F490093

General Info

Members Datasets Scaffolds Average Seq Length
1102 378 1101 254

Family's Representative Sequence

Representative Sequence 3300059423|Ga0590074_001275|Ga0590074_001275_686_1471
Length 261
Sequence VIVCRSQAEVEKLRRVNQLVARILAELRAMVAPGVTTQQIDELAERRVREAGAVPAFKGYHGYPATVCASVNEQVVHGIPSKRRLVDGDVLSIDIGAQLDGFFGDSAVTVPVGTVAPQAAQLLKVTEEALFHGIEAVKPGARVSDIGAAVQRHVEAYGFSVVREFVGHGIGTSLHEEPQIANYGPGGRGPRLAEGMVLAIEPMVNLGKAAVKVLGDGWTAVTRDGSLSAHFEHTVVVTSDGCEILTLLGHQAAKATMVAHS

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
203 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
204 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
205 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
213 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
226 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
227 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
240 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
241 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
242 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
243 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
269 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
276 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
282 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
283 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
289 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
292 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
293 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
294 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
295 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
296 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
297 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
310 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
311 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
312 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
313 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
314 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
315 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
316 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
317 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
318 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
319 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
336 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
350 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
353 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
354 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
370 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
373 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
374 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
375 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
376 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
377 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
378 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.36
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 4.17
Rhizosphere 94.74
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10023592 3300002239 Bacteria 977
2 JGI24751J29686_10025647 3300002459 Bacteria 1223
3 JGI25404J52841_10004671 3300003659 Bacteria 2792
4 Ga0058862_12783239 3300004803 Bacteria 2387
5 Ga0065712_10010472 3300005290 Bacteria 2496
6 Ga0065712_10071314 3300005290 Bacteria 5345
7 Ga0065715_10094515 3300005293 Bacteria 4316
8 Ga0065707_10005887 3300005295 Bacteria 3199
9 Ga0065707_10167480 3300005295 Bacteria 1507
10 Ga0070658_10000766 3300005327 Bacteria 27565
11 Ga0070658_10001004 3300005327 Bacteria 24213
12 Ga0070658_10070625 3300005327 Bacteria 2859
13 Ga0070658_10103382 3300005327 Bacteria 2356
14 Ga0070658_10169859 3300005327 Bacteria 1832
15 Ga0070658_10239990 3300005327 Bacteria 1536
16 Ga0070658_10615310 3300005327 Bacteria 942
17 Ga0070676_10000510 3300005328 Bacteria 18623
18 Ga0070676_10078880 3300005328 Bacteria 1993
19 Ga0070683_100017258 3300005329 Bacteria 6378
20 Ga0070683_100048913 3300005329 Bacteria 3909
21 Ga0070683_100116656 3300005329 Bacteria 2521
22 Ga0070683_100139567 3300005329 Bacteria 2296
23 Ga0070690_100000366 3300005330 Bacteria 23062
24 Ga0070690_100006534 3300005330 Bacteria 6617
25 Ga0070670_100047369 3300005331 Bacteria 3699
26 Ga0070670_100345458 3300005331 Bacteria 1306
27 Ga0068869_100002833 3300005334 Bacteria 10512
28 Ga0068869_100175092 3300005334 Bacteria 1678
29 Ga0068869_100410718 3300005334 Bacteria 1115
30 Ga0070666_10007809 3300005335 Bacteria 6607
31 Ga0070666_10021119 3300005335 Bacteria 4218
32 Ga0070666_10069715 3300005335 Bacteria 2391
33 Ga0070666_10236804 3300005335 Bacteria 1290
34 Ga0070666_10382760 3300005335 Bacteria 1010
35 Ga0070680_100014163 3300005336 Bacteria 6229
36 Ga0070680_100075087 3300005336 Bacteria 2783
37 Ga0070680_100181162 3300005336 Bacteria 1774
38 Ga0068868_100002098 3300005338 Bacteria 13728
39 Ga0068868_100181756 3300005338 Bacteria 1745
40 Ga0068868_100227577 3300005338 Bacteria 1563
41 Ga0068868_100645934 3300005338 Bacteria 942
42 Ga0070660_100002987 3300005339 Bacteria 11642
43 Ga0070660_100009153 3300005339 Bacteria 6952
44 Ga0070660_100027583 3300005339 Bacteria 4239
45 Ga0070660_100075797 3300005339 Bacteria 2634
46 Ga0070660_100211410 3300005339 Bacteria 1575
47 Ga0070689_100001862 3300005340 Bacteria 13594
48 Ga0070689_100043206 3300005340 Bacteria 3463
49 Ga0070689_100064561 3300005340 Bacteria 2850
50 Ga0070689_100112365 3300005340 Bacteria 2168
51 Ga0070691_10004188 3300005341 Bacteria 6554
52 Ga0070687_100000205 3300005343 Bacteria 20626
53 Ga0070687_100030822 3300005343 Bacteria 2625
54 Ga0070661_100009522 3300005344 Bacteria 6731
55 Ga0070661_100085265 3300005344 Bacteria 2334
56 Ga0070661_100677188 3300005344 Bacteria 839
57 Ga0070692_10001681 3300005345 Bacteria 8190
58 Ga0070692_10038405 3300005345 Bacteria 2440
59 Ga0070668_100001206 3300005347 Bacteria 18356
60 Ga0070668_100054493 3300005347 Bacteria 3084
61 Ga0070668_100188378 3300005347 Bacteria 1689
62 Ga0070668_100206939 3300005347 Bacteria 1612
63 Ga0070668_100547736 3300005347 Bacteria 1007
64 Ga0070669_100035389 3300005353 Bacteria 3617
65 Ga0070669_100051867 3300005353 Bacteria 2999
66 Ga0070669_100178091 3300005353 Bacteria 1662
67 Ga0070675_100000056 3300005354 Bacteria 66985
68 Ga0070675_100002314 3300005354 Bacteria 14155
69 Ga0070675_100224737 3300005354 Bacteria 1636
70 Ga0070671_100001676 3300005355 Bacteria 16774
71 Ga0070671_100005888 3300005355 Bacteria 9769
72 Ga0070671_100031409 3300005355 Bacteria 4387
73 Ga0070671_100141666 3300005355 Bacteria 2029
74 Ga0070671_100207169 3300005355 Bacteria 1663
75 Ga0070674_100000202 3300005356 Bacteria 28786
76 Ga0070674_100008546 3300005356 Bacteria 6104
77 Ga0070674_100219684 3300005356 Bacteria 1478
78 Ga0070673_100003427 3300005364 Bacteria 9877
79 Ga0070673_100005301 3300005364 Bacteria 8239
80 Ga0070673_100176401 3300005364 Bacteria 1827
81 Ga0070673_100197094 3300005364 Bacteria 1733
82 Ga0070688_100000519 3300005365 Bacteria 19443
83 Ga0070688_100070904 3300005365 Bacteria 2229
84 Ga0070688_100132643 3300005365 Bacteria 1683
85 Ga0070659_100000088 3300005366 Bacteria 69112
86 Ga0070659_100001021 3300005366 Bacteria 20542
87 Ga0070659_100059884 3300005366 Bacteria 3007
88 Ga0070659_100064943 3300005366 Bacteria 2890
89 Ga0070659_100149861 3300005366 Bacteria 1902
90 Ga0070667_100315003 3300005367 Bacteria 1411
91 Ga0070714_100101561 3300005435 Bacteria 2535
92 Ga0070714_100315339 3300005435 Bacteria 1461
93 Ga0070714_100492224 3300005435 Bacteria 1168
94 Ga0070713_100025501 3300005436 Bacteria 4622
95 Ga0070701_10065697 3300005438 Bacteria 1926
96 Ga0070701_10100710 3300005438 Bacteria 1600
97 Ga0070701_10194700 3300005438 Bacteria 1195
98 Ga0070705_100000543 3300005440 Bacteria 21853
99 Ga0070705_100121105 3300005440 Bacteria 1690
100 Ga0070700_100028280 3300005441 Bacteria 3332
101 Ga0070700_100071314 3300005441 Bacteria 2218
102 Ga0070700_100185954 3300005441 Bacteria 1449
103 Ga0070700_100563804 3300005441 Bacteria 887
104 Ga0070694_100338305 3300005444 Bacteria 1163
105 Ga0070708_100074375 3300005445 Bacteria 3064
106 Ga0070708_100100566 3300005445 Bacteria 2647
107 Ga0070708_100236502 3300005445 Bacteria 1714
108 Ga0070663_100021838 3300005455 Bacteria 4264
109 Ga0070663_100067372 3300005455 Bacteria 2596
110 Ga0070663_100169091 3300005455 Bacteria 1688
111 Ga0070663_100213585 3300005455 Bacteria 1512
112 Ga0070678_100004288 3300005456 Bacteria 8062
113 Ga0070678_100066041 3300005456 Bacteria 2688
114 Ga0070678_100193215 3300005456 Bacteria 1675
115 Ga0070662_100524581 3300005457 Bacteria 990
116 Ga0070681_10045035 3300005458 Bacteria 4416
117 Ga0070681_10047185 3300005458 Bacteria 4306
118 Ga0070681_10258473 3300005458 Bacteria 1653
119 Ga0068867_100178546 3300005459 Bacteria 1687
120 Ga0070685_10000717 3300005466 Bacteria 18012
121 Ga0070685_10261157 3300005466 Bacteria 1152
122 Ga0070706_100014444 3300005467 Bacteria 7294
123 Ga0070706_100386616 3300005467 Bacteria 1303
124 Ga0070707_100000221 3300005468 Bacteria 57035
125 Ga0070707_100012972 3300005468 Bacteria 7786
126 Ga0070707_100272326 3300005468 Bacteria 1646
127 Ga0070707_100337037 3300005468 Bacteria 1465
128 Ga0070698_100003045 3300005471 Bacteria 18470
129 Ga0070698_100015478 3300005471 Bacteria 8057
130 Ga0070698_100034124 3300005471 Bacteria 5270
131 Ga0070698_100040017 3300005471 Bacteria 4820
132 Ga0070698_100260579 3300005471 Bacteria 1666
133 Ga0070698_100324402 3300005471 Bacteria 1471
134 Ga0070698_100348933 3300005471 Bacteria 1411
135 Ga0070699_100004496 3300005518 Bacteria 12337
136 Ga0070699_100006991 3300005518 Bacteria 9807
137 Ga0070699_100200625 3300005518 Bacteria 1774
138 Ga0070699_100333055 3300005518 Bacteria 1366
139 Ga0070679_100044653 3300005530 Bacteria 4415
140 Ga0070679_100056981 3300005530 Bacteria 3894
141 Ga0070679_100124874 3300005530 Bacteria 2557
142 Ga0070679_100129389 3300005530 Bacteria 2506
143 Ga0070679_100136540 3300005530 Bacteria 2433
144 Ga0070679_100171866 3300005530 Bacteria 2140
145 Ga0070679_100312644 3300005530 Bacteria 1520
146 Ga0070684_100078274 3300005535 Bacteria 2921
147 Ga0070684_100192829 3300005535 Bacteria 1854
148 Ga0070684_100194820 3300005535 Bacteria 1845
149 Ga0070697_100059883 3300005536 Bacteria 3102
150 Ga0070697_100111457 3300005536 Bacteria 2281
151 Ga0070697_100386456 3300005536 Bacteria 1213
152 Ga0068853_100000054 3300005539 Bacteria 80837
153 Ga0068853_100000347 3300005539 Bacteria 32301
154 Ga0070672_100000351 3300005543 Bacteria 26640
155 Ga0070672_100150676 3300005543 Bacteria 1924
156 Ga0070672_100306641 3300005543 Bacteria 1347
157 Ga0070672_100549363 3300005543 Bacteria 1003
158 Ga0070686_100000914 3300005544 Bacteria 17078
159 Ga0070686_100002243 3300005544 Bacteria 10661
160 Ga0070686_100095531 3300005544 Bacteria 1997
161 Ga0070695_100003541 3300005545 Bacteria 9119
162 Ga0070695_100034315 3300005545 Bacteria 3180
163 Ga0070695_100230632 3300005545 Bacteria 1338
164 Ga0070696_100118842 3300005546 Bacteria 1911
165 Ga0070696_100130833 3300005546 Bacteria 1826
166 Ga0070693_100041481 3300005547 Bacteria 2589
167 Ga0070665_100004733 3300005548 Bacteria 14164
168 Ga0070665_100005447 3300005548 Bacteria 13122
169 Ga0070665_100008632 3300005548 Bacteria 10311
170 Ga0070665_100010437 3300005548 Bacteria 9398
171 Ga0070665_100039128 3300005548 Bacteria 4769
172 Ga0070704_100019087 3300005549 Bacteria 4400
173 Ga0070704_100176447 3300005549 Bacteria 1705
174 Ga0070704_100365659 3300005549 Bacteria 1222
175 Ga0068855_100000527 3300005563 Bacteria 46819
176 Ga0068855_100000913 3300005563 Bacteria 36693
177 Ga0068855_100003825 3300005563 Bacteria 18405
178 Ga0068855_100012883 3300005563 Bacteria 10089
179 Ga0068855_100019504 3300005563 Bacteria 8149
180 Ga0068855_100035485 3300005563 Bacteria 5939
181 Ga0068855_100041514 3300005563 Bacteria 5452
182 Ga0068855_100232692 3300005563 Bacteria 2062
183 Ga0070664_100008108 3300005564 Bacteria 8491
184 Ga0070664_100016133 3300005564 Bacteria 6122
185 Ga0070664_100080024 3300005564 Bacteria 2814
186 Ga0070664_100349949 3300005564 Bacteria 1344
187 Ga0068857_100002221 3300005577 Bacteria 15818
188 Ga0068857_100005689 3300005577 Bacteria 10657
189 Ga0068857_100024303 3300005577 Bacteria 5332
190 Ga0068857_100247318 3300005577 Bacteria 1634
191 Ga0068854_100000137 3300005578 Bacteria 50696
192 Ga0068854_100000245 3300005578 Bacteria 36812
193 Ga0068854_100071487 3300005578 Bacteria 2538
194 Ga0068854_100215853 3300005578 Bacteria 1515
195 Ga0068856_100018557 3300005614 Bacteria 6740
196 Ga0068856_100022481 3300005614 Bacteria 6131
197 Ga0068856_100296549 3300005614 Bacteria 1634
198 Ga0068856_100307374 3300005614 Bacteria 1603
199 Ga0068856_100507566 3300005614 Bacteria 1227
200 Ga0070702_100002883 3300005615 Bacteria 7557
201 Ga0070702_100034939 3300005615 Bacteria 2774
202 Ga0070702_100370516 3300005615 Bacteria 1015
203 Ga0068852_100001092 3300005616 Bacteria 17912
204 Ga0068852_100039624 3300005616 Bacteria 3968
205 Ga0068852_100179574 3300005616 Bacteria 1989
206 Ga0068859_100000315 3300005617 Bacteria 48378
207 Ga0068859_100004442 3300005617 Bacteria 14311
208 Ga0068859_100026110 3300005617 Bacteria 5859
209 Ga0068859_100225844 3300005617 Bacteria 1960
210 Ga0068859_100260452 3300005617 Bacteria 1825
211 Ga0068859_100315560 3300005617 Bacteria 1657
212 Ga0068864_100000998 3300005618 Bacteria 23675
213 Ga0068864_100063762 3300005618 Bacteria 3194
214 Ga0068864_100098788 3300005618 Bacteria 2586
215 Ga0068864_100192620 3300005618 Bacteria 1870
216 Ga0068864_100399043 3300005618 Bacteria 1306
217 Ga0068866_10000101 3300005718 Bacteria 36354
218 Ga0068866_10024804 3300005718 Bacteria 2811
219 Ga0068866_10029954 3300005718 Bacteria 2607
220 Ga0068866_10126540 3300005718 Bacteria 1447
221 Ga0068866_10274385 3300005718 Bacteria 1042
222 Ga0068861_100006034 3300005719 Bacteria 8239
223 Ga0068861_100036380 3300005719 Bacteria 3653
224 Ga0068861_100067590 3300005719 Bacteria 2759
225 Ga0068861_100196107 3300005719 Bacteria 1692
226 Ga0068851_10000245 3300005834 Bacteria 25653
227 Ga0068851_10008832 3300005834 Bacteria 4671
228 Ga0068870_10000036 3300005840 Bacteria 42809
229 Ga0068863_100000343 3300005841 Bacteria 47460
230 Ga0068863_100036062 3300005841 Bacteria 4709
231 Ga0068863_100098324 3300005841 Bacteria 2779
232 Ga0068858_100001254 3300005842 Bacteria 26256
233 Ga0068858_100008638 3300005842 Bacteria 9781
234 Ga0068858_100036297 3300005842 Bacteria 4570
235 Ga0068858_100113223 3300005842 Bacteria 2534
236 Ga0068858_100373013 3300005842 Bacteria 1369
237 Ga0068858_100435265 3300005842 Bacteria 1262
238 Ga0068860_100166724 3300005843 Bacteria 2127
239 Ga0068860_100204933 3300005843 Bacteria 1912
240 Ga0068860_100205882 3300005843 Bacteria 1908
241 Ga0068860_100361999 3300005843 Bacteria 1429
242 Ga0068860_100563070 3300005843 Bacteria 1143
243 Ga0068862_100021021 3300005844 Bacteria 5453
244 Ga0068862_100051237 3300005844 Bacteria 3530
245 Ga0068862_100126963 3300005844 Bacteria 2253
246 Ga0068862_100187532 3300005844 Bacteria 1859
247 Ga0068862_100366282 3300005844 Bacteria 1340
248 Ga0081455_10025866 3300005937 Bacteria 5409
249 Ga0081538_10028271 3300005981 Bacteria 3861
250 Ga0081540_1000264 3300005983 Bacteria 55128
251 Ga0081540_1009729 3300005983 Bacteria 6593
252 Ga0081540_1010957 3300005983 Bacteria 6089
253 Ga0097621_100000177 3300006237 Bacteria 40430
254 Ga0097621_100006061 3300006237 Bacteria 8549
255 Ga0097621_100015176 3300006237 Bacteria 5787
256 Ga0097621_100020231 3300006237 Bacteria 5126
257 Ga0097621_100211650 3300006237 Bacteria 1686
258 Ga0097621_100464583 3300006237 Bacteria 1142
259 Ga0097621_100503003 3300006237 Bacteria 1098
