F490009

General Info

Members Datasets Scaffolds Average Seq Length
1097 463 1074 184

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_004843|Ga0500645_004843_1747_2376
Length 209
Sequence LPDACESTISVARFVTWEDEVTRLSPPLDSCPALVLNADFRPLSYFPLSLWSWQDTVKAVFLDRVNILSHYDQTVRSPNFEMRLPSVISLKEYVQATRRPAFTRFNVFLRDSFTCQYCGTGFPTHELTFDHVIPRSRGGRTTWDNVLTACSCCNLRKGDKLCRECGMHPRLEPFQPSAFELQENGRQFPPNFLHESWRDYLYWDSELDS

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
5 2643221733 Bosea sp. Root381 Isolate Unclassified
6 2643221734 Bosea sp. Root670 Isolate Unclassified
7 2643221736 Bosea sp. Root483D1 Isolate Unclassified
8 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
9 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
10 2773857925 Microvirga vignae BR3299 Isolate Unclassified
11 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
12 2818991467 Bosea vestrisii 3192 Isolate Unclassified
13 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
14 2841760612 Bosea sp. Tri-49 Isolate Nodule
15 2844104063 Bosea sp. Tri-39 Isolate Nodule
16 2851182111 Bosea sp. Tri-44 Isolate Nodule
17 2851246043 Bosea sp. Tri-54 Isolate Nodule
18 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
19 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
20 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
21 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
22 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
137 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
138 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
211 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
212 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
213 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
214 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
229 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
232 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
233 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
234 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
239 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
240 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
241 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
242 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
247 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
249 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
250 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
251 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
255 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
258 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
259 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
260 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
263 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
267 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
280 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
281 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
282 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
283 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
284 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
285 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
286 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
287 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
288 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
289 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
290 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
291 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
292 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
293 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
294 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
295 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
296 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
297 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
298 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
305 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
306 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
307 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
308 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
309 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
310 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
311 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
312 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
313 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
314 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
315 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
316 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
317 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
318 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
319 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
320 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
321 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
322 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
323 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
324 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
325 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
326 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
327 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
328 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
329 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
330 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
331 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
332 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
333 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
334 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
335 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
336 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
337 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
338 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
339 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
340 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
341 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
342 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
345 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
346 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
347 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
348 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
349 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
350 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
351 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
352 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
355 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
356 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
357 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
358 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
378 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
379 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
380 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
381 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
382 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
383 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
384 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
399 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
400 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
401 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
402 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
403 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
404 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
405 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
406 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
407 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
408 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
409 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
410 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
411 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
412 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
413 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
414 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
417 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
418 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
419 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
420 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
421 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
422 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
423 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
424 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
425 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
426 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
427 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
428 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
429 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
430 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
431 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
432 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
433 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
434 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
435 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
436 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
437 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
438 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
439 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
440 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
441 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
442 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
443 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
444 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
445 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
446 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
447 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
448 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
449 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
450 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
451 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
452 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
453 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
454 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
455 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
456 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
457 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
458 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
459 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
460 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
461 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
462 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
463 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0.09
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.38
Nodule 0.91
Rhizoplane 2.83
Rhizosphere 85.23
Stem 0
Stem Tuber 0
Unclassified 4.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10065118 3300003187 Bacteria 1136
2 JGI25165J46597_1000035 3300003214 Bacteria 290723
3 JGI25153J46596_10001002 3300003215 Bacteria 17171
4 JGI25404J52841_10004507 3300003659 Bacteria 2828
5 Ga0055526_1000017 3300003771 Bacteria 210613
6 Ga0055524_1000346 3300003775 Bacteria 42383
7 Ga0055534_1020864 3300003784 Bacteria 1102
8 Ga0058862_12227048 3300004803 Bacteria 754
9 Ga0065165_1000014 3300005262 Bacteria 292366
10 Ga0070658_10013783 3300005327 Bacteria 6487
11 Ga0070658_10065932 3300005327 Bacteria 2957
12 Ga0070658_10168949 3300005327 Bacteria 1837
13 Ga0070658_10392359 3300005327 Bacteria 1192
14 Ga0070683_100538067 3300005329 Bacteria 1117
15 Ga0070670_100209151 3300005331 Bacteria 1696
16 Ga0070670_101232511 3300005331 Bacteria 684
17 Ga0070680_100019997 3300005336 Bacteria 5308
18 Ga0068868_100074643 3300005338 Bacteria 2709
19 Ga0068868_100777868 3300005338 Bacteria 862
20 Ga0070660_100026293 3300005339 Bacteria 4332
21 Ga0070660_100048071 3300005339 Bacteria 3275
22 Ga0070660_100175509 3300005339 Bacteria 1733
23 Ga0070660_100245190 3300005339 Bacteria 1460
24 Ga0070660_100294341 3300005339 Bacteria 1330
25 Ga0070689_100562049 3300005340 Bacteria 984
26 Ga0070691_10000082 3300005341 Bacteria 26541
27 Ga0070691_10005590 3300005341 Bacteria 5721
28 Ga0070691_10208519 3300005341 Bacteria 1030
29 Ga0070661_100037883 3300005344 Bacteria 3509
30 Ga0070661_100054716 3300005344 Bacteria 2923
31 Ga0070661_100263221 3300005344 Bacteria 1334
32 Ga0070661_100855708 3300005344 Bacteria 749
33 Ga0070668_100000460 3300005347 Bacteria 26920
34 Ga0070669_100008586 3300005353 Bacteria 7293
35 Ga0070675_101055289 3300005354 Bacteria 747
36 Ga0070674_100156460 3300005356 Bacteria 1725
37 Ga0070659_100072331 3300005366 Bacteria 2743
38 Ga0070667_100000286 3300005367 Bacteria 57006
39 Ga0070667_100003377 3300005367 Bacteria 13615
40 Ga0070667_100012865 3300005367 Bacteria 6914
41 Ga0070709_10000238 3300005434 Bacteria 35500
42 Ga0070709_10045744 3300005434 Bacteria 2718
43 Ga0070714_100102534 3300005435 Bacteria 2523
44 Ga0070714_100783559 3300005435 Bacteria 923
45 Ga0070713_100000011 3300005436 Bacteria 146314
46 Ga0070713_100151412 3300005436 Bacteria 2064
47 Ga0070710_10127880 3300005437 Bacteria 1546
48 Ga0070710_10454226 3300005437 Bacteria 869
49 Ga0070701_10119472 3300005438 Bacteria 1483
50 Ga0070711_100356823 3300005439 Bacteria 1176
51 Ga0070711_100574444 3300005439 Unclassified 938
52 Ga0070705_100064547 3300005440 Bacteria 2188
53 Ga0070663_100077387 3300005455 Bacteria 2435
54 Ga0070678_100002013 3300005456 Bacteria 10984
55 Ga0070678_100031753 3300005456 Bacteria 3648
56 Ga0070678_100193757 3300005456 Bacteria 1673
57 Ga0070681_10030628 3300005458 Bacteria 5400
58 Ga0070681_10233974 3300005458 Bacteria 1751
59 Ga0068867_100014884 3300005459 Bacteria 5513
60 Ga0068867_100120838 3300005459 Bacteria 2024
61 Ga0070698_100937610 3300005471 Bacteria 812
62 Ga0070679_100057246 3300005530 Bacteria 3886
63 Ga0070679_100111217 3300005530 Bacteria 2725
64 Ga0070679_100195179 3300005530 Bacteria 1992
65 Ga0070684_100089015 3300005535 Bacteria 2743
66 Ga0070697_100041945 3300005536 Bacteria 3704
67 Ga0068853_100047449 3300005539 Bacteria 3685
68 Ga0068853_100093302 3300005539 Bacteria 2650
69 Ga0068853_100177958 3300005539 Bacteria 1928
70 Ga0068853_100258552 3300005539 Bacteria 1600
71 Ga0068853_100801823 3300005539 Bacteria 902
72 Ga0070695_100016895 3300005545 Bacteria 4422
73 Ga0070695_100055449 3300005545 Bacteria 2554
74 Ga0070696_100110164 3300005546 Bacteria 1982
75 Ga0070693_100033589 3300005547 Bacteria 2832
76 Ga0070693_100402999 3300005547 Bacteria 949
77 Ga0070665_100002597 3300005548 Bacteria 19721
78 Ga0070665_100043299 3300005548 Bacteria 4524
79 Ga0070665_100057758 3300005548 Bacteria 3890
80 Ga0070665_100151997 3300005548 Bacteria 2318
81 Ga0070665_100272665 3300005548 Bacteria 1694
82 Ga0070665_100288383 3300005548 Bacteria 1644
83 Ga0070665_100492091 3300005548 Bacteria 1237
84 Ga0070665_100623458 3300005548 Bacteria 1091
85 Ga0070665_101045588 3300005548 Bacteria 828
86 Ga0068855_100000106 3300005563 Bacteria 103864
87 Ga0068855_100006202 3300005563 Bacteria 14572
88 Ga0068855_100012271 3300005563 Bacteria 10354
89 Ga0068855_100014142 3300005563 Bacteria 9615
90 Ga0068855_100027939 3300005563 Bacteria 6749
91 Ga0068855_100055070 3300005563 Bacteria 4673
92 Ga0068855_100077683 3300005563 Bacteria 3852
93 Ga0068855_100138942 3300005563 Bacteria 2771
94 Ga0068855_100483284 3300005563 Bacteria 1348
95 Ga0068855_100528692 3300005563 Bacteria 1279
96 Ga0070664_100039249 3300005564 Bacteria 3989
97 Ga0070664_100362090 3300005564 Bacteria 1321
98 Ga0068857_100005182 3300005577 Bacteria 11087
99 Ga0068857_100088072 3300005577 Bacteria 2777
100 Ga0068857_100584454 3300005577 Bacteria 1054
101 Ga0068856_100000964 3300005614 Bacteria 30705
102 Ga0068856_100003424 3300005614 Bacteria 16037
103 Ga0068856_100210874 3300005614 Bacteria 1958
104 Ga0068856_100258190 3300005614 Bacteria 1758
105 Ga0068856_100546245 3300005614 Bacteria 1180
106 Ga0068856_101287059 3300005614 Bacteria 746
107 Ga0070702_100416808 3300005615 Bacteria 965
108 Ga0068852_100005817 3300005616 Bacteria 8853
109 Ga0068852_100244694 3300005616 Bacteria 1716
110 Ga0068852_101474884 3300005616 Bacteria 702
111 Ga0068859_100166394 3300005617 Bacteria 2285
112 Ga0068859_100448827 3300005617 Bacteria 1386
113 Ga0068864_100070798 3300005618 Bacteria 3035
114 Ga0068866_10026254 3300005718 Bacteria 2748
115 Ga0068861_101100664 3300005719 Bacteria 763
116 Ga0068851_10074425 3300005834 Bacteria 1763
117 Ga0068863_100000168 3300005841 Bacteria 70935
118 Ga0068863_100201536 3300005841 Bacteria 1914
119 Ga0068863_100986815 3300005841 Bacteria 845
120 Ga0068858_100028088 3300005842 Bacteria 5228
121 Ga0068858_100132435 3300005842 Bacteria 2338
122 Ga0068860_100170056 3300005843 Bacteria 2105
123 Ga0068860_100272964 3300005843 Bacteria 1651
124 Ga0068862_100380837 3300005844 Bacteria 1316
125 Ga0068862_100684859 3300005844 Bacteria 992
126 Ga0081538_10000555 3300005981 Bacteria 41352
127 Ga0081540_1000085 3300005983 Bacteria 99716
128 Ga0081540_1012270 3300005983 Bacteria 5660
129 Ga0081539_10056561 3300005985 Bacteria 2176
130 Ga0070717_10602427 3300006028 Bacteria 997
131 Ga0075368_10199700 3300006042 Bacteria 846
132 Ga0075364_10257245 3300006051 Bacteria 1187
133 Ga0070716_100155533 3300006173 Bacteria 1476
134 Ga0070712_100000014 3300006175 Bacteria 108668
135 Ga0070712_100000314 3300006175 Bacteria 27319
136 Ga0075367_10102956 3300006178 Bacteria 1747
137 Ga0075367_10358281 3300006178 Bacteria 921
138 Ga0075369_10030068 3300006186 Bacteria 2286
139 Ga0075369_10132287 3300006186 Bacteria 1134
140 Ga0097621_100011176 3300006237 Bacteria 6607
141 Ga0068871_100007657 3300006358 Bacteria 7726
142 Ga0075428_100028440 3300006844 Bacteria 6185
143 Ga0075430_100013832 3300006846 Bacteria 6876
144 Ga0075430_100093408 3300006846 Bacteria 2515
145 Ga0075430_100094425 3300006846 Bacteria 2500
146 Ga0075431_100000880 3300006847 Bacteria 26403
147 Ga0075433_10204790 3300006852 Bacteria 1754
148 Ga0075434_100108181 3300006871 Bacteria 2791
149 Ga0075434_100194094 3300006871 Bacteria 2051
150 Ga0075429_100000855 3300006880 Bacteria 23955
151 Ga0068865_100025832 3300006881 Bacteria 3867
152 Ga0068865_100125667 3300006881 Bacteria 1914
153 Ga0068865_100293988 3300006881 Bacteria 1298
154 Ga0068865_100639903 3300006881 Bacteria 903
155 Ga0075436_100000047 3300006914 Bacteria 72907
156 Ga0075436_100015996 3300006914 Bacteria 5136
157 Ga0075436_100098258 3300006914 Bacteria 2037
158 Ga0097620_100166403 3300006931 Bacteria 2285
159 Ga0097620_100448782 3300006931 Bacteria 1386
160 Ga0075435_100030692 3300007076 Bacteria 4229
161 Ga0075435_100075730 3300007076 Bacteria 2757
162 Ga0075435_100367529 3300007076 Bacteria 1235
163 Ga0075435_100455725 3300007076 Bacteria 1103
164 Ga0099794_10479520 3300007265 Bacteria 653
165 Ga0105244_10149710 3300009036 Bacteria 1119
166 Ga0105240_10000055 3300009093 Bacteria 225380
167 Ga0105240_10011987 3300009093 Bacteria 12015
168 Ga0105240_10015552 3300009093 Bacteria 10342
169 Ga0105240_10028212 3300009093 Bacteria 7335
170 Ga0105240_10033158 3300009093 Bacteria 6675
171 Ga0105240_10059737 3300009093 Bacteria 4757
172 Ga0105240_10187103 3300009093 Bacteria 2438
173 Ga0105240_10318352 3300009093 Bacteria 1774
174 Ga0105240_11199516 3300009093 Bacteria 804
175 Ga0111539_10000367 3300009094 Bacteria 55719
176 Ga0111539_10076197 3300009094 Bacteria 3949
177 Ga0105245_10818295 3300009098 Bacteria 970
178 Ga0105245_11251745 3300009098 Bacteria 790
179 Ga0105247_10016288 3300009101 Bacteria 4453
180 Ga0105247_10200079 3300009101 Bacteria 1342
181 Ga0114129_10000825 3300009147 Bacteria 40003
182 Ga0114129_10054590 3300009147 Bacteria 5602
183 Ga0114129_10176535 3300009147 Bacteria 2909
184 Ga0114129_10203225 3300009147 Bacteria 2682
185 Ga0114129_11027880 3300009147 Bacteria 1036
186 Ga0105243_10395671 3300009148 Bacteria 1282
187 Ga0105243_11242240 3300009148 Bacteria 760
188 Ga0105241_10022531 3300009174 Bacteria 4666
189 Ga0105241_10230233 3300009174 Bacteria 1562
190 Ga0105241_10301851 3300009174 Bacteria 1375
191 Ga0105242_10219682 3300009176 Bacteria 1698
192 Ga0105242_10495986 3300009176 Bacteria 1160
193 Ga0105248_10031038 3300009177 Bacteria 5971
194 Ga0105248_10039182 3300009177 Bacteria 5306
195 Ga0105248_10109932 3300009177 Bacteria 3108
196 Ga0105248_10482647 3300009177 Bacteria 1397
197 Ga0105248_10695449 3300009177 Bacteria 1147
198 Ga0105237_10014301 3300009545 Bacteria 8307
199 Ga0105237_10015763 3300009545 Bacteria 7860
200 Ga0105237_10070274 3300009545 Bacteria 3497
201 Ga0105237_10208069 3300009545 Bacteria 1956
