551 | 252 |
| 863 | 3300050512 | nmdc:mga0n895_134377_c1 | nmdc:mga0n895_134377_c1_164_934 | 252 |
| 864 | 3300050512 | nmdc:mga0n895_142639_c1 | nmdc:mga0n895_142639_c1_1207_1977 | 252 |
| 865 | 3300050512 | nmdc:mga0n895_735049_c1 | nmdc:mga0n895_735049_c1_110_883 | 252 |
| 866 | 3300050513 | nmdc:mga0rr50_139029_c1 | nmdc:mga0rr50_139029_c1_639_1412 | 252 |
| 867 | 3300050513 | nmdc:mga0rr50_21352_c1 | nmdc:mga0rr50_21352_c1_2545_3318 | 252 |
| 868 | 3300050513 | nmdc:mga0rr50_2205_c1 | nmdc:mga0rr50_2205_c1_5045_5815 | 252 |
| 869 | 3300050513 | nmdc:mga0rr50_3252_c1 | nmdc:mga0rr50_3252_c1_1947_2720 | 252 |
| 870 | 3300050513 | nmdc:mga0rr50_373_c1 | nmdc:mga0rr50_373_c1_15100_15873 | 252 |
| 871 | 3300050513 | nmdc:mga0rr50_60229_c1 | nmdc:mga0rr50_60229_c1_518_1291 | 252 |
| 872 | 3300050513 | nmdc:mga0rr50_9864_c1 | nmdc:mga0rr50_9864_c1_4917_5690 | 252 |
| 873 | 3300050514 | nmdc:mga08x19_15605_c1 | nmdc:mga08x19_15605_c1_1059_1832 | 252 |
| 874 | 3300050514 | nmdc:mga08x19_78043_c1 | nmdc:mga08x19_78043_c1_653_1426 | 252 |
| 875 | 3300050514 | nmdc:mga08x19_90727_c1 | nmdc:mga08x19_90727_c1_214_1059 | 252 |
| 876 | 3300050515 | nmdc:mga0a205_10346_c1 | nmdc:mga0a205_10346_c1_2295_3065 | 252 |
| 877 | 3300050515 | nmdc:mga0a205_47564_c1 | nmdc:mga0a205_47564_c1_1973_2743 | 252 |
| 878 | 3300053077 | Ga0495601_0063448 | Ga0495601_0063448_1218_1991 | 252 |
| 879 | 3300053077 | Ga0495601_0126279 | Ga0495601_0126279_821_1606 | 252 |
| 880 | 3300053083 | Ga0495655_0010860 | Ga0495655_0010860_173_946 | 252 |
| 881 | 3300053084 | Ga0495595_0030502 | Ga0495595_0030502_1553_2326 | 252 |
| 882 | 3300053084 | Ga0495595_0102853 | Ga0495595_0102853_253_1038 | 252 |
| 883 | 3300053085 | Ga0495619_0004075 | Ga0495619_0004075_6189_6962 | 252 |
| 884 | 3300053085 | Ga0495619_0029701 | Ga0495619_0029701_2193_2966 | 252 |
| 885 | 3300053085 | Ga0495619_0062284 | Ga0495619_0062284_1397_2182 | 252 |
| 886 | 3300060353 | Ga0501082_0175766 | Ga0501082_0175766_424_1224 | 252 |
| 887 | 3300005340 | Ga0070689_100112365 | Ga0070689_1001123651 | 253 |
| 888 | 3300005347 | Ga0070668_100547736 | Ga0070668_1005477361 | 253 |
| 889 | 3300005353 | Ga0070669_100035389 | Ga0070669_1000353895 | 253 |
| 890 | 3300005355 | Ga0070671_100031409 | Ga0070671_1000314097 | 253 |
| 891 | 3300005365 | Ga0070688_100132643 | Ga0070688_1001326432 | 253 |
| 892 | 3300005468 | Ga0070707_100272326 | Ga0070707_1002723262 | 253 |
| 893 | 3300005471 | Ga0070698_100003045 | Ga0070698_10000304525 | 253 |
| 894 | 3300005471 | Ga0070698_100260579 | Ga0070698_1002605792 | 253 |
| 895 | 3300005841 | Ga0068863_100098324 | Ga0068863_1000983243 | 253 |
| 896 | 3300005843 | Ga0068860_100204933 | Ga0068860_1002049332 | 253 |
| 897 | 3300005844 | Ga0068862_100021021 | Ga0068862_1000210213 | 253 |