260 Ga0097621_100731126 3300006237 Bacteria 913
261 Ga0068871_100001728 3300006358 Bacteria 14706
262 Ga0068871_100006055 3300006358 Bacteria 8509
263 Ga0068871_100006948 3300006358 Bacteria 8062
264 Ga0068871_100061643 3300006358 Bacteria 3064
265 Ga0068871_100088164 3300006358 Bacteria 2581
266 Ga0068871_100286689 3300006358 Bacteria 1442
267 Ga0075428_100000009 3300006844 Bacteria 266370
268 Ga0075428_100055934 3300006844 Bacteria 4322
269 Ga0075428_100413009 3300006844 Bacteria 1446
270 Ga0075430_100370608 3300006846 Unclassified 1182
271 Ga0075431_100167049 3300006847 Bacteria 2262
272 Ga0075431_100173239 3300006847 Bacteria 2217
273 Ga0075433_10052805 3300006852 Bacteria 3542
274 Ga0075433_10114798 3300006852 Bacteria 2389
275 Ga0075434_100007963 3300006871 Bacteria 9823
276 Ga0075434_100123476 3300006871 Bacteria 2605
277 Ga0075434_100128953 3300006871 Bacteria 2547
278 Ga0075434_100146743 3300006871 Bacteria 2379
279 Ga0075434_100183729 3300006871 Bacteria 2112
280 Ga0075434_100214894 3300006871 Bacteria 1943
281 Ga0075434_100240424 3300006871 Bacteria 1830
282 Ga0075429_100087511 3300006880 Bacteria 2715
283 Ga0068865_100015593 3300006881 Bacteria 4848
284 Ga0068865_100152892 3300006881 Bacteria 1752
285 Ga0075436_100006359 3300006914 Bacteria 8095
286 Ga0075436_100014321 3300006914 Bacteria 5430
287 Ga0075436_100019702 3300006914 Bacteria 4625
288 Ga0075436_100020847 3300006914 Bacteria 4496
289 Ga0075436_100028497 3300006914 Bacteria 3842
290 Ga0075436_100049304 3300006914 Bacteria 2905
291 Ga0075436_100058745 3300006914 Bacteria 2656
292 Ga0075436_100108712 3300006914 Bacteria 1934
293 Ga0075436_100109094 3300006914 Bacteria 1931
294 Ga0097620_100000315 3300006931 Bacteria 48378
295 Ga0097620_100004442 3300006931 Bacteria 14311
296 Ga0097620_100026110 3300006931 Bacteria 5859
297 Ga0097620_100225847 3300006931 Bacteria 1960
298 Ga0097620_100260449 3300006931 Bacteria 1825
299 Ga0097620_100315544 3300006931 Bacteria 1657
300 Ga0075435_100001542 3300007076 Bacteria 14846
301 Ga0075435_100001694 3300007076 Bacteria 14328
302 Ga0075435_100004862 3300007076 Bacteria 9304
303 Ga0075435_100008444 3300007076 Bacteria 7390
304 Ga0075435_100021902 3300007076 Bacteria 4925
305 Ga0075435_100070719 3300007076 Bacteria 2848
306 Ga0075435_100072955 3300007076 Bacteria 2805
307 Ga0075435_100083105 3300007076 Bacteria 2632
308 Ga0099794_10061435 3300007265 Bacteria 1826
309 Ga0105240_10000001 3300009093 Bacteria 2887840
310 Ga0105240_10001604 3300009093 Bacteria 38373
311 Ga0105240_10012027 3300009093 Bacteria 11997
312 Ga0105240_10012782 3300009093 Bacteria 11567
313 Ga0105240_10077161 3300009093 Bacteria 4106
314 Ga0105240_10114294 3300009093 Bacteria 3261
315 Ga0105240_10224743 3300009093 Bacteria 2185
316 Ga0105240_10297529 3300009093 Bacteria 1847
317 Ga0105240_10393217 3300009093 Bacteria 1563
318 Ga0111539_10000010 3300009094 Bacteria 366246
319 Ga0111539_10000566 3300009094 Bacteria 47366
320 Ga0111539_10005584 3300009094 Bacteria 16267
321 Ga0111539_10380566 3300009094 Bacteria 1643
322 Ga0111539_10541437 3300009094 Bacteria 1356
323 Ga0105245_10000166 3300009098 Bacteria 62554
324 Ga0105245_10026276 3300009098 Bacteria 5123
325 Ga0105247_10001356 3300009101 Bacteria 17787
326 Ga0105247_10028592 3300009101 Bacteria 3374
327 Ga0114129_10004861 3300009147 Bacteria 18961
328 Ga0114129_10033059 3300009147 Bacteria 7309
329 Ga0114129_10060820 3300009147 Bacteria 5280
330 Ga0114129_10078194 3300009147 Bacteria 4602
331 Ga0114129_10081911 3300009147 Bacteria 4485
332 Ga0114129_10106586 3300009147 Bacteria 3871
333 Ga0114129_10294188 3300009147 Bacteria 2166
334 Ga0105243_10071634 3300009148 Bacteria 2803
335 Ga0105241_10001205 3300009174 Bacteria 19748
336 Ga0105241_10087967 3300009174 Bacteria 2446
337 Ga0105241_10484016 3300009174 Bacteria 1100
338 Ga0105242_10003060 3300009176 Bacteria 13071
339 Ga0105242_10060486 3300009176 Bacteria 3113
340 Ga0105242_10465875 3300009176 Bacteria 1194
341 Ga0105248_10006569 3300009177 Bacteria 12749
342 Ga0105248_10012842 3300009177 Bacteria 9238
343 Ga0105248_10013460 3300009177 Bacteria 9007
344 Ga0105248_10019507 3300009177 Bacteria 7503
345 Ga0105248_10089526 3300009177 Bacteria 3464
346 Ga0105248_10094826 3300009177 Bacteria 3360
347 Ga0105248_10135047 3300009177 Bacteria 2783
348 Ga0105248_10169500 3300009177 Bacteria 2461
349 Ga0105248_10371694 3300009177 Bacteria 1609
350 Ga0105248_10428740 3300009177 Bacteria 1489
351 Ga0105248_10564353 3300009177 Bacteria 1284
352 Ga0105237_10001703 3300009545 Bacteria 28456
353 Ga0105237_10004977 3300009545 Bacteria 15150
354 Ga0105238_10000391 3300009551 Bacteria 46771
355 Ga0105238_10008485 3300009551 Bacteria 10286
356 Ga0105238_10070590 3300009551 Bacteria 3491
357 Ga0105238_10101639 3300009551 Bacteria 2857
358 Ga0105238_10146657 3300009551 Bacteria 2336
359 Ga0105238_10184047 3300009551 Bacteria 2066
360 Ga0105238_10360448 3300009551 Bacteria 1443
361 Ga0105249_10000319 3300009553 Bacteria 48708
362 Ga0105249_10233757 3300009553 Bacteria 1814
363 Ga0105249_10261220 3300009553 Bacteria 1721
364 Ga0105249_10483952 3300009553 Bacteria 1281
365 Ga0105239_10000707 3300010375 Bacteria 47294
366 Ga0105239_10111134 3300010375 Bacteria 3037
367 Ga0105239_10198030 3300010375 Bacteria 2250
368 Ga0105246_10000493 3300011119 Bacteria 21438
369 Ga0105246_10048926 3300011119 Bacteria 2892
370 Ga0157373_10025268 3300013100 Bacteria 4298
371 Ga0157371_10000492 3300013102 Bacteria 47893
372 Ga0157371_10260778 3300013102 Bacteria 1249
373 Ga0157371_10562805 3300013102 Unclassified 846
374 Ga0157370_10011397 3300013104 Bacteria 9301
375 Ga0157370_10017703 3300013104 Bacteria 7183
376 Ga0157370_10017947 3300013104 Bacteria 7125
377 Ga0157370_10018903 3300013104 Bacteria 6929
378 Ga0157370_10035941 3300013104 Bacteria 4811
379 Ga0157370_10204238 3300013104 Bacteria 1832
380 Ga0157369_10004814 3300013105 Bacteria 15850
381 Ga0157369_10019707 3300013105 Bacteria 7549
382 Ga0157369_10025443 3300013105 Bacteria 6573
383 Ga0157369_10036798 3300013105 Bacteria 5361
384 Ga0157369_10069128 3300013105 Bacteria 3794
385 Ga0157369_10099587 3300013105 Bacteria 3098
386 Ga0157369_10156301 3300013105 Bacteria 2409
387 Ga0157369_10405426 3300013105 Bacteria 1414
388 Ga0157374_10001527 3300013296 Bacteria 19489
389 Ga0157374_10016453 3300013296 Bacteria 6502
390 Ga0157374_10054566 3300013296 Bacteria 3728
391 Ga0157374_10064149 3300013296 Bacteria 3446
392 Ga0157374_10066771 3300013296 Bacteria 3380
393 Ga0157374_10095902 3300013296 Bacteria 2837
394 Ga0157374_10293282 3300013296 Bacteria 1608
395 Ga0157378_10000975 3300013297 Bacteria 26209
396 Ga0157378_10083535 3300013297 Bacteria 2890
397 Ga0157378_10250405 3300013297 Bacteria 1696
398 Ga0163162_10001548 3300013306 Bacteria 21476
399 Ga0163162_10023636 3300013306 Bacteria 6068
400 Ga0163162_10071217 3300013306 Bacteria 3529
401 Ga0163162_10258213 3300013306 Bacteria 1874
402 Ga0157372_10002029 3300013307 Bacteria 22018
403 Ga0157372_10006518 3300013307 Bacteria 12426
404 Ga0157372_10019768 3300013307 Bacteria 7258
405 Ga0157372_10026761 3300013307 Bacteria 6278
406 Ga0157372_10096890 3300013307 Bacteria 3363
407 Ga0157372_10177561 3300013307 Bacteria 2465
408 Ga0157372_10345978 3300013307 Bacteria 1732
409 Ga0157372_10520950 3300013307 Bacteria 1386
410 Ga0157375_10059650 3300013308 Bacteria 3781
411 Ga0157375_10185394 3300013308 Bacteria 2234
412 Ga0157375_10544408 3300013308 Bacteria 1323
413 Ga0157375_11026482 3300013308 Bacteria 963
414 Ga0163163_10001027 3300014325 Bacteria 23654
415 Ga0163163_10039817 3300014325 Bacteria 4588
416 Ga0163163_10058152 3300014325 Bacteria 3823
417 Ga0163163_10064535 3300014325 Bacteria 3633
418 Ga0163163_10070157 3300014325 Bacteria 3489
419 Ga0163163_10146285 3300014325 Bacteria 2407
420 Ga0163163_10319719 3300014325 Bacteria 1606
421 Ga0157380_10052717 3300014326 Bacteria 3222
422 Ga0157380_10186521 3300014326 Bacteria 1827
423 Ga0157377_10000364 3300014745 Bacteria 20226
424 Ga0157377_10078424 3300014745 Bacteria 1925
425 Ga0157377_10146525 3300014745 Bacteria 1456
426 Ga0157379_10000136 3300014968 Bacteria 52716
427 Ga0157379_10082081 3300014968 Bacteria 2888
428 Ga0157379_10144530 3300014968 Bacteria 2145
429 Ga0157376_10000282 3300014969 Bacteria 34358
430 Ga0157376_10019471 3300014969 Bacteria 5233
431 Ga0157376_10030126 3300014969 Bacteria 4329
432 Ga0157376_10042534 3300014969 Bacteria 3724
433 Ga0157376_10045847 3300014969 Bacteria 3602
434 Ga0157376_10068436 3300014969 Bacteria 3007
435 Ga0157376_10136940 3300014969 Bacteria 2192
436 Ga0157376_10158816 3300014969 Bacteria 2047
437 Ga0157376_10207123 3300014969 Bacteria 1808
438 Ga0157376_10235850 3300014969 Bacteria 1702
439 Ga0157376_10243650 3300014969 Bacteria 1676
440 Ga0157376_10258253 3300014969 Unclassified 1631
441 Ga0157376_10576190 3300014969 Bacteria 1117
442 Ga0157376_10629810 3300014969 Bacteria 1071
443 Ga0163161_10003977 3300017792 Bacteria 10351
444 Ga0228598_1004988 3300024227 Bacteria 2791
445 Ga0228598_1007435 3300024227 Bacteria 2230
446 Ga0209233_1007528 3300025261 Bacteria 3444
447 Ga0207697_10001780 3300025315 Bacteria 11536
448 Ga0207656_10023292 3300025321 Bacteria 2492
449 Ga0207682_10000392 3300025893 Bacteria 20119
450 Ga0207642_10020722 3300025899 Bacteria 2573
451 Ga0207642_10026880 3300025899 Bacteria 2348
452 Ga0207710_10014776 3300025900 Bacteria 3296
453 Ga0207710_10015930 3300025900 Bacteria 3179
454 Ga0207688_10000089 3300025901 Bacteria 35353
455 Ga0207680_10006153 3300025903 Bacteria 5788
456 Ga0207680_10014898 3300025903 Bacteria 4041
457 Ga0207680_10033225 3300025903 Bacteria 2941
458 Ga0207680_10049998 3300025903 Bacteria 2492
459 Ga0207680_10158383 3300025903 Bacteria 1516
460 Ga0207647_10000810 3300025904 Bacteria 24235
461 Ga0207647_10003459 3300025904 Bacteria 11851
462 Ga0207647_10042476 3300025904 Bacteria 2852
463 Ga0207645_10003099 3300025907 Bacteria 12749
464 Ga0207645_10174320 3300025907 Bacteria 1410
465 Ga0207645_10266741 3300025907 Bacteria 1135
466 Ga0207643_10000030 3300025908 Bacteria 97831
467 Ga0207705_10000048 3300025909 Bacteria 171848
468 Ga0207705_10003131 3300025909 Bacteria 12595
469 Ga0207705_10003420 3300025909 Bacteria 12069
470 Ga0207705_10009158 3300025909 Bacteria 7213
471 Ga0207705_10080739 3300025909 Bacteria 2370
472 Ga0207705_10156854 3300025909 Bacteria 1708
473 Ga0207705_10190806 3300025909 Bacteria 1549
474 Ga0207705_10251566 3300025909 Bacteria 1348
475 Ga0207654_10003953 3300025911 Bacteria 7464
476 Ga0207654_10040688 3300025911 Bacteria 2620
477 Ga0207707_10042746 3300025912 Bacteria 3954
478 Ga0207707_10106078 3300025912 Bacteria 2456
479 Ga0207707_10176404 3300025912 Bacteria 1867
480 Ga0207707_10208335 3300025912 Bacteria 1703
481 Ga0207707_10223257 3300025912 Bacteria 1640
482 Ga0207707_10319707 3300025912 Bacteria 1340
483 Ga0207695_10000001 3300025913 Bacteria 2888630
484 Ga0207695_10000354 3300025913 Bacteria 105275
485 Ga0207695_10071412 3300025913 Bacteria 3546
486 Ga0207695_10236616 3300025913 Bacteria 1729
487 Ga0207695_10345777 3300025913 Bacteria 1375
488 Ga0207695_10523965 3300025913 Bacteria 1067
489 Ga0207671_10002141 3300025914 Bacteria 21552
490 Ga0207663_10501109 3300025916 Bacteria 943
491 Ga0207660_10033197 3300025917 Bacteria 3568
492 Ga0207660_10089871 3300025917 Bacteria 2274
493 Ga0207660_10162028 3300025917 Bacteria 1726
494 Ga0207660_10233607 3300025917 Bacteria 1446
495 Ga0207660_10279115 3300025917 Bacteria 1325
496 Ga0207662_10000128 3300025918 Bacteria 36490
497 Ga0207662_10061436 3300025918 Bacteria 2256
498 Ga0207662_10119494 3300025918 Bacteria 1652
499 Ga0207657_10000011 3300025919 Bacteria 186233
500 Ga0207657_10000823 3300025919 Bacteria 32798
501 Ga0207657_10017050 3300025919 Bacteria 6985
502 Ga0207657_10069052 3300025919 Bacteria 3000
503 Ga0207649_10002988 3300025920 Bacteria 9318
504 Ga0207649_10007381 3300025920 Bacteria 5981
505 Ga0207649_10167624 3300025920 Bacteria 1527
506 Ga0207649_10207470 3300025920 Bacteria 1388
507 Ga0207652_10016976 3300025921 Bacteria 5954
508 Ga0207652_10017745 3300025921 Bacteria 5829
509 Ga0207652_10019825 3300025921 Bacteria 5536
510 Ga0207652_10077073 3300025921 Bacteria 2908
511 Ga0207652_10117046 3300025921 Bacteria 2368
512 Ga0207652_10243248 3300025921 Bacteria 1622
513 Ga0207646_10000037 3300025922 Bacteria 196362
514 Ga0207646_10000343 3300025922 Bacteria 62896
515 Ga0207646_10513079 3300025922 Bacteria 1079
516 Ga0207646_10550266 3300025922 Bacteria 1038
517 Ga0207681_10000822 3300025923 Bacteria 20467
518 Ga0207681_10118269 3300025923 Bacteria 1939
519 Ga0207681_10180816 3300025923 Bacteria 1606
520 Ga0207694_10010372 3300025924 Bacteria 7023
521 Ga0207694_10012007 3300025924 Bacteria 6531
522 Ga0207694_10033732 3300025924 Bacteria 3921
523 Ga0207694_10097950 3300025924 Bacteria 2321
524 Ga0207694_10210222 3300025924 Bacteria 1585
525 Ga0207694_10360249 3300025924 Bacteria 1205
526 Ga0207650_10000283 3300025925 Bacteria 52381
527 Ga0207650_10029449 3300025925 Bacteria 3947
528 Ga0207650_10267387 3300025925 Bacteria 1389
529 Ga0207659_10000996 3300025926 Bacteria 16842
530 Ga0207659_10001213 3300025926 Bacteria 15413
531 Ga0207659_10113563 3300025926 Bacteria 2063
532 Ga0207659_10117776 3300025926 Bacteria 2030
533 Ga0207659_10359411 3300025926 Bacteria 1210
534 Ga0207659_10453394 3300025926 Bacteria 1080
535 Ga0207687_10007299 3300025927 Bacteria 7291
536 Ga0207687_10107619 3300025927 Bacteria 2063
537 Ga0207700_10003657 3300025928 Bacteria 8964
538 Ga0207700_10130792 3300025928 Bacteria 2049
539 Ga0207664_10359771 3300025929 Bacteria 1289
540 Ga0207644_10020458 3300025931 Bacteria 4499
541 Ga0207644_10029897 3300025931 Bacteria 3782
542 Ga0207690_10002489 3300025932 Bacteria 11132
543 Ga0207690_10118262 3300025932 Bacteria 1920
544 Ga0207690_10279237 3300025932 Bacteria 1300
545 Ga0207706_10000365 3300025933 Bacteria 48957
546 Ga0207706_10113218 3300025933 Bacteria 2387
547 Ga0207706_10126975 3300025933 Bacteria 2243
548 Ga0207706_10552701 3300025933 Bacteria 991
549 Ga0207686_10004734 3300025934 Bacteria 7303
550 Ga0207686_10150260 3300025934 Bacteria 1621
551 Ga0207686_10229107 3300025934 Bacteria 1346
552 Ga0207670_10000186 3300025936 Bacteria 41273
553 Ga0207670_10141333 3300025936 Bacteria 1776
554 Ga0207670_10191489 3300025936 Bacteria 1548
555 Ga0207669_10005330 3300025937 Bacteria 5759
556 Ga0207704_10000310 3300025938 Bacteria 22888
557 Ga0207704_10005824 3300025938 Bacteria 5702
558 Ga0207665_10058141 3300025939 Bacteria 2613
559 Ga0207665_10152862 3300025939 Bacteria 1654
560 Ga0207691_10000341 3300025940 Bacteria 46943
561 Ga0207691_10033820 3300025940 Bacteria 4759
562 Ga0207691_10079684 3300025940 Bacteria 2947
563 Ga0207691_10347585 3300025940 Bacteria 1269
564 Ga0207711_10003067 3300025941 Bacteria 14585
565 Ga0207711_10007764 3300025941 Bacteria 8964
566 Ga0207711_10036970 3300025941 Bacteria 4144
567 Ga0207711_10039221 3300025941 Bacteria 4028
568 Ga0207711_10041117 3300025941 Bacteria 3936
569 Ga0207711_10077530 3300025941 Bacteria 2897
570 Ga0207711_10087655 3300025941 Bacteria 2731
571 Ga0207711_10162404 3300025941 Bacteria 2023
572 Ga0207711_10380065 3300025941 Bacteria 1310
573 Ga0207711_10393153 3300025941 Bacteria 1288
574 Ga0207711_10405682 3300025941 Bacteria 1266
575 Ga0207711_10522921 3300025941 Bacteria 1106
576 Ga0207689_10000224 3300025942 Bacteria 50152
577 Ga0207689_10051675 3300025942 Bacteria 3388
578 Ga0207689_10107787 3300025942 Bacteria 2289
579 Ga0207689_10138408 3300025942 Bacteria 2005
580 Ga0207689_10402049 3300025942 Bacteria 1142
581 Ga0207661_10005036 3300025944 Bacteria 9269
582 Ga0207661_10215005 3300025944 Bacteria 1696
583 Ga0207679_10000998 3300025945 Bacteria 18155