202 Ga0105237_10259103 3300009545 Bacteria 1742
203 Ga0105237_10706943 3300009545 Bacteria 1014
204 Ga0105237_11693442 3300009545 Bacteria 640
205 Ga0105238_10003708 3300009551 Bacteria 15199
206 Ga0105238_10059046 3300009551 Bacteria 3843
207 Ga0105238_10171582 3300009551 Bacteria 2145
208 Ga0105238_10301334 3300009551 Bacteria 1586
209 Ga0105238_10347755 3300009551 Bacteria 1471
210 Ga0105249_10017761 3300009553 Bacteria 6319
211 Ga0105249_10410476 3300009553 Bacteria 1386
212 Ga0105249_10702721 3300009553 Bacteria 1071
213 Ga0099796_10031529 3300010159 Bacteria 1729
214 Ga0105239_10004084 3300010375 Bacteria 17564
215 Ga0105239_10036916 3300010375 Bacteria 5360
216 Ga0105239_10068805 3300010375 Bacteria 3891
217 Ga0105239_10140823 3300010375 Bacteria 2687
218 Ga0105239_10150764 3300010375 Bacteria 2595
219 Ga0105239_10195832 3300010375 Bacteria 2263
220 Ga0105239_10590879 3300010375 Bacteria 1266
221 Ga0105239_10710453 3300010375 Bacteria 1149
222 Ga0105246_10009904 3300011119 Bacteria 5878
223 Ga0105246_10280295 3300011119 Bacteria 1337
224 Ga0157373_10166258 3300013100 Bacteria 1552
225 Ga0157370_10004453 3300013104 Bacteria 16057
226 Ga0157370_10123082 3300013104 Bacteria 2422
227 Ga0157370_10280808 3300013104 Bacteria 1539
228 Ga0157370_10389712 3300013104 Bacteria 1283
229 Ga0157369_10395457 3300013105 Bacteria 1434
230 Ga0157369_10705866 3300013105 Bacteria 1038
231 Ga0157369_10835689 3300013105 Bacteria 946
232 Ga0171462_1012 3300013250 Bacteria 208216
233 Ga0157374_10025468 3300013296 Bacteria 5312
234 Ga0157374_10053771 3300013296 Bacteria 3754
235 Ga0157374_10119881 3300013296 Bacteria 2538
236 Ga0157378_10217130 3300013297 Bacteria 1816
237 Ga0157378_10407490 3300013297 Bacteria 1341
238 Ga0163162_10044647 3300013306 Bacteria 4439
239 Ga0163162_10051883 3300013306 Bacteria 4117
240 Ga0163162_10283378 3300013306 Bacteria 1789
241 Ga0163162_10585205 3300013306 Bacteria 1243
242 Ga0163162_11042084 3300013306 Bacteria 926
243 Ga0163162_11744522 3300013306 Bacteria 711
244 Ga0157372_10001838 3300013307 Bacteria 23006
245 Ga0157372_10021266 3300013307 Bacteria 7008
246 Ga0157372_10071967 3300013307 Bacteria 3895
247 Ga0157372_10153838 3300013307 Bacteria 2656
248 Ga0157372_10172222 3300013307 Bacteria 2505
249 Ga0157372_11203848 3300013307 Bacteria 875
250 Ga0157375_10022440 3300013308 Bacteria 5809
251 Ga0157375_10358402 3300013308 Bacteria 1624
252 Ga0163163_10000012 3300014325 Bacteria 257369
253 Ga0163163_10440936 3300014325 Bacteria 1362
254 Ga0163163_10589756 3300014325 Bacteria 1174
255 Ga0157380_10028596 3300014326 Bacteria 4252
256 Ga0157380_10139607 3300014326 Bacteria 2080
257 Ga0157380_10646276 3300014326 Bacteria 1054
258 Ga0182008_10043533 3300014497 Bacteria 2235
259 Ga0157379_10002345 3300014968 Bacteria 15799
260 Ga0157379_10014522 3300014968 Bacteria 6912
261 Ga0157379_10022783 3300014968 Bacteria 5550
262 Ga0157379_10102466 3300014968 Bacteria 2569
263 Ga0157379_10155032 3300014968 Bacteria 2066
264 Ga0157376_10002383 3300014969 Bacteria 12692
265 Ga0157376_10163184 3300014969 Bacteria 2022
266 Ga0163161_10003599 3300017792 Bacteria 10865
267 Ga0163161_10572422 3300017792 Bacteria 928
268 Ga0213873_10060593 3300021358 Bacteria 1024
269 Ga0213872_10044499 3300021361 Bacteria 2020
270 Ga0213874_10142791 3300021377 Bacteria 830
271 Ga0213876_10000537 3300021384 Bacteria 28569
272 Ga0213876_10020516 3300021384 Bacteria 3493
273 Ga0213876_10208064 3300021384 Bacteria 1040
274 Ga0213871_10042895 3300021441 Bacteria 1219
275 Ga0209233_1000006 3300025261 Bacteria 1473685
276 Ga0209233_1002157 3300025261 Bacteria 7381
277 Ga0209233_1010276 3300025261 Bacteria 2814
278 Ga0209455_1020699 3300025272 Bacteria 1296
279 Ga0209130_1000024 3300025284 Bacteria 354212
280 Ga0209675_1000712 3300025291 Bacteria 22719
281 Ga0209025_1000008 3300025294 Bacteria 1130876
282 Ga0209025_1001592 3300025294 Bacteria 28567
283 Ga0209564_1000015 3300025295 Bacteria 615324
284 Ga0209564_1000031 3300025295 Bacteria 494703
285 Ga0209758_1000008 3300025297 Bacteria 1215263
286 Ga0209758_1084564 3300025297 Bacteria 948
287 Ga0209256_1000181 3300025299 Bacteria 123624
288 Ga0209256_1000205 3300025299 Bacteria 111530
289 Ga0209257_1068891 3300025304 Bacteria 938
290 Ga0207656_10061995 3300025321 Bacteria 1643
291 Ga0207682_10143384 3300025893 Bacteria 1073
292 Ga0207692_10096178 3300025898 Bacteria 1616
293 Ga0207642_10108754 3300025899 Bacteria 1407
294 Ga0207710_10131905 3300025900 Bacteria 1200
295 Ga0207710_10256332 3300025900 Bacteria 876
296 Ga0207680_10001937 3300025903 Bacteria 9718
297 Ga0207680_10005414 3300025903 Bacteria 6099
298 Ga0207680_10065939 3300025903 Bacteria 2225
299 Ga0207647_10460503 3300025904 Bacteria 712
300 Ga0207699_10000233 3300025906 Bacteria 31418
301 Ga0207699_10138978 3300025906 Bacteria 1594
302 Ga0207699_10205688 3300025906 Bacteria 1336
303 Ga0207645_10005584 3300025907 Bacteria 9097
304 Ga0207705_10000058 3300025909 Bacteria 155967
305 Ga0207705_10004973 3300025909 Bacteria 9971
306 Ga0207705_10013975 3300025909 Bacteria 5788
307 Ga0207654_10011752 3300025911 Bacteria 4469
308 Ga0207707_10100605 3300025912 Bacteria 2526
309 Ga0207707_10131316 3300025912 Bacteria 2190
310 Ga0207707_10601225 3300025912 Bacteria 931
311 Ga0207695_10000012 3300025913 Bacteria 840961
312 Ga0207695_10003622 3300025913 Bacteria 21591
313 Ga0207695_10009386 3300025913 Bacteria 12100
314 Ga0207695_10016906 3300025913 Bacteria 8513
315 Ga0207695_10022595 3300025913 Bacteria 7135
316 Ga0207695_10026509 3300025913 Bacteria 6469
317 Ga0207695_10084002 3300025913 Bacteria 3215
318 Ga0207695_10111558 3300025913 Bacteria 2714
319 Ga0207695_10135676 3300025913 Bacteria 2414
320 Ga0207695_10177592 3300025913 Bacteria 2051
321 Ga0207695_10210009 3300025913 Bacteria 1858
322 Ga0207671_10032398 3300025914 Bacteria 3891
323 Ga0207671_10041489 3300025914 Bacteria 3406
324 Ga0207671_10054219 3300025914 Bacteria 2971
325 Ga0207671_10103585 3300025914 Bacteria 2158
326 Ga0207671_10904575 3300025914 Bacteria 698
327 Ga0207693_10000018 3300025915 Bacteria 138365
328 Ga0207693_10000276 3300025915 Bacteria 47566
329 Ga0207663_10255259 3300025916 Bacteria 1292
330 Ga0207663_10424707 3300025916 Unclassified 1021
331 Ga0207660_10003913 3300025917 Bacteria 9706
332 Ga0207660_10059809 3300025917 Bacteria 2737
333 Ga0207660_10111876 3300025917 Bacteria 2056
334 Ga0207660_10556548 3300025917 Bacteria 933
335 Ga0207657_10001163 3300025919 Bacteria 27950
336 Ga0207657_10048575 3300025919 Bacteria 3704
337 Ga0207657_10076217 3300025919 Bacteria 2830
338 Ga0207657_10127414 3300025919 Bacteria 2090
339 Ga0207657_10209736 3300025919 Bacteria 1564
340 Ga0207657_10406424 3300025919 Bacteria 1071
341 Ga0207649_10060208 3300025920 Bacteria 2385
342 Ga0207649_10212659 3300025920 Bacteria 1373
343 Ga0207652_10017999 3300025921 Bacteria 5789
344 Ga0207652_10094808 3300025921 Bacteria 2628
345 Ga0207652_10223206 3300025921 Bacteria 1698
346 Ga0207681_10004489 3300025923 Bacteria 8591
347 Ga0207694_10000006 3300025924 Bacteria 631109
348 Ga0207694_10048560 3300025924 Bacteria 3284
349 Ga0207694_10071716 3300025924 Bacteria 2707
350 Ga0207694_10095479 3300025924 Bacteria 2350
351 Ga0207694_10265334 3300025924 Bacteria 1407
352 Ga0207694_10276699 3300025924 Bacteria 1378
353 Ga0207650_10588503 3300025925 Bacteria 935
354 Ga0207650_10777761 3300025925 Bacteria 811
355 Ga0207659_10112193 3300025926 Bacteria 2074
356 Ga0207687_10058007 3300025927 Bacteria 2722
357 Ga0207687_10058623 3300025927 Bacteria 2709
358 Ga0207700_10000005 3300025928 Bacteria 394836
359 Ga0207700_10098721 3300025928 Bacteria 2324
360 Ga0207700_10156506 3300025928 Bacteria 1888
361 Ga0207700_10297353 3300025928 Bacteria 1393
362 Ga0207700_10980997 3300025928 Bacteria 756
363 Ga0207664_10016200 3300025929 Bacteria 5431
364 Ga0207664_10245800 3300025929 Bacteria 1560
365 Ga0207664_10433441 3300025929 Bacteria 1172
366 Ga0207690_10012687 3300025932 Bacteria 5049
367 Ga0207690_10974988 3300025932 Bacteria 705
368 Ga0207686_10070923 3300025934 Bacteria 2240
369 Ga0207686_10332011 3300025934 Bacteria 1139
370 Ga0207709_10014211 3300025935 Bacteria 4394
371 Ga0207709_10228974 3300025935 Bacteria 1345
372 Ga0207709_10592101 3300025935 Bacteria 877
373 Ga0207670_10595891 3300025936 Bacteria 907
374 Ga0207669_10258786 3300025937 Bacteria 1300
375 Ga0207704_10069864 3300025938 Bacteria 2221
376 Ga0207704_10126082 3300025938 Bacteria 1763
377 Ga0207704_10176381 3300025938 Bacteria 1539
378 Ga0207665_10190158 3300025939 Bacteria 1491
379 Ga0207691_10450005 3300025940 Bacteria 1096
380 Ga0207711_10013219 3300025941 Bacteria 6858
381 Ga0207711_10274730 3300025941 Bacteria 1551
382 Ga0207711_10336468 3300025941 Bacteria 1397
383 Ga0207711_10779036 3300025941 Bacteria 891
384 Ga0207711_10991979 3300025941 Bacteria 779
385 Ga0207679_10467744 3300025945 Bacteria 1120
386 Ga0207667_10000026 3300025949 Bacteria 343713
387 Ga0207667_10002838 3300025949 Bacteria 21514
388 Ga0207667_10007703 3300025949 Bacteria 12887
389 Ga0207667_10010294 3300025949 Bacteria 10945
390 Ga0207667_10015427 3300025949 Bacteria 8679
391 Ga0207667_10054254 3300025949 Bacteria 4216
392 Ga0207667_10158337 3300025949 Bacteria 2330
393 Ga0207667_10347395 3300025949 Bacteria 1513
394 Ga0207651_10074676 3300025960 Bacteria 2415
395 Ga0207712_10014867 3300025961 Bacteria 5012
396 Ga0207668_10000430 3300025972 Bacteria 26480
397 Ga0207640_10040754 3300025981 Bacteria 2949
398 Ga0207640_10821368 3300025981 Bacteria 807
399 Ga0207640_11213628 3300025981 Bacteria 671
400 Ga0207658_10000243 3300025986 Bacteria 57023
401 Ga0207658_10016628 3300025986 Bacteria 5063
402 Ga0207658_10023373 3300025986 Bacteria 4314
403 Ga0207677_10004318 3300026023 Bacteria 7614
404 Ga0207703_10030782 3300026035 Bacteria 4241
405 Ga0207703_10108592 3300026035 Bacteria 2363
406 Ga0207639_10039304 3300026041 Bacteria 3524
407 Ga0207639_10123960 3300026041 Bacteria 2128
408 Ga0207639_10231800 3300026041 Bacteria 1601
409 Ga0207678_10038547 3300026067 Bacteria 4152
410 Ga0207708_10155971 3300026075 Bacteria 1800
411 Ga0207708_11061115 3300026075 Bacteria 705
412 Ga0207702_10001080 3300026078 Bacteria 27929
413 Ga0207702_10144432 3300026078 Bacteria 2157
414 Ga0207702_10378154 3300026078 Bacteria 1361
415 Ga0207702_10414983 3300026078 Bacteria 1301
416 Ga0207702_11279586 3300026078 Bacteria 727
417 Ga0207641_10000241 3300026088 Bacteria 71027
418 Ga0207648_10009495 3300026089 Bacteria 9309
419 Ga0207648_10032185 3300026089 Bacteria 4631
420 Ga0207648_10160988 3300026089 Bacteria 1982
421 Ga0207676_10043534 3300026095 Bacteria 3458
422 Ga0207674_10000112 3300026116 Bacteria 94220
423 Ga0207674_10087310 3300026116 Bacteria 3113
424 Ga0207674_10125019 3300026116 Bacteria 2538
425 Ga0207674_10141586 3300026116 Bacteria 2364
426 Ga0207674_10410658 3300026116 Bacteria 1308
427 Ga0207675_100507766 3300026118 Bacteria 1201
428 Ga0207683_10003082 3300026121 Bacteria 14565
429 Ga0207683_10049440 3300026121 Bacteria 3681
430 Ga0207683_10049446 3300026121 Bacteria 3681
431 Ga0207683_10079367 3300026121 Bacteria 2910
432 Ga0207683_10130897 3300026121 Bacteria 2257
433 Ga0207683_10296793 3300026121 Bacteria 1478
434 Ga0207698_10007028 3300026142 Bacteria 7050
435 Ga0207698_10126006 3300026142 Bacteria 2178
436 Ga0207698_10173140 3300026142 Bacteria 1903
437 Ga0207698_11146899 3300026142 Bacteria 791
438 Ga0207428_10008616 3300027907 Bacteria 9207
439 Ga0268266_10000463 3300028379 Bacteria 59089
440 Ga0268266_10051760 3300028379 Bacteria 3525
441 Ga0268266_10088010 3300028379 Bacteria 2718
442 Ga0268266_10156033 3300028379 Bacteria 2061
443 Ga0268266_10172741 3300028379 Bacteria 1962
444 Ga0268266_10256215 3300028379 Bacteria 1620
445 Ga0268266_10337188 3300028379 Bacteria 1414
446 Ga0268265_10443931 3300028380 Bacteria 1210
447 Ga0268265_10512437 3300028380 Bacteria 1132
448 Ga0268264_10051832 3300028381 Bacteria 3421
449 Ga0268264_10109120 3300028381 Bacteria 2420
450 Ga0265337_1077861 3300028556 Bacteria 908
451 Ga0265334_10008085 3300028573 Bacteria 4486
452 Ga0265318_10000444 3300028577 Bacteria 31172
453 Ga0265318_10003610 3300028577 Bacteria 7735
454 Ga0307517_10265289 3300028786 Bacteria 993
455 Ga0307515_10158798 3300028794 Bacteria 2318
456 Ga0307515_10347015 3300028794 Bacteria 1133
457 Ga0265338_10000011 3300028800 Bacteria 433370
458 Ga0265338_10001087 3300028800 Bacteria 45161
459 Ga0265338_10012082 3300028800 Bacteria 9873
460 Ga0265338_10025211 3300028800 Bacteria 6045
461 Ga0265338_10072660 3300028800 Bacteria 2936
462 Ga0265338_10128693 3300028800 Bacteria 2004
463 Ga0265338_10373225 3300028800 Bacteria 1021
464 Ga0265330_10011184 3300031235 Bacteria 4213
465 Ga0265330_10030973 3300031235 Bacteria 2398
466 Ga0265332_10006040 3300031238 Bacteria 5534
467 Ga0265332_10017334 3300031238 Bacteria 3179
468 Ga0265332_10045050 3300031238 Bacteria 1902
469 Ga0265332_10086948 3300031238 Bacteria 1324
470 Ga0265332_10118928 3300031238 Bacteria 1110
471 Ga0265328_10026476 3300031239 Bacteria 2179
472 Ga0265328_10059621 3300031239 Bacteria 1401
473 Ga0265320_10003153 3300031240 Bacteria 11187
474 Ga0265320_10015770 3300031240 Bacteria 4258
475 Ga0265325_10000009 3300031241 Bacteria 184273
476 Ga0265325_10000094 3300031241 Bacteria 62066
477 Ga0265325_10001690 3300031241 Bacteria 15327
478 Ga0265325_10002838 3300031241 Bacteria 11552
479 Ga0265325_10006623 3300031241 Bacteria 7012
480 Ga0265325_10033081 3300031241 Bacteria 2757
481 Ga0265325_10041342 3300031241 Bacteria 2416
482 Ga0265325_10061936 3300031241 Bacteria 1896
483 Ga0265325_10092700 3300031241 Bacteria 1487
484 Ga0265329_10016573 3300031242 Bacteria 2550
485 Ga0265340_10000159 3300031247 Bacteria 34106
486 Ga0265340_10000562 3300031247 Bacteria 20607
487 Ga0265340_10007094 3300031247 Bacteria 6108
488 Ga0265340_10018994 3300031247 Bacteria 3541
489 Ga0265340_10029135 3300031247 Bacteria 2773
490 Ga0265340_10034288 3300031247 Bacteria 2525
491 Ga0265340_10064703 3300031247 Bacteria 1743
492 Ga0265340_10123891 3300031247 Bacteria 1188
493 Ga0265339_10000320 3300031249 Bacteria 38805
494 Ga0265339_10007160 3300031249 Bacteria 7238
495 Ga0265339_10020568 3300031249 Bacteria 3852
496 Ga0265339_10025613 3300031249 Bacteria 3384
497 Ga0265339_10029739 3300031249 Bacteria 3097
498 Ga0265339_10048309 3300031249 Bacteria 2334
499 Ga0265339_10072044 3300031249 Bacteria 1839
500 Ga0265339_10077525 3300031249 Bacteria 1762
501 Ga0265339_10155506 3300031249 Bacteria 1154
502 Ga0265331_10018315 3300031250 Bacteria 3636
503 Ga0265331_10045617 3300031250 Bacteria 2115
504 Ga0265331_10066308 3300031250 Bacteria 1695
505 Ga0265327_10012908 3300031251 Bacteria 5591
506 Ga0265316_10020381 3300031344 Bacteria 5644
507 Ga0265316_10063310 3300031344 Bacteria 2868
508 Ga0265316_10106193 3300031344 Bacteria 2130
509 Ga0265316_10126519 3300031344 Bacteria 1926
510 Ga0265316_10399989 3300031344 Bacteria 989
511 Ga0265316_10561778 3300031344 Bacteria 811
512 Ga0307513_10164521 3300031456 Bacteria 2105
513 Ga0307513_10230922 3300031456 Bacteria 1663
514 Ga0265313_10000176 3300031595 Bacteria 68037
515 Ga0265313_10002778 3300031595 Bacteria 14762
516 Ga0265313_10016249 3300031595 Bacteria 4287
517 Ga0265313_10028797 3300031595 Bacteria 2881
518 Ga0265313_10032291 3300031595 Bacteria 2675
519 Ga0307508_10196407 3300031616 Bacteria 1619
520 Ga0307508_10436681 3300031616 Bacteria 901
521 Ga0265314_10000857 3300031711 Bacteria 36107
522 Ga0265314_10016114 3300031711 Bacteria 5918
523 Ga0265314_10022487 3300031711 Bacteria 4830
524 Ga0265314_10031751 3300031711 Bacteria 3894
525 Ga0265314_10057403 3300031711 Bacteria 2673
526 Ga0265314_10062004 3300031711 Bacteria 2544
527 Ga0265314_10085255 3300031711 Bacteria 2072
528 Ga0265314_10105286 3300031711 Bacteria 1804
529 Ga0265314_10149712 3300031711 Bacteria 1433
530 Ga0265314_10225858 3300031711 Bacteria 1089
531 Ga0265314_10304631 3300031711 Bacteria 892
532 Ga0265342_10016987 3300031712 Bacteria 4742
533 Ga0265342_10025710 3300031712 Bacteria 3696
534 Ga0265342_10038212 3300031712 Bacteria 2924
535 Ga0265342_10042692 3300031712 Bacteria 2739
536 Ga0265342_10062969 3300031712 Bacteria 2181
537 Ga0265342_10199850 3300031712 Bacteria 1087
538 Ga0316576_10109452 3300031727 Bacteria 2070
539 Ga0316578_10060257 3300031728 Bacteria 2234
540 Ga0307516_10061230 3300031730 Bacteria 3653
541 Ga0307516_10112004 3300031730 Bacteria 2530
542 Ga0307413_10051479 3300031824 Bacteria 2482
543 Ga0307410_10343984 3300031852 Bacteria 1190
544 Ga0307410_10892682 3300031852 Bacteria 761
545 Ga0307406_10619097 3300031901 Bacteria 895
546 Ga0307406_11017709 3300031901 Bacteria 711
547 Ga0307412_10106318 3300031911 Bacteria 1995
548 Ga0307409_100229034 3300031995 Bacteria 1683
549 Ga0307409_100483777 3300031995 Bacteria 1202
550 Ga0307416_101052819 3300032002 Bacteria 917
551 Ga0373959_0040066 3300034820 Bacteria 980
552 Ga0373934_0266305 3300035086 Bacteria 709
553 Ga0373944_0023315 3300035089 Bacteria 1805
554 Ga0373949_0045285 3300035090 Bacteria 1094
555 Ga0373923_0411414 3300035111 Bacteria 652
556 Ga0373932_0021687 3300035112 Bacteria 1698
557 Ga0373936_0049106 3300035113 Bacteria 1704
558 Ga0373939_0081535 3300035114 Bacteria 1075
559 Ga0373941_0000530 3300035115 Bacteria 7622
560 Ga0373941_0071756 3300035115 Bacteria 1151
561 Ga0373941_0195975 3300035115 Bacteria 766
562 Ga0373945_0136157 3300035116 Bacteria 987
563 Ga0373953_0151197 3300035117 Bacteria 995
564 Ga0373953_0339141 3300035117 Bacteria 658
565 Ga0373954_0154300 3300035118 Bacteria 1122
566 Ga0373954_0208443 3300035118 Bacteria 961
567 Ga0373956_0078062 3300035119 Bacteria 1516
568 Ga0373956_0186587 3300035119 Bacteria 981
569 Ga0373957_0047902 3300035120 Bacteria 1627
570 Ga0373943_0002306 3300035170 Bacteria 8671
571 Ga0373943_0094383 3300035170 Bacteria 1554
572 Ga0373955_0016037 3300035172 Bacteria 3681
573 Ga0373955_0017515 3300035172 Bacteria 3548
574 Ga0373955_0681603 3300035172 Bacteria 631
575 Ga0373942_0061565 3300035207 Bacteria 1077
576 Ga0373961_0261766 3300035241 Bacteria 629
577 Ga0373962_0049178 3300035242 Bacteria 1211
578 Ga0373962_0285248 3300035242 Bacteria 582
579 Ga0316574_0120379 3300035398 Bacteria 1685
580 Ga0316574_0244371 3300035398 Bacteria 1147
581 Ga0373931_0002610 3300035691 Bacteria 8020
582 Ga0373931_0010215 3300035691 Bacteria 4509
583 Ga0373931_0425147 3300035691 Bacteria 845
584 Ga0373931_0431111 3300035691 Bacteria 840
585 Ga0373927_0039911 3300035695 Bacteria 3046
586 Ga0373927_0090159 3300035695 Bacteria 1991
587 Ga0373927_0137697 3300035695 Bacteria 1596
588 Ga0373927_0761336 3300035695 Bacteria 640
589 Ga0373933_0017974 3300035724 Bacteria 3971
590 Ga0373933_0030381 3300035724 Bacteria 3128
591 Ga0373933_0331724 3300035724 Bacteria 987
592 Ga0373933_0394071 3300035724 Bacteria 903
593 Ga0373947_0005370 3300035725 Bacteria 7479
594 Ga0373947_0082089 3300035725 Bacteria 1997
595 Ga0373937_0048874 3300036401 Bacteria 3873
596 Ga0373937_0066672 3300036401 Bacteria 3315
597 Ga0373937_0333999 3300036401 Bacteria 1435
598 Ga0373937_0386087 3300036401 Bacteria 1328
599 Ga0373937_0424626 3300036401 Bacteria 1262
600 Ga0316582_0058451 3300036647 Bacteria 2465
601 Ga0316584_0200958 3300036712 Bacteria 1470
602 Ga0316584_0382504 3300036712 Bacteria 1005
603 Ga0373925_0012671 3300037068 Bacteria 6105
604 Ga0373925_0050470 3300037068 Bacteria 3103
605 Ga0373925_0075886 3300037068 Bacteria 2548
606 Ga0373925_0136744 3300037068 Bacteria 1915
607 Ga0373925_0984827 3300037068 Bacteria 694
608 Ga0395899_0269714 3300037312 Bacteria 1161
609 Ga0395900_0088308 3300037418 Bacteria 3187
610 Ga0395900_0323529 3300037418 Bacteria 1522
611 Ga0395898_0026131 3300037466 Bacteria 5877
612 Ga0395898_0222074 3300037466 Bacteria 1802
613 Ga0395898_0230496 3300037466 Bacteria 1766
614 Ga0395905_0970765 3300037471 Bacteria 753
615 Ga0436364_0517728 3300037853 Bacteria 776
616 Ga0436364_1387285 3300037853 Bacteria 3274
617 Ga0395901_0043778 3300038443 Bacteria 4643
618 Ga0395901_0279117 3300038443 Bacteria 1736
619 Ga0400483_031136 3300039062 Bacteria 2896
620 Ga0400483_261441 3300039062 Bacteria 7210
621 Ga0436365_0257402 3300039437 Bacteria 164674
622 Ga0436365_0683017 3300039437 Bacteria 1053
623 Ga0436365_0703435 3300039437 Bacteria 3743
624 Ga0436365_1247148 3300039437 Bacteria 663
625 Ga0436365_1581781 3300039437 Bacteria 2070
626 Ga0436365_1740837 3300039437 Bacteria 1387
627 Ga0436365_1850734 3300039437 Bacteria 740
628 Ga0436365_1887606 3300039437 Bacteria 4569
629 Ga0436360_0009637 3300039438 Bacteria 760
630 Ga0436360_0234379 3300039438 Bacteria 5227
631 Ga0436360_0409435 3300039438 Bacteria 1348
632 Ga0436360_0543230 3300039438 Bacteria 801
633 Ga0436360_0573541 3300039438 Bacteria 1151
634 Ga0436360_0812316 3300039438 Bacteria 1107
635 Ga0436360_1008458 3300039438 Bacteria 780
636 Ga0436361_0290139 3300039447 Bacteria 6933