| 898 | 3300005937 | Ga0081455_10025866 | Ga0081455_100258662 | 253 |
| 899 | 3300006358 | Ga0068871_100286689 | Ga0068871_1002866894 | 253 |
| 900 | 3300006844 | Ga0075428_100055934 | Ga0075428_1000559343 | 253 |
| 901 | 3300006852 | Ga0075433_10114798 | Ga0075433_101147983 | 253 |
| 902 | 3300006871 | Ga0075434_100240424 | Ga0075434_1002404242 | 253 |
| 903 | 3300009094 | Ga0111539_10380566 | Ga0111539_103805662 | 253 |
| 904 | 3300009147 | Ga0114129_10033059 | Ga0114129_100330593 | 253 |
| 905 | 3300009147 | Ga0114129_10078194 | Ga0114129_100781946 | 253 |
| 906 | 3300009177 | Ga0105248_10013460 | Ga0105248_100134605 | 253 |
| 907 | 3300009177 | Ga0105248_10371694 | Ga0105248_103716942 | 253 |
| 908 | 3300009553 | Ga0105249_10261220 | Ga0105249_102612202 | 253 |
| 909 | 3300013102 | Ga0157371_10260778 | Ga0157371_102607781 | 253 |
| 910 | 3300013297 | Ga0157378_10083535 | Ga0157378_100835352 | 253 |
| 911 | 3300014968 | Ga0157379_10082081 | Ga0157379_100820811 | 253 |
| 912 | 3300014969 | Ga0157376_10235850 | Ga0157376_102358502 | 253 |
| 913 | 3300025918 | Ga0207662_10119494 | Ga0207662_101194943 | 253 |
| 914 | 3300025940 | Ga0207691_10033820 | Ga0207691_100338203 | 253 |
| 915 | 3300025960 | Ga0207651_10317438 | Ga0207651_103174382 | 253 |
| 916 | 3300026088 | Ga0207641_10001674 | Ga0207641_1000167421 | 253 |
| 917 | 3300026089 | Ga0207648_10190814 | Ga0207648_101908142 | 253 |
| 918 | 3300026118 | Ga0207675_100121913 | Ga0207675_1001219135 | 253 |
| 919 | 3300027907 | Ga0207428_10070330 | Ga0207428_100703303 | 253 |
| 920 | 3300028381 | Ga0268264_10111054 | Ga0268264_101110543 | 253 |
| 921 | 3300031548 | Ga0307408_100087781 | Ga0307408_1000877812 | 253 |
| 922 | 3300035092 | Ga0373952_0037917 | Ga0373952_0037917_132_914 | 253 |
| 923 | 3300035112 | Ga0373932_0009460 | Ga0373932_0009460_136_918 | 253 |
| 924 | 3300042137 | Ga0450902_021445 | Ga0450902_021445_276_1049 | 253 |
| 925 | 3300046454 | Ga0495592_0342953 | Ga0495592_0342953_44_817 | 253 |
| 926 | 3300046615 | Ga0495656_0184261 | Ga0495656_0184261_110_892 | 253 |
| 927 | 3300048905 | Ga0496102_0213964 | Ga0496102_0213964_813_1595 | 253 |
| 928 | 3300048912 | Ga0496109_0206954 | Ga0496109_0206954_978_1760 | 253 |
| 929 | 3300050507 | nmdc:mga05p37_20610_c1 | nmdc:mga05p37_20610_c1_4977_5759 | 253 |
| 930 | 3300050507 | nmdc:mga05p37_25099_c1 | nmdc:mga05p37_25099_c1_1767_2549 | 253 |
| 931 | 3300050507 | nmdc:mga05p37_6561_c1 | nmdc:mga05p37_6561_c1_9132_9959 | 253 |
| 932 | 3300050508 | nmdc:mga09592_428202_c1 | nmdc:mga09592_428202_c1_309_1091 | 253 |
| 933 | 3300050511 | nmdc:mga08y16_169354_c1 | nmdc:mga08y16_169354_c1_1268_2050 | 253 |
| 934 | 3300050515 | nmdc:mga0a205_72605_c1 | nmdc:mga0a205_72605_c1_1203_1985 | 253 |