584 Ga0207679_10001873 3300025945 Bacteria 13076
585 Ga0207679_10358349 3300025945 Bacteria 1273
586 Ga0207667_10000647 3300025949 Bacteria 45083
587 Ga0207667_10008444 3300025949 Bacteria 12232
588 Ga0207667_10023790 3300025949 Bacteria 6741
589 Ga0207667_10027233 3300025949 Bacteria 6227
590 Ga0207667_10038353 3300025949 Bacteria 5118
591 Ga0207667_10068300 3300025949 Bacteria 3701
592 Ga0207667_10108232 3300025949 Bacteria 2868
593 Ga0207667_10620245 3300025949 Bacteria 1089
594 Ga0207651_10000056 3300025960 Bacteria 49478
595 Ga0207651_10061070 3300025960 Bacteria 2619
596 Ga0207651_10317438 3300025960 Bacteria 1301
597 Ga0207651_10598290 3300025960 Bacteria 964
598 Ga0207668_10014382 3300025972 Bacteria 4896
599 Ga0207668_10017365 3300025972 Bacteria 4508
600 Ga0207640_10000023 3300025981 Bacteria 160979
601 Ga0207640_10001784 3300025981 Bacteria 11559
602 Ga0207640_10017290 3300025981 Bacteria 4218
603 Ga0207658_10000630 3300025986 Bacteria 31077
604 Ga0207658_10283792 3300025986 Bacteria 1420
605 Ga0207677_10000047 3300026023 Bacteria 104149
606 Ga0207677_10076376 3300026023 Bacteria 2385
607 Ga0207677_10136423 3300026023 Bacteria 1871
608 Ga0207677_10544341 3300026023 Bacteria 1011
609 Ga0207703_10000494 3300026035 Bacteria 40942
610 Ga0207703_10012018 3300026035 Bacteria 6743
611 Ga0207703_10032738 3300026035 Bacteria 4115
612 Ga0207703_10067170 3300026035 Bacteria 2951
613 Ga0207639_10000034 3300026041 Bacteria 154355
614 Ga0207639_10000846 3300026041 Bacteria 20822
615 Ga0207639_10087391 3300026041 Bacteria 2485
616 Ga0207639_10175476 3300026041 Bacteria 1819
617 Ga0207678_10001665 3300026067 Bacteria 20379
618 Ga0207678_10009274 3300026067 Bacteria 8658
619 Ga0207708_10057081 3300026075 Bacteria 2978
620 Ga0207708_10071363 3300026075 Bacteria 2660
621 Ga0207708_10100053 3300026075 Bacteria 2243
622 Ga0207708_10337013 3300026075 Bacteria 1234
623 Ga0207702_10005139 3300026078 Bacteria 11514
624 Ga0207641_10000554 3300026088 Bacteria 41888
625 Ga0207641_10001674 3300026088 Bacteria 21561
626 Ga0207641_10007294 3300026088 Bacteria 9214
627 Ga0207641_10187187 3300026088 Bacteria 1900
628 Ga0207641_10281307 3300026088 Bacteria 1565
629 Ga0207648_10002554 3300026089 Bacteria 19510
630 Ga0207648_10038262 3300026089 Bacteria 4222
631 Ga0207648_10096571 3300026089 Bacteria 2586
632 Ga0207648_10135195 3300026089 Bacteria 2172
633 Ga0207648_10190814 3300026089 Bacteria 1816
634 Ga0207676_10001365 3300026095 Bacteria 18169
635 Ga0207676_10047359 3300026095 Bacteria 3331
636 Ga0207676_10076735 3300026095 Bacteria 2701
637 Ga0207676_10363422 3300026095 Bacteria 1342
638 Ga0207674_10000532 3300026116 Bacteria 49916
639 Ga0207674_10021388 3300026116 Bacteria 6967
640 Ga0207674_10032281 3300026116 Bacteria 5494
641 Ga0207674_10184270 3300026116 Bacteria 2038
642 Ga0207674_10209419 3300026116 Bacteria 1899
643 Ga0207674_10301449 3300026116 Bacteria 1551
644 Ga0207674_10327989 3300026116 Bacteria 1480
645 Ga0207674_10431436 3300026116 Bacteria 1274
646 Ga0207675_100000009 3300026118 Bacteria 163023
647 Ga0207675_100017733 3300026118 Bacteria 6641
648 Ga0207675_100075425 3300026118 Bacteria 3157
649 Ga0207675_100082556 3300026118 Bacteria 3014
650 Ga0207675_100121913 3300026118 Bacteria 2468
651 Ga0207675_100273429 3300026118 Bacteria 1640
652 Ga0207683_10010789 3300026121 Bacteria 7791
653 Ga0207683_10032201 3300026121 Bacteria 4554
654 Ga0207683_10037219 3300026121 Bacteria 4237
655 Ga0207683_10080588 3300026121 Bacteria 2888
656 Ga0207683_10240809 3300026121 Bacteria 1650
657 Ga0207683_10350096 3300026121 Bacteria 1356
658 Ga0207683_10393482 3300026121 Bacteria 1274
659 Ga0207698_10002960 3300026142 Bacteria 10169
660 Ga0207428_10000034 3300027907 Bacteria 231306
661 Ga0207428_10045568 3300027907 Bacteria 3531
662 Ga0207428_10070330 3300027907 Bacteria 2751
663 Ga0207428_10110383 3300027907 Bacteria 2118
664 Ga0207428_10111063 3300027907 Bacteria 2110
665 Ga0268266_10001917 3300028379 Bacteria 23380
666 Ga0268266_10005896 3300028379 Bacteria 11335
667 Ga0268266_10007930 3300028379 Bacteria 9500
668 Ga0268266_10029767 3300028379 Bacteria 4639
669 Ga0268266_10398012 3300028379 Bacteria 1302
670 Ga0268265_10183463 3300028380 Bacteria 1800
671 Ga0268265_10196615 3300028380 Bacteria 1745
672 Ga0268265_10626017 3300028380 Bacteria 1032
673 Ga0268264_10005545 3300028381 Bacteria 10695
674 Ga0268264_10111054 3300028381 Bacteria 2401
675 Ga0268264_10145483 3300028381 Bacteria 2119
676 Ga0268264_10234483 3300028381 Bacteria 1696
677 Ga0268264_10656117 3300028381 Bacteria 1039
678 Ga0268264_10732567 3300028381 Bacteria 984
679 Ga0265338_10083576 3300028800 Bacteria 2670
680 Ga0265760_10012291 3300031090 Bacteria 2447
681 Ga0265760_10014127 3300031090 Bacteria 2285
682 Ga0265760_10020278 3300031090 Bacteria 1918
683 Ga0265320_10084511 3300031240 Bacteria 1478
684 Ga0265325_10057154 3300031241 Bacteria 1990
685 Ga0265325_10176116 3300031241 Bacteria 998
686 Ga0265316_10061401 3300031344 Bacteria 2919
687 Ga0265316_10069991 3300031344 Bacteria 2707
688 Ga0265316_10170685 3300031344 Bacteria 1623
689 Ga0307408_100087781 3300031548 Bacteria 2341
690 Ga0307408_100252141 3300031548 Bacteria 1456
691 Ga0265314_10013729 3300031711 Bacteria 6530
692 Ga0307410_10077593 3300031852 Bacteria 2323
693 Ga0307409_100229704 3300031995 Bacteria 1681
694 Ga0307409_100516677 3300031995 Bacteria 1166
695 Ga0307416_100092003 3300032002 Bacteria 2607
696 Ga0307416_100202969 3300032002 Bacteria 1883
697 Ga0307416_100382062 3300032002 Bacteria 1439
698 Ga0307414_10202208 3300032004 Bacteria 1617
699 Ga0307411_10041711 3300032005 Bacteria 2923
700 Ga0307415_100423547 3300032126 Bacteria 1143
701 Ga0307415_100717358 3300032126 Bacteria 904
702 Ga0307510_10118139 3300033180 Bacteria 2366
703 Ga0373950_0016784 3300034818 Bacteria 1255
704 Ga0373959_0000924 3300034820 Bacteria 4951
705 Ga0373938_0017018 3300034957 Bacteria 1427
706 Ga0373926_0070487 3300035083 Bacteria 1284
707 Ga0373928_0003435 3300035084 Bacteria 3015
708 Ga0373929_0000116 3300035085 Bacteria 13311
709 Ga0373934_0105921 3300035086 Bacteria 1138
710 Ga0373940_0000084 3300035088 Bacteria 11367
711 Ga0373944_0029297 3300035089 Bacteria 1645
712 Ga0373949_0019342 3300035090 Bacteria 1550
713 Ga0373952_0027059 3300035092 Bacteria 1249
714 Ga0373952_0037917 3300035092 Bacteria 1102
715 Ga0373952_0060887 3300035092 Bacteria 923
716 Ga0373932_0000807 3300035112 Bacteria 9293
717 Ga0373932_0009460 3300035112 Bacteria 2344
718 Ga0373936_0048513 3300035113 Bacteria 1714
719 Ga0373939_0096860 3300035114 Bacteria 1006
720 Ga0373941_0000161 3300035115 Bacteria 12224
721 Ga0373945_0107256 3300035116 Bacteria 1099
722 Ga0373945_0117583 3300035116 Bacteria 1054
723 Ga0373953_0112914 3300035117 Bacteria 1150
724 Ga0373954_0158733 3300035118 Bacteria 1106
725 Ga0373954_0261659 3300035118 Bacteria 852
726 Ga0373960_0000753 3300035121 Bacteria 6755
727 Ga0373943_0045705 3300035170 Bacteria 2135
728 Ga0373946_0045683 3300035171 Bacteria 1813
729 Ga0373955_0103149 3300035172 Bacteria 1640
730 Ga0373942_0001757 3300035207 Bacteria 5486
731 Ga0373961_0001371 3300035241 Bacteria 7313
732 Ga0373962_0000245 3300035242 Bacteria 11519
733 Ga0373924_0013554 3300035410 Bacteria 3064
734 Ga0373931_0004378 3300035691 Bacteria 6449
735 Ga0373935_0038030 3300035692 Bacteria 3012
736 Ga0373935_0045541 3300035692 Bacteria 2768
737 Ga0373935_0053767 3300035692 Bacteria 2562
738 Ga0373935_0510763 3300035692 Bacteria 873
739 Ga0373927_0117868 3300035695 Bacteria 1732
740 Ga0373947_0040913 3300035725 Bacteria 2762
741 Ga0373937_0029266 3300036401 Bacteria 4988
742 Ga0373937_0103229 3300036401 Bacteria 2648
743 Ga0373937_0120726 3300036401 Bacteria 2442
744 Ga0373937_0202959 3300036401 Bacteria 1864
745 Ga0373937_0274871 3300036401 Bacteria 1590
746 Ga0373937_0554909 3300036401 Bacteria 1091
747 Ga0373925_0005941 3300037068 Bacteria 9044
748 Ga0373925_0046585 3300037068 Bacteria 3225
749 Ga0373925_0173403 3300037068 Bacteria 1703
750 Ga0395905_0001744 3300037471 Bacteria 25404
751 Ga0395905_0007578 3300037471 Bacteria 10786
752 Ga0395905_0014151 3300037471 Bacteria 7623
753 Ga0395905_0033731 3300037471 Bacteria 4808
754 Ga0436364_1357538 3300037853 Bacteria 1887
755 Ga0395901_0728164 3300038443 Bacteria 987
756 Ga0436361_0277179 3300039447 Unclassified 931
757 Ga0436363_1450178 3300039450 Bacteria 1085
758 Ga0450917_003592 3300042120 Bacteria 1124
759 Ga0450891_003545 3300042129 Bacteria 1497
760 Ga0450902_021445 3300042137 Bacteria 1068
761 Ga0439435_0019796 3300042436 Bacteria 1729
762 Ga0451577_0000033 3300042876 Bacteria 378714
763 Ga0451577_0001113 3300042876 Bacteria 38143
764 Ga0451577_0006345 3300042876 Bacteria 11810
765 Ga0451577_0019789 3300042876 Bacteria 6184
766 Ga0451577_0066882 3300042876 Bacteria 3204
767 Ga0451577_0097736 3300042876 Bacteria 2622
768 Ga0451577_0114827 3300042876 Bacteria 2410
769 Ga0451577_0127100 3300042876 Bacteria 2284
770 Ga0451577_0150505 3300042876 Bacteria 2094
771 Ga0451577_0439764 3300042876 Bacteria 1184
772 Ga0453683_0000086 3300044673 Bacteria 139689
773 Ga0453683_0001684 3300044673 Bacteria 18427
774 Ga0453683_0005105 3300044673 Bacteria 9213
775 Ga0453683_0005320 3300044673 Bacteria 8994
776 Ga0453683_0009861 3300044673 Bacteria 6363
777 Ga0453683_0094013 3300044673 Bacteria 1880
778 Ga0453683_0101306 3300044673 Bacteria 1808
779 Ga0453683_0119218 3300044673 Bacteria 1661
780 Ga0466966_0072934 3300044684 Bacteria 2148
781 Ga0466961_0161787 3300044693 Bacteria 1395
782 Ga0466961_0230596 3300044693 Bacteria 1140
783 Ga0466963_0016278 3300044694 Bacteria 4622
784 Ga0466963_0024269 3300044694 Bacteria 3860
785 Ga0466963_0061019 3300044694 Bacteria 2519
786 Ga0466963_0085217 3300044694 Bacteria 2145
787 Ga0466963_0170099 3300044694 Bacteria 1519
788 Ga0453684_0000109 3300044712 Bacteria 361015
789 Ga0453684_0000258 3300044712 Bacteria 228312
790 Ga0453684_0003980 3300044712 Bacteria 32269
791 Ga0453684_0008349 3300044712 Bacteria 18610
792 Ga0453684_0029625 3300044712 Bacteria 7762
793 Ga0453684_0032203 3300044712 Bacteria 7346
794 Ga0453684_0153937 3300044712 Bacteria 2728
795 Ga0453684_0293217 3300044712 Bacteria 1851
796 Ga0466971_0237341 3300044719 Bacteria 867
797 Ga0466959_0118527 3300045049 Bacteria 1884
798 Ga0466959_0131729 3300045049 Bacteria 1772
799 Ga0451576_0003523 3300045051 Bacteria 21376
800 Ga0451576_0005411 3300045051 Bacteria 16028
801 Ga0451576_0017930 3300045051 Bacteria 7771
802 Ga0451576_0027325 3300045051 Bacteria 6130
803 Ga0451576_0030890 3300045051 Bacteria 5715
804 Ga0451576_0050576 3300045051 Bacteria 4358
805 Ga0451576_0055322 3300045051 Bacteria 4152
806 Ga0451576_0268735 3300045051 Bacteria 1782
807 Ga0451576_0447668 3300045051 Bacteria 1356
808 Ga0451576_0582350 3300045051 Bacteria 1176
809 Ga0451576_0640120 3300045051 Bacteria 1117
810 Ga0466967_0046975 3300045976 Bacteria 3762
811 Ga0466967_0542458 3300045976 Bacteria 1144
812 Ga0466967_0769867 3300045976 Bacteria 955
813 Ga0495592_0014907 3300046454 Bacteria 5899
814 Ga0495592_0134880 3300046454 Bacteria 1723
815 Ga0495592_0176304 3300046454 Bacteria 1460
816 Ga0495592_0342953 3300046454 Bacteria 960
817 Ga0495603_0054967 3300046455 Bacteria 2359
818 Ga0495629_0019600 3300046459 Bacteria 4831
819 Ga0495629_0056581 3300046459 Bacteria 2742
820 Ga0495629_0101592 3300046459 Bacteria 2006
821 Ga0495629_0161589 3300046459 Bacteria 1556
822 Ga0495629_0445729 3300046459 Bacteria 877
823 Ga0495638_0125130 3300046460 Bacteria 1515
824 Ga0495651_0029420 3300046462 Bacteria 4283
825 Ga0495651_0117887 3300046462 Bacteria 1954
826 Ga0495651_0211321 3300046462 Bacteria 1350
827 Ga0495653_0002196 3300046463 Bacteria 15433
828 Ga0495653_0382720 3300046463 Bacteria 898
829 Ga0495650_0000010 3300046471 Bacteria 645599
830 Ga0495650_0001875 3300046471 Bacteria 18731
831 Ga0495580_0045055 3300046472 Bacteria 3134
832 Ga0495580_0101580 3300046472 Bacteria 2000
833 Ga0495580_0220030 3300046472 Bacteria 1305
834 Ga0495580_0434515 3300046472 Bacteria 882
835 Ga0495582_0016241 3300046473 Bacteria 4078
836 Ga0495582_0105380 3300046473 Bacteria 1581
837 Ga0495582_0274329 3300046473 Bacteria 968
838 Ga0495639_0003617 3300046475 Bacteria 6665
839 Ga0495662_0047152 3300046476 Bacteria 2080
840 Ga0495664_0089384 3300046477 Bacteria 1851
841 Ga0495664_0133863 3300046477 Bacteria 1502
842 Ga0495585_0038359 3300046492 Bacteria 2697
843 Ga0495594_0005255 3300046499 Bacteria 6657
844 Ga0495594_0025822 3300046499 Bacteria 3158
845 Ga0495596_0041323 3300046500 Bacteria 1818
846 Ga0495583_0005362 3300046506 Bacteria 8743
847 Ga0495606_0011222 3300046507 Bacteria 7332
848 Ga0495606_0054290 3300046507 Bacteria 2595
849 Ga0495606_0177239 3300046507 Bacteria 1232
850 Ga0495608_0004188 3300046511 Bacteria 10337
851 Ga0495628_0004868 3300046516 Bacteria 11820
852 Ga0495628_0118357 3300046516 Bacteria 2034
853 Ga0495628_0247535 3300046516 Bacteria 1332
854 Ga0495628_0412216 3300046516 Bacteria 986
855 Ga0495630_0010900 3300046517 Bacteria 6565
856 Ga0495630_0057928 3300046517 Bacteria 2904
857 Ga0495630_0281019 3300046517 Bacteria 1272
858 Ga0495631_0055316 3300046518 Bacteria 1729
859 Ga0495643_0038186 3300046522 Bacteria 2631
860 Ga0495644_0000777 3300046523 Bacteria 13129
861 Ga0495666_0000717 3300046526 Bacteria 15137
862 Ga0495652_0081707 3300046529 Bacteria 2665
863 Ga0495665_0006456 3300046531 Bacteria 6332
864 Ga0495640_0028932 3300046533 Bacteria 3984
865 Ga0495640_0111910 3300046533 Bacteria 1783
866 Ga0495586_0005179 3300046535 Bacteria 6976
867 Ga0495586_0107871 3300046535 Bacteria 1549
868 Ga0495587_0071108 3300046536 Bacteria 2024
869 Ga0495609_0064869 3300046538 Bacteria 1610
870 Ga0495645_0004427 3300046543 Bacteria 9593
871 Ga0495645_0008980 3300046543 Bacteria 6981
872 Ga0495645_0027506 3300046543 Bacteria 4132
873 Ga0495645_0164427 3300046543 Bacteria 1532
874 Ga0495645_0222475 3300046543 Bacteria 1269
875 Ga0495667_0007451 3300046559 Bacteria 7419
876 Ga0495667_0023465 3300046559 Bacteria 4157
877 Ga0495667_0266452 3300046559 Bacteria 1089
878 Ga0495656_0051535 3300046615 Bacteria 1762
879 Ga0495656_0184261 3300046615 Bacteria 1028
880 Ga0495668_0031504 3300046616 Bacteria 2988
881 Ga0495668_0138011 3300046616 Bacteria 1334
882 Ga0495634_0001003 3300046642 Bacteria 26591
883 Ga0495634_0057828 3300046642 Bacteria 2587
884 Ga0495625_0003213 3300046660 Bacteria 16576
885 Ga0495625_0038577 3300046660 Bacteria 3496
886 Ga0495635_0054696 3300046663 Bacteria 2749
887 Ga0495635_0104808 3300046663 Bacteria 1933
888 Ga0495635_0252379 3300046663 Bacteria 1189
889 Ga0495661_0051415 3300046665 Bacteria 2488
890 Ga0495588_0058761 3300046674 Bacteria 1988
891 Ga0495657_0103606 3300046675 Bacteria 1810
892 Ga0495599_0068521 3300046678 Bacteria 2215
893 Ga0495599_0090734 3300046678 Bacteria 1906
894 Ga0495623_0016239 3300046679 Bacteria 4808
895 Ga0495623_0059574 3300046679 Bacteria 2397
896 Ga0495646_0027537 3300046680 Bacteria 3566
897 Ga0495646_0078441 3300046680 Bacteria 1930
898 Ga0495646_0247826 3300046680 Bacteria 955
899 Ga0495647_0112442 3300046681 Bacteria 1138
900 Ga0495647_0130370 3300046681 Bacteria 1065
901 Ga0495658_0022257 3300046683 Bacteria 3349
902 Ga0495658_0029349 3300046683 Bacteria 2977
903 Ga0495658_0077780 3300046683 Bacteria 1941
904 Ga0495658_0124747 3300046683 Bacteria 1561
905 Ga0495658_0232635 3300046683 Bacteria 1156
906 Ga0495669_0000560 3300046684 Bacteria 16456
907 Ga0495669_0000955 3300046684 Bacteria 12075
908 Ga0495669_0009730 3300046684 Bacteria 4058
909 Ga0495613_0013985 3300046689 Bacteria 5957
910 Ga0495613_0018272 3300046689 Bacteria 5228
911 Ga0495613_0295590 3300046689 Bacteria 1122
912 Ga0495624_0005609 3300046690 Bacteria 9009