637 Ga0436361_0801523 3300039447 Bacteria 1373
638 Ga0436361_0856042 3300039447 Bacteria 2917
639 Ga0436361_0956481 3300039447 Bacteria 1171
640 Ga0436363_0243575 3300039450 Bacteria 1804
641 Ga0436363_0521106 3300039450 Bacteria 2220
642 Ga0436363_1097369 3300039450 Bacteria 608
643 Ga0436363_1599936 3300039450 Bacteria 1064
644 Ga0436362_0160092 3300039453 Bacteria 766
645 Ga0436362_0283225 3300039453 Bacteria 1199
646 Ga0436362_0508487 3300039453 Bacteria 993
647 Ga0436362_1131996 3300039453 Bacteria 1329
648 Ga0436362_1168099 3300039453 Bacteria 1358
649 Ga0439436_0003726 3300041404 Bacteria 4652
650 Ga0439439_0006276 3300041406 Bacteria 2746
651 Ga0439453_0005016 3300041408 Bacteria 1998
652 Ga0439466_0004428 3300041411 Bacteria 5411
653 Ga0439465_0010767 3300041413 Bacteria 2869
654 Ga0451807_0374610 3300041486 Bacteria 976
655 Ga0451853_0974959 3300041512 Bacteria 718
656 Ga0439449_0004779 3300042007 Bacteria 5229
657 Ga0439456_010801 3300042013 Bacteria 1888
658 Ga0439462_0034136 3300042015 Bacteria 1350
659 Ga0450906_008964 3300042145 Bacteria 1919
660 Ga0450910_060756 3300042147 Bacteria 638
661 Ga0450908_033908 3300042184 Bacteria 885
662 Ga0450918_002668 3300042531 Bacteria 3358
663 Ga0466972_0471867 3300044658 Bacteria 590
664 Ga0466966_0016096 3300044684 Bacteria 4945
665 Ga0466963_0596339 3300044694 Bacteria 780
666 Ga0453684_0010839 3300044712 Bacteria 15449
667 Ga0466957_0159678 3300044842 Bacteria 1463
668 Ga0466959_0032618 3300045049 Bacteria 3855
669 Ga0451576_0614764 3300045051 Bacteria 1142
670 Ga0466958_0096417 3300045836 Bacteria 1835
671 Ga0466958_0169328 3300045836 Bacteria 1383
672 Ga0466967_0244384 3300045976 Bacteria 1713
673 Ga0466967_0268247 3300045976 Bacteria 1635
674 Ga0495617_016190 3300046452 Bacteria 2522
675 Ga0495627_002377 3300046453 Bacteria 9161
676 Ga0495627_057892 3300046453 Bacteria 1152
677 Ga0495603_0221875 3300046455 Bacteria 1090
678 Ga0495629_0054668 3300046459 Bacteria 2792
679 Ga0495629_0809914 3300046459 Bacteria 617
680 Ga0495651_0099841 3300046462 Bacteria 2164
681 Ga0495651_0519508 3300046462 Bacteria 760
682 Ga0495653_0137762 3300046463 Bacteria 1720
683 Ga0495653_0728641 3300046463 Bacteria 600
684 Ga0495650_0002793 3300046471 Bacteria 13415
685 Ga0495580_0056424 3300046472 Bacteria 2766
686 Ga0495580_0444109 3300046472 Bacteria 871
687 Ga0495582_0071437 3300046473 Bacteria 1921
688 Ga0495664_0048077 3300046477 Bacteria 2533
689 Ga0495584_0254407 3300046491 Bacteria 893
690 Ga0495596_0235410 3300046500 Bacteria 711
691 Ga0495583_0114591 3300046506 Bacteria 1140
692 Ga0495606_0134503 3300046507 Bacteria 1466
693 Ga0495608_0531636 3300046511 Bacteria 710
694 Ga0495610_0000053 3300046512 Bacteria 142545
695 Ga0495628_0234909 3300046516 Bacteria 1373
696 Ga0495630_1053929 3300046517 Bacteria 617
697 Ga0495637_0002782 3300046520 Bacteria 9488
698 Ga0495644_0121737 3300046523 Bacteria 993
699 Ga0495648_0225185 3300046524 Bacteria 922
700 Ga0495663_0184758 3300046525 Bacteria 723
701 Ga0495652_0062800 3300046529 Bacteria 3130
702 Ga0495652_0160489 3300046529 Bacteria 1746
703 Ga0495640_0417814 3300046533 Bacteria 822
704 Ga0495640_0454885 3300046533 Bacteria 782
705 Ga0495586_0302721 3300046535 Bacteria 916
706 Ga0495586_0678223 3300046535 Bacteria 595
707 Ga0495587_0064240 3300046536 Bacteria 2145
708 Ga0495587_0066469 3300046536 Bacteria 2103
709 Ga0495609_0017425 3300046538 Bacteria 3335
710 Ga0495621_0046217 3300046539 Bacteria 1544
711 Ga0495645_0006290 3300046543 Bacteria 8235
712 Ga0495622_0002344 3300046557 Bacteria 9210
713 Ga0495633_0388340 3300046558 Bacteria 631
714 Ga0495667_0146213 3300046559 Bacteria 1522
715 Ga0495656_0672752 3300046615 Bacteria 556
716 Ga0495668_0161649 3300046616 Bacteria 1227
717 Ga0495625_0124522 3300046660 Bacteria 1751
718 Ga0495661_0026255 3300046665 Bacteria 3753
719 Ga0495657_0248353 3300046675 Bacteria 1072
720 Ga0495599_0156034 3300046678 Bacteria 1412
721 Ga0495599_0224687 3300046678 Bacteria 1148
722 Ga0495647_0076697 3300046681 Bacteria 1348
723 Ga0495647_0089092 3300046681 Bacteria 1262
724 Ga0495658_0001623 3300046683 Bacteria 11704
725 Ga0495658_0069000 3300046683 Bacteria 2048
726 Ga0495613_0338420 3300046689 Bacteria 1036
727 Ga0495624_0119317 3300046690 Bacteria 1620
728 Ga0495670_0100510 3300046691 Bacteria 1489
729 Ga0495649_0081253 3300046694 Bacteria 1733
730 Ga0495600_0044792 3300046809 Bacteria 2886
731 Ga0495660_0266371 3300046810 Bacteria 789
732 Ga0495581_0198013 3300047315 Bacteria 1175
733 Ga0495581_0253610 3300047315 Bacteria 1029
734 Ga0495604_0269185 3300047317 Bacteria 1155
735 Ga0495604_0450737 3300047317 Bacteria 841
736 Ga0495636_0018272 3300047318 Bacteria 2812
737 Ga0495636_0255343 3300047318 Bacteria 812
738 Ga0495674_0385092 3300047319 Bacteria 1134
739 Ga0495676_0390035 3300047321 Bacteria 925
740 Ga0495675_0063178 3300047444 Bacteria 2343
741 Ga0495675_0171663 3300047444 Bacteria 1331
742 Ga0495675_0215194 3300047444 Bacteria 1165
743 Ga0495675_0372148 3300047444 Bacteria 837
744 Ga0495681_0000015 3300047470 Bacteria 183538
745 Ga0495684_0277025 3300047471 Bacteria 1212
746 Ga0495686_0626729 3300047472 Bacteria 555
747 Ga0495602_0105949 3300048088 Bacteria 2296
748 Ga0495602_0222502 3300048088 Bacteria 1424
749 Ga0495602_0339163 3300048088 Bacteria 1088
750 Ga0495614_0061948 3300048089 Bacteria 1608
751 Ga0496100_0137655 3300048903 Bacteria 1727
752 Ga0496100_0881906 3300048903 Bacteria 702
753 Ga0496101_0062638 3300048904 Bacteria 2705
754 Ga0496102_0036294 3300048905 Bacteria 4440
755 Ga0496102_0235447 3300048905 Bacteria 1726
756 Ga0496102_0331067 3300048905 Bacteria 1434
757 Ga0496103_0098768 3300048906 Bacteria 1846
758 Ga0496103_0155229 3300048906 Bacteria 1467
759 Ga0496104_0905407 3300048907 Bacteria 787
760 Ga0496105_0033919 3300048908 Bacteria 4195
761 Ga0496105_0141411 3300048908 Bacteria 1981
762 Ga0496105_0201827 3300048908 Bacteria 1623
763 Ga0496105_0330231 3300048908 Bacteria 1221
764 Ga0496105_0854285 3300048908 Bacteria 689
765 Ga0496106_0041871 3300048909 Bacteria 3433
766 Ga0496107_0106538 3300048910 Bacteria 2059
767 Ga0496107_0218161 3300048910 Bacteria 1419
768 Ga0496107_0484985 3300048910 Bacteria 917
769 Ga0496108_1018291 3300048911 Bacteria 707
770 Ga0496108_1056445 3300048911 Bacteria 692
771 Ga0496109_0028284 3300048912 Bacteria 5011
772 Ga0496109_0072059 3300048912 Bacteria 3173
773 Ga0496110_0264135 3300048913 Bacteria 1567
774 Ga0496111_0024359 3300048914 Bacteria 4261
775 Ga0496112_0035439 3300048915 Bacteria 4861
776 Ga0496113_0003117 3300048916 Bacteria 9859
777 Ga0496113_0307785 3300048916 Bacteria 1269
778 Ga0496114_0085739 3300048917 Bacteria 2668
779 Ga0496114_0133010 3300048917 Bacteria 2149
780 Ga0496115_0067074 3300048918 Bacteria 2901
781 Ga0496117_0067198 3300048920 Bacteria 2427
782 Ga0496117_0106859 3300048920 Bacteria 1755
783 Ga0496121_0000987 3300048924 Bacteria 50954
784 Ga0496122_0233827 3300048925 Bacteria 1042
785 Ga0496123_0018805 3300048926 Bacteria 5474
786 Ga0496123_0026687 3300048926 Bacteria 4319
787 Ga0496126_0000653 3300048929 Bacteria 64292
788 Ga0496126_0047387 3300048929 Bacteria 3935
789 Ga0496126_0295692 3300048929 Bacteria 1338
790 Ga0496126_0518759 3300048929 Bacteria 950
791 Ga0496126_0587409 3300048929 Bacteria 879
792 Ga0495678_042157 3300049459 Bacteria 1821
793 Ga0495682_0005324 3300049460 Bacteria 5364
794 Ga0501031_0036251 3300049568 Bacteria 3217
795 Ga0501031_0037269 3300049568 Bacteria 3172
796 Ga0501031_0161199 3300049568 Bacteria 1466
797 Ga0501031_0241277 3300049568 Bacteria 1175
798 Ga0501031_0255051 3300049568 Bacteria 1140
799 Ga0501032_0014948 3300049569 Bacteria 5490
800 Ga0501032_0022010 3300049569 Bacteria 4425
801 Ga0501032_0087223 3300049569 Bacteria 2073
802 Ga0501032_0102978 3300049569 Bacteria 1892
803 Ga0501032_0131087 3300049569 Bacteria 1654
804 Ga0501033_0002118 3300049570 Bacteria 17169
805 Ga0501033_0003652 3300049570 Bacteria 12550
806 Ga0501033_0005897 3300049570 Bacteria 9621
807 Ga0501033_0014827 3300049570 Bacteria 5917
808 Ga0501033_0065358 3300049570 Bacteria 2676
809 Ga0501033_0096022 3300049570 Bacteria 2166
810 Ga0501033_0118761 3300049570 Bacteria 1920
811 Ga0501033_0136356 3300049570 Bacteria 1775
812 Ga0501033_0155031 3300049570 Bacteria 1651
813 Ga0501033_0194356 3300049570 Bacteria 1451
814 Ga0501033_0374984 3300049570 Bacteria 994
815 Ga0501034_0000319 3300049571 Bacteria 84488
816 Ga0501034_0012726 3300049571 Bacteria 8677
817 Ga0501034_0056463 3300049571 Bacteria 3951
818 Ga0501034_0070593 3300049571 Bacteria 3504
819 Ga0501034_0076368 3300049571 Bacteria 3357
820 Ga0501034_0077548 3300049571 Bacteria 3328
821 Ga0501034_0095123 3300049571 Bacteria 2976
822 Ga0501034_0141858 3300049571 Bacteria 2381
823 Ga0501034_0218897 3300049571 Bacteria 1857
824 Ga0501034_0351369 3300049571 Bacteria 1402
825 Ga0501034_0919631 3300049571 Bacteria 762
826 Ga0501034_1054309 3300049571 Bacteria 695
827 Ga0501034_1240380 3300049571 Bacteria 623
828 Ga0501036_0001489 3300049572 Bacteria 18035
829 Ga0501036_0003952 3300049572 Bacteria 11916
830 Ga0501036_0037534 3300049572 Bacteria 4098
831 Ga0501036_0077192 3300049572 Bacteria 2818
832 Ga0501036_0096762 3300049572 Bacteria 2496
833 Ga0501036_0140446 3300049572 Bacteria 2038
834 Ga0501036_0185206 3300049572 Bacteria 1752
835 Ga0501036_0188215 3300049572 Bacteria 1737
836 Ga0501036_0312155 3300049572 Bacteria 1314
837 Ga0501036_0645948 3300049572 Bacteria 876
838 Ga0501037_0006850 3300049573 Bacteria 8325
839 Ga0501037_0020528 3300049573 Bacteria 4878
840 Ga0501037_0025665 3300049573 Bacteria 4353
841 Ga0501037_0032572 3300049573 Bacteria 3849
842 Ga0501037_0042558 3300049573 Bacteria 3337
843 Ga0501037_0043927 3300049573 Bacteria 3284
844 Ga0501037_0109332 3300049573 Bacteria 1992
845 Ga0501037_0110501 3300049573 Bacteria 1980
846 Ga0501037_0305365 3300049573 Bacteria 1104
847 Ga0501037_0336440 3300049573 Bacteria 1043
848 Ga0501037_0415263 3300049573 Bacteria 921
849 Ga0501038_0039495 3300049574 Bacteria 4128
850 Ga0501038_0194763 3300049574 Bacteria 1629
851 Ga0501038_0217033 3300049574 Bacteria 1528
852 Ga0501038_0328366 3300049574 Bacteria 1195
853 Ga0501038_0365027 3300049574 Bacteria 1122
854 Ga0501039_0059068 3300049575 Bacteria 2970
855 Ga0501039_0130775 3300049575 Bacteria 1970
856 Ga0501039_0269245 3300049575 Bacteria 1339
857 Ga0501041_0077265 3300049577 Bacteria 2048
858 Ga0501041_0251540 3300049577 Bacteria 1111
859 Ga0501042_0043643 3300049578 Bacteria 3193
860 Ga0501042_0165313 3300049578 Bacteria 1597
861 Ga0501042_0330442 3300049578 Bacteria 1102
862 Ga0501042_0735531 3300049578 Bacteria 717
863 Ga0501043_0003947 3300049579 Bacteria 12164
864 Ga0501043_0008747 3300049579 Bacteria 7970
865 Ga0501043_0017115 3300049579 Bacteria 5684
866 Ga0501043_0022990 3300049579 Bacteria 4889
867 Ga0501043_0069685 3300049579 Bacteria 2762
868 Ga0501043_0076267 3300049579 Bacteria 2634
869 Ga0501043_0197278 3300049579 Bacteria 1563
870 Ga0501043_0407220 3300049579 Bacteria 1027
871 Ga0501043_0413606 3300049579 Bacteria 1017
872 Ga0501046_0000636 3300049580 Bacteria 34297
873 Ga0501046_0017066 3300049580 Bacteria 6068
874 Ga0501046_0048921 3300049580 Bacteria 3346
875 Ga0501046_0131919 3300049580 Bacteria 1894
876 Ga0501046_0183850 3300049580 Bacteria 1562
877 Ga0501046_0567589 3300049580 Bacteria 807
878 Ga0501047_0000079 3300049581 Bacteria 122998
879 Ga0501047_0010064 3300049581 Bacteria 8941
880 Ga0501047_0019694 3300049581 Bacteria 6475
881 Ga0501047_0032713 3300049581 Bacteria 5021
882 Ga0501047_0039859 3300049581 Bacteria 4543
883 Ga0501047_0098845 3300049581 Bacteria 2797
884 Ga0501047_0128466 3300049581 Bacteria 2414
885 Ga0501047_0132988 3300049581 Bacteria 2367
886 Ga0501047_0180029 3300049581 Bacteria 1980
887 Ga0501047_0216244 3300049581 Bacteria 1773
888 Ga0501047_0367130 3300049581 Bacteria 1275
889 Ga0501047_0442776 3300049581 Bacteria 1129
890 Ga0501047_0675219 3300049581 Bacteria 851
891 Ga0501048_0000263 3300049582 Bacteria 35151
892 Ga0501048_0000312 3300049582 Bacteria 33190
893 Ga0501048_0164427 3300049582 Bacteria 1571
894 Ga0501048_0204992 3300049582 Bacteria 1398
895 Ga0501067_0005701 3300049583 Bacteria 6916
896 Ga0501067_0023416 3300049583 Bacteria 3422
897 Ga0501068_0188006 3300049584 Bacteria 1307
898 Ga0501069_0005748 3300049585 Bacteria 6465
899 Ga0501069_0012922 3300049585 Bacteria 4447
900 Ga0501069_0030096 3300049585 Bacteria 2981
901 Ga0501069_0052480 3300049585 Bacteria 2270
902 Ga0501069_0099802 3300049585 Bacteria 1647
903 Ga0501070_0000111 3300049586 Bacteria 71786
904 Ga0501070_0004624 3300049586 Bacteria 11801
905 Ga0501070_0012304 3300049586 Bacteria 7222
906 Ga0501070_0023416 3300049586 Bacteria 5173
907 Ga0501070_0039302 3300049586 Bacteria 3947
908 Ga0501070_0074206 3300049586 Bacteria 2816
909 Ga0501070_0113198 3300049586 Bacteria 2242
910 Ga0501070_0141498 3300049586 Bacteria 1986
911 Ga0501070_0219503 3300049586 Bacteria 1559
912 Ga0501070_0311032 3300049586 Bacteria 1282
913 Ga0501070_0781915 3300049586 Bacteria 751
914 Ga0501071_0074774 3300049587 Bacteria 2473
915 Ga0501071_0112232 3300049587 Bacteria 2015
916 Ga0501071_0498439 3300049587 Bacteria 934
917 Ga0501072_0062563 3300049588 Bacteria 2936
918 Ga0501073_0009478 3300049589 Bacteria 7188
919 Ga0501073_0016585 3300049589 Bacteria 5337
920 Ga0501073_0069206 3300049589 Bacteria 2459
921 Ga0501073_0099611 3300049589 Bacteria 2018
922 Ga0501073_0116163 3300049589 Bacteria 1854
923 Ga0501073_0134155 3300049589 Bacteria 1716
924 Ga0501073_0206817 3300049589 Bacteria 1356
925 Ga0501073_0321865 3300049589 Bacteria 1067
926 Ga0501073_0663568 3300049589 Bacteria 720
927 Ga0501074_0008490 3300049590 Bacteria 7442
928 Ga0501074_0010279 3300049590 Bacteria 6792
929 Ga0501074_0089575 3300049590 Bacteria 2203
930 Ga0501074_0091464 3300049590 Bacteria 2179
931 Ga0501074_0111176 3300049590 Bacteria 1960
932 Ga0501074_0248247 3300049590 Bacteria 1266
933 Ga0501074_0916200 3300049590 Bacteria 617
934 Ga0501075_0120714 3300049591 Bacteria 1995
935 Ga0501076_0275950 3300049592 Bacteria 1377
936 Ga0501202_048970 3300049652 Bacteria 932
937 Ga0501261_022849 3300049690 Bacteria 907
938 Ga0501079_0043670 3300049741 Bacteria 3460
939 Ga0501079_0083656 3300049741 Bacteria 2468
940 Ga0501080_0000069 3300049742 Bacteria 68222
941 Ga0501080_0018192 3300049742 Bacteria 6504
942 Ga0501080_0036380 3300049742 Bacteria 4595
943 Ga0501080_0060319 3300049742 Bacteria 3531
944 Ga0501080_0108289 3300049742 Bacteria 2575
945 Ga0501080_0110137 3300049742 Bacteria 2552
946 Ga0501080_0365708 3300049742 Bacteria 1301
947 Ga0501080_0544111 3300049742 Bacteria 1034
948 Ga0501080_0588411 3300049742 Bacteria 989
949 Ga0501080_0701019 3300049742 Bacteria 893
950 Ga0501080_0898142 3300049742 Bacteria 772
951 Ga0501081_0107829 3300049743 Bacteria 1975
952 Ga0501083_0001653 3300049744 Bacteria 15206
953 Ga0501083_0116422 3300049744 Bacteria 1754
954 Ga0501083_0211772 3300049744 Bacteria 1263
955 Ga0501083_0668031 3300049744 Bacteria 676
956 Ga0501035_0002206 3300049822 Bacteria 19336
957 Ga0501035_0002523 3300049822 Bacteria 17906
958 Ga0501035_0005014 3300049822 Bacteria 12538
959 Ga0501035_0016319 3300049822 Bacteria 6851
960 Ga0501035_0021716 3300049822 Bacteria 5902
961 Ga0501035_0042448 3300049822 Bacteria 4102
962 Ga0501035_0049511 3300049822 Bacteria 3765
963 Ga0501035_0049988 3300049822 Bacteria 3748
964 Ga0501035_0062337 3300049822 Bacteria 3318
965 Ga0501035_0069769 3300049822 Bacteria 3114
966 Ga0501035_0085641 3300049822 Bacteria 2777
967 Ga0501035_0191463 3300049822 Bacteria 1758
968 Ga0501044_0003903 3300049823 Bacteria 16713
969 Ga0501044_0006571 3300049823 Bacteria 12839
970 Ga0501044_0007608 3300049823 Bacteria 11911
971 Ga0501044_0007813 3300049823 Bacteria 11757
972 Ga0501044_0010260 3300049823 Bacteria 10174
973 Ga0501044_0015004 3300049823 Bacteria 8352
974 Ga0501044_0037484 3300049823 Bacteria 5067
975 Ga0501044_0039733 3300049823 Bacteria 4906
976 Ga0501044_0050354 3300049823 Bacteria 4298
977 Ga0501044_0066380 3300049823 Bacteria 3679
978 Ga0501044_0149787 3300049823 Bacteria 2316
979 Ga0501044_0196394 3300049823 Bacteria 1977
980 Ga0501044_0213000 3300049823 Bacteria 1885
981 Ga0501044_0218307 3300049823 Bacteria 1858
982 Ga0501044_0285933 3300049823 Bacteria 1581
983 Ga0501044_0334316 3300049823 Bacteria 1437
984 Ga0501044_0360028 3300049823 Bacteria 1373
985 Ga0501044_0473340 3300049823 Bacteria 1156
986 Ga0501044_0476958 3300049823 Bacteria 1151
987 Ga0501044_0554917 3300049823 Bacteria 1045
988 Ga0501044_0627177 3300049823 Bacteria 966
989 Ga0501044_0728990 3300049823 Bacteria 875
990 Ga0501045_0099474 3300049824 Bacteria 2152
991 Ga0501045_0110225 3300049824 Bacteria 2041
992 Ga0501045_0369673 3300049824 Bacteria 1067
993 Ga0501045_0410009 3300049824 Bacteria 1008
994 nmdc:mga03683_32624_c1 3300050489 Bacteria 2096
995 nmdc:mga00v17_264714_c1 3300050491 Bacteria 1115
996 nmdc:mga0yw44_196788_c1 3300050492 Bacteria 1330
997 nmdc:mga06z11_105715_c1 3300050494 Bacteria 1551
998 nmdc:mga06z11_475355_c1 3300050494 Bacteria 756
999 nmdc:mga07m45_306219_c1 3300050496 Bacteria 924
1000 nmdc:mga05p37_134173_c1 3300050507 Bacteria 3037
1001 nmdc:mga05p37_300235_c1 3300050507 Bacteria 1908
1002 nmdc:mga05p37_540_c1 3300050507 Bacteria 41709
1003 nmdc:mga09592_848_c1 3300050508 Bacteria 23773
1004 nmdc:mga0qj67_43893_c1 3300050509 Bacteria 3521
1005 nmdc:mga06r32_3089_c1 3300050510 Bacteria 14903
1006 nmdc:mga08y16_305102_c1 3300050511 Bacteria 1640
1007 nmdc:mga08y16_326573_c1 3300050511 Bacteria 1579
1008 nmdc:mga08y16_64111_c1 3300050511 Bacteria 3837
1009 nmdc:mga08y16_7410_c1 3300050511 Bacteria 11496
1010 nmdc:mga0n895_183410_c1 3300050512 Bacteria 2124
1011 nmdc:mga0n895_185387_c1 3300050512 Bacteria 2112
1012 nmdc:mga0n895_193867_c1 3300050512 Bacteria 2063
1013 nmdc:mga0n895_54774_c1 3300050512 Bacteria 3924
1014 nmdc:mga0rr50_193498_c1 3300050513 Bacteria 1668
1015 nmdc:mga0rr50_30297_c1 3300050513 Bacteria 3829
1016 nmdc:mga0rr50_433606_c1 3300050513 Bacteria 1113
1017 nmdc:mga08x19_26279_c1 3300050514 Bacteria 3631
1018 nmdc:mga08x19_6_c2 3300050514 Bacteria 52011
1019 nmdc:mga0sz30_110484_c1 3300050516 Bacteria 1205
1020 nmdc:mga0sz30_297217_c1 3300050516 Bacteria 720
1021 Ga0495601_0007443 3300053077 Bacteria 6421
1022 Ga0495601_0264478 3300053077 Bacteria 1123
1023 Ga0495612_0008980 3300053078 Bacteria 4051
1024 Ga0495612_0028639 3300053078 Bacteria 2243
1025 Ga0495595_0002673 3300053084 Bacteria 6994
1026 Ga0495595_0059267 3300053084 Bacteria 1789
1027 Ga0495619_0012413 3300053085 Bacteria 5364
1028 Ga0495619_0081396 3300053085 Bacteria 2180
1029 Ga0495619_0169094 3300053085 Bacteria 1511
1030 Ga0495619_0177710 3300053085 Bacteria 1472
1031 Ga0500643_000027 3300053087 Bacteria 251062
1032 Ga0500646_0109722 3300053090 Bacteria 876
1033 Ga0500646_0153262 3300053090 Bacteria 764
1034 Ga0500647_0245044 3300053091 Bacteria 791
1035 Ga0500566_0188241 3300053094 Bacteria 1053
1036 Ga0500641_0005361 3300053096 Bacteria 4542
1037 Ga0500641_0182583 3300053096 Bacteria 900
1038 Ga0500555_056667 3300053103 Bacteria 1062
1039 Ga0500569_035235 3300053109 Bacteria 1434
1040 Ga0500592_028468 3300053116 Bacteria 901
1041 Ga0500593_000272 3300053117 Bacteria 21177
1042 Ga0500594_0100436 3300053118 Bacteria 890
1043 Ga0500595_000824 3300053119 Bacteria 17755
1044 Ga0500595_030441 3300053119 Bacteria 1818
1045 Ga0500595_040738 3300053119 Bacteria 1496
1046 Ga0500595_103449 3300053119 Bacteria 814
1047 Ga0500607_127316 3300053121 Bacteria 1221
1048 Ga0500652_000696 3300053131 Bacteria 11444
1049 Ga0500655_001513 3300053133 Bacteria 4400
1050 Ga0500568_0000005 3300053139 Bacteria 614296
1051 Ga0500568_0012317 3300053139 Bacteria 3939
1052 Ga0500568_0122396 3300053139 Bacteria 969
1053 Ga0500573_0000032 3300053140 Bacteria 131098
1054 Ga0500577_0053674 3300053142 Bacteria 1524
1055 Ga0500577_0081375 3300053142 Bacteria 1292
1056 Ga0500616_0062236 3300053153 Bacteria 1929
1057 Ga0500616_0325338 3300053153 Bacteria 632
1058 Ga0500619_105033 3300053154 Bacteria 960
1059 Ga0500622_0001386 3300053156 Bacteria 19529
1060 Ga0500622_0113530 3300053156 Bacteria 1321
1061 Ga0500639_030043 3300053163 Bacteria 2872
1062 Ga0500636_0014170 3300053177 Bacteria 4687
1063 Ga0500611_144920 3300053727 Bacteria 649
1064 Ga0500645_004843 3300053730 Bacteria 5076
1065 Ga0501084_0042460 3300054114 Bacteria 3804
1066 Ga0501084_0062833 3300054114 Bacteria 3108
1067 Ga0501084_0771418 3300054114 Bacteria 810
1068 Ga0501084_1004112 3300054114 Bacteria 701
1069 Ga0501084_1214094 3300054114 Bacteria 632
1070 Ga0501082_0011504 3300060353 Bacteria 7617
1071 Ga0501082_0118964 3300060353 Bacteria 2289
1072 Ga0501082_0700984 3300060353 Bacteria 886
1073 Ga0466962_0206282 3300061719 Bacteria 961
1074 Ga0530510_0058376 3300061734 Bacteria 2790