| 935 | 3300005293 | Ga0065715_10094515 | Ga0065715_100945156 | 254 |
| 936 | 3300005295 | Ga0065707_10167480 | Ga0065707_101674802 | 254 |
| 937 | 3300005335 | Ga0070666_10382760 | Ga0070666_103827602 | 254 |
| 938 | 3300005340 | Ga0070689_100043206 | Ga0070689_1000432062 | 254 |
| 939 | 3300005354 | Ga0070675_100224737 | Ga0070675_1002247372 | 254 |
| 940 | 3300005438 | Ga0070701_10065697 | Ga0070701_100656971 | 254 |
| 941 | 3300005457 | Ga0070662_100524581 | Ga0070662_1005245811 | 254 |
| 942 | 3300005545 | Ga0070695_100034315 | Ga0070695_1000343153 | 254 |
| 943 | 3300005546 | Ga0070696_100118842 | Ga0070696_1001188422 | 254 |
| 944 | 3300005617 | Ga0068859_100004442 | Ga0068859_1000044424 | 254 |
| 945 | 3300005719 | Ga0068861_100196107 | Ga0068861_1001961072 | 254 |
| 946 | 3300005843 | Ga0068860_100205882 | Ga0068860_1002058822 | 254 |
| 947 | 3300005844 | Ga0068862_100051237 | Ga0068862_1000512373 | 254 |
| 948 | 3300006844 | Ga0075428_100000009 | Ga0075428_100000009208 | 254 |
| 949 | 3300006931 | Ga0097620_100004442 | Ga0097620_10000444224 | 254 |
| 950 | 3300009094 | Ga0111539_10000010 | Ga0111539_1000001030 | 254 |
| 951 | 3300009553 | Ga0105249_10233757 | Ga0105249_102337573 | 254 |
| 952 | 3300025907 | Ga0207645_10174320 | Ga0207645_101743202 | 254 |
| 953 | 3300025933 | Ga0207706_10126975 | Ga0207706_101269753 | 254 |
| 954 | 3300025933 | Ga0207706_10552701 | Ga0207706_105527012 | 254 |
| 955 | 3300025936 | Ga0207670_10141333 | Ga0207670_101413332 | 254 |
| 956 | 3300026121 | Ga0207683_10393482 | Ga0207683_103934822 | 254 |
| 957 | 3300027907 | Ga0207428_10000034 | Ga0207428_10000034190 | 254 |
| 958 | 3300028381 | Ga0268264_10234483 | Ga0268264_102344832 | 254 |
| 959 | 3300031548 | Ga0307408_100252141 | Ga0307408_1002521412 | 254 |
| 960 | 3300032005 | Ga0307411_10041711 | Ga0307411_100417114 | 254 |
| 961 | 3300032126 | Ga0307415_100423547 | Ga0307415_1004235472 | 254 |
| 962 | 3300050511 | nmdc:mga08y16_10_c1 | nmdc:mga08y16_10_c1_438771_439583 | 254 |
| 963 | 3300002239 | JGI24034J26672_10023592 | JGI24034J26672_100235921 | 256 |
| 964 | 3300003659 | JGI25404J52841_10004671 | JGI25404J52841_100046712 | 256 |
| 965 | 3300005295 | Ga0065707_10005887 | Ga0065707_100058871 | 256 |
| 966 | 3300005327 | Ga0070658_10001004 | Ga0070658_1000100427 | 256 |
| 967 | 3300005328 | Ga0070676_10000510 | Ga0070676_1000051022 | 256 |
| 968 | 3300005329 | Ga0070683_100017258 | Ga0070683_1000172586 | 256 |
| 969 | 3300005330 | Ga0070690_100000366 | Ga0070690_10000036626 | 256 |
| 970 | 3300005334 | Ga0068869_100002833 | Ga0068869_10000283314 | 256 |
| 971 | 3300005336 | Ga0070680_100075087 | Ga0070680_1000750873 | 256 |
| 972 | 3300005338 | Ga0068868_100002098 | Ga0068868_10000209810 | 256 |
| 973 | 3300005339 | Ga0070660_100027583 | Ga0070660_1000275834 | 256 |