913 Ga0495624_0237689 3300046690 Bacteria 1103
914 Ga0495670_0032429 3300046691 Bacteria 2599
915 Ga0495670_0311325 3300046691 Bacteria 845
916 Ga0495670_0341633 3300046691 Bacteria 805
917 Ga0495649_0074711 3300046694 Bacteria 1816
918 Ga0495600_0056708 3300046809 Bacteria 2559
919 Ga0495600_0370358 3300046809 Unclassified 895
920 Ga0495581_0000275 3300047315 Bacteria 24951
921 Ga0495581_0088019 3300047315 Unclassified 1801
922 Ga0495581_0211960 3300047315 Bacteria 1133
923 Ga0495581_0237560 3300047315 Bacteria 1066
924 Ga0495604_0009860 3300047317 Bacteria 7560
925 Ga0495604_0027117 3300047317 Bacteria 4558
926 Ga0495604_0073444 3300047317 Bacteria 2582
927 Ga0495636_0043935 3300047318 Bacteria 1860
928 Ga0495674_0009564 3300047319 Bacteria 9205
929 Ga0495674_0088249 3300047319 Bacteria 2653
930 Ga0495674_0206302 3300047319 Bacteria 1629
931 Ga0495672_0005628 3300047320 Bacteria 9887
932 Ga0495672_0072052 3300047320 Bacteria 1953
933 Ga0495672_0265726 3300047320 Bacteria 826
934 Ga0495676_0014477 3300047321 Bacteria 7058
935 Ga0495680_0030110 3300047322 Bacteria 4436
936 Ga0495680_0084304 3300047322 Bacteria 2395
937 Ga0495687_040759 3300047443 Bacteria 2043
938 Ga0495675_0010737 3300047444 Bacteria 5734
939 Ga0495675_0170815 3300047444 Bacteria 1335
940 Ga0495677_0014034 3300047445 Bacteria 2917
941 Ga0495684_0009393 3300047471 Bacteria 7549
942 Ga0495684_0037444 3300047471 Bacteria 3720
943 Ga0495684_0198973 3300047471 Bacteria 1478
944 Ga0495684_0244071 3300047471 Bacteria 1309
945 Ga0495686_0000545 3300047472 Bacteria 53866
946 Ga0495686_0002881 3300047472 Bacteria 15450
947 Ga0495686_0011954 3300047472 Bacteria 6100
948 Ga0495686_0012883 3300047472 Bacteria 5830
949 Ga0495593_0119123 3300047673 Unclassified 1344
950 Ga0495602_0030031 3300048088 Bacteria 5164
951 Ga0495602_0130089 3300048088 Bacteria 2009
952 Ga0495602_0167932 3300048088 Bacteria 1706
953 Ga0495602_0274329 3300048088 Bacteria 1245
954 Ga0495614_0006159 3300048089 Bacteria 5391
955 Ga0495614_0018911 3300048089 Bacteria 2983
956 Ga0496100_0004796 3300048903 Bacteria 7222
957 Ga0496102_0092046 3300048905 Bacteria 2808
958 Ga0496102_0186737 3300048905 Bacteria 1953
959 Ga0496102_0213964 3300048905 Bacteria 1817
960 Ga0496102_0390029 3300048905 Bacteria 1310
961 Ga0496103_0028809 3300048906 Bacteria 3373
962 Ga0496104_0000247 3300048907 Bacteria 47765
963 Ga0496104_0017385 3300048907 Bacteria 6549
964 Ga0496104_0040982 3300048907 Bacteria 4342
965 Ga0496104_0076019 3300048907 Bacteria 3198
966 Ga0496104_0257159 3300048907 Bacteria 1659
967 Ga0496105_0223881 3300048908 Bacteria 1531
968 Ga0496105_0375953 3300048908 Bacteria 1131
969 Ga0496106_0239861 3300048909 Bacteria 1448
970 Ga0496107_0028952 3300048910 Bacteria 3939
971 Ga0496108_0250451 3300048911 Bacteria 1541
972 Ga0496108_0267599 3300048911 Bacteria 1488
973 Ga0496108_0517993 3300048911 Bacteria 1041
974 Ga0496109_0006179 3300048912 Bacteria 10067
975 Ga0496109_0062051 3300048912 Bacteria 3418
976 Ga0496109_0089902 3300048912 Bacteria 2840
977 Ga0496109_0206954 3300048912 Bacteria 1845
978 Ga0496109_0457255 3300048912 Bacteria 1206
979 Ga0496109_0639190 3300048912 Bacteria 1001
980 Ga0496110_0416811 3300048913 Bacteria 1224
981 Ga0496110_0597161 3300048913 Bacteria 1002
982 Ga0496111_0238753 3300048914 Bacteria 1350
983 Ga0496111_0258881 3300048914 Bacteria 1291
984 Ga0496112_0002572 3300048915 Bacteria 14656
985 Ga0496112_0016237 3300048915 Bacteria 6967
986 Ga0496112_0035136 3300048915 Bacteria 4879
987 Ga0496112_0093303 3300048915 Bacteria 2981
988 Ga0496112_0135829 3300048915 Bacteria 2430
989 Ga0496112_0240404 3300048915 Bacteria 1764
990 Ga0496112_0383151 3300048915 Bacteria 1347
991 Ga0496112_0428668 3300048915 Bacteria 1261
992 Ga0496112_0524600 3300048915 Bacteria 1119
993 Ga0496113_0085556 3300048916 Bacteria 2422
994 Ga0496113_0109304 3300048916 Bacteria 2150
995 Ga0496114_0000246 3300048917 Bacteria 39480
996 Ga0496114_0098572 3300048917 Bacteria 2492
997 Ga0496114_0105369 3300048917 Bacteria 2412
998 Ga0496114_0147568 3300048917 Bacteria 2039
999 Ga0496114_0213426 3300048917 Bacteria 1693
1000 Ga0496114_0640718 3300048917 Bacteria 935
1001 Ga0496115_0162341 3300048918 Bacteria 1847
1002 Ga0496116_0009398 3300048919 Bacteria 8336
1003 Ga0496117_0183529 3300048920 Bacteria 1200
1004 Ga0496126_0000005 3300048929 Bacteria 891906
1005 Ga0496126_0000209 3300048929 Bacteria 131440
1006 Ga0496126_0000560 3300048929 Bacteria 71370
1007 Ga0496126_0076168 3300048929 Bacteria 2976
1008 Ga0501031_0035078 3300049568 Bacteria 3272
1009 Ga0501032_0005510 3300049569 Bacteria 9390
1010 Ga0501033_0088222 3300049570 Bacteria 2269
1011 Ga0501034_0018923 3300049571 Bacteria 7055
1012 Ga0501034_0024414 3300049571 Bacteria 6150
1013 Ga0501034_0038818 3300049571 Bacteria 4823
1014 Ga0501036_0001574 3300049572 Bacteria 17653
1015 Ga0501037_0029947 3300049573 Bacteria 4021
1016 Ga0501037_0219280 3300049573 Bacteria 1339
1017 Ga0501038_0021851 3300049574 Bacteria 5738
1018 Ga0501041_0422723 3300049577 Bacteria 845
1019 Ga0501043_0002607 3300049579 Bacteria 15212
1020 Ga0501043_0193740 3300049579 Bacteria 1580
1021 Ga0501043_0242034 3300049579 Bacteria 1391
1022 Ga0501046_0000150 3300049580 Bacteria 72900
1023 Ga0501047_0003876 3300049581 Bacteria 14071
1024 Ga0501047_0015370 3300049581 Bacteria 7290
1025 Ga0501047_0037910 3300049581 Bacteria 4662
1026 Ga0501067_0162452 3300049583 Bacteria 1244
1027 Ga0501068_0301652 3300049584 Bacteria 1025
1028 Ga0501072_0246551 3300049588 Bacteria 1423
1029 Ga0501074_0289035 3300049590 Bacteria 1165
1030 Ga0501076_0605369 3300049592 Bacteria 904
1031 Ga0501077_0068406 3300049593 Bacteria 2251
1032 Ga0501080_0051685 3300049742 Bacteria 3825
1033 Ga0501080_0052843 3300049742 Bacteria 3782
1034 Ga0501081_0272372 3300049743 Bacteria 1238
1035 Ga0501083_0055182 3300049744 Bacteria 2665
1036 Ga0501035_0004457 3300049822 Bacteria 13282
1037 Ga0501044_0001681 3300049823 Bacteria 25990
1038 Ga0501044_0005372 3300049823 Bacteria 14234
1039 nmdc:mga05p37_20610_c1 3300050507 Bacteria 7977
1040 nmdc:mga05p37_25099_c1 3300050507 Bacteria 7247
1041 nmdc:mga05p37_279225_c1 3300050507 Bacteria 1993
1042 nmdc:mga05p37_3048_c1 3300050507 Bacteria 19460
1043 nmdc:mga05p37_46662_c1 3300050507 Bacteria 5326
1044 nmdc:mga05p37_549024_c1 3300050507 Bacteria 1316
1045 nmdc:mga05p37_595_c1 3300050507 Bacteria 25325
1046 nmdc:mga05p37_6561_c1 3300050507 Bacteria 13712
1047 nmdc:mga05p37_78337_c2 3300050507 Bacteria 3598
1048 nmdc:mga09592_168412_c1 3300050508 Unclassified 1894
1049 nmdc:mga09592_253645_c1 3300050508 Bacteria 1525
1050 nmdc:mga09592_428202_c1 3300050508 Bacteria 1142
1051 nmdc:mga06r32_27167_c2 3300050510 Bacteria 4222
1052 nmdc:mga06r32_77561_c1 3300050510 Bacteria 3228
1053 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
1054 nmdc:mga08y16_169354_c1 3300050511 Bacteria 2269
1055 nmdc:mga08y16_17177_c1 3300050511 Bacteria 7617
1056 nmdc:mga08y16_59748_c1 3300050511 Bacteria 3982
1057 nmdc:mga0n895_12870_c1 3300050512 Bacteria 7518
1058 nmdc:mga0n895_134377_c1 3300050512 Bacteria 2500
1059 nmdc:mga0n895_140501_c1 3300050512 Bacteria 2443
1060 nmdc:mga0n895_142639_c1 3300050512 Bacteria 2424
1061 nmdc:mga0n895_7101_c1 3300050512 Bacteria 9574
1062 nmdc:mga0n895_71180_c1 3300050512 Bacteria 3448
1063 nmdc:mga0n895_735049_c1 3300050512 Bacteria 981
1064 nmdc:mga0rr50_139029_c1 3300050513 Bacteria 1952
1065 nmdc:mga0rr50_21352_c1 3300050513 Bacteria 4418
1066 nmdc:mga0rr50_2205_c1 3300050513 Bacteria 10927
1067 nmdc:mga0rr50_23085_c1 3300050513 Bacteria 4283
1068 nmdc:mga0rr50_3252_c1 3300050513 Bacteria 9311
1069 nmdc:mga0rr50_373_c1 3300050513 Bacteria 24506
1070 nmdc:mga0rr50_39611_c1 3300050513 Bacteria 3420
1071 nmdc:mga0rr50_60229_c1 3300050513 Bacteria 2855
1072 nmdc:mga0rr50_9864_c1 3300050513 Bacteria 6035
1073 nmdc:mga08x19_15605_c1 3300050514 Bacteria 4622
1074 nmdc:mga08x19_22597_c1 3300050514 Bacteria 3896
1075 nmdc:mga08x19_34220_c1 3300050514 Bacteria 3210
1076 nmdc:mga08x19_51928_c1 3300050514 Bacteria 2635
1077 nmdc:mga08x19_78043_c1 3300050514 Bacteria 2170
1078 nmdc:mga08x19_90727_c1 3300050514 Bacteria 2017
1079 nmdc:mga0a205_10346_c1 3300050515 Bacteria 8575
1080 nmdc:mga0a205_47564_c1 3300050515 Bacteria 4140
1081 nmdc:mga0a205_6655_c1 3300050515 Bacteria 10458
1082 nmdc:mga0a205_72605_c1 3300050515 Bacteria 3325
1083 Ga0495601_0019915 3300053077 Bacteria 4096
1084 Ga0495601_0063448 3300053077 Bacteria 2348
1085 Ga0495601_0126279 3300053077 Bacteria 1664
1086 Ga0495601_0442679 3300053077 Bacteria 841
1087 Ga0495655_0010860 3300053083 Bacteria 1812
1088 Ga0495595_0030502 3300053084 Bacteria 2419
1089 Ga0495595_0102853 3300053084 Bacteria 1380
1090 Ga0495619_0004075 3300053085 Bacteria 9360
1091 Ga0495619_0029701 3300053085 Bacteria 3534
1092 Ga0495619_0062284 3300053085 Bacteria 2483
1093 Ga0495619_0105732 3300053085 Bacteria 1919
1094 Ga0500651_0000049 3300053093 Bacteria 83361
1095 Ga0500595_000014 3300053119 Bacteria 247996
1096 Ga0590074_001275 3300059423 Bacteria 4003
1097 Ga0590075_002910 3300059424 Bacteria 4072
1098 Ga0590077_004195 3300059426 Bacteria 2969
1099 Ga0590077_027574 3300059426 Bacteria 1231
1100 Ga0501082_0175766 3300060353 Bacteria 1862
1101 Ga0530510_0015081 3300061734 Bacteria 5459

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_100386456 Ga0070697_1003864562 229
2 3300025922 Ga0207646_10550266 Ga0207646_105502662 229
3 3300046459 Ga0495629_0445729 Ga0495629_0445729_156_863 230
4 3300025261 Ga0209233_1007528 Ga0209233_10075281 236
5 3300046459 Ga0495629_0161589 Ga0495629_0161589_272_997 236
6 3300046462 Ga0495651_0117887 Ga0495651_0117887_1207_1917 236
7 3300046477 Ga0495664_0089384 Ga0495664_0089384_38_748 236
8 3300048915 Ga0496112_0035136 Ga0496112_0035136_22_732 236
9 3300006914 Ga0075436_100028497 Ga0075436_1000284975 237
10 3300025926 Ga0207659_10359411 Ga0207659_103594112 237
11 3300046615 Ga0495656_0051535 Ga0495656_0051535_22_747 237
12 3300049593 Ga0501077_0068406 Ga0501077_0068406_931_1734 237
13 3300050514 nmdc:mga08x19_34220_c1 nmdc:mga08x19_34220_c1_1604_2371 237
14 3300025907 Ga0207645_10266741 Ga0207645_102667412 238
15 3300005468 Ga0070707_100000221 Ga0070707_10000022130 239
16 3300024227 Ga0228598_1004988 Ga0228598_10049884 239
17 3300025922 Ga0207646_10000037 Ga0207646_10000037154 239
18 3300005338 Ga0068868_100181756 Ga0068868_1001817562 240
19 3300005338 Ga0068868_100645934 Ga0068868_1006459342 240
20 3300005341 Ga0070691_10004188 Ga0070691_1000418811 240
21 3300005343 Ga0070687_100030822 Ga0070687_1000308223 240
22 3300005345 Ga0070692_10038405 Ga0070692_100384053 240
23 3300005347 Ga0070668_100054493 Ga0070668_1000544935 240
24 3300005347 Ga0070668_100206939 Ga0070668_1002069392 240
25 3300005353 Ga0070669_100051867 Ga0070669_1000518673 240
26 3300005353 Ga0070669_100178091 Ga0070669_1001780912 240
27 3300005364 Ga0070673_100197094 Ga0070673_1001970943 240
28 3300005440 Ga0070705_100121105 Ga0070705_1001211052 240
29 3300005441 Ga0070700_100028280 Ga0070700_1000282803 240
30 3300005441 Ga0070700_100071314 Ga0070700_1000713143 240
31 3300005456 Ga0070678_100066041 Ga0070678_1000660414 240
32 3300005471 Ga0070698_100034124 Ga0070698_1000341248 240
33 3300005530 Ga0070679_100124874 Ga0070679_1001248743 240
34 3300005543 Ga0070672_100150676 Ga0070672_1001506764 240
35 3300005544 Ga0070686_100002243 Ga0070686_1000022431 240
36 3300005545 Ga0070695_100003541 Ga0070695_1000035413 240
37 3300005546 Ga0070696_100130833 Ga0070696_1001308332 240
38 3300005548 Ga0070665_100005447 Ga0070665_1000054478 240
39 3300005549 Ga0070704_100019087 Ga0070704_1000190873 240
40 3300005614 Ga0068856_100018557 Ga0068856_1000185572 240
41 3300005615 Ga0070702_100002883 Ga0070702_10000288310 240
42 3300005617 Ga0068859_100225844 Ga0068859_1002258445 240
43 3300005618 Ga0068864_100063762 Ga0068864_1000637624 240
44 3300005618 Ga0068864_100399043 Ga0068864_1003990432 240
45 3300005718 Ga0068866_10126540 Ga0068866_101265402 240
46 3300005719 Ga0068861_100036380 Ga0068861_1000363804 240
47 3300005719 Ga0068861_100067590 Ga0068861_1000675903 240
48 3300005842 Ga0068858_100001254 Ga0068858_10000125432 240
49 3300005842 Ga0068858_100036297 Ga0068858_1000362973 240
50 3300005842 Ga0068858_100113223 Ga0068858_1001132232 240
51 3300006237 Ga0097621_100731126 Ga0097621_1007311262 240
52 3300006847 Ga0075431_100173239 Ga0075431_1001732392 240
53 3300006871 Ga0075434_100183729 Ga0075434_1001837293 240
54 3300006871 Ga0075434_100214894 Ga0075434_1002148943 240
55 3300006914 Ga0075436_100006359 Ga0075436_1000063599 240
56 3300006914 Ga0075436_100109094 Ga0075436_1001090943 240
57 3300006931 Ga0097620_100225847 Ga0097620_1002258472 240
58 3300007076 Ga0075435_100001542 Ga0075435_10000154210 240
59 3300007076 Ga0075435_100070719 Ga0075435_1000707193 240
60 3300007076 Ga0075435_100083105 Ga0075435_1000831053 240
61 3300009176 Ga0105242_10060486 Ga0105242_100604863 240
62 3300009176 Ga0105242_10465875 Ga0105242_104658752 240
63 3300014325 Ga0163163_10058152 Ga0163163_100581522 240
64 3300014745 Ga0157377_10146525 Ga0157377_101465251 240
65 3300014969 Ga0157376_10019471 Ga0157376_100194713 240
66 3300025900 Ga0207710_10014776 Ga0207710_100147766 240
67 3300025900 Ga0207710_10015930 Ga0207710_100159306 240
68 3300025903 Ga0207680_10006153 Ga0207680_100061538 240
69 3300025911 Ga0207654_10040688 Ga0207654_100406883 240
70 3300025912 Ga0207707_10223257 Ga0207707_102232572 240
71 3300025913 Ga0207695_10523965 Ga0207695_105239651 240
72 3300025917 Ga0207660_10233607 Ga0207660_102336072 240
73 3300025918 Ga0207662_10061436 Ga0207662_100614363 240
74 3300025921 Ga0207652_10077073 Ga0207652_100770734 240
75 3300025923 Ga0207681_10118269 Ga0207681_101182693 240
76 3300025923 Ga0207681_10180816 Ga0207681_101808162 240
77 3300025926 Ga0207659_10113563 Ga0207659_101135633 240
78 3300025926 Ga0207659_10117776 Ga0207659_101177762 240
79 3300025927 Ga0207687_10107619 Ga0207687_101076193 240
80 3300025933 Ga0207706_10113218 Ga0207706_101132181 240
81 3300025937 Ga0207669_10005330 Ga0207669_100053303 240
82 3300025939 Ga0207665_10152862 Ga0207665_101528622 240
83 3300025941 Ga0207711_10036970 Ga0207711_100369705 240
84 3300025941 Ga0207711_10041117 Ga0207711_100411173 240
85 3300025941 Ga0207711_10087655 Ga0207711_100876553 240
86 3300025941 Ga0207711_10162404 Ga0207711_101624044 240
87 3300025972 Ga0207668_10017365 Ga0207668_100173652 240
88 3300025981 Ga0207640_10017290 Ga0207640_100172905 240
89 3300026023 Ga0207677_10076376 Ga0207677_100763765 240
90 3300026035 Ga0207703_10012018 Ga0207703_100120187 240
91 3300026035 Ga0207703_10067170 Ga0207703_100671705 240
92 3300026075 Ga0207708_10057081 Ga0207708_100570815 240
93 3300026075 Ga0207708_10100053 Ga0207708_101000533 240
94 3300026089 Ga0207648_10038262 Ga0207648_100382626 240
95 3300026095 Ga0207676_10047359 Ga0207676_100473592 240
96 3300026118 Ga0207675_100017733 Ga0207675_1000177333 240
97 3300026118 Ga0207675_100075425 Ga0207675_1000754254 240
98 3300026118 Ga0207675_100082556 Ga0207675_1000825563 240
99 3300026121 Ga0207683_10037219 Ga0207683_100372195 240
100 3300026121 Ga0207683_10080588 Ga0207683_100805882 240
101 3300027907 Ga0207428_10045568 Ga0207428_100455685 240
102 3300027907 Ga0207428_10110383 Ga0207428_101103832 240
103 3300028379 Ga0268266_10398012 Ga0268266_103980123 240
104 3300028380 Ga0268265_10196615 Ga0268265_101966153 240
105 3300028381 Ga0268264_10656117 Ga0268264_106561171 240
106 3300032002 Ga0307416_100382062 Ga0307416_1003820622 240
107 3300034818 Ga0373950_0016784 Ga0373950_0016784_24_761 240
108 3300035083 Ga0373926_0070487 Ga0373926_0070487_242_979 240
109 3300035086 Ga0373934_0105921 Ga0373934_0105921_303_1040 240
110 3300035089 Ga0373944_0029297 Ga0373944_0029297_865_1617 240