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10012082 Ga0265338_100120823 155
2 3300031251 Ga0265327_10012908 Ga0265327_100129086 165
3 3300005439 Ga0070711_100574444 Ga0070711_1005744441 168
4 3300025916 Ga0207663_10424707 Ga0207663_104247072 168
5 3300037853 Ga0436364_0517728 Ga0436364_0517728_30_545 171
6 3300048907 Ga0496104_0905407 Ga0496104_0905407_174_689 171
7 3300048908 Ga0496105_0330231 Ga0496105_0330231_239_754 171
8 3300048911 Ga0496108_1018291 Ga0496108_1018291_104_619 171
9 3300048917 Ga0496114_0085739 Ga0496114_0085739_2012_2527 171
10 3300005843 Ga0068860_100272964 Ga0068860_1002729643 172
11 3300006042 Ga0075368_10199700 Ga0075368_101997002 172
12 3300009093 Ga0105240_10033158 Ga0105240_100331588 172
13 3300009098 Ga0105245_10818295 Ga0105245_108182952 172
14 3300009147 Ga0114129_10054590 Ga0114129_100545902 172
15 3300009147 Ga0114129_11027880 Ga0114129_110278801 172
16 3300009177 Ga0105248_10695449 Ga0105248_106954491 172
17 3300009545 Ga0105237_10014301 Ga0105237_100143019 172
18 3300009551 Ga0105238_10003708 Ga0105238_100037084 172
19 3300009553 Ga0105249_10410476 Ga0105249_104104762 172
20 3300009553 Ga0105249_10702721 Ga0105249_107027212 172
21 3300010159 Ga0099796_10031529 Ga0099796_100315292 172
22 3300010375 Ga0105239_10068805 Ga0105239_100688054 172
23 3300010375 Ga0105239_10195832 Ga0105239_101958324 172
24 3300010375 Ga0105239_10710453 Ga0105239_107104531 172
25 3300011119 Ga0105246_10280295 Ga0105246_102802952 172
26 3300013105 Ga0157369_10835689 Ga0157369_108356891 172
27 3300013297 Ga0157378_10407490 Ga0157378_104074902 172
28 3300013306 Ga0163162_11042084 Ga0163162_110420842 172
29 3300013306 Ga0163162_11744522 Ga0163162_117445221 172
30 3300013307 Ga0157372_11203848 Ga0157372_112038481 172
31 3300014326 Ga0157380_10028596 Ga0157380_100285962 172
32 3300026075 Ga0207708_10155971 Ga0207708_101559712 172
33 3300026075 Ga0207708_11061115 Ga0207708_110611152 172
34 3300026121 Ga0207683_10049446 Ga0207683_100494465 172
35 3300031241 Ga0265325_10006623 Ga0265325_1000662310 172
36 3300031711 Ga0265314_10000857 Ga0265314_1000085712 172
37 3300034820 Ga0373959_0040066 Ga0373959_0040066_193_711 172
38 3300035090 Ga0373949_0045285 Ga0373949_0045285_323_841 172
39 3300035114 Ga0373939_0081535 Ga0373939_0081535_523_1041 172
40 3300035115 Ga0373941_0000530 Ga0373941_0000530_2321_2839 172
41 3300035115 Ga0373941_0195975 Ga0373941_0195975_26_544 172
42 3300035170 Ga0373943_0094383 Ga0373943_0094383_486_1004 172
43 3300035172 Ga0373955_0017515 Ga0373955_0017515_23_541 172
44 3300035241 Ga0373961_0261766 Ga0373961_0261766_87_605 172
45 3300035242 Ga0373962_0285248 Ga0373962_0285248_26_544 172
46 3300035398 Ga0316574_0120379 Ga0316574_0120379_207_725 172
47 3300035691 Ga0373931_0002610 Ga0373931_0002610_4162_4680 172
48 3300035695 Ga0373927_0039911 Ga0373927_0039911_896_1414 172
49 3300036401 Ga0373937_0386087 Ga0373937_0386087_241_759 172
50 3300036647 Ga0316582_0058451 Ga0316582_0058451_859_1377 172
51 3300036712 Ga0316584_0200958 Ga0316584_0200958_94_612 172
52 3300036712 Ga0316584_0382504 Ga0316584_0382504_386_904 172
53 3300037068 Ga0373925_0050470 Ga0373925_0050470_28_546 172
54 3300037068 Ga0373925_0075886 Ga0373925_0075886_612_1130 172
55 3300037068 Ga0373925_0984827 Ga0373925_0984827_18_536 172
56 3300037466 Ga0395898_0222074 Ga0395898_0222074_846_1364 172
57 3300038443 Ga0395901_0279117 Ga0395901_0279117_10_528 172
58 3300039437 Ga0436365_1850734 Ga0436365_1850734_32_550 172
59 3300041404 Ga0439436_0003726 Ga0439436_0003726_1540_2058 172
60 3300041406 Ga0439439_0006276 Ga0439439_0006276_1999_2517 172
61 3300041408 Ga0439453_0005016 Ga0439453_0005016_953_1471 172
62 3300041411 Ga0439466_0004428 Ga0439466_0004428_2516_3034 172
63 3300041413 Ga0439465_0010767 Ga0439465_0010767_1741_2259 172
64 3300041512 Ga0451853_0974959 Ga0451853_0974959_175_693 172
65 3300042007 Ga0439449_0004779 Ga0439449_0004779_1268_1786 172
66 3300042013 Ga0439456_010801 Ga0439456_010801_383_901 172
67 3300042015 Ga0439462_0034136 Ga0439462_0034136_604_1122 172
68 3300042145 Ga0450906_008964 Ga0450906_008964_526_1044 172
69 3300042531 Ga0450918_002668 Ga0450918_002668_1132_1650 172
70 3300045976 Ga0466967_0268247 Ga0466967_0268247_1097_1615 172
71 3300046452 Ga0495617_016190 Ga0495617_016190_74_592 172
72 3300046453 Ga0495627_057892 Ga0495627_057892_196_714 172
73 3300046455 Ga0495603_0221875 Ga0495603_0221875_320_838 172
74 3300046459 Ga0495629_0809914 Ga0495629_0809914_52_570 172
75 3300046472 Ga0495580_0444109 Ga0495580_0444109_288_806 172
76 3300046473 Ga0495582_0071437 Ga0495582_0071437_157_675 172
77 3300046506 Ga0495583_0114591 Ga0495583_0114591_555_1073 172
78 3300046517 Ga0495630_1053929 Ga0495630_1053929_24_542 172
79 3300046523 Ga0495644_0121737 Ga0495644_0121737_202_720 172
80 3300046525 Ga0495663_0184758 Ga0495663_0184758_82_600 172
81 3300046533 Ga0495640_0454885 Ga0495640_0454885_251_769 172
82 3300046535 Ga0495586_0302721 Ga0495586_0302721_381_899 172
83 3300046535 Ga0495586_0678223 Ga0495586_0678223_55_573 172
84 3300046538 Ga0495609_0017425 Ga0495609_0017425_1294_1812 172
85 3300046558 Ga0495633_0388340 Ga0495633_0388340_85_603 172
86 3300046615 Ga0495656_0672752 Ga0495656_0672752_16_534 172
87 3300046681 Ga0495647_0076697 Ga0495647_0076697_730_1248 172
88 3300046681 Ga0495647_0089092 Ga0495647_0089092_513_1031 172
89 3300046683 Ga0495658_0069000 Ga0495658_0069000_636_1154 172
90 3300046690 Ga0495624_0119317 Ga0495624_0119317_902_1420 172
91 3300046694 Ga0495649_0081253 Ga0495649_0081253_1193_1711 172
92 3300047315 Ga0495581_0253610 Ga0495581_0253610_424_942 172
93 3300047318 Ga0495636_0255343 Ga0495636_0255343_128_646 172
94 3300047321 Ga0495676_0390035 Ga0495676_0390035_13_531 172
95 3300047472 Ga0495686_0626729 Ga0495686_0626729_13_531 172
96 3300048089 Ga0495614_0061948 Ga0495614_0061948_1036_1554 172
97 3300048903 Ga0496100_0881906 Ga0496100_0881906_132_650 172
98 3300048905 Ga0496102_0235447 Ga0496102_0235447_907_1425 172
99 3300048905 Ga0496102_0331067 Ga0496102_0331067_480_998 172
100 3300048906 Ga0496103_0098768 Ga0496103_0098768_1300_1818 172
101 3300048906 Ga0496103_0155229 Ga0496103_0155229_825_1343 172
102 3300048908 Ga0496105_0033919 Ga0496105_0033919_3156_3674 172
103 3300048908 Ga0496105_0854285 Ga0496105_0854285_108_626 172
104 3300048909 Ga0496106_0041871 Ga0496106_0041871_953_1471 172
105 3300048910 Ga0496107_0484985 Ga0496107_0484985_107_625 172
106 3300048911 Ga0496108_1056445 Ga0496108_1056445_67_585 172
107 3300048912 Ga0496109_0028284 Ga0496109_0028284_3816_4334 172
108 3300048913 Ga0496110_0264135 Ga0496110_0264135_888_1406 172
109 3300048914 Ga0496111_0024359 Ga0496111_0024359_2621_3139 172
110 3300048915 Ga0496112_0035439 Ga0496112_0035439_2833_3351 172
111 3300048916 Ga0496113_0003117 Ga0496113_0003117_1455_1973 172
112 3300048917 Ga0496114_0133010 Ga0496114_0133010_1389_1907 172
113 3300048918 Ga0496115_0067074 Ga0496115_0067074_461_979 172
114 3300048929 Ga0496126_0587409 Ga0496126_0587409_310_828 172
115 3300049568 Ga0501031_0036251 Ga0501031_0036251_1168_1686 172
116 3300049569 Ga0501032_0014948 Ga0501032_0014948_3116_3634 172
117 3300049570 Ga0501033_0136356 Ga0501033_0136356_542_1060 172
118 3300049571 Ga0501034_0141858 Ga0501034_0141858_589_1107 172
119 3300049571 Ga0501034_1240380 Ga0501034_1240380_93_611 172
120 3300049572 Ga0501036_0001489 Ga0501036_0001489_4411_4929 172
121 3300049572 Ga0501036_0037534 Ga0501036_0037534_1630_2148 172
122 3300049572 Ga0501036_0140446 Ga0501036_0140446_201_719 172
123 3300049573 Ga0501037_0020528 Ga0501037_0020528_1639_2157 172
124 3300049573 Ga0501037_0032572 Ga0501037_0032572_1193_1711 172
125 3300049573 Ga0501037_0109332 Ga0501037_0109332_753_1271 172
126 3300049573 Ga0501037_0415263 Ga0501037_0415263_274_792 172
127 3300049574 Ga0501038_0194763 Ga0501038_0194763_967_1485 172
128 3300049575 Ga0501039_0059068 Ga0501039_0059068_2366_2884 172
129 3300049575 Ga0501039_0130775 Ga0501039_0130775_112_630 172
130 3300049578 Ga0501042_0043643 Ga0501042_0043643_1007_1525 172
131 3300049578 Ga0501042_0735531 Ga0501042_0735531_148_666 172
132 3300049579 Ga0501043_0003947 Ga0501043_0003947_10956_11474 172
133 3300049579 Ga0501043_0069685 Ga0501043_0069685_1862_2380 172
134 3300049579 Ga0501043_0413606 Ga0501043_0413606_262_780 172
135 3300049580 Ga0501046_0017066 Ga0501046_0017066_2791_3309 172
136 3300049580 Ga0501046_0048921 Ga0501046_0048921_1132_1650 172
137 3300049580 Ga0501046_0567589 Ga0501046_0567589_130_648 172
138 3300049581 Ga0501047_0000079 Ga0501047_0000079_56746_57264 172
139 3300049581 Ga0501047_0032713 Ga0501047_0032713_4239_4757 172
140 3300049581 Ga0501047_0180029 Ga0501047_0180029_753_1271 172
141 3300049582 Ga0501048_0000263 Ga0501048_0000263_14398_14916 172
142 3300049582 Ga0501048_0000312 Ga0501048_0000312_24067_24585 172
143 3300049584 Ga0501068_0188006 Ga0501068_0188006_455_973 172
144 3300049585 Ga0501069_0052480 Ga0501069_0052480_1560_2078 172
145 3300049585 Ga0501069_0099802 Ga0501069_0099802_455_973 172
146 3300049586 Ga0501070_0023416 Ga0501070_0023416_618_1136 172
147 3300049586 Ga0501070_0039302 Ga0501070_0039302_1821_2339 172
148 3300049586 Ga0501070_0113198 Ga0501070_0113198_1009_1527 172
149 3300049587 Ga0501071_0112232 Ga0501071_0112232_1136_1654 172
150 3300049589 Ga0501073_0116163 Ga0501073_0116163_63_581 172
151 3300049589 Ga0501073_0206817 Ga0501073_0206817_627_1145 172
152 3300049589 Ga0501073_0321865 Ga0501073_0321865_496_1014 172
153 3300049590 Ga0501074_0010279 Ga0501074_0010279_1436_1954 172
154 3300049590 Ga0501074_0111176 Ga0501074_0111176_692_1210 172
155 3300049592 Ga0501076_0275950 Ga0501076_0275950_608_1126 172
156 3300049741 Ga0501079_0083656 Ga0501079_0083656_631_1149 172
157 3300049742 Ga0501080_0000069 Ga0501080_0000069_11058_11576 172
158 3300049742 Ga0501080_0365708 Ga0501080_0365708_14_532 172
159 3300049742 Ga0501080_0544111 Ga0501080_0544111_13_531 172
160 3300049743 Ga0501081_0107829 Ga0501081_0107829_712_1230 172
161 3300049744 Ga0501083_0001653 Ga0501083_0001653_8289_8807 172
162 3300049744 Ga0501083_0116422 Ga0501083_0116422_274_792 172
163 3300049823 Ga0501044_0213000 Ga0501044_0213000_670_1188 172
164 3300049823 Ga0501044_0285933 Ga0501044_0285933_362_880 172
165 3300049823 Ga0501044_0554917 Ga0501044_0554917_262_780 172
166 3300049823 Ga0501044_0728990 Ga0501044_0728990_277_807 172
167 3300049824 Ga0501045_0110225 Ga0501045_0110225_1009_1527 172
168 3300049824 Ga0501045_0369673 Ga0501045_0369673_537_1055 172
169 3300050494 nmdc:mga06z11_105715_c1 nmdc:mga06z11_105715_c1_222_740 172
170 3300050496 nmdc:mga07m45_306219_c1 nmdc:mga07m45_306219_c1_395_913 172
171 3300050507 nmdc:mga05p37_134173_c1 nmdc:mga05p37_134173_c1_1257_1775 172
172 3300050507 nmdc:mga05p37_300235_c1 nmdc:mga05p37_300235_c1_617_1135 172
173 3300050511 nmdc:mga08y16_305102_c1 nmdc:mga08y16_305102_c1_26_544 172
174 3300050512 nmdc:mga0n895_193867_c1 nmdc:mga0n895_193867_c1_1244_1762 172
175 3300050513 nmdc:mga0rr50_193498_c1 nmdc:mga0rr50_193498_c1_30_548 172
176 3300053085 Ga0495619_0177710 Ga0495619_0177710_363_881 172
177 3300053096 Ga0500641_0182583 Ga0500641_0182583_350_868 172
178 3300053131 Ga0500652_000696 Ga0500652_000696_3482_4012 172
179 3300054114 Ga0501084_0062833 Ga0501084_0062833_2435_2953 172
180 3300054114 Ga0501084_1214094 Ga0501084_1214094_93_611 172
181 3300060353 Ga0501082_0700984 Ga0501082_0700984_313_831 172
182 3300005339 Ga0070660_100175509 Ga0070660_1001755092 173
183 3300009093 Ga0105240_10028212 Ga0105240_100282124 173
184 3300009093 Ga0105240_10187103 Ga0105240_101871033 173
185 3300009545 Ga0105237_10070274 Ga0105237_100702741 173
186 3300009545 Ga0105237_11693442 Ga0105237_116934421 173
187 3300009551 Ga0105238_10301334 Ga0105238_103013342 173
188 3300010375 Ga0105239_10590879 Ga0105239_105908792 173
189 3300014497 Ga0182008_10043533 Ga0182008_100435333 173
190 3300035086 Ga0373934_0266305 Ga0373934_0266305_171_692 173
191 3300035111 Ga0373923_0411414 Ga0373923_0411414_38_559 173
192 3300035117 Ga0373953_0339141 Ga0373953_0339141_56_577 173
193 3300035398 Ga0316574_0244371 Ga0316574_0244371_350_871 173
194 3300036401 Ga0373937_0333999 Ga0373937_0333999_369_890 173
195 3300037853 Ga0436364_1387285 Ga0436364_1387285_198_728 173
196 3300039437 Ga0436365_1247148 Ga0436365_1247148_69_599 173
197 3300039438 Ga0436360_0812316 Ga0436360_0812316_535_1056 173
198 3300041486 Ga0451807_0374610 Ga0451807_0374610_435_959 173
199 3300046463 Ga0495653_0728641 Ga0495653_0728641_63_584 173
200 3300046516 Ga0495628_0234909 Ga0495628_0234909_390_911 173
201 3300046533 Ga0495640_0417814 Ga0495640_0417814_38_559 173
202 3300046536 Ga0495587_0064240 Ga0495587_0064240_651_1172 173
203 3300046536 Ga0495587_0066469 Ga0495587_0066469_1160_1681 173
204 3300046660 Ga0495625_0124522 Ga0495625_0124522_846_1367 173
205 3300047317 Ga0495604_0269185 Ga0495604_0269185_404_925 173
206 3300047319 Ga0495674_0385092 Ga0495674_0385092_505_1026 173
207 3300047444 Ga0495675_0215194 Ga0495675_0215194_578_1099 173
208 3300047444 Ga0495675_0372148 Ga0495675_0372148_237_758 173
209 3300048088 Ga0495602_0222502 Ga0495602_0222502_264_785 173
210 3300048088 Ga0495602_0339163 Ga0495602_0339163_302_823 173
211 3300048929 Ga0496126_0518759 Ga0496126_0518759_10_531 173
212 3300053077 Ga0495601_0264478 Ga0495601_0264478_53_574 173
213 3300053078 Ga0495612_0028639 Ga0495612_0028639_849_1370 173
214 3300053085 Ga0495619_0169094 Ga0495619_0169094_976_1497 173
215 3300053087 Ga0500643_000027 Ga0500643_000027_91414_91935 173
216 3300053090 Ga0500646_0153262 Ga0500646_0153262_204_725 173
217 3300053116 Ga0500592_028468 Ga0500592_028468_303_824 173
218 3300053119 Ga0500595_030441 Ga0500595_030441_89_610 173
219 3300053139 Ga0500568_0122396 Ga0500568_0122396_294_815 173
220 3300003659 JGI25404J52841_10004507 JGI25404J52841_100045072 174
221 iso_pu_bacteria 2738541281 2738746493 175
222 iso_pu_bacteria 2738543032 2739355723 175
223 3300005331 Ga0070670_100209151 Ga0070670_1002091512 176
224 3300005347 Ga0070668_100000460 Ga0070668_10000046020 176
225 3300005353 Ga0070669_100008586 Ga0070669_1000085868 176
226 3300005367 Ga0070667_100000286 Ga0070667_10000028629 176
227 3300005841 Ga0068863_100000168 Ga0068863_10000016845 176
228 3300025903 Ga0207680_10065939 Ga0207680_100659392 176
229 3300025923 Ga0207681_10004489 Ga0207681_100044892 176
230 3300025972 Ga0207668_10000430 Ga0207668_100004308 176
231 3300025986 Ga0207658_10000243 Ga0207658_1000024341 176
232 3300026088 Ga0207641_10000241 Ga0207641_1000024132 176
233 3300046453 Ga0495627_002377 Ga0495627_002377_2863_3429 176
234 3300046471 Ga0495650_0002793 Ga0495650_0002793_8893_9459 176
235 3300046491 Ga0495584_0254407 Ga0495584_0254407_57_623 176
236 3300046512 Ga0495610_0000053 Ga0495610_0000053_55754_56320 176
237 3300046520 Ga0495637_0002782 Ga0495637_0002782_4320_4886 176
238 3300046665 Ga0495661_0026255 Ga0495661_0026255_1775_2341 176
239 3300046810 Ga0495660_0266371 Ga0495660_0266371_185_751 176
240 3300047470 Ga0495681_0000015 Ga0495681_0000015_34661_35227 176
241 3300049459 Ga0495678_042157 Ga0495678_042157_701_1267 176
242 3300049569 Ga0501032_0102978 Ga0501032_0102978_792_1325 177
243 3300049570 Ga0501033_0065358 Ga0501033_0065358_544_1077 177
244 3300049571 Ga0501034_0919631 Ga0501034_0919631_200_733 177
245 3300049574 Ga0501038_0217033 Ga0501038_0217033_272_805 177
246 3300049581 Ga0501047_0132988 Ga0501047_0132988_363_896 177
247 3300049742 Ga0501080_0588411 Ga0501080_0588411_420_953 177
248 3300054114 Ga0501084_0771418 Ga0501084_0771418_142_675 177
249 iso_pu_bacteria 2917699015 2917703953 178
250 3300009094 Ga0111539_10076197 Ga0111539_100761972 179
251 3300009545 Ga0105237_10706943 Ga0105237_107069431 179
252 3300014326 Ga0157380_10139607 Ga0157380_101396073 179
253 3300046500 Ga0495596_0235410 Ga0495596_0235410_36_575 179
254 3300046511 Ga0495608_0531636 Ga0495608_0531636_153_692 179
255 3300046689 Ga0495613_0338420 Ga0495613_0338420_264_803 179
256 3300050511 nmdc:mga08y16_64111_c1 nmdc:mga08y16_64111_c1_522_1061 179
257 3300050512 nmdc:mga0n895_54774_c1 nmdc:mga0n895_54774_c1_578_1117 179
258 3300050513 nmdc:mga0rr50_30297_c1 nmdc:mga0rr50_30297_c1_2111_2650 179
259 3300053119 Ga0500595_040738 Ga0500595_040738_52_591 179
260 3300053142 Ga0500577_0081375 Ga0500577_0081375_550_1089 179
261 3300004803 Ga0058862_12227048 Ga0058862_122270481 180
262 3300031240 Ga0265320_10003153 Ga0265320_1000315310 180
263 3300031241 Ga0265325_10002838 Ga0265325_100028384 180
264 3300031247 Ga0265340_10018994 Ga0265340_100189945 180
265 3300035691 Ga0373931_0431111 Ga0373931_0431111_38_592 180
266 3300039438 Ga0436360_0543230 Ga0436360_0543230_114_671 180
267 3300044658 Ga0466972_0471867 Ga0466972_0471867_23_565 180
268 3300045836 Ga0466958_0169328 Ga0466958_0169328_185_742 180