| 974 | 3300005340 | Ga0070689_100001862 | Ga0070689_10000186212 | 256 |
| 975 | 3300005343 | Ga0070687_100000205 | Ga0070687_10000020521 | 256 |
| 976 | 3300005344 | Ga0070661_100009522 | Ga0070661_1000095226 | 256 |
| 977 | 3300005345 | Ga0070692_10001681 | Ga0070692_100016813 | 256 |
| 978 | 3300005347 | Ga0070668_100001206 | Ga0070668_10000120617 | 256 |
| 979 | 3300005354 | Ga0070675_100002314 | Ga0070675_10000231420 | 256 |
| 980 | 3300005355 | Ga0070671_100005888 | Ga0070671_1000058888 | 256 |
| 981 | 3300005356 | Ga0070674_100000202 | Ga0070674_10000020220 | 256 |
| 982 | 3300005364 | Ga0070673_100005301 | Ga0070673_10000530112 | 256 |
| 983 | 3300005365 | Ga0070688_100000519 | Ga0070688_1000005199 | 256 |
| 984 | 3300005366 | Ga0070659_100000088 | Ga0070659_10000008833 | 256 |
| 985 | 3300005440 | Ga0070705_100000543 | Ga0070705_10000054310 | 256 |
| 986 | 3300005441 | Ga0070700_100185954 | Ga0070700_1001859542 | 256 |
| 987 | 3300005455 | Ga0070663_100021838 | Ga0070663_1000218385 | 256 |
| 988 | 3300005456 | Ga0070678_100004288 | Ga0070678_1000042886 | 256 |
| 989 | 3300005466 | Ga0070685_10000717 | Ga0070685_1000071716 | 256 |
| 990 | 3300005530 | Ga0070679_100312644 | Ga0070679_1003126441 | 256 |
| 991 | 3300005539 | Ga0068853_100000347 | Ga0068853_10000034719 | 256 |
| 992 | 3300005543 | Ga0070672_100000351 | Ga0070672_10000035131 | 256 |
| 993 | 3300005544 | Ga0070686_100000914 | Ga0070686_10000091420 | 256 |
| 994 | 3300005545 | Ga0070695_100230632 | Ga0070695_1002306322 | 256 |
| 995 | 3300005547 | Ga0070693_100041481 | Ga0070693_1000414813 | 256 |
| 996 | 3300005563 | Ga0068855_100000527 | Ga0068855_10000052735 | 256 |
| 997 | 3300005564 | Ga0070664_100008108 | Ga0070664_10000810810 | 256 |
| 998 | 3300005564 | Ga0070664_100016133 | Ga0070664_1000161335 | 256 |
| 999 | 3300005577 | Ga0068857_100005689 | Ga0068857_10000568917 | 256 |
| 1000 | 3300005577 | Ga0068857_100024303 | Ga0068857_1000243036 | 256 |
| 1001 | 3300005578 | Ga0068854_100000245 | Ga0068854_10000024534 | 256 |
| 1002 | 3300005614 | Ga0068856_100022481 | Ga0068856_1000224813 | 256 |
| 1003 | 3300005615 | Ga0070702_100370516 | Ga0070702_1003705161 | 256 |
| 1004 | 3300005616 | Ga0068852_100001092 | Ga0068852_10000109220 | 256 |
| 1005 | 3300005617 | Ga0068859_100000315 | Ga0068859_10000031523 | 256 |
| 1006 | 3300005618 | Ga0068864_100000998 | Ga0068864_10000099813 | 256 |
| 1007 | 3300005718 | Ga0068866_10000101 | Ga0068866_1000010127 | 256 |
| 1008 | 3300005719 | Ga0068861_100006034 | Ga0068861_10000603413 | 256 |
| 1009 | 3300005834 | Ga0068851_10000245 | Ga0068851_1000024523 | 256 |
| 1010 | 3300005840 | Ga0068870_10000036 | Ga0068870_1000003630 | 256 |
| 1011 | 3300005841 | Ga0068863_100000343 | Ga0068863_10000034334 | 256 |