111 3300035092 Ga0373952_0027059 Ga0373952_0027059_25_762 240
112 3300035092 Ga0373952_0060887 Ga0373952_0060887_169_906 240
113 3300035116 Ga0373945_0117583 Ga0373945_0117583_79_816 240
114 3300035117 Ga0373953_0112914 Ga0373953_0112914_236_976 240
115 3300035170 Ga0373943_0045705 Ga0373943_0045705_1262_1999 240
116 3300035171 Ga0373946_0045683 Ga0373946_0045683_327_1079 240
117 3300035692 Ga0373935_0038030 Ga0373935_0038030_1499_2236 240
118 3300035692 Ga0373935_0510763 Ga0373935_0510763_122_859 240
119 3300035695 Ga0373927_0117868 Ga0373927_0117868_614_1351 240
120 3300036401 Ga0373937_0202959 Ga0373937_0202959_539_1276 240
121 3300037068 Ga0373925_0173403 Ga0373925_0173403_923_1660 240
122 3300045051 Ga0451576_0640120 Ga0451576_0640120_200_937 240
123 3300045976 Ga0466967_0769867 Ga0466967_0769867_181_918 240
124 3300046454 Ga0495592_0176304 Ga0495592_0176304_486_1223 240
125 3300046516 Ga0495628_0412216 Ga0495628_0412216_79_816 240
126 3300046517 Ga0495630_0057928 Ga0495630_0057928_1988_2725 240
127 3300046517 Ga0495630_0281019 Ga0495630_0281019_159_896 240
128 3300046535 Ga0495586_0107871 Ga0495586_0107871_680_1432 240
129 3300046543 Ga0495645_0164427 Ga0495645_0164427_720_1457 240
130 3300046559 Ga0495667_0266452 Ga0495667_0266452_264_1001 240
131 3300046642 Ga0495634_0057828 Ga0495634_0057828_1668_2405 240
132 3300046681 Ga0495647_0112442 Ga0495647_0112442_230_967 240
133 3300046683 Ga0495658_0022257 Ga0495658_0022257_2031_2768 240
134 3300046683 Ga0495658_0077780 Ga0495658_0077780_1107_1859 240
135 3300046683 Ga0495658_0232635 Ga0495658_0232635_409_1146 240
136 3300046689 Ga0495613_0295590 Ga0495613_0295590_211_960 240
137 3300046691 Ga0495670_0341633 Ga0495670_0341633_24_761 240
138 3300048088 Ga0495602_0167932 Ga0495602_0167932_184_921 240
139 3300048088 Ga0495602_0274329 Ga0495602_0274329_163_900 240
140 3300048912 Ga0496109_0639190 Ga0496109_0639190_234_983 240
141 3300048917 Ga0496114_0105369 Ga0496114_0105369_133_870 240
142 3300048917 Ga0496114_0147568 Ga0496114_0147568_28_765 240
143 3300049571 Ga0501034_0038818 Ga0501034_0038818_2675_3412 240
144 3300049573 Ga0501037_0219280 Ga0501037_0219280_246_983 240
145 3300049577 Ga0501041_0422723 Ga0501041_0422723_27_761 240
146 3300049579 Ga0501043_0242034 Ga0501043_0242034_236_973 240
147 3300049581 Ga0501047_0015370 Ga0501047_0015370_3006_3743 240
148 3300049592 Ga0501076_0605369 Ga0501076_0605369_25_762 240
149 3300049823 Ga0501044_0001681 Ga0501044_0001681_24096_24833 240
150 3300050508 nmdc:mga09592_253645_c1 nmdc:mga09592_253645_c1_322_1059 240
151 3300050510 nmdc:mga06r32_77561_c1 nmdc:mga06r32_77561_c1_2063_2800 240
152 3300050512 nmdc:mga0n895_7101_c1 nmdc:mga0n895_7101_c1_6556_7293 240
153 3300050513 nmdc:mga0rr50_39611_c1 nmdc:mga0rr50_39611_c1_1295_2032 240
154 3300050514 nmdc:mga08x19_22597_c1 nmdc:mga08x19_22597_c1_1389_2126 240
155 3300050515 nmdc:mga0a205_6655_c1 nmdc:mga0a205_6655_c1_1040_1777 240
156 3300053077 Ga0495601_0442679 Ga0495601_0442679_74_811 240
157 3300053085 Ga0495619_0105732 Ga0495619_0105732_552_1289 240
158 3300005718 Ga0068866_10029954 Ga0068866_100299543 241
159 3300026075 Ga0207708_10071363 Ga0207708_100713633 241
160 3300046691 Ga0495670_0311325 Ga0495670_0311325_12_758 241
161 3300005334 Ga0068869_100410718 Ga0068869_1004107181 245
162 3300005718 Ga0068866_10274385 Ga0068866_102743852 245
163 3300025942 Ga0207689_10402049 Ga0207689_104020491 245
164 3300026023 Ga0207677_10136423 Ga0207677_101364234 245
165 3300050512 nmdc:mga0n895_140501_c1 nmdc:mga0n895_140501_c1_590_1342 245
166 iso_pu_bacteria 2884215851 2884219651 245
167 3300006914 Ga0075436_100049304 Ga0075436_1000493045 246
168 3300042876 Ga0451577_0097736 Ga0451577_0097736_809_1561 247
169 3300042876 Ga0451577_0439764 Ga0451577_0439764_70_819 247
170 3300044673 Ga0453683_0000086 Ga0453683_0000086_77891_78643 247
171 3300044673 Ga0453683_0101306 Ga0453683_0101306_172_924 247
172 3300044712 Ga0453684_0003980 Ga0453684_0003980_5262_6011 247
173 3300044712 Ga0453684_0029625 Ga0453684_0029625_1025_1777 247
174 3300045051 Ga0451576_0447668 Ga0451576_0447668_114_866 247
175 3300013297 Ga0157378_10250405 Ga0157378_102504052 248
176 3300025921 Ga0207652_10117046 Ga0207652_101170462 248
177 3300042876 Ga0451577_0114827 Ga0451577_0114827_766_1518 248
178 3300044712 Ga0453684_0293217 Ga0453684_0293217_744_1496 248
179 3300049571 Ga0501034_0018923 Ga0501034_0018923_529_1293 248
180 3300005327 Ga0070658_10000766 Ga0070658_1000076620 249
181 3300005327 Ga0070658_10070625 Ga0070658_100706254 249
182 3300005327 Ga0070658_10103382 Ga0070658_101033822 249
183 3300005327 Ga0070658_10169859 Ga0070658_101698593 249
184 3300005329 Ga0070683_100048913 Ga0070683_1000489133 249
185 3300005335 Ga0070666_10021119 Ga0070666_100211194 249
186 3300005336 Ga0070680_100014163 Ga0070680_1000141632 249
187 3300005339 Ga0070660_100009153 Ga0070660_1000091533 249
188 3300005339 Ga0070660_100211410 Ga0070660_1002114102 249
189 3300005347 Ga0070668_100188378 Ga0070668_1001883782 249
190 3300005355 Ga0070671_100001676 Ga0070671_10000167613 249
191 3300005355 Ga0070671_100207169 Ga0070671_1002071693 249
192 3300005364 Ga0070673_100176401 Ga0070673_1001764013 249
193 3300005366 Ga0070659_100001021 Ga0070659_10000102110 249
194 3300005366 Ga0070659_100064943 Ga0070659_1000649434 249
195 3300005366 Ga0070659_100149861 Ga0070659_1001498611 249
196 3300005435 Ga0070714_100101561 Ga0070714_1001015613 249
197 3300005435 Ga0070714_100315339 Ga0070714_1003153391 249
198 3300005435 Ga0070714_100492224 Ga0070714_1004922242 249
199 3300005455 Ga0070663_100067372 Ga0070663_1000673723 249
200 3300005455 Ga0070663_100169091 Ga0070663_1001690911 249
201 3300005455 Ga0070663_100213585 Ga0070663_1002135853 249
202 3300005456 Ga0070678_100193215 Ga0070678_1001932152 249
203 3300005458 Ga0070681_10045035 Ga0070681_100450354 249
204 3300005530 Ga0070679_100056981 Ga0070679_1000569813 249
205 3300005530 Ga0070679_100171866 Ga0070679_1001718663 249
206 3300005535 Ga0070684_100078274 Ga0070684_1000782742 249
207 3300005535 Ga0070684_100194820 Ga0070684_1001948202 249
208 3300005539 Ga0068853_100000054 Ga0068853_10000005425 249
209 3300005548 Ga0070665_100008632 Ga0070665_1000086325 249
210 3300005548 Ga0070665_100039128 Ga0070665_1000391283 249
211 3300005563 Ga0068855_100000913 Ga0068855_10000091324 249
212 3300005563 Ga0068855_100003825 Ga0068855_10000382520 249
213 3300005563 Ga0068855_100012883 Ga0068855_1000128838 249
214 3300005563 Ga0068855_100035485 Ga0068855_1000354858 249
215 3300005563 Ga0068855_100041514 Ga0068855_1000415142 249
216 3300005563 Ga0068855_100232692 Ga0068855_1002326922 249
217 3300005564 Ga0070664_100349949 Ga0070664_1003499493 249
218 3300005577 Ga0068857_100002221 Ga0068857_1000022214 249
219 3300005578 Ga0068854_100000137 Ga0068854_10000013735 249
220 3300005578 Ga0068854_100071487 Ga0068854_1000714873 249
221 3300005614 Ga0068856_100296549 Ga0068856_1002965493 249
222 3300005614 Ga0068856_100307374 Ga0068856_1003073742 249
223 3300005616 Ga0068852_100039624 Ga0068852_1000396244 249
224 3300005616 Ga0068852_100179574 Ga0068852_1001795744 249
225 3300005618 Ga0068864_100192620 Ga0068864_1001926204 249
226 3300005834 Ga0068851_10008832 Ga0068851_100088321 249
227 3300005841 Ga0068863_100036062 Ga0068863_1000360622 249
228 3300009093 Ga0105240_10000001 Ga0105240_10000001907 249
229 3300009093 Ga0105240_10012027 Ga0105240_1001202715 249
230 3300009093 Ga0105240_10012782 Ga0105240_100127823 249
231 3300009093 Ga0105240_10114294 Ga0105240_101142943 249
232 3300009093 Ga0105240_10224743 Ga0105240_102247432 249
233 3300009093 Ga0105240_10297529 Ga0105240_102975292 249
234 3300009174 Ga0105241_10484016 Ga0105241_104840162 249
235 3300009177 Ga0105248_10012842 Ga0105248_100128424 249
236 3300009545 Ga0105237_10004977 Ga0105237_1000497714 249
237 3300009551 Ga0105238_10008485 Ga0105238_1000848516 249
238 3300009551 Ga0105238_10070590 Ga0105238_100705903 249
239 3300009551 Ga0105238_10101639 Ga0105238_101016393 249
240 3300009551 Ga0105238_10184047 Ga0105238_101840472 249
241 3300010375 Ga0105239_10111134 Ga0105239_101111344 249
242 3300013102 Ga0157371_10562805 Ga0157371_105628051 249
243 3300013104 Ga0157370_10011397 Ga0157370_1001139713 249
244 3300013104 Ga0157370_10017703 Ga0157370_100177038 249
245 3300013104 Ga0157370_10017947 Ga0157370_100179476 249
246 3300013104 Ga0157370_10018903 Ga0157370_100189039 249
247 3300013104 Ga0157370_10035941 Ga0157370_100359414 249
248 3300013104 Ga0157370_10204238 Ga0157370_102042382 249
249 3300013105 Ga0157369_10019707 Ga0157369_100197074 249
250 3300013105 Ga0157369_10025443 Ga0157369_100254434 249
251 3300013105 Ga0157369_10036798 Ga0157369_100367985 249
252 3300013105 Ga0157369_10069128 Ga0157369_100691283 249
253 3300013105 Ga0157369_10099587 Ga0157369_100995872 249
254 3300013105 Ga0157369_10156301 Ga0157369_101563015 249
255 3300013105 Ga0157369_10405426 Ga0157369_104054262 249
256 3300013296 Ga0157374_10016453 Ga0157374_100164538 249
257 3300013296 Ga0157374_10064149 Ga0157374_100641492 249
258 3300013296 Ga0157374_10066771 Ga0157374_100667713 249
259 3300013296 Ga0157374_10095902 Ga0157374_100959022 249
260 3300013296 Ga0157374_10293282 Ga0157374_102932822 249
261 3300013306 Ga0163162_10023636 Ga0163162_100236362 249
262 3300013306 Ga0163162_10071217 Ga0163162_100712173 249
263 3300013306 Ga0163162_10258213 Ga0163162_102582133 249
264 3300013307 Ga0157372_10006518 Ga0157372_100065185 249
265 3300013307 Ga0157372_10019768 Ga0157372_1001976811 249
266 3300013307 Ga0157372_10026761 Ga0157372_100267616 249
267 3300013307 Ga0157372_10096890 Ga0157372_100968903 249
268 3300013307 Ga0157372_10177561 Ga0157372_101775612 249
269 3300013307 Ga0157372_10520950 Ga0157372_105209501 249
270 3300013308 Ga0157375_10544408 Ga0157375_105444082 249
271 3300014325 Ga0163163_10039817 Ga0163163_100398174 249
272 3300014325 Ga0163163_10070157 Ga0163163_100701573 249
273 3300014969 Ga0157376_10042534 Ga0157376_100425344 249
274 3300014969 Ga0157376_10136940 Ga0157376_101369402 249
275 3300014969 Ga0157376_10258253 Ga0157376_102582532 249
276 3300014969 Ga0157376_10629810 Ga0157376_106298102 249
277 3300024227 Ga0228598_1007435 Ga0228598_10074352 249
278 3300025903 Ga0207680_10033225 Ga0207680_100332254 249
279 3300025904 Ga0207647_10003459 Ga0207647_1000345910 249
280 3300025904 Ga0207647_10042476 Ga0207647_100424762 249
281 3300025909 Ga0207705_10000048 Ga0207705_10000048147 249
282 3300025909 Ga0207705_10003420 Ga0207705_100034209 249
283 3300025909 Ga0207705_10009158 Ga0207705_100091582 249
284 3300025909 Ga0207705_10080739 Ga0207705_100807392 249
285 3300025909 Ga0207705_10156854 Ga0207705_101568542 249
286 3300025912 Ga0207707_10319707 Ga0207707_103197071 249
287 3300025913 Ga0207695_10000001 Ga0207695_10000001910 249
288 3300025913 Ga0207695_10000354 Ga0207695_10000354100 249
289 3300025913 Ga0207695_10071412 Ga0207695_100714124 249
290 3300025913 Ga0207695_10236616 Ga0207695_102366163 249
291 3300025917 Ga0207660_10162028 Ga0207660_101620282 249
292 3300025919 Ga0207657_10000823 Ga0207657_100008239 249
293 3300025919 Ga0207657_10017050 Ga0207657_1001705010 249
294 3300025920 Ga0207649_10007381 Ga0207649_100073812 249
295 3300025920 Ga0207649_10207470 Ga0207649_102074702 249
296 3300025924 Ga0207694_10010372 Ga0207694_100103727 249
297 3300025924 Ga0207694_10012007 Ga0207694_1001200710 249
298 3300025924 Ga0207694_10097950 Ga0207694_100979502 249
299 3300025924 Ga0207694_10210222 Ga0207694_102102222 249
300 3300025924 Ga0207694_10360249 Ga0207694_103602491 249
301 3300025925 Ga0207650_10267387 Ga0207650_102673871 249
302 3300025928 Ga0207700_10003657 Ga0207700_1000365711 249
303 3300025929 Ga0207664_10359771 Ga0207664_103597712 249
304 3300025931 Ga0207644_10029897 Ga0207644_100298974 249
305 3300025932 Ga0207690_10279237 Ga0207690_102792371 249
306 3300025941 Ga0207711_10405682 Ga0207711_104056822 249
307 3300025945 Ga0207679_10358349 Ga0207679_103583492 249
308 3300025949 Ga0207667_10000647 Ga0207667_1000064730 249
309 3300025949 Ga0207667_10008444 Ga0207667_100084448 249
310 3300025949 Ga0207667_10027233 Ga0207667_100272339 249
311 3300025949 Ga0207667_10038353 Ga0207667_100383537 249
312 3300025949 Ga0207667_10068300 Ga0207667_100683003 249
313 3300025949 Ga0207667_10108232 Ga0207667_101082324 249
314 3300025981 Ga0207640_10000023 Ga0207640_1000002325 249
315 3300026023 Ga0207677_10544341 Ga0207677_105443411 249
316 3300026041 Ga0207639_10000034 Ga0207639_1000003468 249
317 3300026041 Ga0207639_10087391 Ga0207639_100873912 249
318 3300026067 Ga0207678_10001665 Ga0207678_100016659 249
319 3300026088 Ga0207641_10007294 Ga0207641_100072943 249
320 3300026116 Ga0207674_10000532 Ga0207674_1000053225 249
321 3300028379 Ga0268266_10007930 Ga0268266_1000793013 249
322 3300031344 Ga0265316_10061401 Ga0265316_100614012 249
323 3300033180 Ga0307510_10118139 Ga0307510_101181392 249
324 3300037471 Ga0395905_0001744 Ga0395905_0001744_7630_8382 249
325 3300037471 Ga0395905_0007578 Ga0395905_0007578_3949_4701 249
326 3300037471 Ga0395905_0014151 Ga0395905_0014151_669_1421 249
327 3300037471 Ga0395905_0033731 Ga0395905_0033731_3136_3888 249
328 3300037853 Ga0436364_1357538 Ga0436364_1357538_612_1361 249
329 3300039447 Ga0436361_0277179 Ga0436361_0277179_103_852 249
330 3300044684 Ga0466966_0072934 Ga0466966_0072934_1232_1981 249
331 3300044693 Ga0466961_0161787 Ga0466961_0161787_58_807 249
332 3300044694 Ga0466963_0016278 Ga0466963_0016278_3690_4439 249
333 3300044694 Ga0466963_0024269 Ga0466963_0024269_2648_3397 249
334 3300044694 Ga0466963_0061019 Ga0466963_0061019_1178_1927 249
335 3300044719 Ga0466971_0237341 Ga0466971_0237341_43_792 249
336 3300045049 Ga0466959_0131729 Ga0466959_0131729_431_1180 249
337 3300045976 Ga0466967_0046975 Ga0466967_0046975_113_862 249
338 3300045976 Ga0466967_0542458 Ga0466967_0542458_371_1120 249
339 3300046454 Ga0495592_0014907 Ga0495592_0014907_3504_4253 249
340 3300046455 Ga0495603_0054967 Ga0495603_0054967_993_1742 249
341 3300046459 Ga0495629_0019600 Ga0495629_0019600_3666_4415 249
342 3300046459 Ga0495629_0101592 Ga0495629_0101592_747_1496 249
343 3300046460 Ga0495638_0125130 Ga0495638_0125130_600_1349 249
344 3300046462 Ga0495651_0029420 Ga0495651_0029420_672_1421 249
345 3300046462 Ga0495651_0211321 Ga0495651_0211321_583_1332 249
346 3300046463 Ga0495653_0002196 Ga0495653_0002196_6346_7095 249
347 3300046463 Ga0495653_0382720 Ga0495653_0382720_10_759 249
348 3300046471 Ga0495650_0000010 Ga0495650_0000010_631628_632377 249
349 3300046471 Ga0495650_0001875 Ga0495650_0001875_4592_5341 249
350 3300046472 Ga0495580_0045055 Ga0495580_0045055_539_1288 249
351 3300046472 Ga0495580_0101580 Ga0495580_0101580_253_1002 249
352 3300046473 Ga0495582_0016241 Ga0495582_0016241_722_1471 249
353 3300046475 Ga0495639_0003617 Ga0495639_0003617_1487_2236 249
354 3300046476 Ga0495662_0047152 Ga0495662_0047152_925_1674 249
355 3300046492 Ga0495585_0038359 Ga0495585_0038359_967_1716 249
356 3300046499 Ga0495594_0005255 Ga0495594_0005255_993_1742 249
357 3300046499 Ga0495594_0025822 Ga0495594_0025822_2019_2768 249
358 3300046500 Ga0495596_0041323 Ga0495596_0041323_433_1182 249
359 3300046506 Ga0495583_0005362 Ga0495583_0005362_6924_7673 249
360 3300046507 Ga0495606_0011222 Ga0495606_0011222_6501_7250 249
361 3300046507 Ga0495606_0054290 Ga0495606_0054290_1580_2329 249
362 3300046507 Ga0495606_0177239 Ga0495606_0177239_21_770 249
363 3300046516 Ga0495628_0004868 Ga0495628_0004868_4654_5403 249
364 3300046518 Ga0495631_0055316 Ga0495631_0055316_945_1694 249
365 3300046522 Ga0495643_0038186 Ga0495643_0038186_151_900 249
366 3300046523 Ga0495644_0000777 Ga0495644_0000777_295_1044 249