269 3300045976 Ga0466967_0244384 Ga0466967_0244384_686_1243 180
270 3300049569 Ga0501032_0087223 Ga0501032_0087223_558_1100 180
271 3300049570 Ga0501033_0014827 Ga0501033_0014827_3464_4006 180
272 3300049571 Ga0501034_0077548 Ga0501034_0077548_1380_1922 180
273 3300049572 Ga0501036_0185206 Ga0501036_0185206_1190_1732 180
274 3300049579 Ga0501043_0197278 Ga0501043_0197278_348_890 180
275 3300049581 Ga0501047_0675219 Ga0501047_0675219_86_628 180
276 3300049586 Ga0501070_0141498 Ga0501070_0141498_1032_1574 180
277 3300049590 Ga0501074_0248247 Ga0501074_0248247_524_1066 180
278 3300005545 Ga0070695_100016895 Ga0070695_1000168956 181
279 3300006178 Ga0075367_10102956 Ga0075367_101029563 181
280 3300006844 Ga0075428_100028440 Ga0075428_1000284407 181
281 3300006846 Ga0075430_100013832 Ga0075430_1000138329 181
282 3300006847 Ga0075431_100000880 Ga0075431_10000088029 181
283 3300006880 Ga0075429_100000855 Ga0075429_10000085523 181
284 3300007076 Ga0075435_100367529 Ga0075435_1003675292 181
285 3300009094 Ga0111539_10000367 Ga0111539_1000036730 181
286 3300009147 Ga0114129_10000825 Ga0114129_1000082530 181
287 3300009147 Ga0114129_10176535 Ga0114129_101765352 181
288 3300013306 Ga0163162_10585205 Ga0163162_105852052 181
289 3300025949 Ga0207667_10054254 Ga0207667_100542543 181
290 3300027907 Ga0207428_10008616 Ga0207428_100086168 181
291 3300028379 Ga0268266_10088010 Ga0268266_100880104 181
292 3300031250 Ga0265331_10018315 Ga0265331_100183152 181
293 3300046678 Ga0495599_0224687 Ga0495599_0224687_19_567 181
294 3300048910 Ga0496107_0218161 Ga0496107_0218161_13_558 181
295 3300049568 Ga0501031_0037269 Ga0501031_0037269_1783_2328 181
296 3300049570 Ga0501033_0374984 Ga0501033_0374984_46_603 181
297 3300049573 Ga0501037_0336440 Ga0501037_0336440_242_799 181
298 3300049652 Ga0501202_048970 Ga0501202_048970_372_917 181
299 3300049822 Ga0501035_0016319 Ga0501035_0016319_5069_5626 181
300 3300049822 Ga0501035_0069769 Ga0501035_0069769_2107_2652 181
301 3300049823 Ga0501044_0050354 Ga0501044_0050354_2404_2949 181
302 3300050507 nmdc:mga05p37_540_c1 nmdc:mga05p37_540_c1_23558_24103 181
303 3300050508 nmdc:mga09592_848_c1 nmdc:mga09592_848_c1_1164_1709 181
304 3300050509 nmdc:mga0qj67_43893_c1 nmdc:mga0qj67_43893_c1_652_1197 181
305 3300050510 nmdc:mga06r32_3089_c1 nmdc:mga06r32_3089_c1_2344_2889 181
306 3300050511 nmdc:mga08y16_326573_c1 nmdc:mga08y16_326573_c1_840_1385 181
307 3300050511 nmdc:mga08y16_7410_c1 nmdc:mga08y16_7410_c1_3771_4316 181
308 3300050514 nmdc:mga08x19_6_c2 nmdc:mga08x19_6_c2_3799_4344 181
309 iso_pu_bacteria 2513237087 2513594079 181
310 iso_pu_bacteria 2643221547 2643758482 181
311 3300005327 Ga0070658_10168949 Ga0070658_101689492 182
312 3300005539 Ga0068853_100093302 Ga0068853_1000933022 182
313 3300005563 Ga0068855_100006202 Ga0068855_10000620216 182
314 3300006186 Ga0075369_10132287 Ga0075369_101322872 182
315 3300006846 Ga0075430_100093408 Ga0075430_1000934083 182
316 3300009093 Ga0105240_10011987 Ga0105240_100119873 182
317 3300009093 Ga0105240_10015552 Ga0105240_100155527 182
318 3300009148 Ga0105243_11242240 Ga0105243_112422401 182
319 3300010375 Ga0105239_10036916 Ga0105239_100369163 182
320 3300010375 Ga0105239_10140823 Ga0105239_101408233 182
321 3300013105 Ga0157369_10705866 Ga0157369_107058662 182
322 3300025913 Ga0207695_10026509 Ga0207695_100265096 182
323 3300025919 Ga0207657_10127414 Ga0207657_101274142 182
324 3300025924 Ga0207694_10265334 Ga0207694_102653342 182
325 3300025949 Ga0207667_10015427 Ga0207667_100154279 182
326 3300026116 Ga0207674_10410658 Ga0207674_104106581 182
327 3300031456 Ga0307513_10230922 Ga0307513_102309223 182
328 3300031616 Ga0307508_10196407 Ga0307508_101964072 182
329 3300039437 Ga0436365_1887606 Ga0436365_1887606_2377_2937 182
330 3300044712 Ga0453684_0010839 Ga0453684_0010839_7832_8395 182
331 3300048920 Ga0496117_0067198 Ga0496117_0067198_385_933 182
332 3300049571 Ga0501034_0076368 Ga0501034_0076368_1980_2528 182
333 3300049571 Ga0501034_0351369 Ga0501034_0351369_53_601 182
334 3300049573 Ga0501037_0006850 Ga0501037_0006850_1925_2485 182
335 3300049574 Ga0501038_0365027 Ga0501038_0365027_396_956 182
336 3300049579 Ga0501043_0076267 Ga0501043_0076267_973_1533 182
337 3300049580 Ga0501046_0183850 Ga0501046_0183850_55_615 182
338 3300049822 Ga0501035_0049988 Ga0501035_0049988_2669_3229 182
339 3300050494 nmdc:mga06z11_475355_c1 nmdc:mga06z11_475355_c1_58_606 182
340 3300050516 nmdc:mga0sz30_297217_c1 nmdc:mga0sz30_297217_c1_141_701 182
341 3300053096 Ga0500641_0005361 Ga0500641_0005361_2804_3358 182
342 3300053139 Ga0500568_0012317 Ga0500568_0012317_1059_1619 182
343 3300053142 Ga0500577_0053674 Ga0500577_0053674_565_1128 182
344 3300053177 Ga0500636_0014170 Ga0500636_0014170_2713_3261 182
345 3300028794 Ga0307515_10347015 Ga0307515_103470151 183
346 3300031901 Ga0307406_11017709 Ga0307406_110177091 183
347 3300047317 Ga0495604_0450737 Ga0495604_0450737_19_570 183
348 3300049571 Ga0501034_0056463 Ga0501034_0056463_3295_3855 183
349 3300049587 Ga0501071_0498439 Ga0501071_0498439_63_614 183
350 3300049823 Ga0501044_0149787 Ga0501044_0149787_144_707 183
351 3300054114 Ga0501084_1004112 Ga0501084_1004112_62_625 183
352 3300005341 Ga0070691_10000082 Ga0070691_1000008229 184
353 3300005367 Ga0070667_100003377 Ga0070667_1000033773 184
354 3300005434 Ga0070709_10000238 Ga0070709_1000023836 184
355 3300005434 Ga0070709_10045744 Ga0070709_100457442 184
356 3300005436 Ga0070713_100000011 Ga0070713_10000001178 184
357 3300005436 Ga0070713_100151412 Ga0070713_1001514122 184
358 3300005437 Ga0070710_10454226 Ga0070710_104542262 184
359 3300005439 Ga0070711_100356823 Ga0070711_1003568232 184
360 3300005458 Ga0070681_10233974 Ga0070681_102339742 184
361 3300005539 Ga0068853_100047449 Ga0068853_1000474493 184
362 3300005545 Ga0070695_100055449 Ga0070695_1000554492 184
363 3300005547 Ga0070693_100033589 Ga0070693_1000335893 184
364 3300005563 Ga0068855_100027939 Ga0068855_1000279392 184
365 3300005564 Ga0070664_100039249 Ga0070664_1000392493 184
366 3300005577 Ga0068857_100005182 Ga0068857_1000051829 184
367 3300005614 Ga0068856_100000964 Ga0068856_10000096413 184
368 3300005614 Ga0068856_100003424 Ga0068856_1000034248 184
369 3300005616 Ga0068852_100005817 Ga0068852_1000058178 184
370 3300005841 Ga0068863_100986815 Ga0068863_1009868151 184
371 3300006173 Ga0070716_100155533 Ga0070716_1001555331 184
372 3300006175 Ga0070712_100000014 Ga0070712_10000001485 184
373 3300006175 Ga0070712_100000314 Ga0070712_10000031418 184
374 3300006871 Ga0075434_100108181 Ga0075434_1001081815 184
375 3300006914 Ga0075436_100000047 Ga0075436_10000004744 184
376 3300006914 Ga0075436_100098258 Ga0075436_1000982583 184
377 3300007076 Ga0075435_100075730 Ga0075435_1000757302 184
378 3300009177 Ga0105248_10039182 Ga0105248_100391826 184
379 3300014968 Ga0157379_10022783 Ga0157379_100227836 184
380 3300025903 Ga0207680_10001937 Ga0207680_100019378 184
381 3300025906 Ga0207699_10000233 Ga0207699_100002337 184
382 3300025906 Ga0207699_10138978 Ga0207699_101389783 184
383 3300025906 Ga0207699_10205688 Ga0207699_102056882 184
384 3300025913 Ga0207695_10016906 Ga0207695_100169064 184
385 3300025915 Ga0207693_10000018 Ga0207693_1000001838 184
386 3300025915 Ga0207693_10000276 Ga0207693_1000027642 184
387 3300025916 Ga0207663_10255259 Ga0207663_102552593 184
388 3300025928 Ga0207700_10000005 Ga0207700_1000000543 184
389 3300025928 Ga0207700_10156506 Ga0207700_101565062 184
390 3300025939 Ga0207665_10190158 Ga0207665_101901583 184
391 3300025949 Ga0207667_10007703 Ga0207667_100077039 184
392 3300025949 Ga0207667_10347395 Ga0207667_103473952 184
393 3300025986 Ga0207658_10016628 Ga0207658_100166286 184
394 3300026041 Ga0207639_10039304 Ga0207639_100393043 184
395 3300026078 Ga0207702_10001080 Ga0207702_1000108015 184
396 3300026078 Ga0207702_10414983 Ga0207702_104149832 184
397 3300026116 Ga0207674_10000112 Ga0207674_1000011242 184
398 3300026142 Ga0207698_10007028 Ga0207698_100070284 184
399 3300028556 Ga0265337_1077861 Ga0265337_10778611 184
400 3300028800 Ga0265338_10025211 Ga0265338_100252118 184
401 3300028800 Ga0265338_10373225 Ga0265338_103732252 184
402 3300031238 Ga0265332_10086948 Ga0265332_100869482 184
403 3300031238 Ga0265332_10118928 Ga0265332_101189281 184
404 3300031241 Ga0265325_10000094 Ga0265325_1000009458 184
405 3300031249 Ga0265339_10007160 Ga0265339_100071609 184
406 3300031249 Ga0265339_10025613 Ga0265339_100256134 184
407 3300031344 Ga0265316_10020381 Ga0265316_100203812 184
408 3300031711 Ga0265314_10057403 Ga0265314_100574032 184
409 3300031711 Ga0265314_10105286 Ga0265314_101052862 184
410 3300031712 Ga0265342_10042692 Ga0265342_100426922 184
411 3300035112 Ga0373932_0021687 Ga0373932_0021687_287_844 184
412 3300035118 Ga0373954_0208443 Ga0373954_0208443_197_799 184
413 3300035691 Ga0373931_0010215 Ga0373931_0010215_2685_3242 184
414 3300035695 Ga0373927_0090159 Ga0373927_0090159_1231_1833 184
415 3300035724 Ga0373933_0017974 Ga0373933_0017974_510_1112 184
416 3300037068 Ga0373925_0136744 Ga0373925_0136744_631_1233 184
417 3300039437 Ga0436365_0703435 Ga0436365_0703435_2841_3398 184
418 3300039453 Ga0436362_1131996 Ga0436362_1131996_509_1063 184
419 3300045051 Ga0451576_0614764 Ga0451576_0614764_435_992 184
420 3300048929 Ga0496126_0000653 Ga0496126_0000653_41301_41858 184
421 3300049589 Ga0501073_0663568 Ga0501073_0663568_90_692 184
422 3300050512 nmdc:mga0n895_185387_c1 nmdc:mga0n895_185387_c1_14_571 184
423 3300050513 nmdc:mga0rr50_433606_c1 nmdc:mga0rr50_433606_c1_515_1072 184
424 3300050514 nmdc:mga08x19_26279_c1 nmdc:mga08x19_26279_c1_1780_2337 184
425 3300003215 JGI25153J46596_10001002 JGI25153J46596_1000100221 185
426 3300005327 Ga0070658_10065932 Ga0070658_100659322 185
427 3300005327 Ga0070658_10392359 Ga0070658_103923592 185
428 3300005329 Ga0070683_100538067 Ga0070683_1005380671 185
429 3300005339 Ga0070660_100048071 Ga0070660_1000480712 185
430 3300005339 Ga0070660_100245190 Ga0070660_1002451902 185
431 3300005339 Ga0070660_100294341 Ga0070660_1002943412 185
432 3300005341 Ga0070691_10005590 Ga0070691_100055906 185
433 3300005341 Ga0070691_10208519 Ga0070691_102085192 185
434 3300005344 Ga0070661_100263221 Ga0070661_1002632211 185
435 3300005344 Ga0070661_100855708 Ga0070661_1008557081 185
436 3300005366 Ga0070659_100072331 Ga0070659_1000723315 185
437 3300005435 Ga0070714_100102534 Ga0070714_1001025344 185
438 3300005435 Ga0070714_100783559 Ga0070714_1007835592 185
439 3300005437 Ga0070710_10127880 Ga0070710_101278802 185
440 3300005440 Ga0070705_100064547 Ga0070705_1000645472 185
441 3300005455 Ga0070663_100077387 Ga0070663_1000773872 185
442 3300005471 Ga0070698_100937610 Ga0070698_1009376101 185
443 3300005530 Ga0070679_100057246 Ga0070679_1000572466 185
444 3300005530 Ga0070679_100195179 Ga0070679_1001951792 185
445 3300005536 Ga0070697_100041945 Ga0070697_1000419452 185
446 3300005539 Ga0068853_100177958 Ga0068853_1001779583 185
447 3300005539 Ga0068853_100258552 Ga0068853_1002585523 185
448 3300005546 Ga0070696_100110164 Ga0070696_1001101642 185
449 3300005548 Ga0070665_100043299 Ga0070665_1000432992 185
450 3300005548 Ga0070665_100492091 Ga0070665_1004920912 185
451 3300005548 Ga0070665_101045588 Ga0070665_1010455881 185
452 3300005563 Ga0068855_100000106 Ga0068855_100000106101 185
453 3300005563 Ga0068855_100014142 Ga0068855_10001414211 185
454 3300005563 Ga0068855_100055070 Ga0068855_1000550706 185
455 3300005563 Ga0068855_100077683 Ga0068855_1000776833 185
456 3300005563 Ga0068855_100138942 Ga0068855_1001389422 185
457 3300005563 Ga0068855_100483284 Ga0068855_1004832842 185
458 3300005563 Ga0068855_100528692 Ga0068855_1005286922 185
459 3300005577 Ga0068857_100088072 Ga0068857_1000880722 185
460 3300005577 Ga0068857_100584454 Ga0068857_1005844541 185
461 3300005614 Ga0068856_100210874 Ga0068856_1002108744 185
462 3300005614 Ga0068856_100258190 Ga0068856_1002581902 185
463 3300005616 Ga0068852_101474884 Ga0068852_1014748841 185
464 3300005981 Ga0081538_10000555 Ga0081538_100005559 185
465 3300005983 Ga0081540_1000085 Ga0081540_100008593 185
466 3300005983 Ga0081540_1012270 Ga0081540_10122704 185
467 3300006028 Ga0070717_10602427 Ga0070717_106024272 185
468 3300006051 Ga0075364_10257245 Ga0075364_102572452 185
469 3300006178 Ga0075367_10358281 Ga0075367_103582811 185
470 3300006846 Ga0075430_100094425 Ga0075430_1000944251 185
471 3300006852 Ga0075433_10204790 Ga0075433_102047902 185
472 3300006871 Ga0075434_100194094 Ga0075434_1001940942 185
473 3300006881 Ga0068865_100293988 Ga0068865_1002939882 185
474 3300006914 Ga0075436_100015996 Ga0075436_1000159967 185
475 3300007076 Ga0075435_100030692 Ga0075435_1000306923 185
476 3300007076 Ga0075435_100455725 Ga0075435_1004557252 185
477 3300007265 Ga0099794_10479520 Ga0099794_104795201 185
478 3300009036 Ga0105244_10149710 Ga0105244_101497102 185
479 3300009093 Ga0105240_10000055 Ga0105240_1000005545 185
480 3300009098 Ga0105245_11251745 Ga0105245_112517451 185
481 3300009101 Ga0105247_10016288 Ga0105247_100162886 185
482 3300009147 Ga0114129_10203225 Ga0114129_102032253 185
483 3300009174 Ga0105241_10301851 Ga0105241_103018513 185
484 3300009176 Ga0105242_10495986 Ga0105242_104959862 185
485 3300009551 Ga0105238_10059046 Ga0105238_100590465 185
486 3300010375 Ga0105239_10004084 Ga0105239_100040849 185
487 3300013100 Ga0157373_10166258 Ga0157373_101662582 185
488 3300013104 Ga0157370_10004453 Ga0157370_1000445313 185
489 3300013104 Ga0157370_10123082 Ga0157370_101230822 185
490 3300013250 Ga0171462_1012 Ga0171462_1012191 185
491 3300013307 Ga0157372_10001838 Ga0157372_100018387 185
492 3300013307 Ga0157372_10021266 Ga0157372_100212664 185
493 3300013307 Ga0157372_10153838 Ga0157372_101538383 185
494 3300013307 Ga0157372_10172222 Ga0157372_101722223 185
495 3300014325 Ga0163163_10440936 Ga0163163_104409361 185
496 3300014326 Ga0157380_10646276 Ga0157380_106462761 185
497 3300017792 Ga0163161_10572422 Ga0163161_105724221 185
498 3300021377 Ga0213874_10142791 Ga0213874_101427912 185
499 3300021384 Ga0213876_10000537 Ga0213876_1000053727 185
500 3300021384 Ga0213876_10020516 Ga0213876_100205164 185
501 3300021384 Ga0213876_10208064 Ga0213876_102080641 185
502 3300025261 Ga0209233_1010276 Ga0209233_10102764 185
503 3300025272 Ga0209455_1020699 Ga0209455_10206992 185
504 3300025297 Ga0209758_1000008 Ga0209758_1000008236 185
505 3300025297 Ga0209758_1084564 Ga0209758_10845641 185
506 3300025898 Ga0207692_10096178 Ga0207692_100961782 185
507 3300025900 Ga0207710_10131905 Ga0207710_101319052 185
508 3300025904 Ga0207647_10460503 Ga0207647_104605031 185
509 3300025909 Ga0207705_10000058 Ga0207705_10000058135 185
510 3300025909 Ga0207705_10004973 Ga0207705_100049734 185
511 3300025912 Ga0207707_10100605 Ga0207707_101006052 185
512 3300025912 Ga0207707_10601225 Ga0207707_106012251 185
513 3300025913 Ga0207695_10000012 Ga0207695_10000012291 185
514 3300025913 Ga0207695_10003622 Ga0207695_100036226 185
515 3300025913 Ga0207695_10009386 Ga0207695_100093863 185
516 3300025913 Ga0207695_10022595 Ga0207695_100225958 185
517 3300025914 Ga0207671_10041489 Ga0207671_100414894 185
518 3300025914 Ga0207671_10054219 Ga0207671_100542191 185
519 3300025914 Ga0207671_10103585 Ga0207671_101035852 185
520 3300025914 Ga0207671_10904575 Ga0207671_109045751 185
521 3300025917 Ga0207660_10003913 Ga0207660_100039133 185
522 3300025917 Ga0207660_10111876 Ga0207660_101118762 185
523 3300025917 Ga0207660_10556548 Ga0207660_105565482 185
524 3300025919 Ga0207657_10001163 Ga0207657_1000116311 185
525 3300025919 Ga0207657_10076217 Ga0207657_100762173 185
526 3300025919 Ga0207657_10209736 Ga0207657_102097362 185
527 3300025921 Ga0207652_10017999 Ga0207652_100179997 185
528 3300025921 Ga0207652_10223206 Ga0207652_102232061 185
529 3300025924 Ga0207694_10000006 Ga0207694_10000006373 185
530 3300025924 Ga0207694_10048560 Ga0207694_100485605 185
531 3300025924 Ga0207694_10071716 Ga0207694_100717164 185
532 3300025924 Ga0207694_10095479 Ga0207694_100954793 185
533 3300025928 Ga0207700_10297353 Ga0207700_102973532 185
534 3300025929 Ga0207664_10016200 Ga0207664_100162008 185
535 3300025929 Ga0207664_10245800 Ga0207664_102458003 185
536 3300025929 Ga0207664_10433441 Ga0207664_104334412 185
537 3300025932 Ga0207690_10012687 Ga0207690_1001268710 185
538 3300025932 Ga0207690_10974988 Ga0207690_109749881 185
539 3300025938 Ga0207704_10176381 Ga0207704_101763812 185
540 3300025940 Ga0207691_10450005 Ga0207691_104500052 185
541 3300025941 Ga0207711_10274730 Ga0207711_102747302 185
542 3300025941 Ga0207711_10991979 Ga0207711_109919791 185
543 3300025949 Ga0207667_10000026 Ga0207667_1000002674 185
544 3300025949 Ga0207667_10002838 Ga0207667_1000283812 185
545 3300025949 Ga0207667_10158337 Ga0207667_101583372 185
546 3300025981 Ga0207640_10821368 Ga0207640_108213681 185
547 3300025981 Ga0207640_11213628 Ga0207640_112136281 185