| 1012 | 3300005983 | Ga0081540_1000264 | Ga0081540_10002649 | 256 |
| 1013 | 3300005983 | Ga0081540_1009729 | Ga0081540_10097297 | 256 |
| 1014 | 3300005983 | Ga0081540_1010957 | Ga0081540_10109572 | 256 |
| 1015 | 3300006237 | Ga0097621_100000177 | Ga0097621_10000017734 | 256 |
| 1016 | 3300006358 | Ga0068871_100006948 | Ga0068871_1000069487 | 256 |
| 1017 | 3300006931 | Ga0097620_100000315 | Ga0097620_10000031523 | 256 |
| 1018 | 3300009093 | Ga0105240_10001604 | Ga0105240_1000160428 | 256 |
| 1019 | 3300009098 | Ga0105245_10000166 | Ga0105245_1000016641 | 256 |
| 1020 | 3300009101 | Ga0105247_10001356 | Ga0105247_1000135611 | 256 |
| 1021 | 3300009174 | Ga0105241_10001205 | Ga0105241_100012055 | 256 |
| 1022 | 3300009176 | Ga0105242_10003060 | Ga0105242_1000306015 | 256 |
| 1023 | 3300009177 | Ga0105248_10006569 | Ga0105248_100065694 | 256 |
| 1024 | 3300009545 | Ga0105237_10001703 | Ga0105237_1000170323 | 256 |
| 1025 | 3300009551 | Ga0105238_10000391 | Ga0105238_1000039133 | 256 |
| 1026 | 3300009553 | Ga0105249_10000319 | Ga0105249_1000031925 | 256 |
| 1027 | 3300010375 | Ga0105239_10000707 | Ga0105239_1000070734 | 256 |
| 1028 | 3300011119 | Ga0105246_10000493 | Ga0105246_1000049325 | 256 |
| 1029 | 3300013100 | Ga0157373_10025268 | Ga0157373_100252683 | 256 |
| 1030 | 3300013102 | Ga0157371_10000492 | Ga0157371_1000049223 | 256 |
| 1031 | 3300013105 | Ga0157369_10004814 | Ga0157369_1000481423 | 256 |
| 1032 | 3300013296 | Ga0157374_10001527 | Ga0157374_1000152723 | 256 |
| 1033 | 3300013297 | Ga0157378_10000975 | Ga0157378_1000097517 | 256 |
| 1034 | 3300013306 | Ga0163162_10001548 | Ga0163162_1000154823 | 256 |
| 1035 | 3300013307 | Ga0157372_10002029 | Ga0157372_100020296 | 256 |
| 1036 | 3300013308 | Ga0157375_10059650 | Ga0157375_100596504 | 256 |
| 1037 | 3300014325 | Ga0163163_10001027 | Ga0163163_1000102715 | 256 |
| 1038 | 3300014745 | Ga0157377_10000364 | Ga0157377_1000036415 | 256 |
| 1039 | 3300014968 | Ga0157379_10000136 | Ga0157379_1000013626 | 256 |
| 1040 | 3300014969 | Ga0157376_10000282 | Ga0157376_1000028230 | 256 |
| 1041 | 3300017792 | Ga0163161_10003977 | Ga0163161_100039774 | 256 |
| 1042 | 3300025315 | Ga0207697_10001780 | Ga0207697_100017804 | 256 |
| 1043 | 3300025321 | Ga0207656_10023292 | Ga0207656_100232923 | 256 |
| 1044 | 3300025893 | Ga0207682_10000392 | Ga0207682_1000039229 | 256 |
| 1045 | 3300025899 | Ga0207642_10026880 | Ga0207642_100268804 | 256 |
| 1046 | 3300025901 | Ga0207688_10000089 | Ga0207688_1000008913 | 256 |
| 1047 | 3300025903 | Ga0207680_10014898 | Ga0207680_100148984 | 256 |
| 1048 | 3300025904 | Ga0207647_10000810 | Ga0207647_1000081031 | 256 |
| 1049 | 3300025907 | Ga0207645_10003099 | Ga0207645_100030994 | 256 |
| 1050 | 3300025908 | Ga0207643_10000030 | Ga0207643_1000003086 | 256 |