367 3300046526 Ga0495666_0000717 Ga0495666_0000717_2961_3710 249
368 3300046531 Ga0495665_0006456 Ga0495665_0006456_4704_5453 249
369 3300046533 Ga0495640_0111910 Ga0495640_0111910_297_1046 249
370 3300046535 Ga0495586_0005179 Ga0495586_0005179_1064_1813 249
371 3300046536 Ga0495587_0071108 Ga0495587_0071108_449_1198 249
372 3300046538 Ga0495609_0064869 Ga0495609_0064869_21_770 249
373 3300046543 Ga0495645_0008980 Ga0495645_0008980_4712_5461 249
374 3300046559 Ga0495667_0007451 Ga0495667_0007451_6290_7039 249
375 3300046616 Ga0495668_0031504 Ga0495668_0031504_2212_2961 249
376 3300046616 Ga0495668_0138011 Ga0495668_0138011_284_1033 249
377 3300046642 Ga0495634_0001003 Ga0495634_0001003_11431_12180 249
378 3300046660 Ga0495625_0003213 Ga0495625_0003213_6895_7644 249
379 3300046660 Ga0495625_0038577 Ga0495625_0038577_177_926 249
380 3300046663 Ga0495635_0054696 Ga0495635_0054696_1490_2239 249
381 3300046665 Ga0495661_0051415 Ga0495661_0051415_934_1683 249
382 3300046674 Ga0495588_0058761 Ga0495588_0058761_210_959 249
383 3300046678 Ga0495599_0090734 Ga0495599_0090734_1022_1771 249
384 3300046679 Ga0495623_0016239 Ga0495623_0016239_2458_3207 249
385 3300046679 Ga0495623_0059574 Ga0495623_0059574_207_956 249
386 3300046680 Ga0495646_0027537 Ga0495646_0027537_1903_2652 249
387 3300046680 Ga0495646_0078441 Ga0495646_0078441_323_1072 249
388 3300046684 Ga0495669_0000955 Ga0495669_0000955_7675_8424 249
389 3300046684 Ga0495669_0009730 Ga0495669_0009730_587_1336 249
390 3300046689 Ga0495613_0018272 Ga0495613_0018272_2619_3368 249
391 3300046690 Ga0495624_0005609 Ga0495624_0005609_628_1377 249
392 3300046694 Ga0495649_0074711 Ga0495649_0074711_391_1140 249
393 3300046809 Ga0495600_0056708 Ga0495600_0056708_58_807 249
394 3300046809 Ga0495600_0370358 Ga0495600_0370358_61_810 249
395 3300047315 Ga0495581_0000275 Ga0495581_0000275_12746_13495 249
396 3300047315 Ga0495581_0088019 Ga0495581_0088019_131_880 249
397 3300047317 Ga0495604_0009860 Ga0495604_0009860_5378_6127 249
398 3300047317 Ga0495604_0027117 Ga0495604_0027117_3721_4470 249
399 3300047318 Ga0495636_0043935 Ga0495636_0043935_27_776 249
400 3300047319 Ga0495674_0009564 Ga0495674_0009564_3270_4019 249
401 3300047319 Ga0495674_0206302 Ga0495674_0206302_652_1401 249
402 3300047320 Ga0495672_0005628 Ga0495672_0005628_5337_6086 249
403 3300047320 Ga0495672_0072052 Ga0495672_0072052_1079_1828 249
404 3300047320 Ga0495672_0265726 Ga0495672_0265726_46_795 249
405 3300047321 Ga0495676_0014477 Ga0495676_0014477_1221_1970 249
406 3300047443 Ga0495687_040759 Ga0495687_040759_659_1408 249
407 3300047444 Ga0495675_0010737 Ga0495675_0010737_417_1166 249
408 3300047445 Ga0495677_0014034 Ga0495677_0014034_260_1009 249
409 3300047471 Ga0495684_0037444 Ga0495684_0037444_555_1304 249
410 3300047471 Ga0495684_0198973 Ga0495684_0198973_92_841 249
411 3300047472 Ga0495686_0000545 Ga0495686_0000545_16264_17013 249
412 3300047472 Ga0495686_0002881 Ga0495686_0002881_169_918 249
413 3300047472 Ga0495686_0011954 Ga0495686_0011954_1448_2197 249
414 3300047472 Ga0495686_0012883 Ga0495686_0012883_5011_5760 249
415 3300047673 Ga0495593_0119123 Ga0495593_0119123_174_923 249
416 3300048088 Ga0495602_0030031 Ga0495602_0030031_3348_4097 249
417 3300048089 Ga0495614_0006159 Ga0495614_0006159_2456_3205 249
418 3300048089 Ga0495614_0018911 Ga0495614_0018911_273_1022 249
419 3300048905 Ga0496102_0390029 Ga0496102_0390029_366_1115 249
420 3300048907 Ga0496104_0000247 Ga0496104_0000247_40200_40949 249
421 3300048907 Ga0496104_0257159 Ga0496104_0257159_357_1106 249
422 3300048908 Ga0496105_0375953 Ga0496105_0375953_189_938 249
423 3300048911 Ga0496108_0517993 Ga0496108_0517993_31_780 249
424 3300048912 Ga0496109_0089902 Ga0496109_0089902_1647_2396 249
425 3300048915 Ga0496112_0135829 Ga0496112_0135829_790_1539 249
426 3300048916 Ga0496113_0085556 Ga0496113_0085556_1238_1987 249
427 3300048918 Ga0496115_0162341 Ga0496115_0162341_659_1408 249
428 3300048919 Ga0496116_0009398 Ga0496116_0009398_4635_5384 249
429 3300048920 Ga0496117_0183529 Ga0496117_0183529_47_796 249
430 3300048929 Ga0496126_0000005 Ga0496126_0000005_869047_869796 249
431 3300048929 Ga0496126_0000209 Ga0496126_0000209_117422_118171 249
432 3300048929 Ga0496126_0000560 Ga0496126_0000560_13321_14070 249
433 3300048929 Ga0496126_0076168 Ga0496126_0076168_1129_1878 249
434 3300049568 Ga0501031_0035078 Ga0501031_0035078_2407_3156 249
435 3300049569 Ga0501032_0005510 Ga0501032_0005510_547_1296 249
436 3300049570 Ga0501033_0088222 Ga0501033_0088222_639_1388 249
437 3300049571 Ga0501034_0024414 Ga0501034_0024414_162_911 249
438 3300049572 Ga0501036_0001574 Ga0501036_0001574_11975_12724 249
439 3300049573 Ga0501037_0029947 Ga0501037_0029947_1506_2255 249
440 3300049574 Ga0501038_0021851 Ga0501038_0021851_3568_4317 249
441 3300049579 Ga0501043_0002607 Ga0501043_0002607_1260_2009 249
442 3300049579 Ga0501043_0193740 Ga0501043_0193740_203_952 249
443 3300049580 Ga0501046_0000150 Ga0501046_0000150_13254_14003 249
444 3300049581 Ga0501047_0003876 Ga0501047_0003876_13166_13915 249
445 3300049581 Ga0501047_0037910 Ga0501047_0037910_2190_2939 249
446 3300049584 Ga0501068_0301652 Ga0501068_0301652_119_868 249
447 3300049590 Ga0501074_0289035 Ga0501074_0289035_129_878 249
448 3300049742 Ga0501080_0051685 Ga0501080_0051685_1237_1986 249
449 3300049742 Ga0501080_0052843 Ga0501080_0052843_2494_3243 249
450 3300049822 Ga0501035_0004457 Ga0501035_0004457_9462_10211 249
451 3300049823 Ga0501044_0005372 Ga0501044_0005372_139_888 249
452 3300053077 Ga0495601_0019915 Ga0495601_0019915_666_1415 249
453 3300053093 Ga0500651_0000049 Ga0500651_0000049_13250_13999 249
454 3300053119 Ga0500595_000014 Ga0500595_000014_13223_13972 249
455 3300059423 Ga0590074_001275 Ga0590074_001275_686_1471 249
456 3300059424 Ga0590075_002910 Ga0590075_002910_21_806 249
457 3300059426 Ga0590077_004195 Ga0590077_004195_1768_2553 249
458 3300005327 Ga0070658_10615310 Ga0070658_106153101 250
459 3300005329 Ga0070683_100139567 Ga0070683_1001395672 250
460 3300005336 Ga0070680_100181162 Ga0070680_1001811622 250
461 3300005344 Ga0070661_100677188 Ga0070661_1006771881 250
462 3300005445 Ga0070708_100074375 Ga0070708_1000743754 250
463 3300005458 Ga0070681_10258473 Ga0070681_102584731 250
464 3300005530 Ga0070679_100129389 Ga0070679_1001293892 250
465 3300005530 Ga0070679_100136540 Ga0070679_1001365403 250
466 3300005535 Ga0070684_100192829 Ga0070684_1001928293 250
467 3300006237 Ga0097621_100211650 Ga0097621_1002116502 250
468 3300006844 Ga0075428_100413009 Ga0075428_1004130092 250
469 3300006846 Ga0075430_100370608 Ga0075430_1003706082 250
470 3300006852 Ga0075433_10052805 Ga0075433_100528055 250
471 3300006871 Ga0075434_100007963 Ga0075434_10000796314 250
472 3300006914 Ga0075436_100020847 Ga0075436_1000208473 250
473 3300006914 Ga0075436_100108712 Ga0075436_1001087122 250
474 3300007076 Ga0075435_100008444 Ga0075435_1000084449 250
475 3300009551 Ga0105238_10146657 Ga0105238_101466572 250
476 3300013296 Ga0157374_10054566 Ga0157374_100545666 250
477 3300014325 Ga0163163_10319719 Ga0163163_103197192 250
478 3300014969 Ga0157376_10243650 Ga0157376_102436503 250
479 3300025909 Ga0207705_10190806 Ga0207705_101908062 250
480 3300025909 Ga0207705_10251566 Ga0207705_102515663 250
481 3300025912 Ga0207707_10176404 Ga0207707_101764043 250
482 3300025912 Ga0207707_10208335 Ga0207707_102083352 250
483 3300025917 Ga0207660_10089871 Ga0207660_100898712 250
484 3300025917 Ga0207660_10279115 Ga0207660_102791153 250
485 3300025921 Ga0207652_10019825 Ga0207652_100198259 250
486 3300025921 Ga0207652_10243248 Ga0207652_102432483 250
487 3300025944 Ga0207661_10215005 Ga0207661_102150052 250
488 3300025949 Ga0207667_10620245 Ga0207667_106202451 250
489 3300026041 Ga0207639_10175476 Ga0207639_101754762 250
490 3300026116 Ga0207674_10184270 Ga0207674_101842703 250
491 3300026116 Ga0207674_10301449 Ga0207674_103014493 250
492 3300031995 Ga0307409_100516677 Ga0307409_1005166772 250
493 3300035692 Ga0373935_0045541 Ga0373935_0045541_265_1017 250
494 3300036401 Ga0373937_0120726 Ga0373937_0120726_524_1276 250
495 3300037068 Ga0373925_0046585 Ga0373925_0046585_387_1139 250
496 3300039450 Ga0436363_1450178 Ga0436363_1450178_32_790 250
497 3300042876 Ga0451577_0001113 Ga0451577_0001113_11081_11848 250
498 3300042876 Ga0451577_0006345 Ga0451577_0006345_7630_8397 250
499 3300042876 Ga0451577_0066882 Ga0451577_0066882_1990_2763 250
500 3300042876 Ga0451577_0127100 Ga0451577_0127100_990_1757 250
501 3300044673 Ga0453683_0001684 Ga0453683_0001684_11081_11848 250
502 3300044673 Ga0453683_0005320 Ga0453683_0005320_2052_2825 250
503 3300044673 Ga0453683_0009861 Ga0453683_0009861_3866_4633 250
504 3300044673 Ga0453683_0119218 Ga0453683_0119218_122_895 250
505 3300044693 Ga0466961_0230596 Ga0466961_0230596_113_871 250
506 3300044712 Ga0453684_0000258 Ga0453684_0000258_216465_217232 250
507 3300044712 Ga0453684_0032203 Ga0453684_0032203_1849_2622 250
508 3300044712 Ga0453684_0153937 Ga0453684_0153937_1167_1943 250
509 3300045049 Ga0466959_0118527 Ga0466959_0118527_944_1702 250
510 3300045051 Ga0451576_0003523 Ga0451576_0003523_14435_15208 250
511 3300045051 Ga0451576_0005411 Ga0451576_0005411_8838_9605 250
512 3300045051 Ga0451576_0017930 Ga0451576_0017930_987_1754 250
513 3300045051 Ga0451576_0268735 Ga0451576_0268735_400_1176 250
514 3300046454 Ga0495592_0134880 Ga0495592_0134880_381_1139 250
515 3300046543 Ga0495645_0222475 Ga0495645_0222475_325_1083 250
516 3300046678 Ga0495599_0068521 Ga0495599_0068521_545_1303 250
517 3300046691 Ga0495670_0032429 Ga0495670_0032429_1403_2155 250
518 3300047317 Ga0495604_0073444 Ga0495604_0073444_1197_1955 250
519 3300047471 Ga0495684_0244071 Ga0495684_0244071_437_1195 250
520 3300048088 Ga0495602_0130089 Ga0495602_0130089_730_1488 250
521 3300048913 Ga0496110_0597161 Ga0496110_0597161_54_806 250
522 3300048915 Ga0496112_0240404 Ga0496112_0240404_379_1137 250
523 3300050512 nmdc:mga0n895_71180_c1 nmdc:mga0n895_71180_c1_986_1744 250
524 3300050513 nmdc:mga0rr50_23085_c1 nmdc:mga0rr50_23085_c1_1181_1939 250
525 3300050514 nmdc:mga08x19_51928_c1 nmdc:mga08x19_51928_c1_461_1219 250
526 3300005444 Ga0070694_100338305 Ga0070694_1003383052 251
527 3300005468 Ga0070707_100337037 Ga0070707_1003370373 251
528 3300005471 Ga0070698_100015478 Ga0070698_1000154786 251
529 3300005981 Ga0081538_10028271 Ga0081538_100282713 251
530 3300014326 Ga0157380_10186521 Ga0157380_101865212 251
531 3300025916 Ga0207663_10501109 Ga0207663_105011092 251
532 3300025922 Ga0207646_10513079 Ga0207646_105130791 251
533 3300031090 Ga0265760_10012291 Ga0265760_100122912 251
534 3300031090 Ga0265760_10014127 Ga0265760_100141274 251
535 3300031090 Ga0265760_10020278 Ga0265760_100202782 251
536 3300031241 Ga0265325_10057154 Ga0265325_100571542 251
537 3300031241 Ga0265325_10176116 Ga0265325_101761161 251
538 3300031344 Ga0265316_10069991 Ga0265316_100699913 251
539 3300031344 Ga0265316_10170685 Ga0265316_101706853 251
540 3300031852 Ga0307410_10077593 Ga0307410_100775933 251
541 3300031995 Ga0307409_100229704 Ga0307409_1002297044 251
542 3300032002 Ga0307416_100092003 Ga0307416_1000920033 251
543 3300032004 Ga0307414_10202208 Ga0307414_102022082 251
544 3300042876 Ga0451577_0000033 Ga0451577_0000033_349602_350363 251
545 3300044673 Ga0453683_0094013 Ga0453683_0094013_356_1129 251
546 3300044712 Ga0453684_0000109 Ga0453684_0000109_11723_12484 251
547 3300046473 Ga0495582_0274329 Ga0495582_0274329_82_849 251
548 3300049588 Ga0501072_0246551 Ga0501072_0246551_378_1157 251
549 3300059426 Ga0590077_027574 Ga0590077_027574_207_998 251
550 3300002459 JGI24751J29686_10025647 JGI24751J29686_100256472 252
551 3300004803 Ga0058862_12783239 Ga0058862_127832393 252
552 3300005290 Ga0065712_10010472 Ga0065712_100104722 252
553 3300005290 Ga0065712_10071314 Ga0065712_100713143 252
554 3300005327 Ga0070658_10239990 Ga0070658_102399902 252
555 3300005328 Ga0070676_10078880 Ga0070676_100788802 252
556 3300005329 Ga0070683_100116656 Ga0070683_1001166563 252
557 3300005330 Ga0070690_100006534 Ga0070690_1000065343 252
558 3300005331 Ga0070670_100047369 Ga0070670_1000473695 252
559 3300005331 Ga0070670_100345458 Ga0070670_1003454582 252
560 3300005334 Ga0068869_100175092 Ga0068869_1001750922 252
561 3300005335 Ga0070666_10007809 Ga0070666_100078098 252
562 3300005335 Ga0070666_10069715 Ga0070666_100697154 252
563 3300005335 Ga0070666_10236804 Ga0070666_102368042 252
564 3300005338 Ga0068868_100227577 Ga0068868_1002275772 252
565 3300005339 Ga0070660_100002987 Ga0070660_1000029875 252
566 3300005339 Ga0070660_100075797 Ga0070660_1000757972 252
567 3300005340 Ga0070689_100064561 Ga0070689_1000645612 252
568 3300005344 Ga0070661_100085265 Ga0070661_1000852654 252
569 3300005354 Ga0070675_100000056 Ga0070675_10000005633 252
570 3300005355 Ga0070671_100141666 Ga0070671_1001416662 252
571 3300005356 Ga0070674_100008546 Ga0070674_1000085467 252
572 3300005356 Ga0070674_100219684 Ga0070674_1002196842 252
573 3300005364 Ga0070673_100003427 Ga0070673_1000034273 252
574 3300005365 Ga0070688_100070904 Ga0070688_1000709043 252
575 3300005366 Ga0070659_100059884 Ga0070659_1000598843 252
576 3300005367 Ga0070667_100315003 Ga0070667_1003150031 252
577 3300005436 Ga0070713_100025501 Ga0070713_1000255012 252
578 3300005438 Ga0070701_10100710 Ga0070701_101007102 252
579 3300005438 Ga0070701_10194700 Ga0070701_101947002 252
580 3300005441 Ga0070700_100563804 Ga0070700_1005638041 252
581 3300005445 Ga0070708_100100566 Ga0070708_1001005665 252
582 3300005445 Ga0070708_100236502 Ga0070708_1002365022 252
583 3300005458 Ga0070681_10047185 Ga0070681_100471855 252
584 3300005459 Ga0068867_100178546 Ga0068867_1001785462 252
585 3300005466 Ga0070685_10261157 Ga0070685_102611572 252
586 3300005467 Ga0070706_100014444 Ga0070706_1000144443 252
587 3300005467 Ga0070706_100386616 Ga0070706_1003866162 252
588 3300005468 Ga0070707_100012972 Ga0070707_1000129724 252
589 3300005471 Ga0070698_100040017 Ga0070698_1000400177 252
590 3300005471 Ga0070698_100324402 Ga0070698_1003244021 252
591 3300005471 Ga0070698_100348933 Ga0070698_1003489333 252
592 3300005518 Ga0070699_100004496 Ga0070699_1000044964 252
593 3300005518 Ga0070699_100006991 Ga0070699_1000069915 252
594 3300005518 Ga0070699_100200625 Ga0070699_1002006252 252
595 3300005518 Ga0070699_100333055 Ga0070699_1003330552 252
596 3300005530 Ga0070679_100044653 Ga0070679_1000446536 252
597 3300005536 Ga0070697_100059883 Ga0070697_1000598833 252
598 3300005536 Ga0070697_100111457 Ga0070697_1001114572 252
599 3300005543 Ga0070672_100306641 Ga0070672_1003066412 252
600 3300005543 Ga0070672_100549363 Ga0070672_1005493632 252
601 3300005544 Ga0070686_100095531 Ga0070686_1000955312 252
602 3300005548 Ga0070665_100004733 Ga0070665_1000047336 252
603 3300005548 Ga0070665_100010437 Ga0070665_10001043710 252
604 3300005549 Ga0070704_100176447 Ga0070704_1001764472 252
605 3300005549 Ga0070704_100365659 Ga0070704_1003656592 252
606 3300005563 Ga0068855_100019504 Ga0068855_1000195044 252
607 3300005564 Ga0070664_100080024 Ga0070664_1000800243 252
608 3300005577 Ga0068857_100247318 Ga0068857_1002473182 252
609 3300005578 Ga0068854_100215853 Ga0068854_1002158532 252
610 3300005614 Ga0068856_100507566 Ga0068856_1005075662 252
611 3300005615 Ga0070702_100034939 Ga0070702_1000349392 252
612 3300005617 Ga0068859_100026110 Ga0068859_1000261103 252
613 3300005617 Ga0068859_100260452 Ga0068859_1002604523 252
614 3300005617 Ga0068859_100315560 Ga0068859_1003155602 252
615 3300005618 Ga0068864_100098788 Ga0068864_1000987885 252
616 3300005718 Ga0068866_10024804 Ga0068866_100248046 252
617 3300005842 Ga0068858_100008638 Ga0068858_10000863819 252
618 3300005842 Ga0068858_100373013 Ga0068858_1003730131 252
619 3300005842 Ga0068858_100435265 Ga0068858_1004352652 252