548 3300026041 Ga0207639_10231800 Ga0207639_102318002 185
549 3300026067 Ga0207678_10038547 Ga0207678_100385474 185
550 3300026078 Ga0207702_10378154 Ga0207702_103781542 185
551 3300026078 Ga0207702_11279586 Ga0207702_112795861 185
552 3300026116 Ga0207674_10087310 Ga0207674_100873103 185
553 3300026116 Ga0207674_10141586 Ga0207674_101415862 185
554 3300026142 Ga0207698_10173140 Ga0207698_101731401 185
555 3300026142 Ga0207698_11146899 Ga0207698_111468991 185
556 3300028379 Ga0268266_10156033 Ga0268266_101560332 185
557 3300028380 Ga0268265_10512437 Ga0268265_105124372 185
558 3300028573 Ga0265334_10008085 Ga0265334_100080852 185
559 3300028577 Ga0265318_10000444 Ga0265318_1000044428 185
560 3300028577 Ga0265318_10003610 Ga0265318_100036101 185
561 3300028800 Ga0265338_10000011 Ga0265338_10000011230 185
562 3300028800 Ga0265338_10072660 Ga0265338_100726602 185
563 3300028800 Ga0265338_10128693 Ga0265338_101286932 185
564 3300031235 Ga0265330_10011184 Ga0265330_100111843 185
565 3300031235 Ga0265330_10030973 Ga0265330_100309733 185
566 3300031238 Ga0265332_10006040 Ga0265332_100060406 185
567 3300031238 Ga0265332_10017334 Ga0265332_100173342 185
568 3300031238 Ga0265332_10045050 Ga0265332_100450502 185
569 3300031239 Ga0265328_10026476 Ga0265328_100264763 185
570 3300031240 Ga0265320_10015770 Ga0265320_100157705 185
571 3300031241 Ga0265325_10000009 Ga0265325_10000009109 185
572 3300031241 Ga0265325_10001690 Ga0265325_1000169015 185
573 3300031241 Ga0265325_10033081 Ga0265325_100330813 185
574 3300031241 Ga0265325_10041342 Ga0265325_100413423 185
575 3300031241 Ga0265325_10061936 Ga0265325_100619364 185
576 3300031241 Ga0265325_10092700 Ga0265325_100927001 185
577 3300031242 Ga0265329_10016573 Ga0265329_100165732 185
578 3300031247 Ga0265340_10000159 Ga0265340_1000015910 185
579 3300031247 Ga0265340_10000562 Ga0265340_100005627 185
580 3300031247 Ga0265340_10007094 Ga0265340_100070945 185
581 3300031247 Ga0265340_10029135 Ga0265340_100291353 185
582 3300031247 Ga0265340_10034288 Ga0265340_100342884 185
583 3300031247 Ga0265340_10123891 Ga0265340_101238912 185
584 3300031249 Ga0265339_10000320 Ga0265339_1000032047 185
585 3300031249 Ga0265339_10029739 Ga0265339_100297394 185
586 3300031249 Ga0265339_10048309 Ga0265339_100483094 185
587 3300031249 Ga0265339_10072044 Ga0265339_100720442 185
588 3300031249 Ga0265339_10155506 Ga0265339_101555062 185
589 3300031250 Ga0265331_10045617 Ga0265331_100456171 185
590 3300031250 Ga0265331_10066308 Ga0265331_100663083 185
591 3300031344 Ga0265316_10063310 Ga0265316_100633102 185
592 3300031344 Ga0265316_10106193 Ga0265316_101061932 185
593 3300031344 Ga0265316_10126519 Ga0265316_101265192 185
594 3300031595 Ga0265313_10000176 Ga0265313_1000017642 185
595 3300031595 Ga0265313_10002778 Ga0265313_1000277813 185
596 3300031595 Ga0265313_10016249 Ga0265313_100162492 185
597 3300031595 Ga0265313_10028797 Ga0265313_100287973 185
598 3300031616 Ga0307508_10436681 Ga0307508_104366811 185
599 3300031711 Ga0265314_10022487 Ga0265314_100224875 185
600 3300031711 Ga0265314_10085255 Ga0265314_100852554 185
601 3300031711 Ga0265314_10225858 Ga0265314_102258582 185
602 3300031711 Ga0265314_10304631 Ga0265314_103046312 185
603 3300031712 Ga0265342_10016987 Ga0265342_100169872 185
604 3300031712 Ga0265342_10025710 Ga0265342_100257104 185
605 3300031712 Ga0265342_10038212 Ga0265342_100382122 185
606 3300031712 Ga0265342_10062969 Ga0265342_100629691 185
607 3300031712 Ga0265342_10199850 Ga0265342_101998502 185
608 3300031730 Ga0307516_10112004 Ga0307516_101120043 185
609 3300031852 Ga0307410_10343984 Ga0307410_103439841 185
610 3300031995 Ga0307409_100483777 Ga0307409_1004837771 185
611 3300035089 Ga0373944_0023315 Ga0373944_0023315_561_1121 185
612 3300035113 Ga0373936_0049106 Ga0373936_0049106_499_1059 185
613 3300035115 Ga0373941_0071756 Ga0373941_0071756_25_585 185
614 3300035116 Ga0373945_0136157 Ga0373945_0136157_345_905 185
615 3300035117 Ga0373953_0151197 Ga0373953_0151197_85_642 185
616 3300035118 Ga0373954_0154300 Ga0373954_0154300_357_914 185
617 3300035119 Ga0373956_0078062 Ga0373956_0078062_674_1231 185
618 3300035119 Ga0373956_0186587 Ga0373956_0186587_341_898 185
619 3300035120 Ga0373957_0047902 Ga0373957_0047902_988_1545 185
620 3300035170 Ga0373943_0002306 Ga0373943_0002306_3770_4330 185
621 3300035172 Ga0373955_0016037 Ga0373955_0016037_547_1104 185
622 3300035242 Ga0373962_0049178 Ga0373962_0049178_263_823 185
623 3300035695 Ga0373927_0137697 Ga0373927_0137697_422_982 185
624 3300035695 Ga0373927_0761336 Ga0373927_0761336_54_611 185
625 3300035724 Ga0373933_0030381 Ga0373933_0030381_1184_1741 185
626 3300035724 Ga0373933_0331724 Ga0373933_0331724_10_567 185
627 3300035725 Ga0373947_0005370 Ga0373947_0005370_4767_5327 185
628 3300035725 Ga0373947_0082089 Ga0373947_0082089_1316_1876 185
629 3300036401 Ga0373937_0048874 Ga0373937_0048874_2227_2784 185
630 3300036401 Ga0373937_0066672 Ga0373937_0066672_988_1545 185
631 3300036401 Ga0373937_0424626 Ga0373937_0424626_382_942 185
632 3300037068 Ga0373925_0012671 Ga0373925_0012671_3577_4137 185
633 3300037312 Ga0395899_0269714 Ga0395899_0269714_188_748 185
634 3300037418 Ga0395900_0323529 Ga0395900_0323529_360_920 185
635 3300037466 Ga0395898_0230496 Ga0395898_0230496_611_1171 185
636 3300039437 Ga0436365_0257402 Ga0436365_0257402_125995_126555 185
637 3300039437 Ga0436365_1581781 Ga0436365_1581781_241_798 185
638 3300039437 Ga0436365_1740837 Ga0436365_1740837_273_833 185
639 3300039450 Ga0436363_1097369 Ga0436363_1097369_20_577 185
640 3300039450 Ga0436363_1599936 Ga0436363_1599936_102_662 185
641 3300042147 Ga0450910_060756 Ga0450910_060756_14_571 185
642 3300042184 Ga0450908_033908 Ga0450908_033908_228_785 185
643 3300044694 Ga0466963_0596339 Ga0466963_0596339_134_691 185
644 3300046459 Ga0495629_0054668 Ga0495629_0054668_2207_2767 185
645 3300046462 Ga0495651_0099841 Ga0495651_0099841_1493_2050 185
646 3300046462 Ga0495651_0519508 Ga0495651_0519508_152_709 185
647 3300046463 Ga0495653_0137762 Ga0495653_0137762_302_859 185
648 3300046472 Ga0495580_0056424 Ga0495580_0056424_374_934 185
649 3300046477 Ga0495664_0048077 Ga0495664_0048077_667_1227 185
650 3300046524 Ga0495648_0225185 Ga0495648_0225185_89_646 185
651 3300046529 Ga0495652_0062800 Ga0495652_0062800_2355_2915 185
652 3300046529 Ga0495652_0160489 Ga0495652_0160489_756_1316 185
653 3300046543 Ga0495645_0006290 Ga0495645_0006290_2144_2704 185
654 3300046559 Ga0495667_0146213 Ga0495667_0146213_115_672 185
655 3300046678 Ga0495599_0156034 Ga0495599_0156034_346_906 185
656 3300046683 Ga0495658_0001623 Ga0495658_0001623_7341_7901 185
657 3300046691 Ga0495670_0100510 Ga0495670_0100510_141_698 185
658 3300046809 Ga0495600_0044792 Ga0495600_0044792_1120_1677 185
659 3300047315 Ga0495581_0198013 Ga0495581_0198013_337_897 185
660 3300047444 Ga0495675_0063178 Ga0495675_0063178_1420_1980 185
661 3300047444 Ga0495675_0171663 Ga0495675_0171663_520_1077 185
662 3300047471 Ga0495684_0277025 Ga0495684_0277025_517_1077 185
663 3300048088 Ga0495602_0105949 Ga0495602_0105949_1646_2203 185
664 3300048903 Ga0496100_0137655 Ga0496100_0137655_627_1184 185
665 3300048904 Ga0496101_0062638 Ga0496101_0062638_634_1191 185
666 3300048905 Ga0496102_0036294 Ga0496102_0036294_337_894 185
667 3300048908 Ga0496105_0201827 Ga0496105_0201827_1037_1594 185
668 3300048910 Ga0496107_0106538 Ga0496107_0106538_741_1301 185
669 3300048912 Ga0496109_0072059 Ga0496109_0072059_1198_1755 185
670 3300048916 Ga0496113_0307785 Ga0496113_0307785_409_966 185
671 3300048920 Ga0496117_0106859 Ga0496117_0106859_311_868 185
672 3300048925 Ga0496122_0233827 Ga0496122_0233827_91_648 185
673 3300048926 Ga0496123_0018805 Ga0496123_0018805_2238_2795 185
674 3300048926 Ga0496123_0026687 Ga0496123_0026687_2443_3000 185
675 3300048929 Ga0496126_0047387 Ga0496126_0047387_2810_3367 185
676 3300048929 Ga0496126_0295692 Ga0496126_0295692_75_635 185
677 3300049460 Ga0495682_0005324 Ga0495682_0005324_151_711 185
678 3300049568 Ga0501031_0161199 Ga0501031_0161199_77_637 185
679 3300049568 Ga0501031_0255051 Ga0501031_0255051_544_1110 185
680 3300049569 Ga0501032_0022010 Ga0501032_0022010_3730_4302 185
681 3300049570 Ga0501033_0002118 Ga0501033_0002118_1064_1630 185
682 3300049570 Ga0501033_0003652 Ga0501033_0003652_4861_5421 185
683 3300049570 Ga0501033_0005897 Ga0501033_0005897_7201_7773 185
684 3300049570 Ga0501033_0096022 Ga0501033_0096022_522_1082 185
685 3300049570 Ga0501033_0118761 Ga0501033_0118761_860_1420 185
686 3300049570 Ga0501033_0155031 Ga0501033_0155031_213_779 185
687 3300049570 Ga0501033_0194356 Ga0501033_0194356_859_1419 185
688 3300049571 Ga0501034_0000319 Ga0501034_0000319_60263_60820 185
689 3300049571 Ga0501034_0012726 Ga0501034_0012726_7740_8312 185
690 3300049571 Ga0501034_0070593 Ga0501034_0070593_689_1249 185
691 3300049571 Ga0501034_0095123 Ga0501034_0095123_1983_2543 185
692 3300049571 Ga0501034_1054309 Ga0501034_1054309_88_648 185
693 3300049572 Ga0501036_0003952 Ga0501036_0003952_4452_5024 185
694 3300049572 Ga0501036_0077192 Ga0501036_0077192_1839_2396 185
695 3300049572 Ga0501036_0312155 Ga0501036_0312155_726_1298 185
696 3300049572 Ga0501036_0645948 Ga0501036_0645948_226_783 185
697 3300049573 Ga0501037_0025665 Ga0501037_0025665_697_1263 185
698 3300049573 Ga0501037_0043927 Ga0501037_0043927_2567_3124 185
699 3300049573 Ga0501037_0110501 Ga0501037_0110501_685_1257 185
700 3300049573 Ga0501037_0305365 Ga0501037_0305365_103_681 185
701 3300049574 Ga0501038_0039495 Ga0501038_0039495_36_596 185
702 3300049574 Ga0501038_0328366 Ga0501038_0328366_247_807 185
703 3300049575 Ga0501039_0269245 Ga0501039_0269245_13_573 185
704 3300049577 Ga0501041_0251540 Ga0501041_0251540_482_1039 185
705 3300049578 Ga0501042_0165313 Ga0501042_0165313_365_937 185
706 3300049578 Ga0501042_0330442 Ga0501042_0330442_314_874 185
707 3300049579 Ga0501043_0008747 Ga0501043_0008747_365_937 185
708 3300049579 Ga0501043_0017115 Ga0501043_0017115_3451_4023 185
709 3300049579 Ga0501043_0022990 Ga0501043_0022990_264_824 185
710 3300049579 Ga0501043_0407220 Ga0501043_0407220_125_682 185
711 3300049580 Ga0501046_0000636 Ga0501046_0000636_14154_14726 185
712 3300049581 Ga0501047_0010064 Ga0501047_0010064_6678_7244 185
713 3300049581 Ga0501047_0019694 Ga0501047_0019694_5227_5787 185
714 3300049581 Ga0501047_0039859 Ga0501047_0039859_3403_3975 185
715 3300049581 Ga0501047_0098845 Ga0501047_0098845_1428_1985 185
716 3300049581 Ga0501047_0128466 Ga0501047_0128466_1743_2303 185
717 3300049581 Ga0501047_0367130 Ga0501047_0367130_19_579 185
718 3300049582 Ga0501048_0164427 Ga0501048_0164427_572_1144 185
719 3300049582 Ga0501048_0204992 Ga0501048_0204992_815_1375 185
720 3300049583 Ga0501067_0005701 Ga0501067_0005701_5563_6123 185
721 3300049583 Ga0501067_0023416 Ga0501067_0023416_2435_3007 185
722 3300049585 Ga0501069_0005748 Ga0501069_0005748_1842_2402 185
723 3300049585 Ga0501069_0012922 Ga0501069_0012922_3401_3973 185
724 3300049585 Ga0501069_0030096 Ga0501069_0030096_2093_2653 185
725 3300049586 Ga0501070_0000111 Ga0501070_0000111_5573_6133 185
726 3300049586 Ga0501070_0004624 Ga0501070_0004624_734_1306 185
727 3300049586 Ga0501070_0012304 Ga0501070_0012304_1033_1593 185
728 3300049586 Ga0501070_0074206 Ga0501070_0074206_1578_2138 185
729 3300049586 Ga0501070_0219503 Ga0501070_0219503_235_795 185
730 3300049586 Ga0501070_0311032 Ga0501070_0311032_681_1238 185
731 3300049586 Ga0501070_0781915 Ga0501070_0781915_16_576 185
732 3300049588 Ga0501072_0062563 Ga0501072_0062563_249_806 185
733 3300049589 Ga0501073_0009478 Ga0501073_0009478_706_1278 185
734 3300049589 Ga0501073_0016585 Ga0501073_0016585_1338_1910 185
735 3300049589 Ga0501073_0069206 Ga0501073_0069206_1135_1695 185
736 3300049589 Ga0501073_0099611 Ga0501073_0099611_151_711 185
737 3300049589 Ga0501073_0134155 Ga0501073_0134155_266_838 185
738 3300049590 Ga0501074_0008490 Ga0501074_0008490_6850_7422 185
739 3300049590 Ga0501074_0089575 Ga0501074_0089575_1329_1889 185
740 3300049590 Ga0501074_0091464 Ga0501074_0091464_1225_1782 185
741 3300049590 Ga0501074_0916200 Ga0501074_0916200_13_585 185
742 3300049591 Ga0501075_0120714 Ga0501075_0120714_1356_1913 185
743 3300049741 Ga0501079_0043670 Ga0501079_0043670_1314_1874 185
744 3300049742 Ga0501080_0018192 Ga0501080_0018192_2473_3033 185
745 3300049742 Ga0501080_0036380 Ga0501080_0036380_3252_3824 185
746 3300049742 Ga0501080_0108289 Ga0501080_0108289_1166_1726 185
747 3300049742 Ga0501080_0110137 Ga0501080_0110137_1780_2352 185
748 3300049742 Ga0501080_0898142 Ga0501080_0898142_133_693 185
749 3300049744 Ga0501083_0211772 Ga0501083_0211772_335_895 185
750 3300049822 Ga0501035_0002206 Ga0501035_0002206_9097_9657 185
751 3300049822 Ga0501035_0002523 Ga0501035_0002523_15659_16225 185
752 3300049822 Ga0501035_0005014 Ga0501035_0005014_5480_6040 185
753 3300049822 Ga0501035_0021716 Ga0501035_0021716_4739_5311 185
754 3300049822 Ga0501035_0042448 Ga0501035_0042448_62_622 185
755 3300049822 Ga0501035_0049511 Ga0501035_0049511_2203_2763 185
756 3300049822 Ga0501035_0062337 Ga0501035_0062337_1117_1689 185
757 3300049822 Ga0501035_0085641 Ga0501035_0085641_860_1417 185
758 3300049823 Ga0501044_0003903 Ga0501044_0003903_2975_3535 185
759 3300049823 Ga0501044_0006571 Ga0501044_0006571_5638_6198 185
760 3300049823 Ga0501044_0007608 Ga0501044_0007608_157_723 185
761 3300049823 Ga0501044_0010260 Ga0501044_0010260_7996_8568 185
762 3300049823 Ga0501044_0015004 Ga0501044_0015004_4645_5217 185
763 3300049823 Ga0501044_0037484 Ga0501044_0037484_2913_3473 185
764 3300049823 Ga0501044_0039733 Ga0501044_0039733_4296_4856 185
765 3300049823 Ga0501044_0066380 Ga0501044_0066380_1860_2420 185
766 3300049823 Ga0501044_0196394 Ga0501044_0196394_422_979 185
767 3300049823 Ga0501044_0218307 Ga0501044_0218307_904_1461 185
768 3300049823 Ga0501044_0334316 Ga0501044_0334316_33_593 185
769 3300049823 Ga0501044_0360028 Ga0501044_0360028_783_1355 185
770 3300049823 Ga0501044_0476958 Ga0501044_0476958_25_585 185
771 3300049823 Ga0501044_0627177 Ga0501044_0627177_38_604 185
772 3300049824 Ga0501045_0410009 Ga0501045_0410009_158_730 185
773 3300050489 nmdc:mga03683_32624_c1 nmdc:mga03683_32624_c1_308_865 185
774 3300050491 nmdc:mga00v17_264714_c1 nmdc:mga00v17_264714_c1_277_834 185
775 3300050492 nmdc:mga0yw44_196788_c1 nmdc:mga0yw44_196788_c1_560_1117 185
776 3300050512 nmdc:mga0n895_183410_c1 nmdc:mga0n895_183410_c1_43_621 185
777 3300050516 nmdc:mga0sz30_110484_c1 nmdc:mga0sz30_110484_c1_458_1015 185
778 3300053077 Ga0495601_0007443 Ga0495601_0007443_2423_2980 185
779 3300053078 Ga0495612_0008980 Ga0495612_0008980_2022_2579 185
780 3300053084 Ga0495595_0002673 Ga0495595_0002673_790_1347 185
781 3300053084 Ga0495595_0059267 Ga0495595_0059267_827_1384 185
782 3300053085 Ga0495619_0012413 Ga0495619_0012413_134_691 185
783 3300053085 Ga0495619_0081396 Ga0495619_0081396_706_1263 185
784 3300053090 Ga0500646_0109722 Ga0500646_0109722_288_848 185
785 3300053091 Ga0500647_0245044 Ga0500647_0245044_137_697 185
786 3300053109 Ga0500569_035235 Ga0500569_035235_362_919 185
787 3300053117 Ga0500593_000272 Ga0500593_000272_1048_1605 185
788 3300053118 Ga0500594_0100436 Ga0500594_0100436_20_577 185
789 3300053121 Ga0500607_127316 Ga0500607_127316_416_973 185
790 3300053133 Ga0500655_001513 Ga0500655_001513_2804_3364 185
791 3300053139 Ga0500568_0000005 Ga0500568_0000005_170894_171451 185
792 3300053153 Ga0500616_0062236 Ga0500616_0062236_1229_1786 185
793 3300053153 Ga0500616_0325338 Ga0500616_0325338_18_614 185
794 3300053156 Ga0500622_0001386 Ga0500622_0001386_2053_2613 185
795 3300053156 Ga0500622_0113530 Ga0500622_0113530_228_785 185
796 3300053727 Ga0500611_144920 Ga0500611_144920_21_593 185
797 3300054114 Ga0501084_0042460 Ga0501084_0042460_815_1375 185
798 3300060353 Ga0501082_0011504 Ga0501082_0011504_3861_4433 185
799 3300060353 Ga0501082_0118964 Ga0501082_0118964_59_619 185
800 3300061734 Ga0530510_0058376 Ga0530510_0058376_1352_1909 185
801 iso_pu_bacteria 2508501050 2508727363 185
802 iso_pu_bacteria 2508501114 2509077094 185
803 iso_pu_bacteria 2773857925 2774873044 185
804 iso_pu_bacteria 2775506901 2776262402 185
805 iso_pu_bacteria 2835312727 2835313005 185
806 iso_pu_bacteria 2882456835 2882461350 185
807 iso_pu_bacteria 2884298095 2884298784 185
808 iso_pu_bacteria 2894232714 2894234187 185
809 3300035724 Ga0373933_0394071 Ga0373933_0394071_262_822 186
810 iso_pu_bacteria 2643221733 2644730081 186
811 iso_pu_bacteria 2643221734 2644737148 186
812 iso_pu_bacteria 2643221736 2644742925 186
813 iso_pu_bacteria 2818991467 2819720050 186
814 iso_pu_bacteria 2841760612 2841765273 186
815 iso_pu_bacteria 2844104063 2844106883 186
816 iso_pu_bacteria 2851182111 2851185856 186
817 iso_pu_bacteria 2851246043 2851248923 186
818 iso_pu_bacteria 8057529695 8057532721 186
819 3300031727 Ga0316576_10109452 Ga0316576_101094523 187