| 1051 | 3300025909 | Ga0207705_10003131 | Ga0207705_100031314 | 256 |
| 1052 | 3300025911 | Ga0207654_10003953 | Ga0207654_100039535 | 256 |
| 1053 | 3300025912 | Ga0207707_10106078 | Ga0207707_101060783 | 256 |
| 1054 | 3300025914 | Ga0207671_10002141 | Ga0207671_1000214126 | 256 |
| 1055 | 3300025918 | Ga0207662_10000128 | Ga0207662_1000012823 | 256 |
| 1056 | 3300025919 | Ga0207657_10000011 | Ga0207657_1000001134 | 256 |
| 1057 | 3300025920 | Ga0207649_10002988 | Ga0207649_100029887 | 256 |
| 1058 | 3300025923 | Ga0207681_10000822 | Ga0207681_1000082213 | 256 |
| 1059 | 3300025924 | Ga0207694_10033732 | Ga0207694_100337324 | 256 |
| 1060 | 3300025925 | Ga0207650_10000283 | Ga0207650_1000028328 | 256 |
| 1061 | 3300025926 | Ga0207659_10000996 | Ga0207659_1000099627 | 256 |
| 1062 | 3300025927 | Ga0207687_10007299 | Ga0207687_100072994 | 256 |
| 1063 | 3300025931 | Ga0207644_10020458 | Ga0207644_100204584 | 256 |
| 1064 | 3300025932 | Ga0207690_10002489 | Ga0207690_1000248920 | 256 |
| 1065 | 3300025933 | Ga0207706_10000365 | Ga0207706_1000036536 | 256 |
| 1066 | 3300025936 | Ga0207670_10000186 | Ga0207670_1000018635 | 256 |
| 1067 | 3300025938 | Ga0207704_10000310 | Ga0207704_1000031027 | 256 |
| 1068 | 3300025940 | Ga0207691_10000341 | Ga0207691_1000034123 | 256 |
| 1069 | 3300025941 | Ga0207711_10003067 | Ga0207711_1000306724 | 256 |
| 1070 | 3300025942 | Ga0207689_10000224 | Ga0207689_1000022435 | 256 |
| 1071 | 3300025944 | Ga0207661_10005036 | Ga0207661_100050367 | 256 |
| 1072 | 3300025945 | Ga0207679_10000998 | Ga0207679_1000099814 | 256 |
| 1073 | 3300025945 | Ga0207679_10001873 | Ga0207679_1000187321 | 256 |
| 1074 | 3300025960 | Ga0207651_10000056 | Ga0207651_1000005635 | 256 |
| 1075 | 3300025972 | Ga0207668_10014382 | Ga0207668_100143826 | 256 |
| 1076 | 3300025981 | Ga0207640_10001784 | Ga0207640_1000178413 | 256 |
| 1077 | 3300025986 | Ga0207658_10000630 | Ga0207658_1000063025 | 256 |
| 1078 | 3300026023 | Ga0207677_10000047 | Ga0207677_1000004776 | 256 |
| 1079 | 3300026035 | Ga0207703_10000494 | Ga0207703_100004944 | 256 |
| 1080 | 3300026041 | Ga0207639_10000846 | Ga0207639_1000084622 | 256 |
| 1081 | 3300026067 | Ga0207678_10009274 | Ga0207678_1000927412 | 256 |
| 1082 | 3300026075 | Ga0207708_10337013 | Ga0207708_103370131 | 256 |
| 1083 | 3300026078 | Ga0207702_10005139 | Ga0207702_100051394 | 256 |
| 1084 | 3300026088 | Ga0207641_10000554 | Ga0207641_1000055411 | 256 |
| 1085 | 3300026089 | Ga0207648_10002554 | Ga0207648_1000255413 | 256 |
| 1086 | 3300026095 | Ga0207676_10001365 | Ga0207676_1000136520 | 256 |
| 1087 | 3300026116 | Ga0207674_10021388 | Ga0207674_100213884 | 256 |
| 1088 | 3300026116 | Ga0207674_10032281 | Ga0207674_100322816 | 256 |
| 1089 | 3300026118 | Ga0207675_100000009 | Ga0207675_10000000924 | 256 |