620 3300005843 Ga0068860_100166724 Ga0068860_1001667244 252
621 3300005843 Ga0068860_100361999 Ga0068860_1003619992 252
622 3300005843 Ga0068860_100563070 Ga0068860_1005630702 252
623 3300005844 Ga0068862_100126963 Ga0068862_1001269632 252
624 3300005844 Ga0068862_100187532 Ga0068862_1001875322 252
625 3300005844 Ga0068862_100366282 Ga0068862_1003662822 252
626 3300006237 Ga0097621_100006061 Ga0097621_1000060619 252
627 3300006237 Ga0097621_100015176 Ga0097621_1000151763 252
628 3300006237 Ga0097621_100020231 Ga0097621_1000202316 252
629 3300006237 Ga0097621_100464583 Ga0097621_1004645832 252
630 3300006237 Ga0097621_100503003 Ga0097621_1005030032 252
631 3300006358 Ga0068871_100001728 Ga0068871_10000172813 252
632 3300006358 Ga0068871_100006055 Ga0068871_1000060554 252
633 3300006358 Ga0068871_100061643 Ga0068871_1000616436 252
634 3300006358 Ga0068871_100088164 Ga0068871_1000881643 252
635 3300006847 Ga0075431_100167049 Ga0075431_1001670494 252
636 3300006871 Ga0075434_100123476 Ga0075434_1001234763 252
637 3300006871 Ga0075434_100128953 Ga0075434_1001289532 252
638 3300006871 Ga0075434_100146743 Ga0075434_1001467432 252
639 3300006880 Ga0075429_100087511 Ga0075429_1000875114 252
640 3300006881 Ga0068865_100015593 Ga0068865_1000155936 252
641 3300006881 Ga0068865_100152892 Ga0068865_1001528925 252
642 3300006914 Ga0075436_100014321 Ga0075436_1000143213 252
643 3300006914 Ga0075436_100019702 Ga0075436_1000197028 252
644 3300006914 Ga0075436_100058745 Ga0075436_1000587453 252
645 3300006931 Ga0097620_100026110 Ga0097620_1000261108 252
646 3300006931 Ga0097620_100260449 Ga0097620_1002604493 252
647 3300006931 Ga0097620_100315544 Ga0097620_1003155442 252
648 3300007076 Ga0075435_100001694 Ga0075435_10000169424 252
649 3300007076 Ga0075435_100004862 Ga0075435_10000486211 252
650 3300007076 Ga0075435_100021902 Ga0075435_1000219028 252
651 3300007076 Ga0075435_100072955 Ga0075435_1000729553 252
652 3300007265 Ga0099794_10061435 Ga0099794_100614353 252
653 3300009093 Ga0105240_10077161 Ga0105240_100771615 252
654 3300009093 Ga0105240_10393217 Ga0105240_103932172 252
655 3300009094 Ga0111539_10000566 Ga0111539_1000056617 252
656 3300009094 Ga0111539_10005584 Ga0111539_1000558414 252
657 3300009094 Ga0111539_10541437 Ga0111539_105414372 252
658 3300009098 Ga0105245_10026276 Ga0105245_100262766 252
659 3300009101 Ga0105247_10028592 Ga0105247_100285922 252
660 3300009147 Ga0114129_10004861 Ga0114129_100048614 252
661 3300009147 Ga0114129_10060820 Ga0114129_100608204 252
662 3300009147 Ga0114129_10081911 Ga0114129_100819112 252
663 3300009147 Ga0114129_10106586 Ga0114129_101065863 252
664 3300009147 Ga0114129_10294188 Ga0114129_102941882 252
665 3300009148 Ga0105243_10071634 Ga0105243_100716343 252
666 3300009174 Ga0105241_10087967 Ga0105241_100879673 252
667 3300009177 Ga0105248_10019507 Ga0105248_100195075 252
668 3300009177 Ga0105248_10089526 Ga0105248_100895263 252
669 3300009177 Ga0105248_10094826 Ga0105248_100948266 252
670 3300009177 Ga0105248_10135047 Ga0105248_101350473 252
671 3300009177 Ga0105248_10169500 Ga0105248_101695003 252
672 3300009177 Ga0105248_10428740 Ga0105248_104287402 252
673 3300009177 Ga0105248_10564353 Ga0105248_105643532 252
674 3300009551 Ga0105238_10360448 Ga0105238_103604482 252
675 3300009553 Ga0105249_10483952 Ga0105249_104839522 252
676 3300010375 Ga0105239_10198030 Ga0105239_101980301 252
677 3300011119 Ga0105246_10048926 Ga0105246_100489262 252
678 3300013307 Ga0157372_10345978 Ga0157372_103459782 252
679 3300013308 Ga0157375_10185394 Ga0157375_101853944 252
680 3300013308 Ga0157375_11026482 Ga0157375_110264822 252
681 3300014325 Ga0163163_10064535 Ga0163163_100645354 252
682 3300014325 Ga0163163_10146285 Ga0163163_101462853 252
683 3300014326 Ga0157380_10052717 Ga0157380_100527174 252
684 3300014745 Ga0157377_10078424 Ga0157377_100784242 252
685 3300014968 Ga0157379_10144530 Ga0157379_101445304 252
686 3300014969 Ga0157376_10030126 Ga0157376_100301262 252
687 3300014969 Ga0157376_10045847 Ga0157376_100458475 252
688 3300014969 Ga0157376_10068436 Ga0157376_100684363 252
689 3300014969 Ga0157376_10158816 Ga0157376_101588162 252
690 3300014969 Ga0157376_10207123 Ga0157376_102071233 252
691 3300014969 Ga0157376_10576190 Ga0157376_105761902 252
692 3300025899 Ga0207642_10020722 Ga0207642_100207226 252
693 3300025903 Ga0207680_10049998 Ga0207680_100499983 252
694 3300025903 Ga0207680_10158383 Ga0207680_101583832 252
695 3300025912 Ga0207707_10042746 Ga0207707_100427462 252
696 3300025913 Ga0207695_10345777 Ga0207695_103457772 252
697 3300025917 Ga0207660_10033197 Ga0207660_100331972 252
698 3300025919 Ga0207657_10069052 Ga0207657_100690522 252
699 3300025920 Ga0207649_10167624 Ga0207649_101676242 252
700 3300025921 Ga0207652_10016976 Ga0207652_100169768 252
701 3300025921 Ga0207652_10017745 Ga0207652_100177452 252
702 3300025922 Ga0207646_10000343 Ga0207646_1000034326 252
703 3300025925 Ga0207650_10029449 Ga0207650_100294492 252
704 3300025926 Ga0207659_10001213 Ga0207659_1000121313 252
705 3300025926 Ga0207659_10453394 Ga0207659_104533942 252
706 3300025928 Ga0207700_10130792 Ga0207700_101307922 252
707 3300025932 Ga0207690_10118262 Ga0207690_101182624 252
708 3300025934 Ga0207686_10004734 Ga0207686_100047345 252
709 3300025934 Ga0207686_10150260 Ga0207686_101502604 252
710 3300025934 Ga0207686_10229107 Ga0207686_102291073 252
711 3300025936 Ga0207670_10191489 Ga0207670_101914892 252
712 3300025938 Ga0207704_10005824 Ga0207704_100058248 252
713 3300025939 Ga0207665_10058141 Ga0207665_100581414 252
714 3300025940 Ga0207691_10079684 Ga0207691_100796846 252
715 3300025940 Ga0207691_10347585 Ga0207691_103475852 252
716 3300025941 Ga0207711_10007764 Ga0207711_100077644 252
717 3300025941 Ga0207711_10039221 Ga0207711_100392217 252
718 3300025941 Ga0207711_10077530 Ga0207711_100775303 252
719 3300025941 Ga0207711_10380065 Ga0207711_103800652 252
720 3300025941 Ga0207711_10393153 Ga0207711_103931532 252
721 3300025941 Ga0207711_10522921 Ga0207711_105229212 252
722 3300025942 Ga0207689_10051675 Ga0207689_100516756 252
723 3300025942 Ga0207689_10107787 Ga0207689_101077872 252
724 3300025942 Ga0207689_10138408 Ga0207689_101384082 252
725 3300025949 Ga0207667_10023790 Ga0207667_100237904 252
726 3300025960 Ga0207651_10061070 Ga0207651_100610706 252
727 3300025960 Ga0207651_10598290 Ga0207651_105982902 252
728 3300025986 Ga0207658_10283792 Ga0207658_102837921 252
729 3300026035 Ga0207703_10032738 Ga0207703_100327386 252
730 3300026088 Ga0207641_10187187 Ga0207641_101871873 252
731 3300026088 Ga0207641_10281307 Ga0207641_102813072 252
732 3300026089 Ga0207648_10096571 Ga0207648_100965712 252
733 3300026089 Ga0207648_10135195 Ga0207648_101351952 252
734 3300026095 Ga0207676_10076735 Ga0207676_100767353 252
735 3300026095 Ga0207676_10363422 Ga0207676_103634222 252
736 3300026116 Ga0207674_10209419 Ga0207674_102094191 252
737 3300026116 Ga0207674_10327989 Ga0207674_103279892 252
738 3300026116 Ga0207674_10431436 Ga0207674_104314362 252
739 3300026118 Ga0207675_100273429 Ga0207675_1002734292 252
740 3300026121 Ga0207683_10032201 Ga0207683_100322016 252
741 3300026121 Ga0207683_10240809 Ga0207683_102408092 252
742 3300026121 Ga0207683_10350096 Ga0207683_103500962 252
743 3300027907 Ga0207428_10111063 Ga0207428_101110631 252
744 3300028379 Ga0268266_10005896 Ga0268266_1000589615 252
745 3300028379 Ga0268266_10029767 Ga0268266_100297678 252
746 3300028380 Ga0268265_10183463 Ga0268265_101834633 252
747 3300028380 Ga0268265_10626017 Ga0268265_106260172 252
748 3300028381 Ga0268264_10145483 Ga0268264_101454832 252
749 3300028381 Ga0268264_10732567 Ga0268264_107325672 252
750 3300028800 Ga0265338_10083576 Ga0265338_100835764 252
751 3300031240 Ga0265320_10084511 Ga0265320_100845112 252
752 3300031711 Ga0265314_10013729 Ga0265314_100137292 252
753 3300032002 Ga0307416_100202969 Ga0307416_1002029691 252
754 3300032126 Ga0307415_100717358 Ga0307415_1007173582 252
755 3300034820 Ga0373959_0000924 Ga0373959_0000924_1591_2364 252
756 3300034957 Ga0373938_0017018 Ga0373938_0017018_143_916 252
757 3300035084 Ga0373928_0003435 Ga0373928_0003435_1475_2248 252
758 3300035085 Ga0373929_0000116 Ga0373929_0000116_5324_6097 252
759 3300035088 Ga0373940_0000084 Ga0373940_0000084_9205_9978 252
760 3300035090 Ga0373949_0019342 Ga0373949_0019342_388_1161 252
761 3300035112 Ga0373932_0000807 Ga0373932_0000807_5504_6277 252
762 3300035113 Ga0373936_0048513 Ga0373936_0048513_116_889 252
763 3300035114 Ga0373939_0096860 Ga0373939_0096860_175_948 252
764 3300035115 Ga0373941_0000161 Ga0373941_0000161_10384_11157 252
765 3300035116 Ga0373945_0107256 Ga0373945_0107256_89_862 252
766 3300035118 Ga0373954_0158733 Ga0373954_0158733_293_1066 252
767 3300035118 Ga0373954_0261659 Ga0373954_0261659_61_834 252
768 3300035121 Ga0373960_0000753 Ga0373960_0000753_3154_3927 252
769 3300035172 Ga0373955_0103149 Ga0373955_0103149_753_1526 252
770 3300035207 Ga0373942_0001757 Ga0373942_0001757_143_916 252
771 3300035241 Ga0373961_0001371 Ga0373961_0001371_1237_2010 252
772 3300035242 Ga0373962_0000245 Ga0373962_0000245_144_917 252
773 3300035410 Ga0373924_0013554 Ga0373924_0013554_2042_2815 252
774 3300035691 Ga0373931_0004378 Ga0373931_0004378_5632_6405 252
775 3300035692 Ga0373935_0053767 Ga0373935_0053767_1368_2141 252
776 3300035725 Ga0373947_0040913 Ga0373947_0040913_814_1587 252
777 3300036401 Ga0373937_0029266 Ga0373937_0029266_1634_2419 252
778 3300036401 Ga0373937_0103229 Ga0373937_0103229_888_1661 252
779 3300036401 Ga0373937_0274871 Ga0373937_0274871_558_1331 252
780 3300036401 Ga0373937_0554909 Ga0373937_0554909_179_952 252
781 3300037068 Ga0373925_0005941 Ga0373925_0005941_8069_8842 252
782 3300038443 Ga0395901_0728164 Ga0395901_0728164_69_842 252
783 3300042120 Ga0450917_003592 Ga0450917_003592_283_1053 252
784 3300042129 Ga0450891_003545 Ga0450891_003545_354_1124 252
785 3300042436 Ga0439435_0019796 Ga0439435_0019796_146_916 252
786 3300042876 Ga0451577_0019789 Ga0451577_0019789_3061_3837 252
787 3300044673 Ga0453683_0005105 Ga0453683_0005105_5192_5968 252
788 3300044694 Ga0466963_0085217 Ga0466963_0085217_1090_1863 252
789 3300044694 Ga0466963_0170099 Ga0466963_0170099_81_854 252
790 3300044712 Ga0453684_0008349 Ga0453684_0008349_5619_6395 252
791 3300045051 Ga0451576_0027325 Ga0451576_0027325_3396_4172 252
792 3300045051 Ga0451576_0030890 Ga0451576_0030890_4377_5150 252
793 3300045051 Ga0451576_0055322 Ga0451576_0055322_698_1471 252
794 3300045051 Ga0451576_0582350 Ga0451576_0582350_167_940 252
795 3300046459 Ga0495629_0056581 Ga0495629_0056581_243_1016 252
796 3300046472 Ga0495580_0220030 Ga0495580_0220030_41_814 252
797 3300046472 Ga0495580_0434515 Ga0495580_0434515_60_833 252
798 3300046473 Ga0495582_0105380 Ga0495582_0105380_237_1010 252
799 3300046477 Ga0495664_0133863 Ga0495664_0133863_153_926 252
800 3300046511 Ga0495608_0004188 Ga0495608_0004188_7847_8620 252
801 3300046516 Ga0495628_0118357 Ga0495628_0118357_667_1440 252
802 3300046516 Ga0495628_0247535 Ga0495628_0247535_234_1019 252
803 3300046517 Ga0495630_0010900 Ga0495630_0010900_3531_4304 252
804 3300046529 Ga0495652_0081707 Ga0495652_0081707_523_1296 252
805 3300046533 Ga0495640_0028932 Ga0495640_0028932_1032_1805 252
806 3300046543 Ga0495645_0004427 Ga0495645_0004427_6797_7582 252
807 3300046543 Ga0495645_0027506 Ga0495645_0027506_1341_2114 252
808 3300046559 Ga0495667_0023465 Ga0495667_0023465_1550_2323 252
809 3300046663 Ga0495635_0104808 Ga0495635_0104808_365_1138 252
810 3300046663 Ga0495635_0252379 Ga0495635_0252379_18_791 252
811 3300046675 Ga0495657_0103606 Ga0495657_0103606_1010_1783 252
812 3300046680 Ga0495646_0247826 Ga0495646_0247826_55_828 252
813 3300046681 Ga0495647_0130370 Ga0495647_0130370_200_973 252
814 3300046683 Ga0495658_0124747 Ga0495658_0124747_760_1533 252
815 3300046684 Ga0495669_0000560 Ga0495669_0000560_10095_10868 252
816 3300046689 Ga0495613_0013985 Ga0495613_0013985_3446_4219 252
817 3300046690 Ga0495624_0237689 Ga0495624_0237689_103_876 252
818 3300047315 Ga0495581_0211960 Ga0495581_0211960_350_1123 252
819 3300047315 Ga0495581_0237560 Ga0495581_0237560_128_901 252
820 3300047319 Ga0495674_0088249 Ga0495674_0088249_692_1477 252
821 3300047322 Ga0495680_0030110 Ga0495680_0030110_1813_2586 252
822 3300047322 Ga0495680_0084304 Ga0495680_0084304_943_1716 252
823 3300047444 Ga0495675_0170815 Ga0495675_0170815_77_850 252
824 3300047471 Ga0495684_0009393 Ga0495684_0009393_4030_4803 252
825 3300048903 Ga0496100_0004796 Ga0496100_0004796_6414_7187 252
826 3300048905 Ga0496102_0186737 Ga0496102_0186737_164_940 252
827 3300048907 Ga0496104_0017385 Ga0496104_0017385_1444_2229 252
828 3300048907 Ga0496104_0040982 Ga0496104_0040982_391_1164 252
829 3300048907 Ga0496104_0076019 Ga0496104_0076019_911_1684 252
830 3300048908 Ga0496105_0223881 Ga0496105_0223881_339_1112 252
831 3300048909 Ga0496106_0239861 Ga0496106_0239861_291_1064 252
832 3300048910 Ga0496107_0028952 Ga0496107_0028952_498_1271 252
833 3300048911 Ga0496108_0250451 Ga0496108_0250451_385_1158 252
834 3300048911 Ga0496108_0267599 Ga0496108_0267599_354_1139 252
835 3300048912 Ga0496109_0062051 Ga0496109_0062051_2435_3208 252
836 3300048912 Ga0496109_0457255 Ga0496109_0457255_67_840 252
837 3300048913 Ga0496110_0416811 Ga0496110_0416811_333_1106 252
838 3300048914 Ga0496111_0238753 Ga0496111_0238753_512_1285 252
839 3300048914 Ga0496111_0258881 Ga0496111_0258881_82_855 252
840 3300048915 Ga0496112_0016237 Ga0496112_0016237_2719_3504 252
841 3300048915 Ga0496112_0093303 Ga0496112_0093303_1618_2391 252
842 3300048915 Ga0496112_0383151 Ga0496112_0383151_278_1051 252
843 3300048915 Ga0496112_0428668 Ga0496112_0428668_426_1199 252
844 3300048915 Ga0496112_0524600 Ga0496112_0524600_255_1028 252
845 3300048917 Ga0496114_0000246 Ga0496114_0000246_8246_9019 252
846 3300048917 Ga0496114_0098572 Ga0496114_0098572_224_1009 252
847 3300048917 Ga0496114_0213426 Ga0496114_0213426_582_1370 252
848 3300048917 Ga0496114_0640718 Ga0496114_0640718_113_886 252
849 3300049583 Ga0501067_0162452 Ga0501067_0162452_120_893 252
850 3300049743 Ga0501081_0272372 Ga0501081_0272372_68_841 252
851 3300049744 Ga0501083_0055182 Ga0501083_0055182_1169_1942 252
852 3300050507 nmdc:mga05p37_279225_c1 nmdc:mga05p37_279225_c1_857_1627 252
853 3300050507 nmdc:mga05p37_3048_c1 nmdc:mga05p37_3048_c1_17459_18232 252
854 3300050507 nmdc:mga05p37_46662_c1 nmdc:mga05p37_46662_c1_1602_2372 252
855 3300050507 nmdc:mga05p37_549024_c1 nmdc:mga05p37_549024_c1_206_982 252
856 3300050507 nmdc:mga05p37_595_c1 nmdc:mga05p37_595_c1_11669_12442 252
857 3300050507 nmdc:mga05p37_78337_c2 nmdc:mga05p37_78337_c2_2193_2966 252
858 3300050508 nmdc:mga09592_168412_c1 nmdc:mga09592_168412_c1_765_1541 252
859 3300050510 nmdc:mga06r32_27167_c2 nmdc:mga06r32_27167_c2_2671_3447 252
860 3300050511 nmdc:mga08y16_17177_c1 nmdc:mga08y16_17177_c1_5873_6646 252
861 3300050511 nmdc:mga08y16_59748_c1 nmdc:mga08y16_59748_c1_1269_2042 252
862 3300050512 nmdc:mga0n895_12870_c1 nmdc:mga0n895_12870_c1_4778_5551 252
863 3300050512 nmdc:mga0n895_134377_c1 nmdc:mga0n895_134377_c1_164_934 252
864 3300050512 nmdc:mga0n895_142639_c1 nmdc:mga0n895_142639_c1_1207_1977 252
865 3300050512 nmdc:mga0n895_735049_c1 nmdc:mga0n895_735049_c1_110_883 252
866 3300050513 nmdc:mga0rr50_139029_c1 nmdc:mga0rr50_139029_c1_639_1412 252
867 3300050513 nmdc:mga0rr50_21352_c1 nmdc:mga0rr50_21352_c1_2545_3318 252
868 3300050513 nmdc:mga0rr50_2205_c1 nmdc:mga0rr50_2205_c1_5045_5815 252
869 3300050513 nmdc:mga0rr50_3252_c1 nmdc:mga0rr50_3252_c1_1947_2720 252
870 3300050513 nmdc:mga0rr50_373_c1 nmdc:mga0rr50_373_c1_15100_15873 252
871 3300050513 nmdc:mga0rr50_60229_c1 nmdc:mga0rr50_60229_c1_518_1291 252
872 3300050513 nmdc:mga0rr50_9864_c1 nmdc:mga0rr50_9864_c1_4917_5690 252
873 3300050514 nmdc:mga08x19_15605_c1 nmdc:mga08x19_15605_c1_1059_1832 252
874 3300050514 nmdc:mga08x19_78043_c1 nmdc:mga08x19_78043_c1_653_1426 252
875 3300050514 nmdc:mga08x19_90727_c1 nmdc:mga08x19_90727_c1_214_1059 252
876 3300050515 nmdc:mga0a205_10346_c1 nmdc:mga0a205_10346_c1_2295_3065 252
877 3300050515 nmdc:mga0a205_47564_c1 nmdc:mga0a205_47564_c1_1973_2743 252
878 3300053077 Ga0495601_0063448 Ga0495601_0063448_1218_1991 252
879 3300053077 Ga0495601_0126279 Ga0495601_0126279_821_1606 252
880 3300053083 Ga0495655_0010860 Ga0495655_0010860_173_946 252
881 3300053084 Ga0495595_0030502 Ga0495595_0030502_1553_2326 252
882 3300053084 Ga0495595_0102853 Ga0495595_0102853_253_1038 252
883 3300053085 Ga0495619_0004075 Ga0495619_0004075_6189_6962 252
884 3300053085 Ga0495619_0029701 Ga0495619_0029701_2193_2966 252
885 3300053085 Ga0495619_0062284 Ga0495619_0062284_1397_2182 252
886 3300060353 Ga0501082_0175766 Ga0501082_0175766_424_1224 252
887 3300005340 Ga0070689_100112365 Ga0070689_1001123651 253
888 3300005347 Ga0070668_100547736 Ga0070668_1005477361 253
889 3300005353 Ga0070669_100035389 Ga0070669_1000353895 253
890 3300005355 Ga0070671_100031409 Ga0070671_1000314097 253
891 3300005365 Ga0070688_100132643 Ga0070688_1001326432 253
892 3300005468 Ga0070707_100272326 Ga0070707_1002723262 253
893 3300005471 Ga0070698_100003045 Ga0070698_10000304525 253
894 3300005471 Ga0070698_100260579 Ga0070698_1002605792 253
895 3300005841 Ga0068863_100098324 Ga0068863_1000983243 253
896 3300005843 Ga0068860_100204933 Ga0068860_1002049332 253
897 3300005844 Ga0068862_100021021 Ga0068862_1000210213 253
898 3300005937 Ga0081455_10025866 Ga0081455_100258662 253
899 3300006358 Ga0068871_100286689 Ga0068871_1002866894 253
900 3300006844 Ga0075428_100055934 Ga0075428_1000559343 253
901 3300006852 Ga0075433_10114798 Ga0075433_101147983 253
902 3300006871 Ga0075434_100240424 Ga0075434_1002404242 253
903 3300009094 Ga0111539_10380566 Ga0111539_103805662 253
904 3300009147 Ga0114129_10033059 Ga0114129_100330593 253
905 3300009147 Ga0114129_10078194 Ga0114129_100781946 253
906 3300009177 Ga0105248_10013460 Ga0105248_100134605 253
907 3300009177 Ga0105248_10371694 Ga0105248_103716942 253
908 3300009553 Ga0105249_10261220 Ga0105249_102612202 253
909 3300013102 Ga0157371_10260778 Ga0157371_102607781 253
910 3300013297 Ga0157378_10083535 Ga0157378_100835352 253
911 3300014968 Ga0157379_10082081 Ga0157379_100820811 253
912 3300014969 Ga0157376_10235850 Ga0157376_102358502 253
913 3300025918 Ga0207662_10119494 Ga0207662_101194943 253
914 3300025940 Ga0207691_10033820 Ga0207691_100338203 253
915 3300025960 Ga0207651_10317438 Ga0207651_103174382 253
916 3300026088 Ga0207641_10001674 Ga0207641_1000167421 253
917 3300026089 Ga0207648_10190814 Ga0207648_101908142 253
918 3300026118 Ga0207675_100121913 Ga0207675_1001219135 253
919 3300027907 Ga0207428_10070330 Ga0207428_100703303 253
920 3300028381 Ga0268264_10111054 Ga0268264_101110543 253
921 3300031548 Ga0307408_100087781 Ga0307408_1000877812 253
922 3300035092 Ga0373952_0037917 Ga0373952_0037917_132_914 253
923 3300035112 Ga0373932_0009460 Ga0373932_0009460_136_918 253
924 3300042137 Ga0450902_021445 Ga0450902_021445_276_1049 253
925 3300046454 Ga0495592_0342953 Ga0495592_0342953_44_817 253
926 3300046615 Ga0495656_0184261 Ga0495656_0184261_110_892 253
927 3300048905 Ga0496102_0213964 Ga0496102_0213964_813_1595 253
928 3300048912 Ga0496109_0206954 Ga0496109_0206954_978_1760 253
929 3300050507 nmdc:mga05p37_20610_c1 nmdc:mga05p37_20610_c1_4977_5759 253
930 3300050507 nmdc:mga05p37_25099_c1 nmdc:mga05p37_25099_c1_1767_2549 253
931 3300050507 nmdc:mga05p37_6561_c1 nmdc:mga05p37_6561_c1_9132_9959 253
932 3300050508 nmdc:mga09592_428202_c1 nmdc:mga09592_428202_c1_309_1091 253
933 3300050511 nmdc:mga08y16_169354_c1 nmdc:mga08y16_169354_c1_1268_2050 253
934 3300050515 nmdc:mga0a205_72605_c1 nmdc:mga0a205_72605_c1_1203_1985 253
935 3300005293 Ga0065715_10094515 Ga0065715_100945156 254
936 3300005295 Ga0065707_10167480 Ga0065707_101674802 254
937 3300005335 Ga0070666_10382760 Ga0070666_103827602 254
938 3300005340 Ga0070689_100043206 Ga0070689_1000432062 254
939 3300005354 Ga0070675_100224737 Ga0070675_1002247372 254
940 3300005438 Ga0070701_10065697 Ga0070701_100656971 254
941 3300005457 Ga0070662_100524581 Ga0070662_1005245811 254
942 3300005545 Ga0070695_100034315 Ga0070695_1000343153 254
943 3300005546 Ga0070696_100118842 Ga0070696_1001188422 254
944 3300005617 Ga0068859_100004442 Ga0068859_1000044424 254
945 3300005719 Ga0068861_100196107 Ga0068861_1001961072 254
946 3300005843 Ga0068860_100205882 Ga0068860_1002058822 254
947 3300005844 Ga0068862_100051237 Ga0068862_1000512373 254
948 3300006844 Ga0075428_100000009 Ga0075428_100000009208 254
949 3300006931 Ga0097620_100004442 Ga0097620_10000444224 254
950 3300009094 Ga0111539_10000010 Ga0111539_1000001030 254
951 3300009553 Ga0105249_10233757 Ga0105249_102337573 254
952 3300025907 Ga0207645_10174320 Ga0207645_101743202 254
953 3300025933 Ga0207706_10126975 Ga0207706_101269753 254
954 3300025933 Ga0207706_10552701 Ga0207706_105527012 254
955 3300025936 Ga0207670_10141333 Ga0207670_101413332 254
956 3300026121 Ga0207683_10393482 Ga0207683_103934822 254
957 3300027907 Ga0207428_10000034 Ga0207428_10000034190 254
958 3300028381 Ga0268264_10234483 Ga0268264_102344832 254
959 3300031548 Ga0307408_100252141 Ga0307408_1002521412 254
960 3300032005 Ga0307411_10041711 Ga0307411_100417114 254
961 3300032126 Ga0307415_100423547 Ga0307415_1004235472 254
962 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_438771_439583 254
963 3300002239 JGI24034J26672_10023592 JGI24034J26672_100235921 256
964 3300003659 JGI25404J52841_10004671 JGI25404J52841_100046712 256
965 3300005295 Ga0065707_10005887 Ga0065707_100058871 256
966 3300005327 Ga0070658_10001004 Ga0070658_1000100427 256
967 3300005328 Ga0070676_10000510 Ga0070676_1000051022 256
968 3300005329 Ga0070683_100017258 Ga0070683_1000172586 256
969 3300005330 Ga0070690_100000366 Ga0070690_10000036626 256
970 3300005334 Ga0068869_100002833 Ga0068869_10000283314 256
971 3300005336 Ga0070680_100075087 Ga0070680_1000750873 256
972 3300005338 Ga0068868_100002098 Ga0068868_10000209810 256
973 3300005339 Ga0070660_100027583 Ga0070660_1000275834 256
974 3300005340 Ga0070689_100001862 Ga0070689_10000186212 256
975 3300005343 Ga0070687_100000205 Ga0070687_10000020521 256
976 3300005344 Ga0070661_100009522 Ga0070661_1000095226 256
977 3300005345 Ga0070692_10001681 Ga0070692_100016813 256
978 3300005347 Ga0070668_100001206 Ga0070668_10000120617 256
979 3300005354 Ga0070675_100002314 Ga0070675_10000231420 256
980 3300005355 Ga0070671_100005888 Ga0070671_1000058888 256
981 3300005356 Ga0070674_100000202 Ga0070674_10000020220 256
982 3300005364 Ga0070673_100005301 Ga0070673_10000530112 256
983 3300005365 Ga0070688_100000519 Ga0070688_1000005199 256
984 3300005366 Ga0070659_100000088 Ga0070659_10000008833 256
985 3300005440 Ga0070705_100000543 Ga0070705_10000054310 256
986 3300005441 Ga0070700_100185954 Ga0070700_1001859542 256
987 3300005455 Ga0070663_100021838 Ga0070663_1000218385 256
988 3300005456 Ga0070678_100004288 Ga0070678_1000042886 256
989 3300005466 Ga0070685_10000717 Ga0070685_1000071716 256
990 3300005530 Ga0070679_100312644 Ga0070679_1003126441 256
991 3300005539 Ga0068853_100000347 Ga0068853_10000034719 256
992 3300005543 Ga0070672_100000351 Ga0070672_10000035131 256
993 3300005544 Ga0070686_100000914 Ga0070686_10000091420 256
994 3300005545 Ga0070695_100230632 Ga0070695_1002306322 256
995 3300005547 Ga0070693_100041481 Ga0070693_1000414813 256
996 3300005563 Ga0068855_100000527 Ga0068855_10000052735 256
997 3300005564 Ga0070664_100008108 Ga0070664_10000810810 256
998 3300005564 Ga0070664_100016133 Ga0070664_1000161335 256
999 3300005577 Ga0068857_100005689 Ga0068857_10000568917 256
1000 3300005577 Ga0068857_100024303 Ga0068857_1000243036 256
1001 3300005578 Ga0068854_100000245 Ga0068854_10000024534 256
1002 3300005614 Ga0068856_100022481 Ga0068856_1000224813 256
1003 3300005615 Ga0070702_100370516 Ga0070702_1003705161 256
1004 3300005616 Ga0068852_100001092 Ga0068852_10000109220 256
1005 3300005617 Ga0068859_100000315 Ga0068859_10000031523 256
1006 3300005618 Ga0068864_100000998 Ga0068864_10000099813 256
1007 3300005718 Ga0068866_10000101 Ga0068866_1000010127 256
1008 3300005719 Ga0068861_100006034 Ga0068861_10000603413 256
1009 3300005834 Ga0068851_10000245 Ga0068851_1000024523 256
1010 3300005840 Ga0068870_10000036 Ga0068870_1000003630 256
1011 3300005841 Ga0068863_100000343 Ga0068863_10000034334 256
1012 3300005983 Ga0081540_1000264 Ga0081540_10002649 256
1013 3300005983 Ga0081540_1009729 Ga0081540_10097297 256
1014 3300005983 Ga0081540_1010957 Ga0081540_10109572 256
1015 3300006237 Ga0097621_100000177 Ga0097621_10000017734 256
1016 3300006358 Ga0068871_100006948 Ga0068871_1000069487 256
1017 3300006931 Ga0097620_100000315 Ga0097620_10000031523 256
1018 3300009093 Ga0105240_10001604 Ga0105240_1000160428 256
1019 3300009098 Ga0105245_10000166 Ga0105245_1000016641 256
1020 3300009101 Ga0105247_10001356 Ga0105247_1000135611 256
1021 3300009174 Ga0105241_10001205 Ga0105241_100012055 256
1022 3300009176 Ga0105242_10003060 Ga0105242_1000306015 256
1023 3300009177 Ga0105248_10006569 Ga0105248_100065694 256
1024 3300009545 Ga0105237_10001703 Ga0105237_1000170323 256
1025 3300009551 Ga0105238_10000391 Ga0105238_1000039133 256
1026 3300009553 Ga0105249_10000319 Ga0105249_1000031925 256
1027 3300010375 Ga0105239_10000707 Ga0105239_1000070734 256
1028 3300011119 Ga0105246_10000493 Ga0105246_1000049325 256
1029 3300013100 Ga0157373_10025268 Ga0157373_100252683 256
1030 3300013102 Ga0157371_10000492 Ga0157371_1000049223 256
1031 3300013105 Ga0157369_10004814 Ga0157369_1000481423 256
1032 3300013296 Ga0157374_10001527 Ga0157374_1000152723 256
1033 3300013297 Ga0157378_10000975 Ga0157378_1000097517 256
1034 3300013306 Ga0163162_10001548 Ga0163162_1000154823 256
1035 3300013307 Ga0157372_10002029 Ga0157372_100020296 256
1036 3300013308 Ga0157375_10059650 Ga0157375_100596504 256
1037 3300014325 Ga0163163_10001027 Ga0163163_1000102715 256
1038 3300014745 Ga0157377_10000364 Ga0157377_1000036415 256
1039 3300014968 Ga0157379_10000136 Ga0157379_1000013626 256
1040 3300014969 Ga0157376_10000282 Ga0157376_1000028230 256
1041 3300017792 Ga0163161_10003977 Ga0163161_100039774 256
1042 3300025315 Ga0207697_10001780 Ga0207697_100017804 256
1043 3300025321 Ga0207656_10023292 Ga0207656_100232923 256
1044 3300025893 Ga0207682_10000392 Ga0207682_1000039229 256
1045 3300025899 Ga0207642_10026880 Ga0207642_100268804 256
1046 3300025901 Ga0207688_10000089 Ga0207688_1000008913 256
1047 3300025903 Ga0207680_10014898 Ga0207680_100148984 256
1048 3300025904 Ga0207647_10000810 Ga0207647_1000081031 256
1049 3300025907 Ga0207645_10003099 Ga0207645_100030994 256
1050 3300025908 Ga0207643_10000030 Ga0207643_1000003086 256
1051 3300025909 Ga0207705_10003131 Ga0207705_100031314 256
1052 3300025911 Ga0207654_10003953 Ga0207654_100039535 256
1053 3300025912 Ga0207707_10106078 Ga0207707_101060783 256
1054 3300025914 Ga0207671_10002141 Ga0207671_1000214126 256
1055 3300025918 Ga0207662_10000128 Ga0207662_1000012823 256
1056 3300025919 Ga0207657_10000011 Ga0207657_1000001134 256
1057 3300025920 Ga0207649_10002988 Ga0207649_100029887 256
1058 3300025923 Ga0207681_10000822 Ga0207681_1000082213 256
1059 3300025924 Ga0207694_10033732 Ga0207694_100337324 256
1060 3300025925 Ga0207650_10000283 Ga0207650_1000028328 256
1061 3300025926 Ga0207659_10000996 Ga0207659_1000099627 256
1062 3300025927 Ga0207687_10007299 Ga0207687_100072994 256
1063 3300025931 Ga0207644_10020458 Ga0207644_100204584 256
1064 3300025932 Ga0207690_10002489 Ga0207690_1000248920 256
1065 3300025933 Ga0207706_10000365 Ga0207706_1000036536 256
1066 3300025936 Ga0207670_10000186 Ga0207670_1000018635 256
1067 3300025938 Ga0207704_10000310 Ga0207704_1000031027 256
1068 3300025940 Ga0207691_10000341 Ga0207691_1000034123 256
1069 3300025941 Ga0207711_10003067 Ga0207711_1000306724 256
1070 3300025942 Ga0207689_10000224 Ga0207689_1000022435 256
1071 3300025944 Ga0207661_10005036 Ga0207661_100050367 256
1072 3300025945 Ga0207679_10000998 Ga0207679_1000099814 256
1073 3300025945 Ga0207679_10001873 Ga0207679_1000187321 256
1074 3300025960 Ga0207651_10000056 Ga0207651_1000005635 256
1075 3300025972 Ga0207668_10014382 Ga0207668_100143826 256
1076 3300025981 Ga0207640_10001784 Ga0207640_1000178413 256
1077 3300025986 Ga0207658_10000630 Ga0207658_1000063025 256
1078 3300026023 Ga0207677_10000047 Ga0207677_1000004776 256
1079 3300026035 Ga0207703_10000494 Ga0207703_100004944 256
1080 3300026041 Ga0207639_10000846 Ga0207639_1000084622 256
1081 3300026067 Ga0207678_10009274 Ga0207678_1000927412 256
1082 3300026075 Ga0207708_10337013 Ga0207708_103370131 256
1083 3300026078 Ga0207702_10005139 Ga0207702_100051394 256
1084 3300026088 Ga0207641_10000554 Ga0207641_1000055411 256
1085 3300026089 Ga0207648_10002554 Ga0207648_1000255413 256
1086 3300026095 Ga0207676_10001365 Ga0207676_1000136520 256
1087 3300026116 Ga0207674_10021388 Ga0207674_100213884 256
1088 3300026116 Ga0207674_10032281 Ga0207674_100322816 256
1089 3300026118 Ga0207675_100000009 Ga0207675_10000000924 256
1090 3300026121 Ga0207683_10010789 Ga0207683_100107897 256
1091 3300026142 Ga0207698_10002960 Ga0207698_1000296014 256
1092 3300028379 Ga0268266_10001917 Ga0268266_1000191714 256
1093 3300028381 Ga0268264_10005545 Ga0268264_100055454 256
1094 3300042876 Ga0451577_0150505 Ga0451577_0150505_399_1172 256
1095 3300045051 Ga0451576_0050576 Ga0451576_0050576_1134_1907 256
1096 3300046683 Ga0495658_0029349 Ga0495658_0029349_1060_1830 256
1097 3300048905 Ga0496102_0092046 Ga0496102_0092046_686_1456 256
1098 3300048906 Ga0496103_0028809 Ga0496103_0028809_1301_2071 256
1099 3300048912 Ga0496109_0006179 Ga0496109_0006179_6971_7741 256
1100 3300048915 Ga0496112_0002572 Ga0496112_0002572_3138_3908 256
1101 3300048916 Ga0496113_0109304 Ga0496113_0109304_544_1314 256
1102 3300061734 Ga0530510_0015081 Ga0530510_0015081_373_1179 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

11

239

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9911 2 249
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9845 2 248
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9832 2 249
5yoi-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105t mutant) in complex with methionine 0.979 5 249
5yoh-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105m mutant) in complex with methionine 0.9789 5 249
ID Description Score Start End Superfamily
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9911 2 249 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9832 2 249 3.90.230.10
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9826 15 125 3.90.230.10
af_Q4VBS4_53_336_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9814 2 251 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9806 5 248 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A7W1ELN7-F1-model_v4 M24 family metallopeptidase 0.9986 125 249 GO:0005829
GO:0070006
AF-A0A1F9XM49-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9973 2 249 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A534Y610-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9972 1 249 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A2N1UPX4-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.997 2 203 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-K1Z9M1-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9959 5 248 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Feature Viewer

pLDDT pTM Quality
96.7 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map