820 3300031728 Ga0316578_10060257 Ga0316578_100602573 187
821 3300039062 Ga0400483_031136 Ga0400483_031136_1810_2394 187
822 3300039062 Ga0400483_261441 Ga0400483_261441_1047_1631 187
823 3300039447 Ga0436361_0290139 Ga0436361_0290139_817_1440 187
824 3300005354 Ga0070675_101055289 Ga0070675_1010552891 188
825 3300005456 Ga0070678_100193757 Ga0070678_1001937572 188
826 3300005459 Ga0068867_100120838 Ga0068867_1001208382 188
827 3300005548 Ga0070665_100623458 Ga0070665_1006234581 188
828 3300006881 Ga0068865_100125667 Ga0068865_1001256672 188
829 3300009093 Ga0105240_10059737 Ga0105240_100597374 188
830 3300009148 Ga0105243_10395671 Ga0105243_103956712 188
831 3300009545 Ga0105237_10208069 Ga0105237_102080691 188
832 3300013104 Ga0157370_10389712 Ga0157370_103897121 188
833 3300013306 Ga0163162_10051883 Ga0163162_100518834 188
834 3300021358 Ga0213873_10060593 Ga0213873_100605932 188
835 3300021361 Ga0213872_10044499 Ga0213872_100444991 188
836 3300021441 Ga0213871_10042895 Ga0213871_100428951 188
837 3300025913 Ga0207695_10177592 Ga0207695_101775923 188
838 3300025919 Ga0207657_10406424 Ga0207657_104064241 188
839 3300025928 Ga0207700_10980997 Ga0207700_109809971 188
840 3300025935 Ga0207709_10592101 Ga0207709_105921011 188
841 3300025938 Ga0207704_10126082 Ga0207704_101260822 188
842 3300026035 Ga0207703_10030782 Ga0207703_100307826 188
843 3300026121 Ga0207683_10296793 Ga0207683_102967931 188
844 3300028379 Ga0268266_10256215 Ga0268266_102562152 188
845 3300028786 Ga0307517_10265289 Ga0307517_102652891 188
846 3300031239 Ga0265328_10059621 Ga0265328_100596212 188
847 3300031249 Ga0265339_10020568 Ga0265339_100205684 188
848 3300031344 Ga0265316_10399989 Ga0265316_103999891 188
849 3300031344 Ga0265316_10561778 Ga0265316_105617781 188
850 3300031456 Ga0307513_10164521 Ga0307513_101645212 188
851 3300031711 Ga0265314_10016114 Ga0265314_100161142 188
852 3300031711 Ga0265314_10062004 Ga0265314_100620045 188
853 3300039438 Ga0436360_0009637 Ga0436360_0009637_110_676 188
854 3300039438 Ga0436360_0234379 Ga0436360_0234379_4420_4986 188
855 3300039438 Ga0436360_0409435 Ga0436360_0409435_332_898 188
856 3300039438 Ga0436360_0573541 Ga0436360_0573541_548_1114 188
857 3300039438 Ga0436360_1008458 Ga0436360_1008458_38_604 188
858 3300039447 Ga0436361_0801523 Ga0436361_0801523_719_1285 188
859 3300039447 Ga0436361_0856042 Ga0436361_0856042_2287_2856 188
860 3300039447 Ga0436361_0956481 Ga0436361_0956481_553_1122 188
861 3300039450 Ga0436363_0243575 Ga0436363_0243575_1180_1746 188
862 3300039450 Ga0436363_0521106 Ga0436363_0521106_1043_1609 188
863 3300039453 Ga0436362_0160092 Ga0436362_0160092_111_677 188
864 3300039453 Ga0436362_0283225 Ga0436362_0283225_583_1149 188
865 3300039453 Ga0436362_0508487 Ga0436362_0508487_129_695 188
866 3300039453 Ga0436362_1168099 Ga0436362_1168099_321_887 188
867 3300044684 Ga0466966_0016096 Ga0466966_0016096_2509_3075 188
868 3300045049 Ga0466959_0032618 Ga0466959_0032618_1078_1644 188
869 3300045836 Ga0466958_0096417 Ga0466958_0096417_234_800 188
870 3300046557 Ga0495622_0002344 Ga0495622_0002344_5934_6503 188
871 3300046675 Ga0495657_0248353 Ga0495657_0248353_340_909 188
872 3300048908 Ga0496105_0141411 Ga0496105_0141411_287_853 188
873 3300048924 Ga0496121_0000987 Ga0496121_0000987_3890_4459 188
874 3300053094 Ga0500566_0188241 Ga0500566_0188241_154_723 188
875 3300053103 Ga0500555_056667 Ga0500555_056667_359_934 188
876 3300053119 Ga0500595_103449 Ga0500595_103449_13_582 188
877 3300053154 Ga0500619_105033 Ga0500619_105033_328_897 188
878 3300061719 Ga0466962_0206282 Ga0466962_0206282_221_787 188
879 iso_pu_bacteria 3000017691 3000018114 188
880 3300005331 Ga0070670_101232511 Ga0070670_1012325111 189
881 3300005615 Ga0070702_100416808 Ga0070702_1004168081 189
882 3300005985 Ga0081539_10056561 Ga0081539_100565614 189
883 3300025935 Ga0207709_10228974 Ga0207709_102289742 189
884 3300031824 Ga0307413_10051479 Ga0307413_100514792 189
885 3300031852 Ga0307410_10892682 Ga0307410_108926821 189
886 3300031901 Ga0307406_10619097 Ga0307406_106190972 189
887 3300031911 Ga0307412_10106318 Ga0307412_101063182 189
888 3300031995 Ga0307409_100229034 Ga0307409_1002290342 189
889 3300032002 Ga0307416_101052819 Ga0307416_1010528192 189
890 3300049568 Ga0501031_0241277 Ga0501031_0241277_25_594 189
891 3300049577 Ga0501041_0077265 Ga0501041_0077265_599_1168 189
892 3300049580 Ga0501046_0131919 Ga0501046_0131919_1299_1868 189
893 3300049690 Ga0501261_022849 Ga0501261_022849_50_637 189
894 3300049742 Ga0501080_0701019 Ga0501080_0701019_305_874 189
895 3300049824 Ga0501045_0099474 Ga0501045_0099474_936_1505 189
896 3300053163 Ga0500639_030043 Ga0500639_030043_1372_1956 189
897 3300003187 JGI25151J46595_10065118 JGI25151J46595_100651183 190
898 3300003214 JGI25165J46597_1000035 JGI25165J46597_1000035204 190
899 3300003771 Ga0055526_1000017 Ga0055526_100001775 190
900 3300003775 Ga0055524_1000346 Ga0055524_100034619 190
901 3300003784 Ga0055534_1020864 Ga0055534_10208641 190
902 3300005262 Ga0065165_1000014 Ga0065165_1000014222 190
903 3300005327 Ga0070658_10013783 Ga0070658_100137832 190
904 3300005336 Ga0070680_100019997 Ga0070680_1000199975 190
905 3300005338 Ga0068868_100074643 Ga0068868_1000746434 190
906 3300005338 Ga0068868_100777868 Ga0068868_1007778681 190
907 3300005339 Ga0070660_100026293 Ga0070660_1000262932 190
908 3300005340 Ga0070689_100562049 Ga0070689_1005620491 190
909 3300005344 Ga0070661_100037883 Ga0070661_1000378834 190
910 3300005344 Ga0070661_100054716 Ga0070661_1000547164 190
911 3300005356 Ga0070674_100156460 Ga0070674_1001564601 190
912 3300005367 Ga0070667_100012865 Ga0070667_1000128654 190
913 3300005438 Ga0070701_10119472 Ga0070701_101194722 190
914 3300005456 Ga0070678_100002013 Ga0070678_1000020136 190
915 3300005456 Ga0070678_100031753 Ga0070678_1000317534 190
916 3300005458 Ga0070681_10030628 Ga0070681_100306286 190
917 3300005459 Ga0068867_100014884 Ga0068867_1000148846 190
918 3300005530 Ga0070679_100111217 Ga0070679_1001112172 190
919 3300005535 Ga0070684_100089015 Ga0070684_1000890153 190
920 3300005539 Ga0068853_100801823 Ga0068853_1008018232 190
921 3300005547 Ga0070693_100402999 Ga0070693_1004029991 190
922 3300005548 Ga0070665_100002597 Ga0070665_10000259722 190
923 3300005548 Ga0070665_100057758 Ga0070665_1000577584 190
924 3300005548 Ga0070665_100151997 Ga0070665_1001519973 190
925 3300005548 Ga0070665_100272665 Ga0070665_1002726652 190
926 3300005548 Ga0070665_100288383 Ga0070665_1002883832 190
927 3300005563 Ga0068855_100012271 Ga0068855_10001227112 190
928 3300005564 Ga0070664_100362090 Ga0070664_1003620902 190
929 3300005614 Ga0068856_100546245 Ga0068856_1005462451 190
930 3300005614 Ga0068856_101287059 Ga0068856_1012870591 190
931 3300005616 Ga0068852_100244694 Ga0068852_1002446942 190
932 3300005617 Ga0068859_100166394 Ga0068859_1001663943 190
933 3300005617 Ga0068859_100448827 Ga0068859_1004488272 190
934 3300005618 Ga0068864_100070798 Ga0068864_1000707982 190
935 3300005718 Ga0068866_10026254 Ga0068866_100262543 190
936 3300005719 Ga0068861_101100664 Ga0068861_1011006641 190
937 3300005834 Ga0068851_10074425 Ga0068851_100744252 190
938 3300005841 Ga0068863_100201536 Ga0068863_1002015363 190
939 3300005842 Ga0068858_100028088 Ga0068858_1000280882 190
940 3300005842 Ga0068858_100132435 Ga0068858_1001324354 190
941 3300005843 Ga0068860_100170056 Ga0068860_1001700562 190
942 3300005844 Ga0068862_100380837 Ga0068862_1003808372 190
943 3300005844 Ga0068862_100684859 Ga0068862_1006848592 190
944 3300006186 Ga0075369_10030068 Ga0075369_100300683 190
945 3300006237 Ga0097621_100011176 Ga0097621_1000111765 190
946 3300006358 Ga0068871_100007657 Ga0068871_10000765710 190
947 3300006881 Ga0068865_100025832 Ga0068865_1000258325 190
948 3300006881 Ga0068865_100639903 Ga0068865_1006399031 190
949 3300006931 Ga0097620_100166403 Ga0097620_1001664033 190
950 3300006931 Ga0097620_100448782 Ga0097620_1004487822 190
951 3300009093 Ga0105240_10318352 Ga0105240_103183523 190
952 3300009093 Ga0105240_11199516 Ga0105240_111995161 190
953 3300009101 Ga0105247_10200079 Ga0105247_102000792 190
954 3300009174 Ga0105241_10022531 Ga0105241_100225315 190
955 3300009174 Ga0105241_10230233 Ga0105241_102302332 190
956 3300009176 Ga0105242_10219682 Ga0105242_102196822 190
957 3300009177 Ga0105248_10031038 Ga0105248_100310382 190
958 3300009177 Ga0105248_10109932 Ga0105248_101099324 190
959 3300009177 Ga0105248_10482647 Ga0105248_104826472 190
960 3300009545 Ga0105237_10015763 Ga0105237_100157634 190
961 3300009545 Ga0105237_10259103 Ga0105237_102591032 190
962 3300009551 Ga0105238_10171582 Ga0105238_101715823 190
963 3300009551 Ga0105238_10347755 Ga0105238_103477552 190
964 3300009553 Ga0105249_10017761 Ga0105249_100177616 190
965 3300010375 Ga0105239_10150764 Ga0105239_101507641 190
966 3300011119 Ga0105246_10009904 Ga0105246_100099044 190
967 3300013104 Ga0157370_10280808 Ga0157370_102808083 190
968 3300013105 Ga0157369_10395457 Ga0157369_103954571 190
969 3300013296 Ga0157374_10025468 Ga0157374_100254683 190
970 3300013296 Ga0157374_10053771 Ga0157374_100537712 190
971 3300013296 Ga0157374_10119881 Ga0157374_101198813 190
972 3300013297 Ga0157378_10217130 Ga0157378_102171302 190
973 3300013306 Ga0163162_10044647 Ga0163162_100446475 190
974 3300013306 Ga0163162_10283378 Ga0163162_102833782 190
975 3300013307 Ga0157372_10071967 Ga0157372_100719675 190
976 3300013308 Ga0157375_10022440 Ga0157375_100224403 190
977 3300013308 Ga0157375_10358402 Ga0157375_103584023 190
978 3300014325 Ga0163163_10000012 Ga0163163_10000012201 190
979 3300014325 Ga0163163_10589756 Ga0163163_105897562 190
980 3300014968 Ga0157379_10002345 Ga0157379_100023456 190
981 3300014968 Ga0157379_10014522 Ga0157379_100145225 190
982 3300014968 Ga0157379_10102466 Ga0157379_101024662 190
983 3300014968 Ga0157379_10155032 Ga0157379_101550323 190
984 3300014969 Ga0157376_10002383 Ga0157376_100023839 190
985 3300014969 Ga0157376_10163184 Ga0157376_101631842 190
986 3300017792 Ga0163161_10003599 Ga0163161_100035994 190
987 3300025261 Ga0209233_1000006 Ga0209233_1000006698 190
988 3300025261 Ga0209233_1002157 Ga0209233_10021572 190
989 3300025284 Ga0209130_1000024 Ga0209130_100002454 190
990 3300025291 Ga0209675_1000712 Ga0209675_10007122 190
991 3300025294 Ga0209025_1000008 Ga0209025_100000836 190
992 3300025294 Ga0209025_1001592 Ga0209025_10015921 190
993 3300025295 Ga0209564_1000015 Ga0209564_100001590 190
994 3300025295 Ga0209564_1000031 Ga0209564_1000031132 190
995 3300025299 Ga0209256_1000181 Ga0209256_1000181114 190
996 3300025299 Ga0209256_1000205 Ga0209256_100020540 190
997 3300025304 Ga0209257_1068891 Ga0209257_10688911 190
998 3300025321 Ga0207656_10061995 Ga0207656_100619952 190
999 3300025893 Ga0207682_10143384 Ga0207682_101433842 190
1000 3300025899 Ga0207642_10108754 Ga0207642_101087542 190
1001 3300025900 Ga0207710_10256332 Ga0207710_102563322 190
1002 3300025903 Ga0207680_10005414 Ga0207680_100054144 190
1003 3300025907 Ga0207645_10005584 Ga0207645_100055844 190
1004 3300025909 Ga0207705_10013975 Ga0207705_100139755 190
1005 3300025911 Ga0207654_10011752 Ga0207654_100117526 190
1006 3300025912 Ga0207707_10131316 Ga0207707_101313164 190
1007 3300025913 Ga0207695_10084002 Ga0207695_100840025 190
1008 3300025913 Ga0207695_10111558 Ga0207695_101115582 190
1009 3300025913 Ga0207695_10135676 Ga0207695_101356763 190
1010 3300025913 Ga0207695_10210009 Ga0207695_102100093 190
1011 3300025914 Ga0207671_10032398 Ga0207671_100323985 190
1012 3300025917 Ga0207660_10059809 Ga0207660_100598092 190
1013 3300025919 Ga0207657_10048575 Ga0207657_100485753 190
1014 3300025920 Ga0207649_10060208 Ga0207649_100602084 190
1015 3300025920 Ga0207649_10212659 Ga0207649_102126592 190
1016 3300025921 Ga0207652_10094808 Ga0207652_100948083 190
1017 3300025924 Ga0207694_10276699 Ga0207694_102766991 190
1018 3300025925 Ga0207650_10588503 Ga0207650_105885031 190
1019 3300025925 Ga0207650_10777761 Ga0207650_107777611 190
1020 3300025926 Ga0207659_10112193 Ga0207659_101121932 190
1021 3300025927 Ga0207687_10058007 Ga0207687_100580072 190
1022 3300025927 Ga0207687_10058623 Ga0207687_100586234 190
1023 3300025928 Ga0207700_10098721 Ga0207700_100987213 190
1024 3300025934 Ga0207686_10070923 Ga0207686_100709233 190
1025 3300025934 Ga0207686_10332011 Ga0207686_103320112 190
1026 3300025935 Ga0207709_10014211 Ga0207709_100142114 190
1027 3300025936 Ga0207670_10595891 Ga0207670_105958911 190
1028 3300025937 Ga0207669_10258786 Ga0207669_102587862 190
1029 3300025938 Ga0207704_10069864 Ga0207704_100698642 190
1030 3300025941 Ga0207711_10013219 Ga0207711_100132195 190
1031 3300025941 Ga0207711_10336468 Ga0207711_103364681 190
1032 3300025941 Ga0207711_10779036 Ga0207711_107790361 190
1033 3300025945 Ga0207679_10467744 Ga0207679_104677442 190
1034 3300025949 Ga0207667_10010294 Ga0207667_100102941 190
1035 3300025960 Ga0207651_10074676 Ga0207651_100746764 190
1036 3300025961 Ga0207712_10014867 Ga0207712_100148674 190
1037 3300025981 Ga0207640_10040754 Ga0207640_100407542 190
1038 3300025986 Ga0207658_10023373 Ga0207658_100233732 190
1039 3300026023 Ga0207677_10004318 Ga0207677_100043185 190
1040 3300026035 Ga0207703_10108592 Ga0207703_101085922 190
1041 3300026041 Ga0207639_10123960 Ga0207639_101239603 190
1042 3300026078 Ga0207702_10144432 Ga0207702_101444321 190
1043 3300026089 Ga0207648_10009495 Ga0207648_100094959 190
1044 3300026089 Ga0207648_10032185 Ga0207648_100321852 190
1045 3300026089 Ga0207648_10160988 Ga0207648_101609882 190
1046 3300026095 Ga0207676_10043534 Ga0207676_100435342 190
1047 3300026116 Ga0207674_10125019 Ga0207674_101250192 190
1048 3300026118 Ga0207675_100507766 Ga0207675_1005077662 190
1049 3300026121 Ga0207683_10003082 Ga0207683_100030827 190
1050 3300026121 Ga0207683_10049440 Ga0207683_100494404 190
1051 3300026121 Ga0207683_10079367 Ga0207683_100793671 190
1052 3300026121 Ga0207683_10130897 Ga0207683_101308972 190
1053 3300026142 Ga0207698_10126006 Ga0207698_101260063 190
1054 3300028379 Ga0268266_10000463 Ga0268266_100004636 190
1055 3300028379 Ga0268266_10051760 Ga0268266_100517601 190
1056 3300028379 Ga0268266_10172741 Ga0268266_101727412 190
1057 3300028379 Ga0268266_10337188 Ga0268266_103371882 190
1058 3300028380 Ga0268265_10443931 Ga0268265_104439312 190
1059 3300028381 Ga0268264_10051832 Ga0268264_100518324 190
1060 3300028381 Ga0268264_10109120 Ga0268264_101091202 190
1061 3300028794 Ga0307515_10158798 Ga0307515_101587982 190
1062 3300028800 Ga0265338_10001087 Ga0265338_1000108724 190
1063 3300031247 Ga0265340_10064703 Ga0265340_100647032 190
1064 3300031249 Ga0265339_10077525 Ga0265339_100775251 190
1065 3300031595 Ga0265313_10032291 Ga0265313_100322912 190
1066 3300031711 Ga0265314_10031751 Ga0265314_100317512 190
1067 3300031711 Ga0265314_10149712 Ga0265314_101497121 190
1068 3300031730 Ga0307516_10061230 Ga0307516_100612304 190
1069 3300035172 Ga0373955_0681603 Ga0373955_0681603_25_621 190
1070 3300035207 Ga0373942_0061565 Ga0373942_0061565_463_1041 190
1071 3300035691 Ga0373931_0425147 Ga0373931_0425147_243_821 190
1072 3300037418 Ga0395900_0088308 Ga0395900_0088308_1509_2084 190
1073 3300037466 Ga0395898_0026131 Ga0395898_0026131_483_1058 190
1074 3300037471 Ga0395905_0970765 Ga0395905_0970765_33_611 190
1075 3300038443 Ga0395901_0043778 Ga0395901_0043778_4036_4611 190
1076 3300039437 Ga0436365_0683017 Ga0436365_0683017_448_1023 190
1077 3300044842 Ga0466957_0159678 Ga0466957_0159678_368_943 190
1078 3300046507 Ga0495606_0134503 Ga0495606_0134503_615_1193 190
1079 3300046539 Ga0495621_0046217 Ga0495621_0046217_40_618 190
1080 3300046616 Ga0495668_0161649 Ga0495668_0161649_112_690 190
1081 3300047318 Ga0495636_0018272 Ga0495636_0018272_2206_2784 190
1082 3300049569 Ga0501032_0131087 Ga0501032_0131087_529_1101 190
1083 3300049571 Ga0501034_0218897 Ga0501034_0218897_576_1154 190
1084 3300049572 Ga0501036_0096762 Ga0501036_0096762_322_894 190
1085 3300049572 Ga0501036_0188215 Ga0501036_0188215_1026_1601 190
1086 3300049573 Ga0501037_0042558 Ga0501037_0042558_1470_2045 190
1087 3300049581 Ga0501047_0216244 Ga0501047_0216244_217_789 190
1088 3300049581 Ga0501047_0442776 Ga0501047_0442776_177_755 190
1089 3300049587 Ga0501071_0074774 Ga0501071_0074774_933_1505 190
1090 3300049742 Ga0501080_0060319 Ga0501080_0060319_949_1524 190
1091 3300049744 Ga0501083_0668031 Ga0501083_0668031_44_622 190
1092 3300049822 Ga0501035_0191463 Ga0501035_0191463_858_1433 190
1093 3300049823 Ga0501044_0007813 Ga0501044_0007813_11041_11616 190
1094 3300049823 Ga0501044_0473340 Ga0501044_0473340_79_651 190
1095 3300053119 Ga0500595_000824 Ga0500595_000824_2083_2658 190
1096 3300053140 Ga0500573_0000032 Ga0500573_0000032_13222_13800 190
1097 3300053730 Ga0500645_004843 Ga0500645_004843_1747_2376 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01844

HNH

HNH endonuclease

115

160

0.97

PF14279

HNH_5

HNH endonuclease

115

170

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mpz-assembly1.cif.gz_A hnh nuclease domain from g. stearothermophilus cas9 0.8652 89 146
5vgb-assembly1.cif.gz_A crystal structure of nmecas9 hnh domain bound to anti-crispr acriic1 0.8072 89 146
6j9n-assembly1.cif.gz_A nmehnh+acriic3 0.8053 89 146
5x1h-assembly4.cif.gz_I structure of legionella pneumophila dotn 0.8003 88 131
4l0k-assembly2.cif.gz_D crystal structure of a type ii restriction endonuclease 0.7732 98 147
ID Description Score Start End Superfamily
af_I1MTW9_33_119_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.9568 108 142 1.10.30.50
af_P71806_355_434_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8021 86 138 2.30.29.30
4h9dB00 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.7126 87 146 1.10.30.50
af_I1MTU7_87_181_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.7078 110 166 1.10.30.50
2qgpB00 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.5868 76 147 1.10.30.50
ID Description Score Start End GO Terms
AF-A0A3C1HRD6-F1-model_v4 deleted 0.9918 88 147
AF-A0A3D2L8Y0-F1-model_v4 HNH endonuclease 0.9684 79 157 GO:0004519
AF-A0A2H1HV63-F1-model_v4 HNH endonuclease 0.9573 83 163 GO:0004519
AF-A0A3D2L8Y0-F1-model_v4 HNH endonuclease 0.9565 79 157 GO:0004519
AF-A0A257VR97-F1-model_v4 HNH nuclease domain-containing protein 0.9561 79 158

Feature Viewer

pLDDT pTM Quality
79.29 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map