| 1090 | 3300026121 | Ga0207683_10010789 | Ga0207683_100107897 | 256 |
| 1091 | 3300026142 | Ga0207698_10002960 | Ga0207698_1000296014 | 256 |
| 1092 | 3300028379 | Ga0268266_10001917 | Ga0268266_1000191714 | 256 |
| 1093 | 3300028381 | Ga0268264_10005545 | Ga0268264_100055454 | 256 |
| 1094 | 3300042876 | Ga0451577_0150505 | Ga0451577_0150505_399_1172 | 256 |
| 1095 | 3300045051 | Ga0451576_0050576 | Ga0451576_0050576_1134_1907 | 256 |
| 1096 | 3300046683 | Ga0495658_0029349 | Ga0495658_0029349_1060_1830 | 256 |
| 1097 | 3300048905 | Ga0496102_0092046 | Ga0496102_0092046_686_1456 | 256 |
| 1098 | 3300048906 | Ga0496103_0028809 | Ga0496103_0028809_1301_2071 | 256 |
| 1099 | 3300048912 | Ga0496109_0006179 | Ga0496109_0006179_6971_7741 | 256 |
| 1100 | 3300048915 | Ga0496112_0002572 | Ga0496112_0002572_3138_3908 | 256 |
| 1101 | 3300048916 | Ga0496113_0109304 | Ga0496113_0109304_544_1314 | 256 |
| 1102 | 3300061734 | Ga0530510_0015081 | Ga0530510_0015081_373_1179 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o0x-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution | 0.9911 | 2 | 249 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9845 | 2 | 248 |
| 1o0x-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution | 0.9832 | 2 | 249 |
| 5yoi-assembly1.cif.gz_A | mycobacterium tuberculosis methionine aminopeptidase type 1c (c105t mutant) in complex with methionine | 0.979 | 5 | 249 |
| 5yoh-assembly1.cif.gz_A | mycobacterium tuberculosis methionine aminopeptidase type 1c (c105m mutant) in complex with methionine | 0.9789 | 5 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1o0xA00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9911 | 2 | 249 | 3.90.230.10 |
| 1o0xA00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9832 | 2 | 249 | 3.90.230.10 |
| af_Q6Z3V9_1_121_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9826 | 15 | 125 | 3.90.230.10 |
| af_Q4VBS4_53_336_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9814 | 2 | 251 | 3.90.230.10 |
| af_P9WK19_6_284_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9806 | 5 | 248 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1ELN7-F1-model_v4 | M24 family metallopeptidase | 0.9986 | 125 | 249 |
GO:0005829
GO:0070006 |
| AF-A0A1F9XM49-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9973 | 2 | 249 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A534Y610-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9972 | 1 | 249 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A2N1UPX4-F1-model_v4 | Methionine aminopeptidase (EC 3.4.11.18) | 0.997 | 2 | 203 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-K1Z9M1-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9959 | 5 | 248 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar