F490009
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1097 | 463 | 1074 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300053730|Ga0500645_004843|Ga0500645_004843_1747_2376 |
| Length | 209 |
| Sequence | LPDACESTISVARFVTWEDEVTRLSPPLDSCPALVLNADFRPLSYFPLSLWSWQDTVKAVFLDRVNILSHYDQTVRSPNFEMRLPSVISLKEYVQATRRPAFTRFNVFLRDSFTCQYCGTGFPTHELTFDHVIPRSRGGRTTWDNVLTACSCCNLRKGDKLCRECGMHPRLEPFQPSAFELQENGRQFPPNFLHESWRDYLYWDSELDS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 4 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 5 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 6 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 7 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 8 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 9 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 10 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 11 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 12 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 13 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 14 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 15 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 16 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 17 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 18 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 19 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 20 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 21 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 22 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 23 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 24 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 25 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 26 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 137 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 138 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 141 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 214 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 219 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 226 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 228 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 230 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 233 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 234 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 235 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 236 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 240 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 241 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 249 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 255 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 261 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 263 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 264 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 265 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 267 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 278 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 279 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 280 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 281 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 282 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 283 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 284 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 285 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 286 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 288 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 289 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 290 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 291 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 292 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 293 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 294 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 295 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 296 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 297 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 298 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 301 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 302 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 303 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 304 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 364 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 365 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 366 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 378 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 379 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 380 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 381 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 382 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 409 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 410 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 418 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 419 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 420 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 421 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 422 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 431 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 436 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 437 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 438 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 439 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 440 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 441 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 442 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 443 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 444 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 445 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 446 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 447 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 448 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 449 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 450 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 451 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 452 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 453 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 454 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 455 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 456 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 457 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 458 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 459 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 462 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 463 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.81 |
| Metatranscriptomes | 0.09 |
| Isolates | 2.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.38 |
| Nodule | 0.91 |
| Rhizoplane | 2.83 |
| Rhizosphere | 85.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10065118 | 3300003187 | Bacteria | 1136 |
| 2 | JGI25165J46597_1000035 | 3300003214 | Bacteria | 290723 |
| 3 | JGI25153J46596_10001002 | 3300003215 | Bacteria | 17171 |
| 4 | JGI25404J52841_10004507 | 3300003659 | Bacteria | 2828 |
| 5 | Ga0055526_1000017 | 3300003771 | Bacteria | 210613 |
| 6 | Ga0055524_1000346 | 3300003775 | Bacteria | 42383 |
| 7 | Ga0055534_1020864 | 3300003784 | Bacteria | 1102 |
| 8 | Ga0058862_12227048 | 3300004803 | Bacteria | 754 |
| 9 | Ga0065165_1000014 | 3300005262 | Bacteria | 292366 |
| 10 | Ga0070658_10013783 | 3300005327 | Bacteria | 6487 |
| 11 | Ga0070658_10065932 | 3300005327 | Bacteria | 2957 |
| 12 | Ga0070658_10168949 | 3300005327 | Bacteria | 1837 |
| 13 | Ga0070658_10392359 | 3300005327 | Bacteria | 1192 |
| 14 | Ga0070683_100538067 | 3300005329 | Bacteria | 1117 |
| 15 | Ga0070670_100209151 | 3300005331 | Bacteria | 1696 |
| 16 | Ga0070670_101232511 | 3300005331 | Bacteria | 684 |
| 17 | Ga0070680_100019997 | 3300005336 | Bacteria | 5308 |
| 18 | Ga0068868_100074643 | 3300005338 | Bacteria | 2709 |
| 19 | Ga0068868_100777868 | 3300005338 | Bacteria | 862 |
| 20 | Ga0070660_100026293 | 3300005339 | Bacteria | 4332 |
| 21 | Ga0070660_100048071 | 3300005339 | Bacteria | 3275 |
| 22 | Ga0070660_100175509 | 3300005339 | Bacteria | 1733 |
| 23 | Ga0070660_100245190 | 3300005339 | Bacteria | 1460 |
| 24 | Ga0070660_100294341 | 3300005339 | Bacteria | 1330 |
| 25 | Ga0070689_100562049 | 3300005340 | Bacteria | 984 |
| 26 | Ga0070691_10000082 | 3300005341 | Bacteria | 26541 |
| 27 | Ga0070691_10005590 | 3300005341 | Bacteria | 5721 |
| 28 | Ga0070691_10208519 | 3300005341 | Bacteria | 1030 |
| 29 | Ga0070661_100037883 | 3300005344 | Bacteria | 3509 |
| 30 | Ga0070661_100054716 | 3300005344 | Bacteria | 2923 |
| 31 | Ga0070661_100263221 | 3300005344 | Bacteria | 1334 |
| 32 | Ga0070661_100855708 | 3300005344 | Bacteria | 749 |
| 33 | Ga0070668_100000460 | 3300005347 | Bacteria | 26920 |
| 34 | Ga0070669_100008586 | 3300005353 | Bacteria | 7293 |
| 35 | Ga0070675_101055289 | 3300005354 | Bacteria | 747 |
| 36 | Ga0070674_100156460 | 3300005356 | Bacteria | 1725 |
| 37 | Ga0070659_100072331 | 3300005366 | Bacteria | 2743 |
| 38 | Ga0070667_100000286 | 3300005367 | Bacteria | 57006 |
| 39 | Ga0070667_100003377 | 3300005367 | Bacteria | 13615 |
| 40 | Ga0070667_100012865 | 3300005367 | Bacteria | 6914 |
| 41 | Ga0070709_10000238 | 3300005434 | Bacteria | 35500 |
| 42 | Ga0070709_10045744 | 3300005434 | Bacteria | 2718 |
| 43 | Ga0070714_100102534 | 3300005435 | Bacteria | 2523 |
| 44 | Ga0070714_100783559 | 3300005435 | Bacteria | 923 |
| 45 | Ga0070713_100000011 | 3300005436 | Bacteria | 146314 |
| 46 | Ga0070713_100151412 | 3300005436 | Bacteria | 2064 |
| 47 | Ga0070710_10127880 | 3300005437 | Bacteria | 1546 |
| 48 | Ga0070710_10454226 | 3300005437 | Bacteria | 869 |
| 49 | Ga0070701_10119472 | 3300005438 | Bacteria | 1483 |
| 50 | Ga0070711_100356823 | 3300005439 | Bacteria | 1176 |
| 51 | Ga0070711_100574444 | 3300005439 | Unclassified | 938 |
| 52 | Ga0070705_100064547 | 3300005440 | Bacteria | 2188 |
| 53 | Ga0070663_100077387 | 3300005455 | Bacteria | 2435 |
| 54 | Ga0070678_100002013 | 3300005456 | Bacteria | 10984 |
| 55 | Ga0070678_100031753 | 3300005456 | Bacteria | 3648 |
| 56 | Ga0070678_100193757 | 3300005456 | Bacteria | 1673 |
| 57 | Ga0070681_10030628 | 3300005458 | Bacteria | 5400 |
| 58 | Ga0070681_10233974 | 3300005458 | Bacteria | 1751 |
| 59 | Ga0068867_100014884 | 3300005459 | Bacteria | 5513 |
| 60 | Ga0068867_100120838 | 3300005459 | Bacteria | 2024 |
| 61 | Ga0070698_100937610 | 3300005471 | Bacteria | 812 |
| 62 | Ga0070679_100057246 | 3300005530 | Bacteria | 3886 |
| 63 | Ga0070679_100111217 | 3300005530 | Bacteria | 2725 |
| 64 | Ga0070679_100195179 | 3300005530 | Bacteria | 1992 |
| 65 | Ga0070684_100089015 | 3300005535 | Bacteria | 2743 |
| 66 | Ga0070697_100041945 | 3300005536 | Bacteria | 3704 |
| 67 | Ga0068853_100047449 | 3300005539 | Bacteria | 3685 |
| 68 | Ga0068853_100093302 | 3300005539 | Bacteria | 2650 |
| 69 | Ga0068853_100177958 | 3300005539 | Bacteria | 1928 |
| 70 | Ga0068853_100258552 | 3300005539 | Bacteria | 1600 |
| 71 | Ga0068853_100801823 | 3300005539 | Bacteria | 902 |
| 72 | Ga0070695_100016895 | 3300005545 | Bacteria | 4422 |
| 73 | Ga0070695_100055449 | 3300005545 | Bacteria | 2554 |
| 74 | Ga0070696_100110164 | 3300005546 | Bacteria | 1982 |
| 75 | Ga0070693_100033589 | 3300005547 | Bacteria | 2832 |
| 76 | Ga0070693_100402999 | 3300005547 | Bacteria | 949 |
| 77 | Ga0070665_100002597 | 3300005548 | Bacteria | 19721 |
| 78 | Ga0070665_100043299 | 3300005548 | Bacteria | 4524 |
| 79 | Ga0070665_100057758 | 3300005548 | Bacteria | 3890 |
| 80 | Ga0070665_100151997 | 3300005548 | Bacteria | 2318 |
| 81 | Ga0070665_100272665 | 3300005548 | Bacteria | 1694 |
| 82 | Ga0070665_100288383 | 3300005548 | Bacteria | 1644 |
| 83 | Ga0070665_100492091 | 3300005548 | Bacteria | 1237 |
| 84 | Ga0070665_100623458 | 3300005548 | Bacteria | 1091 |
| 85 | Ga0070665_101045588 | 3300005548 | Bacteria | 828 |
| 86 | Ga0068855_100000106 | 3300005563 | Bacteria | 103864 |
| 87 | Ga0068855_100006202 | 3300005563 | Bacteria | 14572 |
| 88 | Ga0068855_100012271 | 3300005563 | Bacteria | 10354 |
| 89 | Ga0068855_100014142 | 3300005563 | Bacteria | 9615 |
| 90 | Ga0068855_100027939 | 3300005563 | Bacteria | 6749 |
| 91 | Ga0068855_100055070 | 3300005563 | Bacteria | 4673 |
| 92 | Ga0068855_100077683 | 3300005563 | Bacteria | 3852 |
| 93 | Ga0068855_100138942 | 3300005563 | Bacteria | 2771 |
| 94 | Ga0068855_100483284 | 3300005563 | Bacteria | 1348 |
| 95 | Ga0068855_100528692 | 3300005563 | Bacteria | 1279 |
| 96 | Ga0070664_100039249 | 3300005564 | Bacteria | 3989 |
| 97 | Ga0070664_100362090 | 3300005564 | Bacteria | 1321 |
| 98 | Ga0068857_100005182 | 3300005577 | Bacteria | 11087 |
| 99 | Ga0068857_100088072 | 3300005577 | Bacteria | 2777 |
| 100 | Ga0068857_100584454 | 3300005577 | Bacteria | 1054 |
| 101 | Ga0068856_100000964 | 3300005614 | Bacteria | 30705 |
| 102 | Ga0068856_100003424 | 3300005614 | Bacteria | 16037 |
| 103 | Ga0068856_100210874 | 3300005614 | Bacteria | 1958 |
| 104 | Ga0068856_100258190 | 3300005614 | Bacteria | 1758 |
| 105 | Ga0068856_100546245 | 3300005614 | Bacteria | 1180 |
| 106 | Ga0068856_101287059 | 3300005614 | Bacteria | 746 |
| 107 | Ga0070702_100416808 | 3300005615 | Bacteria | 965 |
| 108 | Ga0068852_100005817 | 3300005616 | Bacteria | 8853 |
| 109 | Ga0068852_100244694 | 3300005616 | Bacteria | 1716 |
| 110 | Ga0068852_101474884 | 3300005616 | Bacteria | 702 |
| 111 | Ga0068859_100166394 | 3300005617 | Bacteria | 2285 |
| 112 | Ga0068859_100448827 | 3300005617 | Bacteria | 1386 |
| 113 | Ga0068864_100070798 | 3300005618 | Bacteria | 3035 |
| 114 | Ga0068866_10026254 | 3300005718 | Bacteria | 2748 |
| 115 | Ga0068861_101100664 | 3300005719 | Bacteria | 763 |
| 116 | Ga0068851_10074425 | 3300005834 | Bacteria | 1763 |
| 117 | Ga0068863_100000168 | 3300005841 | Bacteria | 70935 |
| 118 | Ga0068863_100201536 | 3300005841 | Bacteria | 1914 |
| 119 | Ga0068863_100986815 | 3300005841 | Bacteria | 845 |
| 120 | Ga0068858_100028088 | 3300005842 | Bacteria | 5228 |
| 121 | Ga0068858_100132435 | 3300005842 | Bacteria | 2338 |
| 122 | Ga0068860_100170056 | 3300005843 | Bacteria | 2105 |
| 123 | Ga0068860_100272964 | 3300005843 | Bacteria | 1651 |
| 124 | Ga0068862_100380837 | 3300005844 | Bacteria | 1316 |
| 125 | Ga0068862_100684859 | 3300005844 | Bacteria | 992 |
| 126 | Ga0081538_10000555 | 3300005981 | Bacteria | 41352 |
| 127 | Ga0081540_1000085 | 3300005983 | Bacteria | 99716 |
| 128 | Ga0081540_1012270 | 3300005983 | Bacteria | 5660 |
| 129 | Ga0081539_10056561 | 3300005985 | Bacteria | 2176 |
| 130 | Ga0070717_10602427 | 3300006028 | Bacteria | 997 |
| 131 | Ga0075368_10199700 | 3300006042 | Bacteria | 846 |
| 132 | Ga0075364_10257245 | 3300006051 | Bacteria | 1187 |
| 133 | Ga0070716_100155533 | 3300006173 | Bacteria | 1476 |
| 134 | Ga0070712_100000014 | 3300006175 | Bacteria | 108668 |
| 135 | Ga0070712_100000314 | 3300006175 | Bacteria | 27319 |
| 136 | Ga0075367_10102956 | 3300006178 | Bacteria | 1747 |
| 137 | Ga0075367_10358281 | 3300006178 | Bacteria | 921 |
| 138 | Ga0075369_10030068 | 3300006186 | Bacteria | 2286 |
| 139 | Ga0075369_10132287 | 3300006186 | Bacteria | 1134 |
| 140 | Ga0097621_100011176 | 3300006237 | Bacteria | 6607 |
| 141 | Ga0068871_100007657 | 3300006358 | Bacteria | 7726 |
| 142 | Ga0075428_100028440 | 3300006844 | Bacteria | 6185 |
| 143 | Ga0075430_100013832 | 3300006846 | Bacteria | 6876 |
| 144 | Ga0075430_100093408 | 3300006846 | Bacteria | 2515 |
| 145 | Ga0075430_100094425 | 3300006846 | Bacteria | 2500 |
| 146 | Ga0075431_100000880 | 3300006847 | Bacteria | 26403 |
| 147 | Ga0075433_10204790 | 3300006852 | Bacteria | 1754 |
| 148 | Ga0075434_100108181 | 3300006871 | Bacteria | 2791 |
| 149 | Ga0075434_100194094 | 3300006871 | Bacteria | 2051 |
| 150 | Ga0075429_100000855 | 3300006880 | Bacteria | 23955 |
| 151 | Ga0068865_100025832 | 3300006881 | Bacteria | 3867 |
| 152 | Ga0068865_100125667 | 3300006881 | Bacteria | 1914 |
| 153 | Ga0068865_100293988 | 3300006881 | Bacteria | 1298 |
| 154 | Ga0068865_100639903 | 3300006881 | Bacteria | 903 |
| 155 | Ga0075436_100000047 | 3300006914 | Bacteria | 72907 |
| 156 | Ga0075436_100015996 | 3300006914 | Bacteria | 5136 |
| 157 | Ga0075436_100098258 | 3300006914 | Bacteria | 2037 |
| 158 | Ga0097620_100166403 | 3300006931 | Bacteria | 2285 |
| 159 | Ga0097620_100448782 | 3300006931 | Bacteria | 1386 |
| 160 | Ga0075435_100030692 | 3300007076 | Bacteria | 4229 |
| 161 | Ga0075435_100075730 | 3300007076 | Bacteria | 2757 |
| 162 | Ga0075435_100367529 | 3300007076 | Bacteria | 1235 |
| 163 | Ga0075435_100455725 | 3300007076 | Bacteria | 1103 |
| 164 | Ga0099794_10479520 | 3300007265 | Bacteria | 653 |
| 165 | Ga0105244_10149710 | 3300009036 | Bacteria | 1119 |
| 166 | Ga0105240_10000055 | 3300009093 | Bacteria | 225380 |
| 167 | Ga0105240_10011987 | 3300009093 | Bacteria | 12015 |
| 168 | Ga0105240_10015552 | 3300009093 | Bacteria | 10342 |
| 169 | Ga0105240_10028212 | 3300009093 | Bacteria | 7335 |
| 170 | Ga0105240_10033158 | 3300009093 | Bacteria | 6675 |
| 171 | Ga0105240_10059737 | 3300009093 | Bacteria | 4757 |
| 172 | Ga0105240_10187103 | 3300009093 | Bacteria | 2438 |
| 173 | Ga0105240_10318352 | 3300009093 | Bacteria | 1774 |
| 174 | Ga0105240_11199516 | 3300009093 | Bacteria | 804 |
| 175 | Ga0111539_10000367 | 3300009094 | Bacteria | 55719 |
| 176 | Ga0111539_10076197 | 3300009094 | Bacteria | 3949 |
| 177 | Ga0105245_10818295 | 3300009098 | Bacteria | 970 |
| 178 | Ga0105245_11251745 | 3300009098 | Bacteria | 790 |
| 179 | Ga0105247_10016288 | 3300009101 | Bacteria | 4453 |
| 180 | Ga0105247_10200079 | 3300009101 | Bacteria | 1342 |
| 181 | Ga0114129_10000825 | 3300009147 | Bacteria | 40003 |
| 182 | Ga0114129_10054590 | 3300009147 | Bacteria | 5602 |
| 183 | Ga0114129_10176535 | 3300009147 | Bacteria | 2909 |
| 184 | Ga0114129_10203225 | 3300009147 | Bacteria | 2682 |
| 185 | Ga0114129_11027880 | 3300009147 | Bacteria | 1036 |
| 186 | Ga0105243_10395671 | 3300009148 | Bacteria | 1282 |
| 187 | Ga0105243_11242240 | 3300009148 | Bacteria | 760 |
| 188 | Ga0105241_10022531 | 3300009174 | Bacteria | 4666 |
| 189 | Ga0105241_10230233 | 3300009174 | Bacteria | 1562 |
| 190 | Ga0105241_10301851 | 3300009174 | Bacteria | 1375 |
| 191 | Ga0105242_10219682 | 3300009176 | Bacteria | 1698 |
| 192 | Ga0105242_10495986 | 3300009176 | Bacteria | 1160 |
| 193 | Ga0105248_10031038 | 3300009177 | Bacteria | 5971 |
| 194 | Ga0105248_10039182 | 3300009177 | Bacteria | 5306 |
| 195 | Ga0105248_10109932 | 3300009177 | Bacteria | 3108 |
| 196 | Ga0105248_10482647 | 3300009177 | Bacteria | 1397 |
| 197 | Ga0105248_10695449 | 3300009177 | Bacteria | 1147 |
| 198 | Ga0105237_10014301 | 3300009545 | Bacteria | 8307 |
| 199 | Ga0105237_10015763 | 3300009545 | Bacteria | 7860 |
| 200 | Ga0105237_10070274 | 3300009545 | Bacteria | 3497 |
| 201 | Ga0105237_10208069 | 3300009545 | Bacteria | 1956 |
| 202 | Ga0105237_10259103 | 3300009545 | Bacteria | 1742 |
| 203 | Ga0105237_10706943 | 3300009545 | Bacteria | 1014 |
| 204 | Ga0105237_11693442 | 3300009545 | Bacteria | 640 |
| 205 | Ga0105238_10003708 | 3300009551 | Bacteria | 15199 |
| 206 | Ga0105238_10059046 | 3300009551 | Bacteria | 3843 |
| 207 | Ga0105238_10171582 | 3300009551 | Bacteria | 2145 |
| 208 | Ga0105238_10301334 | 3300009551 | Bacteria | 1586 |
| 209 | Ga0105238_10347755 | 3300009551 | Bacteria | 1471 |
| 210 | Ga0105249_10017761 | 3300009553 | Bacteria | 6319 |
| 211 | Ga0105249_10410476 | 3300009553 | Bacteria | 1386 |
| 212 | Ga0105249_10702721 | 3300009553 | Bacteria | 1071 |
| 213 | Ga0099796_10031529 | 3300010159 | Bacteria | 1729 |
| 214 | Ga0105239_10004084 | 3300010375 | Bacteria | 17564 |
| 215 | Ga0105239_10036916 | 3300010375 | Bacteria | 5360 |
| 216 | Ga0105239_10068805 | 3300010375 | Bacteria | 3891 |
| 217 | Ga0105239_10140823 | 3300010375 | Bacteria | 2687 |
| 218 | Ga0105239_10150764 | 3300010375 | Bacteria | 2595 |
| 219 | Ga0105239_10195832 | 3300010375 | Bacteria | 2263 |
| 220 | Ga0105239_10590879 | 3300010375 | Bacteria | 1266 |
| 221 | Ga0105239_10710453 | 3300010375 | Bacteria | 1149 |
| 222 | Ga0105246_10009904 | 3300011119 | Bacteria | 5878 |
| 223 | Ga0105246_10280295 | 3300011119 | Bacteria | 1337 |
| 224 | Ga0157373_10166258 | 3300013100 | Bacteria | 1552 |
| 225 | Ga0157370_10004453 | 3300013104 | Bacteria | 16057 |
| 226 | Ga0157370_10123082 | 3300013104 | Bacteria | 2422 |
| 227 | Ga0157370_10280808 | 3300013104 | Bacteria | 1539 |
| 228 | Ga0157370_10389712 | 3300013104 | Bacteria | 1283 |
| 229 | Ga0157369_10395457 | 3300013105 | Bacteria | 1434 |
| 230 | Ga0157369_10705866 | 3300013105 | Bacteria | 1038 |
| 231 | Ga0157369_10835689 | 3300013105 | Bacteria | 946 |
| 232 | Ga0171462_1012 | 3300013250 | Bacteria | 208216 |
| 233 | Ga0157374_10025468 | 3300013296 | Bacteria | 5312 |
| 234 | Ga0157374_10053771 | 3300013296 | Bacteria | 3754 |
| 235 | Ga0157374_10119881 | 3300013296 | Bacteria | 2538 |
| 236 | Ga0157378_10217130 | 3300013297 | Bacteria | 1816 |
| 237 | Ga0157378_10407490 | 3300013297 | Bacteria | 1341 |
| 238 | Ga0163162_10044647 | 3300013306 | Bacteria | 4439 |
| 239 | Ga0163162_10051883 | 3300013306 | Bacteria | 4117 |
| 240 | Ga0163162_10283378 | 3300013306 | Bacteria | 1789 |
| 241 | Ga0163162_10585205 | 3300013306 | Bacteria | 1243 |
| 242 | Ga0163162_11042084 | 3300013306 | Bacteria | 926 |
| 243 | Ga0163162_11744522 | 3300013306 | Bacteria | 711 |
| 244 | Ga0157372_10001838 | 3300013307 | Bacteria | 23006 |
| 245 | Ga0157372_10021266 | 3300013307 | Bacteria | 7008 |
| 246 | Ga0157372_10071967 | 3300013307 | Bacteria | 3895 |
| 247 | Ga0157372_10153838 | 3300013307 | Bacteria | 2656 |
| 248 | Ga0157372_10172222 | 3300013307 | Bacteria | 2505 |
| 249 | Ga0157372_11203848 | 3300013307 | Bacteria | 875 |
| 250 | Ga0157375_10022440 | 3300013308 | Bacteria | 5809 |
| 251 | Ga0157375_10358402 | 3300013308 | Bacteria | 1624 |
| 252 | Ga0163163_10000012 | 3300014325 | Bacteria | 257369 |
| 253 | Ga0163163_10440936 | 3300014325 | Bacteria | 1362 |
| 254 | Ga0163163_10589756 | 3300014325 | Bacteria | 1174 |
| 255 | Ga0157380_10028596 | 3300014326 | Bacteria | 4252 |
| 256 | Ga0157380_10139607 | 3300014326 | Bacteria | 2080 |
| 257 | Ga0157380_10646276 | 3300014326 | Bacteria | 1054 |
| 258 | Ga0182008_10043533 | 3300014497 | Bacteria | 2235 |
| 259 | Ga0157379_10002345 | 3300014968 | Bacteria | 15799 |
| 260 | Ga0157379_10014522 | 3300014968 | Bacteria | 6912 |
| 261 | Ga0157379_10022783 | 3300014968 | Bacteria | 5550 |
| 262 | Ga0157379_10102466 | 3300014968 | Bacteria | 2569 |
| 263 | Ga0157379_10155032 | 3300014968 | Bacteria | 2066 |
| 264 | Ga0157376_10002383 | 3300014969 | Bacteria | 12692 |
| 265 | Ga0157376_10163184 | 3300014969 | Bacteria | 2022 |
| 266 | Ga0163161_10003599 | 3300017792 | Bacteria | 10865 |
| 267 | Ga0163161_10572422 | 3300017792 | Bacteria | 928 |
| 268 | Ga0213873_10060593 | 3300021358 | Bacteria | 1024 |
| 269 | Ga0213872_10044499 | 3300021361 | Bacteria | 2020 |
| 270 | Ga0213874_10142791 | 3300021377 | Bacteria | 830 |
| 271 | Ga0213876_10000537 | 3300021384 | Bacteria | 28569 |
| 272 | Ga0213876_10020516 | 3300021384 | Bacteria | 3493 |
| 273 | Ga0213876_10208064 | 3300021384 | Bacteria | 1040 |
| 274 | Ga0213871_10042895 | 3300021441 | Bacteria | 1219 |
| 275 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 276 | Ga0209233_1002157 | 3300025261 | Bacteria | 7381 |
| 277 | Ga0209233_1010276 | 3300025261 | Bacteria | 2814 |
| 278 | Ga0209455_1020699 | 3300025272 | Bacteria | 1296 |
| 279 | Ga0209130_1000024 | 3300025284 | Bacteria | 354212 |
| 280 | Ga0209675_1000712 | 3300025291 | Bacteria | 22719 |
| 281 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 282 | Ga0209025_1001592 | 3300025294 | Bacteria | 28567 |
| 283 | Ga0209564_1000015 | 3300025295 | Bacteria | 615324 |
| 284 | Ga0209564_1000031 | 3300025295 | Bacteria | 494703 |
| 285 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 286 | Ga0209758_1084564 | 3300025297 | Bacteria | 948 |
| 287 | Ga0209256_1000181 | 3300025299 | Bacteria | 123624 |
| 288 | Ga0209256_1000205 | 3300025299 | Bacteria | 111530 |
| 289 | Ga0209257_1068891 | 3300025304 | Bacteria | 938 |
| 290 | Ga0207656_10061995 | 3300025321 | Bacteria | 1643 |
| 291 | Ga0207682_10143384 | 3300025893 | Bacteria | 1073 |
| 292 | Ga0207692_10096178 | 3300025898 | Bacteria | 1616 |
| 293 | Ga0207642_10108754 | 3300025899 | Bacteria | 1407 |
| 294 | Ga0207710_10131905 | 3300025900 | Bacteria | 1200 |
| 295 | Ga0207710_10256332 | 3300025900 | Bacteria | 876 |
| 296 | Ga0207680_10001937 | 3300025903 | Bacteria | 9718 |
| 297 | Ga0207680_10005414 | 3300025903 | Bacteria | 6099 |
| 298 | Ga0207680_10065939 | 3300025903 | Bacteria | 2225 |
| 299 | Ga0207647_10460503 | 3300025904 | Bacteria | 712 |
| 300 | Ga0207699_10000233 | 3300025906 | Bacteria | 31418 |
| 301 | Ga0207699_10138978 | 3300025906 | Bacteria | 1594 |
| 302 | Ga0207699_10205688 | 3300025906 | Bacteria | 1336 |
| 303 | Ga0207645_10005584 | 3300025907 | Bacteria | 9097 |
| 304 | Ga0207705_10000058 | 3300025909 | Bacteria | 155967 |
| 305 | Ga0207705_10004973 | 3300025909 | Bacteria | 9971 |
| 306 | Ga0207705_10013975 | 3300025909 | Bacteria | 5788 |
| 307 | Ga0207654_10011752 | 3300025911 | Bacteria | 4469 |
| 308 | Ga0207707_10100605 | 3300025912 | Bacteria | 2526 |
| 309 | Ga0207707_10131316 | 3300025912 | Bacteria | 2190 |
| 310 | Ga0207707_10601225 | 3300025912 | Bacteria | 931 |
| 311 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 312 | Ga0207695_10003622 | 3300025913 | Bacteria | 21591 |
| 313 | Ga0207695_10009386 | 3300025913 | Bacteria | 12100 |
| 314 | Ga0207695_10016906 | 3300025913 | Bacteria | 8513 |
| 315 | Ga0207695_10022595 | 3300025913 | Bacteria | 7135 |
| 316 | Ga0207695_10026509 | 3300025913 | Bacteria | 6469 |
| 317 | Ga0207695_10084002 | 3300025913 | Bacteria | 3215 |
| 318 | Ga0207695_10111558 | 3300025913 | Bacteria | 2714 |
| 319 | Ga0207695_10135676 | 3300025913 | Bacteria | 2414 |
| 320 | Ga0207695_10177592 | 3300025913 | Bacteria | 2051 |
| 321 | Ga0207695_10210009 | 3300025913 | Bacteria | 1858 |
| 322 | Ga0207671_10032398 | 3300025914 | Bacteria | 3891 |
| 323 | Ga0207671_10041489 | 3300025914 | Bacteria | 3406 |
| 324 | Ga0207671_10054219 | 3300025914 | Bacteria | 2971 |
| 325 | Ga0207671_10103585 | 3300025914 | Bacteria | 2158 |
| 326 | Ga0207671_10904575 | 3300025914 | Bacteria | 698 |
| 327 | Ga0207693_10000018 | 3300025915 | Bacteria | 138365 |
| 328 | Ga0207693_10000276 | 3300025915 | Bacteria | 47566 |
| 329 | Ga0207663_10255259 | 3300025916 | Bacteria | 1292 |
| 330 | Ga0207663_10424707 | 3300025916 | Unclassified | 1021 |
| 331 | Ga0207660_10003913 | 3300025917 | Bacteria | 9706 |
| 332 | Ga0207660_10059809 | 3300025917 | Bacteria | 2737 |
| 333 | Ga0207660_10111876 | 3300025917 | Bacteria | 2056 |
| 334 | Ga0207660_10556548 | 3300025917 | Bacteria | 933 |
| 335 | Ga0207657_10001163 | 3300025919 | Bacteria | 27950 |
| 336 | Ga0207657_10048575 | 3300025919 | Bacteria | 3704 |
| 337 | Ga0207657_10076217 | 3300025919 | Bacteria | 2830 |
| 338 | Ga0207657_10127414 | 3300025919 | Bacteria | 2090 |
| 339 | Ga0207657_10209736 | 3300025919 | Bacteria | 1564 |
| 340 | Ga0207657_10406424 | 3300025919 | Bacteria | 1071 |
| 341 | Ga0207649_10060208 | 3300025920 | Bacteria | 2385 |
| 342 | Ga0207649_10212659 | 3300025920 | Bacteria | 1373 |
| 343 | Ga0207652_10017999 | 3300025921 | Bacteria | 5789 |
| 344 | Ga0207652_10094808 | 3300025921 | Bacteria | 2628 |
| 345 | Ga0207652_10223206 | 3300025921 | Bacteria | 1698 |
| 346 | Ga0207681_10004489 | 3300025923 | Bacteria | 8591 |
| 347 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 348 | Ga0207694_10048560 | 3300025924 | Bacteria | 3284 |
| 349 | Ga0207694_10071716 | 3300025924 | Bacteria | 2707 |
| 350 | Ga0207694_10095479 | 3300025924 | Bacteria | 2350 |
| 351 | Ga0207694_10265334 | 3300025924 | Bacteria | 1407 |
| 352 | Ga0207694_10276699 | 3300025924 | Bacteria | 1378 |
| 353 | Ga0207650_10588503 | 3300025925 | Bacteria | 935 |
| 354 | Ga0207650_10777761 | 3300025925 | Bacteria | 811 |
| 355 | Ga0207659_10112193 | 3300025926 | Bacteria | 2074 |
| 356 | Ga0207687_10058007 | 3300025927 | Bacteria | 2722 |
| 357 | Ga0207687_10058623 | 3300025927 | Bacteria | 2709 |
| 358 | Ga0207700_10000005 | 3300025928 | Bacteria | 394836 |
| 359 | Ga0207700_10098721 | 3300025928 | Bacteria | 2324 |
| 360 | Ga0207700_10156506 | 3300025928 | Bacteria | 1888 |
| 361 | Ga0207700_10297353 | 3300025928 | Bacteria | 1393 |
| 362 | Ga0207700_10980997 | 3300025928 | Bacteria | 756 |
| 363 | Ga0207664_10016200 | 3300025929 | Bacteria | 5431 |
| 364 | Ga0207664_10245800 | 3300025929 | Bacteria | 1560 |
| 365 | Ga0207664_10433441 | 3300025929 | Bacteria | 1172 |
| 366 | Ga0207690_10012687 | 3300025932 | Bacteria | 5049 |
| 367 | Ga0207690_10974988 | 3300025932 | Bacteria | 705 |
| 368 | Ga0207686_10070923 | 3300025934 | Bacteria | 2240 |
| 369 | Ga0207686_10332011 | 3300025934 | Bacteria | 1139 |
| 370 | Ga0207709_10014211 | 3300025935 | Bacteria | 4394 |
| 371 | Ga0207709_10228974 | 3300025935 | Bacteria | 1345 |
| 372 | Ga0207709_10592101 | 3300025935 | Bacteria | 877 |
| 373 | Ga0207670_10595891 | 3300025936 | Bacteria | 907 |
| 374 | Ga0207669_10258786 | 3300025937 | Bacteria | 1300 |
| 375 | Ga0207704_10069864 | 3300025938 | Bacteria | 2221 |
| 376 | Ga0207704_10126082 | 3300025938 | Bacteria | 1763 |
| 377 | Ga0207704_10176381 | 3300025938 | Bacteria | 1539 |
| 378 | Ga0207665_10190158 | 3300025939 | Bacteria | 1491 |
| 379 | Ga0207691_10450005 | 3300025940 | Bacteria | 1096 |
| 380 | Ga0207711_10013219 | 3300025941 | Bacteria | 6858 |
| 381 | Ga0207711_10274730 | 3300025941 | Bacteria | 1551 |
| 382 | Ga0207711_10336468 | 3300025941 | Bacteria | 1397 |
| 383 | Ga0207711_10779036 | 3300025941 | Bacteria | 891 |
| 384 | Ga0207711_10991979 | 3300025941 | Bacteria | 779 |
| 385 | Ga0207679_10467744 | 3300025945 | Bacteria | 1120 |
| 386 | Ga0207667_10000026 | 3300025949 | Bacteria | 343713 |
| 387 | Ga0207667_10002838 | 3300025949 | Bacteria | 21514 |
| 388 | Ga0207667_10007703 | 3300025949 | Bacteria | 12887 |
| 389 | Ga0207667_10010294 | 3300025949 | Bacteria | 10945 |
| 390 | Ga0207667_10015427 | 3300025949 | Bacteria | 8679 |
| 391 | Ga0207667_10054254 | 3300025949 | Bacteria | 4216 |
| 392 | Ga0207667_10158337 | 3300025949 | Bacteria | 2330 |
| 393 | Ga0207667_10347395 | 3300025949 | Bacteria | 1513 |
| 394 | Ga0207651_10074676 | 3300025960 | Bacteria | 2415 |
| 395 | Ga0207712_10014867 | 3300025961 | Bacteria | 5012 |
| 396 | Ga0207668_10000430 | 3300025972 | Bacteria | 26480 |
| 397 | Ga0207640_10040754 | 3300025981 | Bacteria | 2949 |
| 398 | Ga0207640_10821368 | 3300025981 | Bacteria | 807 |
| 399 | Ga0207640_11213628 | 3300025981 | Bacteria | 671 |
| 400 | Ga0207658_10000243 | 3300025986 | Bacteria | 57023 |
| 401 | Ga0207658_10016628 | 3300025986 | Bacteria | 5063 |
| 402 | Ga0207658_10023373 | 3300025986 | Bacteria | 4314 |
| 403 | Ga0207677_10004318 | 3300026023 | Bacteria | 7614 |
| 404 | Ga0207703_10030782 | 3300026035 | Bacteria | 4241 |
| 405 | Ga0207703_10108592 | 3300026035 | Bacteria | 2363 |
| 406 | Ga0207639_10039304 | 3300026041 | Bacteria | 3524 |
| 407 | Ga0207639_10123960 | 3300026041 | Bacteria | 2128 |
| 408 | Ga0207639_10231800 | 3300026041 | Bacteria | 1601 |
| 409 | Ga0207678_10038547 | 3300026067 | Bacteria | 4152 |
| 410 | Ga0207708_10155971 | 3300026075 | Bacteria | 1800 |
| 411 | Ga0207708_11061115 | 3300026075 | Bacteria | 705 |
| 412 | Ga0207702_10001080 | 3300026078 | Bacteria | 27929 |
| 413 | Ga0207702_10144432 | 3300026078 | Bacteria | 2157 |
| 414 | Ga0207702_10378154 | 3300026078 | Bacteria | 1361 |
| 415 | Ga0207702_10414983 | 3300026078 | Bacteria | 1301 |
| 416 | Ga0207702_11279586 | 3300026078 | Bacteria | 727 |
| 417 | Ga0207641_10000241 | 3300026088 | Bacteria | 71027 |
| 418 | Ga0207648_10009495 | 3300026089 | Bacteria | 9309 |
| 419 | Ga0207648_10032185 | 3300026089 | Bacteria | 4631 |
| 420 | Ga0207648_10160988 | 3300026089 | Bacteria | 1982 |
| 421 | Ga0207676_10043534 | 3300026095 | Bacteria | 3458 |
| 422 | Ga0207674_10000112 | 3300026116 | Bacteria | 94220 |
| 423 | Ga0207674_10087310 | 3300026116 | Bacteria | 3113 |
| 424 | Ga0207674_10125019 | 3300026116 | Bacteria | 2538 |
| 425 | Ga0207674_10141586 | 3300026116 | Bacteria | 2364 |
| 426 | Ga0207674_10410658 | 3300026116 | Bacteria | 1308 |
| 427 | Ga0207675_100507766 | 3300026118 | Bacteria | 1201 |
| 428 | Ga0207683_10003082 | 3300026121 | Bacteria | 14565 |
| 429 | Ga0207683_10049440 | 3300026121 | Bacteria | 3681 |
| 430 | Ga0207683_10049446 | 3300026121 | Bacteria | 3681 |
| 431 | Ga0207683_10079367 | 3300026121 | Bacteria | 2910 |
| 432 | Ga0207683_10130897 | 3300026121 | Bacteria | 2257 |
| 433 | Ga0207683_10296793 | 3300026121 | Bacteria | 1478 |
| 434 | Ga0207698_10007028 | 3300026142 | Bacteria | 7050 |
| 435 | Ga0207698_10126006 | 3300026142 | Bacteria | 2178 |
| 436 | Ga0207698_10173140 | 3300026142 | Bacteria | 1903 |
| 437 | Ga0207698_11146899 | 3300026142 | Bacteria | 791 |
| 438 | Ga0207428_10008616 | 3300027907 | Bacteria | 9207 |
| 439 | Ga0268266_10000463 | 3300028379 | Bacteria | 59089 |
| 440 | Ga0268266_10051760 | 3300028379 | Bacteria | 3525 |
| 441 | Ga0268266_10088010 | 3300028379 | Bacteria | 2718 |
| 442 | Ga0268266_10156033 | 3300028379 | Bacteria | 2061 |
| 443 | Ga0268266_10172741 | 3300028379 | Bacteria | 1962 |
| 444 | Ga0268266_10256215 | 3300028379 | Bacteria | 1620 |
| 445 | Ga0268266_10337188 | 3300028379 | Bacteria | 1414 |
| 446 | Ga0268265_10443931 | 3300028380 | Bacteria | 1210 |
| 447 | Ga0268265_10512437 | 3300028380 | Bacteria | 1132 |
| 448 | Ga0268264_10051832 | 3300028381 | Bacteria | 3421 |
| 449 | Ga0268264_10109120 | 3300028381 | Bacteria | 2420 |
| 450 | Ga0265337_1077861 | 3300028556 | Bacteria | 908 |
| 451 | Ga0265334_10008085 | 3300028573 | Bacteria | 4486 |
| 452 | Ga0265318_10000444 | 3300028577 | Bacteria | 31172 |
| 453 | Ga0265318_10003610 | 3300028577 | Bacteria | 7735 |
| 454 | Ga0307517_10265289 | 3300028786 | Bacteria | 993 |
| 455 | Ga0307515_10158798 | 3300028794 | Bacteria | 2318 |
| 456 | Ga0307515_10347015 | 3300028794 | Bacteria | 1133 |
| 457 | Ga0265338_10000011 | 3300028800 | Bacteria | 433370 |
| 458 | Ga0265338_10001087 | 3300028800 | Bacteria | 45161 |
| 459 | Ga0265338_10012082 | 3300028800 | Bacteria | 9873 |
| 460 | Ga0265338_10025211 | 3300028800 | Bacteria | 6045 |
| 461 | Ga0265338_10072660 | 3300028800 | Bacteria | 2936 |
| 462 | Ga0265338_10128693 | 3300028800 | Bacteria | 2004 |
| 463 | Ga0265338_10373225 | 3300028800 | Bacteria | 1021 |
| 464 | Ga0265330_10011184 | 3300031235 | Bacteria | 4213 |
| 465 | Ga0265330_10030973 | 3300031235 | Bacteria | 2398 |
| 466 | Ga0265332_10006040 | 3300031238 | Bacteria | 5534 |
| 467 | Ga0265332_10017334 | 3300031238 | Bacteria | 3179 |
| 468 | Ga0265332_10045050 | 3300031238 | Bacteria | 1902 |
| 469 | Ga0265332_10086948 | 3300031238 | Bacteria | 1324 |
| 470 | Ga0265332_10118928 | 3300031238 | Bacteria | 1110 |
| 471 | Ga0265328_10026476 | 3300031239 | Bacteria | 2179 |
| 472 | Ga0265328_10059621 | 3300031239 | Bacteria | 1401 |
| 473 | Ga0265320_10003153 | 3300031240 | Bacteria | 11187 |
| 474 | Ga0265320_10015770 | 3300031240 | Bacteria | 4258 |
| 475 | Ga0265325_10000009 | 3300031241 | Bacteria | 184273 |
| 476 | Ga0265325_10000094 | 3300031241 | Bacteria | 62066 |
| 477 | Ga0265325_10001690 | 3300031241 | Bacteria | 15327 |
| 478 | Ga0265325_10002838 | 3300031241 | Bacteria | 11552 |
| 479 | Ga0265325_10006623 | 3300031241 | Bacteria | 7012 |
| 480 | Ga0265325_10033081 | 3300031241 | Bacteria | 2757 |
| 481 | Ga0265325_10041342 | 3300031241 | Bacteria | 2416 |
| 482 | Ga0265325_10061936 | 3300031241 | Bacteria | 1896 |
| 483 | Ga0265325_10092700 | 3300031241 | Bacteria | 1487 |
| 484 | Ga0265329_10016573 | 3300031242 | Bacteria | 2550 |
| 485 | Ga0265340_10000159 | 3300031247 | Bacteria | 34106 |
| 486 | Ga0265340_10000562 | 3300031247 | Bacteria | 20607 |
| 487 | Ga0265340_10007094 | 3300031247 | Bacteria | 6108 |
| 488 | Ga0265340_10018994 | 3300031247 | Bacteria | 3541 |
| 489 | Ga0265340_10029135 | 3300031247 | Bacteria | 2773 |
| 490 | Ga0265340_10034288 | 3300031247 | Bacteria | 2525 |
| 491 | Ga0265340_10064703 | 3300031247 | Bacteria | 1743 |
| 492 | Ga0265340_10123891 | 3300031247 | Bacteria | 1188 |
| 493 | Ga0265339_10000320 | 3300031249 | Bacteria | 38805 |
| 494 | Ga0265339_10007160 | 3300031249 | Bacteria | 7238 |
| 495 | Ga0265339_10020568 | 3300031249 | Bacteria | 3852 |
| 496 | Ga0265339_10025613 | 3300031249 | Bacteria | 3384 |
| 497 | Ga0265339_10029739 | 3300031249 | Bacteria | 3097 |
| 498 | Ga0265339_10048309 | 3300031249 | Bacteria | 2334 |
| 499 | Ga0265339_10072044 | 3300031249 | Bacteria | 1839 |
| 500 | Ga0265339_10077525 | 3300031249 | Bacteria | 1762 |
| 501 | Ga0265339_10155506 | 3300031249 | Bacteria | 1154 |
| 502 | Ga0265331_10018315 | 3300031250 | Bacteria | 3636 |
| 503 | Ga0265331_10045617 | 3300031250 | Bacteria | 2115 |
| 504 | Ga0265331_10066308 | 3300031250 | Bacteria | 1695 |
| 505 | Ga0265327_10012908 | 3300031251 | Bacteria | 5591 |
| 506 | Ga0265316_10020381 | 3300031344 | Bacteria | 5644 |
| 507 | Ga0265316_10063310 | 3300031344 | Bacteria | 2868 |
| 508 | Ga0265316_10106193 | 3300031344 | Bacteria | 2130 |
| 509 | Ga0265316_10126519 | 3300031344 | Bacteria | 1926 |
| 510 | Ga0265316_10399989 | 3300031344 | Bacteria | 989 |
| 511 | Ga0265316_10561778 | 3300031344 | Bacteria | 811 |
| 512 | Ga0307513_10164521 | 3300031456 | Bacteria | 2105 |
| 513 | Ga0307513_10230922 | 3300031456 | Bacteria | 1663 |
| 514 | Ga0265313_10000176 | 3300031595 | Bacteria | 68037 |
| 515 | Ga0265313_10002778 | 3300031595 | Bacteria | 14762 |
| 516 | Ga0265313_10016249 | 3300031595 | Bacteria | 4287 |
| 517 | Ga0265313_10028797 | 3300031595 | Bacteria | 2881 |
| 518 | Ga0265313_10032291 | 3300031595 | Bacteria | 2675 |
| 519 | Ga0307508_10196407 | 3300031616 | Bacteria | 1619 |
| 520 | Ga0307508_10436681 | 3300031616 | Bacteria | 901 |
| 521 | Ga0265314_10000857 | 3300031711 | Bacteria | 36107 |
| 522 | Ga0265314_10016114 | 3300031711 | Bacteria | 5918 |
| 523 | Ga0265314_10022487 | 3300031711 | Bacteria | 4830 |
| 524 | Ga0265314_10031751 | 3300031711 | Bacteria | 3894 |
| 525 | Ga0265314_10057403 | 3300031711 | Bacteria | 2673 |
| 526 | Ga0265314_10062004 | 3300031711 | Bacteria | 2544 |
| 527 | Ga0265314_10085255 | 3300031711 | Bacteria | 2072 |
| 528 | Ga0265314_10105286 | 3300031711 | Bacteria | 1804 |
| 529 | Ga0265314_10149712 | 3300031711 | Bacteria | 1433 |
| 530 | Ga0265314_10225858 | 3300031711 | Bacteria | 1089 |
| 531 | Ga0265314_10304631 | 3300031711 | Bacteria | 892 |
| 532 | Ga0265342_10016987 | 3300031712 | Bacteria | 4742 |
| 533 | Ga0265342_10025710 | 3300031712 | Bacteria | 3696 |
| 534 | Ga0265342_10038212 | 3300031712 | Bacteria | 2924 |
| 535 | Ga0265342_10042692 | 3300031712 | Bacteria | 2739 |
| 536 | Ga0265342_10062969 | 3300031712 | Bacteria | 2181 |
| 537 | Ga0265342_10199850 | 3300031712 | Bacteria | 1087 |
| 538 | Ga0316576_10109452 | 3300031727 | Bacteria | 2070 |
| 539 | Ga0316578_10060257 | 3300031728 | Bacteria | 2234 |
| 540 | Ga0307516_10061230 | 3300031730 | Bacteria | 3653 |
| 541 | Ga0307516_10112004 | 3300031730 | Bacteria | 2530 |
| 542 | Ga0307413_10051479 | 3300031824 | Bacteria | 2482 |
| 543 | Ga0307410_10343984 | 3300031852 | Bacteria | 1190 |
| 544 | Ga0307410_10892682 | 3300031852 | Bacteria | 761 |
| 545 | Ga0307406_10619097 | 3300031901 | Bacteria | 895 |
| 546 | Ga0307406_11017709 | 3300031901 | Bacteria | 711 |
| 547 | Ga0307412_10106318 | 3300031911 | Bacteria | 1995 |
| 548 | Ga0307409_100229034 | 3300031995 | Bacteria | 1683 |
| 549 | Ga0307409_100483777 | 3300031995 | Bacteria | 1202 |
| 550 | Ga0307416_101052819 | 3300032002 | Bacteria | 917 |
| 551 | Ga0373959_0040066 | 3300034820 | Bacteria | 980 |
| 552 | Ga0373934_0266305 | 3300035086 | Bacteria | 709 |
| 553 | Ga0373944_0023315 | 3300035089 | Bacteria | 1805 |
| 554 | Ga0373949_0045285 | 3300035090 | Bacteria | 1094 |
| 555 | Ga0373923_0411414 | 3300035111 | Bacteria | 652 |
| 556 | Ga0373932_0021687 | 3300035112 | Bacteria | 1698 |
| 557 | Ga0373936_0049106 | 3300035113 | Bacteria | 1704 |
| 558 | Ga0373939_0081535 | 3300035114 | Bacteria | 1075 |
| 559 | Ga0373941_0000530 | 3300035115 | Bacteria | 7622 |
| 560 | Ga0373941_0071756 | 3300035115 | Bacteria | 1151 |
| 561 | Ga0373941_0195975 | 3300035115 | Bacteria | 766 |
| 562 | Ga0373945_0136157 | 3300035116 | Bacteria | 987 |
| 563 | Ga0373953_0151197 | 3300035117 | Bacteria | 995 |
| 564 | Ga0373953_0339141 | 3300035117 | Bacteria | 658 |
| 565 | Ga0373954_0154300 | 3300035118 | Bacteria | 1122 |
| 566 | Ga0373954_0208443 | 3300035118 | Bacteria | 961 |
| 567 | Ga0373956_0078062 | 3300035119 | Bacteria | 1516 |
| 568 | Ga0373956_0186587 | 3300035119 | Bacteria | 981 |
| 569 | Ga0373957_0047902 | 3300035120 | Bacteria | 1627 |
| 570 | Ga0373943_0002306 | 3300035170 | Bacteria | 8671 |
| 571 | Ga0373943_0094383 | 3300035170 | Bacteria | 1554 |
| 572 | Ga0373955_0016037 | 3300035172 | Bacteria | 3681 |
| 573 | Ga0373955_0017515 | 3300035172 | Bacteria | 3548 |
| 574 | Ga0373955_0681603 | 3300035172 | Bacteria | 631 |
| 575 | Ga0373942_0061565 | 3300035207 | Bacteria | 1077 |
| 576 | Ga0373961_0261766 | 3300035241 | Bacteria | 629 |
| 577 | Ga0373962_0049178 | 3300035242 | Bacteria | 1211 |
| 578 | Ga0373962_0285248 | 3300035242 | Bacteria | 582 |
| 579 | Ga0316574_0120379 | 3300035398 | Bacteria | 1685 |
| 580 | Ga0316574_0244371 | 3300035398 | Bacteria | 1147 |
| 581 | Ga0373931_0002610 | 3300035691 | Bacteria | 8020 |
| 582 | Ga0373931_0010215 | 3300035691 | Bacteria | 4509 |
| 583 | Ga0373931_0425147 | 3300035691 | Bacteria | 845 |
| 584 | Ga0373931_0431111 | 3300035691 | Bacteria | 840 |
| 585 | Ga0373927_0039911 | 3300035695 | Bacteria | 3046 |
| 586 | Ga0373927_0090159 | 3300035695 | Bacteria | 1991 |
| 587 | Ga0373927_0137697 | 3300035695 | Bacteria | 1596 |
| 588 | Ga0373927_0761336 | 3300035695 | Bacteria | 640 |
| 589 | Ga0373933_0017974 | 3300035724 | Bacteria | 3971 |
| 590 | Ga0373933_0030381 | 3300035724 | Bacteria | 3128 |
| 591 | Ga0373933_0331724 | 3300035724 | Bacteria | 987 |
| 592 | Ga0373933_0394071 | 3300035724 | Bacteria | 903 |
| 593 | Ga0373947_0005370 | 3300035725 | Bacteria | 7479 |
| 594 | Ga0373947_0082089 | 3300035725 | Bacteria | 1997 |
| 595 | Ga0373937_0048874 | 3300036401 | Bacteria | 3873 |
| 596 | Ga0373937_0066672 | 3300036401 | Bacteria | 3315 |
| 597 | Ga0373937_0333999 | 3300036401 | Bacteria | 1435 |
| 598 | Ga0373937_0386087 | 3300036401 | Bacteria | 1328 |
| 599 | Ga0373937_0424626 | 3300036401 | Bacteria | 1262 |
| 600 | Ga0316582_0058451 | 3300036647 | Bacteria | 2465 |
| 601 | Ga0316584_0200958 | 3300036712 | Bacteria | 1470 |
| 602 | Ga0316584_0382504 | 3300036712 | Bacteria | 1005 |
| 603 | Ga0373925_0012671 | 3300037068 | Bacteria | 6105 |
| 604 | Ga0373925_0050470 | 3300037068 | Bacteria | 3103 |
| 605 | Ga0373925_0075886 | 3300037068 | Bacteria | 2548 |
| 606 | Ga0373925_0136744 | 3300037068 | Bacteria | 1915 |
| 607 | Ga0373925_0984827 | 3300037068 | Bacteria | 694 |
| 608 | Ga0395899_0269714 | 3300037312 | Bacteria | 1161 |
| 609 | Ga0395900_0088308 | 3300037418 | Bacteria | 3187 |
| 610 | Ga0395900_0323529 | 3300037418 | Bacteria | 1522 |
| 611 | Ga0395898_0026131 | 3300037466 | Bacteria | 5877 |
| 612 | Ga0395898_0222074 | 3300037466 | Bacteria | 1802 |
| 613 | Ga0395898_0230496 | 3300037466 | Bacteria | 1766 |
| 614 | Ga0395905_0970765 | 3300037471 | Bacteria | 753 |
| 615 | Ga0436364_0517728 | 3300037853 | Bacteria | 776 |
| 616 | Ga0436364_1387285 | 3300037853 | Bacteria | 3274 |
| 617 | Ga0395901_0043778 | 3300038443 | Bacteria | 4643 |
| 618 | Ga0395901_0279117 | 3300038443 | Bacteria | 1736 |
| 619 | Ga0400483_031136 | 3300039062 | Bacteria | 2896 |
| 620 | Ga0400483_261441 | 3300039062 | Bacteria | 7210 |
| 621 | Ga0436365_0257402 | 3300039437 | Bacteria | 164674 |
| 622 | Ga0436365_0683017 | 3300039437 | Bacteria | 1053 |
| 623 | Ga0436365_0703435 | 3300039437 | Bacteria | 3743 |
| 624 | Ga0436365_1247148 | 3300039437 | Bacteria | 663 |
| 625 | Ga0436365_1581781 | 3300039437 | Bacteria | 2070 |
| 626 | Ga0436365_1740837 | 3300039437 | Bacteria | 1387 |
| 627 | Ga0436365_1850734 | 3300039437 | Bacteria | 740 |
| 628 | Ga0436365_1887606 | 3300039437 | Bacteria | 4569 |
| 629 | Ga0436360_0009637 | 3300039438 | Bacteria | 760 |
| 630 | Ga0436360_0234379 | 3300039438 | Bacteria | 5227 |
| 631 | Ga0436360_0409435 | 3300039438 | Bacteria | 1348 |
| 632 | Ga0436360_0543230 | 3300039438 | Bacteria | 801 |
| 633 | Ga0436360_0573541 | 3300039438 | Bacteria | 1151 |
| 634 | Ga0436360_0812316 | 3300039438 | Bacteria | 1107 |
| 635 | Ga0436360_1008458 | 3300039438 | Bacteria | 780 |
| 636 | Ga0436361_0290139 | 3300039447 | Bacteria | 6933 |
| 637 | Ga0436361_0801523 | 3300039447 | Bacteria | 1373 |
| 638 | Ga0436361_0856042 | 3300039447 | Bacteria | 2917 |
| 639 | Ga0436361_0956481 | 3300039447 | Bacteria | 1171 |
| 640 | Ga0436363_0243575 | 3300039450 | Bacteria | 1804 |
| 641 | Ga0436363_0521106 | 3300039450 | Bacteria | 2220 |
| 642 | Ga0436363_1097369 | 3300039450 | Bacteria | 608 |
| 643 | Ga0436363_1599936 | 3300039450 | Bacteria | 1064 |
| 644 | Ga0436362_0160092 | 3300039453 | Bacteria | 766 |
| 645 | Ga0436362_0283225 | 3300039453 | Bacteria | 1199 |
| 646 | Ga0436362_0508487 | 3300039453 | Bacteria | 993 |
| 647 | Ga0436362_1131996 | 3300039453 | Bacteria | 1329 |
| 648 | Ga0436362_1168099 | 3300039453 | Bacteria | 1358 |
| 649 | Ga0439436_0003726 | 3300041404 | Bacteria | 4652 |
| 650 | Ga0439439_0006276 | 3300041406 | Bacteria | 2746 |
| 651 | Ga0439453_0005016 | 3300041408 | Bacteria | 1998 |
| 652 | Ga0439466_0004428 | 3300041411 | Bacteria | 5411 |
| 653 | Ga0439465_0010767 | 3300041413 | Bacteria | 2869 |
| 654 | Ga0451807_0374610 | 3300041486 | Bacteria | 976 |
| 655 | Ga0451853_0974959 | 3300041512 | Bacteria | 718 |
| 656 | Ga0439449_0004779 | 3300042007 | Bacteria | 5229 |
| 657 | Ga0439456_010801 | 3300042013 | Bacteria | 1888 |
| 658 | Ga0439462_0034136 | 3300042015 | Bacteria | 1350 |
| 659 | Ga0450906_008964 | 3300042145 | Bacteria | 1919 |
| 660 | Ga0450910_060756 | 3300042147 | Bacteria | 638 |
| 661 | Ga0450908_033908 | 3300042184 | Bacteria | 885 |
| 662 | Ga0450918_002668 | 3300042531 | Bacteria | 3358 |
| 663 | Ga0466972_0471867 | 3300044658 | Bacteria | 590 |
| 664 | Ga0466966_0016096 | 3300044684 | Bacteria | 4945 |
| 665 | Ga0466963_0596339 | 3300044694 | Bacteria | 780 |
| 666 | Ga0453684_0010839 | 3300044712 | Bacteria | 15449 |
| 667 | Ga0466957_0159678 | 3300044842 | Bacteria | 1463 |
| 668 | Ga0466959_0032618 | 3300045049 | Bacteria | 3855 |
| 669 | Ga0451576_0614764 | 3300045051 | Bacteria | 1142 |
| 670 | Ga0466958_0096417 | 3300045836 | Bacteria | 1835 |
| 671 | Ga0466958_0169328 | 3300045836 | Bacteria | 1383 |
| 672 | Ga0466967_0244384 | 3300045976 | Bacteria | 1713 |
| 673 | Ga0466967_0268247 | 3300045976 | Bacteria | 1635 |
| 674 | Ga0495617_016190 | 3300046452 | Bacteria | 2522 |
| 675 | Ga0495627_002377 | 3300046453 | Bacteria | 9161 |
| 676 | Ga0495627_057892 | 3300046453 | Bacteria | 1152 |
| 677 | Ga0495603_0221875 | 3300046455 | Bacteria | 1090 |
| 678 | Ga0495629_0054668 | 3300046459 | Bacteria | 2792 |
| 679 | Ga0495629_0809914 | 3300046459 | Bacteria | 617 |
| 680 | Ga0495651_0099841 | 3300046462 | Bacteria | 2164 |
| 681 | Ga0495651_0519508 | 3300046462 | Bacteria | 760 |
| 682 | Ga0495653_0137762 | 3300046463 | Bacteria | 1720 |
| 683 | Ga0495653_0728641 | 3300046463 | Bacteria | 600 |
| 684 | Ga0495650_0002793 | 3300046471 | Bacteria | 13415 |
| 685 | Ga0495580_0056424 | 3300046472 | Bacteria | 2766 |
| 686 | Ga0495580_0444109 | 3300046472 | Bacteria | 871 |
| 687 | Ga0495582_0071437 | 3300046473 | Bacteria | 1921 |
| 688 | Ga0495664_0048077 | 3300046477 | Bacteria | 2533 |
| 689 | Ga0495584_0254407 | 3300046491 | Bacteria | 893 |
| 690 | Ga0495596_0235410 | 3300046500 | Bacteria | 711 |
| 691 | Ga0495583_0114591 | 3300046506 | Bacteria | 1140 |
| 692 | Ga0495606_0134503 | 3300046507 | Bacteria | 1466 |
| 693 | Ga0495608_0531636 | 3300046511 | Bacteria | 710 |
| 694 | Ga0495610_0000053 | 3300046512 | Bacteria | 142545 |
| 695 | Ga0495628_0234909 | 3300046516 | Bacteria | 1373 |
| 696 | Ga0495630_1053929 | 3300046517 | Bacteria | 617 |
| 697 | Ga0495637_0002782 | 3300046520 | Bacteria | 9488 |
| 698 | Ga0495644_0121737 | 3300046523 | Bacteria | 993 |
| 699 | Ga0495648_0225185 | 3300046524 | Bacteria | 922 |
| 700 | Ga0495663_0184758 | 3300046525 | Bacteria | 723 |
| 701 | Ga0495652_0062800 | 3300046529 | Bacteria | 3130 |
| 702 | Ga0495652_0160489 | 3300046529 | Bacteria | 1746 |
| 703 | Ga0495640_0417814 | 3300046533 | Bacteria | 822 |
| 704 | Ga0495640_0454885 | 3300046533 | Bacteria | 782 |
| 705 | Ga0495586_0302721 | 3300046535 | Bacteria | 916 |
| 706 | Ga0495586_0678223 | 3300046535 | Bacteria | 595 |
| 707 | Ga0495587_0064240 | 3300046536 | Bacteria | 2145 |
| 708 | Ga0495587_0066469 | 3300046536 | Bacteria | 2103 |
| 709 | Ga0495609_0017425 | 3300046538 | Bacteria | 3335 |
| 710 | Ga0495621_0046217 | 3300046539 | Bacteria | 1544 |
| 711 | Ga0495645_0006290 | 3300046543 | Bacteria | 8235 |
| 712 | Ga0495622_0002344 | 3300046557 | Bacteria | 9210 |
| 713 | Ga0495633_0388340 | 3300046558 | Bacteria | 631 |
| 714 | Ga0495667_0146213 | 3300046559 | Bacteria | 1522 |
| 715 | Ga0495656_0672752 | 3300046615 | Bacteria | 556 |
| 716 | Ga0495668_0161649 | 3300046616 | Bacteria | 1227 |
| 717 | Ga0495625_0124522 | 3300046660 | Bacteria | 1751 |
| 718 | Ga0495661_0026255 | 3300046665 | Bacteria | 3753 |
| 719 | Ga0495657_0248353 | 3300046675 | Bacteria | 1072 |
| 720 | Ga0495599_0156034 | 3300046678 | Bacteria | 1412 |
| 721 | Ga0495599_0224687 | 3300046678 | Bacteria | 1148 |
| 722 | Ga0495647_0076697 | 3300046681 | Bacteria | 1348 |
| 723 | Ga0495647_0089092 | 3300046681 | Bacteria | 1262 |
| 724 | Ga0495658_0001623 | 3300046683 | Bacteria | 11704 |
| 725 | Ga0495658_0069000 | 3300046683 | Bacteria | 2048 |
| 726 | Ga0495613_0338420 | 3300046689 | Bacteria | 1036 |
| 727 | Ga0495624_0119317 | 3300046690 | Bacteria | 1620 |
| 728 | Ga0495670_0100510 | 3300046691 | Bacteria | 1489 |
| 729 | Ga0495649_0081253 | 3300046694 | Bacteria | 1733 |
| 730 | Ga0495600_0044792 | 3300046809 | Bacteria | 2886 |
| 731 | Ga0495660_0266371 | 3300046810 | Bacteria | 789 |
| 732 | Ga0495581_0198013 | 3300047315 | Bacteria | 1175 |
| 733 | Ga0495581_0253610 | 3300047315 | Bacteria | 1029 |
| 734 | Ga0495604_0269185 | 3300047317 | Bacteria | 1155 |
| 735 | Ga0495604_0450737 | 3300047317 | Bacteria | 841 |
| 736 | Ga0495636_0018272 | 3300047318 | Bacteria | 2812 |
| 737 | Ga0495636_0255343 | 3300047318 | Bacteria | 812 |
| 738 | Ga0495674_0385092 | 3300047319 | Bacteria | 1134 |
| 739 | Ga0495676_0390035 | 3300047321 | Bacteria | 925 |
| 740 | Ga0495675_0063178 | 3300047444 | Bacteria | 2343 |
| 741 | Ga0495675_0171663 | 3300047444 | Bacteria | 1331 |
| 742 | Ga0495675_0215194 | 3300047444 | Bacteria | 1165 |
| 743 | Ga0495675_0372148 | 3300047444 | Bacteria | 837 |
| 744 | Ga0495681_0000015 | 3300047470 | Bacteria | 183538 |
| 745 | Ga0495684_0277025 | 3300047471 | Bacteria | 1212 |
| 746 | Ga0495686_0626729 | 3300047472 | Bacteria | 555 |
| 747 | Ga0495602_0105949 | 3300048088 | Bacteria | 2296 |
| 748 | Ga0495602_0222502 | 3300048088 | Bacteria | 1424 |
| 749 | Ga0495602_0339163 | 3300048088 | Bacteria | 1088 |
| 750 | Ga0495614_0061948 | 3300048089 | Bacteria | 1608 |
| 751 | Ga0496100_0137655 | 3300048903 | Bacteria | 1727 |
| 752 | Ga0496100_0881906 | 3300048903 | Bacteria | 702 |
| 753 | Ga0496101_0062638 | 3300048904 | Bacteria | 2705 |
| 754 | Ga0496102_0036294 | 3300048905 | Bacteria | 4440 |
| 755 | Ga0496102_0235447 | 3300048905 | Bacteria | 1726 |
| 756 | Ga0496102_0331067 | 3300048905 | Bacteria | 1434 |
| 757 | Ga0496103_0098768 | 3300048906 | Bacteria | 1846 |
| 758 | Ga0496103_0155229 | 3300048906 | Bacteria | 1467 |
| 759 | Ga0496104_0905407 | 3300048907 | Bacteria | 787 |
| 760 | Ga0496105_0033919 | 3300048908 | Bacteria | 4195 |
| 761 | Ga0496105_0141411 | 3300048908 | Bacteria | 1981 |
| 762 | Ga0496105_0201827 | 3300048908 | Bacteria | 1623 |
| 763 | Ga0496105_0330231 | 3300048908 | Bacteria | 1221 |
| 764 | Ga0496105_0854285 | 3300048908 | Bacteria | 689 |
| 765 | Ga0496106_0041871 | 3300048909 | Bacteria | 3433 |
| 766 | Ga0496107_0106538 | 3300048910 | Bacteria | 2059 |
| 767 | Ga0496107_0218161 | 3300048910 | Bacteria | 1419 |
| 768 | Ga0496107_0484985 | 3300048910 | Bacteria | 917 |
| 769 | Ga0496108_1018291 | 3300048911 | Bacteria | 707 |
| 770 | Ga0496108_1056445 | 3300048911 | Bacteria | 692 |
| 771 | Ga0496109_0028284 | 3300048912 | Bacteria | 5011 |
| 772 | Ga0496109_0072059 | 3300048912 | Bacteria | 3173 |
| 773 | Ga0496110_0264135 | 3300048913 | Bacteria | 1567 |
| 774 | Ga0496111_0024359 | 3300048914 | Bacteria | 4261 |
| 775 | Ga0496112_0035439 | 3300048915 | Bacteria | 4861 |
| 776 | Ga0496113_0003117 | 3300048916 | Bacteria | 9859 |
| 777 | Ga0496113_0307785 | 3300048916 | Bacteria | 1269 |
| 778 | Ga0496114_0085739 | 3300048917 | Bacteria | 2668 |
| 779 | Ga0496114_0133010 | 3300048917 | Bacteria | 2149 |
| 780 | Ga0496115_0067074 | 3300048918 | Bacteria | 2901 |
| 781 | Ga0496117_0067198 | 3300048920 | Bacteria | 2427 |
| 782 | Ga0496117_0106859 | 3300048920 | Bacteria | 1755 |
| 783 | Ga0496121_0000987 | 3300048924 | Bacteria | 50954 |
| 784 | Ga0496122_0233827 | 3300048925 | Bacteria | 1042 |
| 785 | Ga0496123_0018805 | 3300048926 | Bacteria | 5474 |
| 786 | Ga0496123_0026687 | 3300048926 | Bacteria | 4319 |
| 787 | Ga0496126_0000653 | 3300048929 | Bacteria | 64292 |
| 788 | Ga0496126_0047387 | 3300048929 | Bacteria | 3935 |
| 789 | Ga0496126_0295692 | 3300048929 | Bacteria | 1338 |
| 790 | Ga0496126_0518759 | 3300048929 | Bacteria | 950 |
| 791 | Ga0496126_0587409 | 3300048929 | Bacteria | 879 |
| 792 | Ga0495678_042157 | 3300049459 | Bacteria | 1821 |
| 793 | Ga0495682_0005324 | 3300049460 | Bacteria | 5364 |
| 794 | Ga0501031_0036251 | 3300049568 | Bacteria | 3217 |
| 795 | Ga0501031_0037269 | 3300049568 | Bacteria | 3172 |
| 796 | Ga0501031_0161199 | 3300049568 | Bacteria | 1466 |
| 797 | Ga0501031_0241277 | 3300049568 | Bacteria | 1175 |
| 798 | Ga0501031_0255051 | 3300049568 | Bacteria | 1140 |
| 799 | Ga0501032_0014948 | 3300049569 | Bacteria | 5490 |
| 800 | Ga0501032_0022010 | 3300049569 | Bacteria | 4425 |
| 801 | Ga0501032_0087223 | 3300049569 | Bacteria | 2073 |
| 802 | Ga0501032_0102978 | 3300049569 | Bacteria | 1892 |
| 803 | Ga0501032_0131087 | 3300049569 | Bacteria | 1654 |
| 804 | Ga0501033_0002118 | 3300049570 | Bacteria | 17169 |
| 805 | Ga0501033_0003652 | 3300049570 | Bacteria | 12550 |
| 806 | Ga0501033_0005897 | 3300049570 | Bacteria | 9621 |
| 807 | Ga0501033_0014827 | 3300049570 | Bacteria | 5917 |
| 808 | Ga0501033_0065358 | 3300049570 | Bacteria | 2676 |
| 809 | Ga0501033_0096022 | 3300049570 | Bacteria | 2166 |
| 810 | Ga0501033_0118761 | 3300049570 | Bacteria | 1920 |
| 811 | Ga0501033_0136356 | 3300049570 | Bacteria | 1775 |
| 812 | Ga0501033_0155031 | 3300049570 | Bacteria | 1651 |
| 813 | Ga0501033_0194356 | 3300049570 | Bacteria | 1451 |
| 814 | Ga0501033_0374984 | 3300049570 | Bacteria | 994 |
| 815 | Ga0501034_0000319 | 3300049571 | Bacteria | 84488 |
| 816 | Ga0501034_0012726 | 3300049571 | Bacteria | 8677 |
| 817 | Ga0501034_0056463 | 3300049571 | Bacteria | 3951 |
| 818 | Ga0501034_0070593 | 3300049571 | Bacteria | 3504 |
| 819 | Ga0501034_0076368 | 3300049571 | Bacteria | 3357 |
| 820 | Ga0501034_0077548 | 3300049571 | Bacteria | 3328 |
| 821 | Ga0501034_0095123 | 3300049571 | Bacteria | 2976 |
| 822 | Ga0501034_0141858 | 3300049571 | Bacteria | 2381 |
| 823 | Ga0501034_0218897 | 3300049571 | Bacteria | 1857 |
| 824 | Ga0501034_0351369 | 3300049571 | Bacteria | 1402 |
| 825 | Ga0501034_0919631 | 3300049571 | Bacteria | 762 |
| 826 | Ga0501034_1054309 | 3300049571 | Bacteria | 695 |
| 827 | Ga0501034_1240380 | 3300049571 | Bacteria | 623 |
| 828 | Ga0501036_0001489 | 3300049572 | Bacteria | 18035 |
| 829 | Ga0501036_0003952 | 3300049572 | Bacteria | 11916 |
| 830 | Ga0501036_0037534 | 3300049572 | Bacteria | 4098 |
| 831 | Ga0501036_0077192 | 3300049572 | Bacteria | 2818 |
| 832 | Ga0501036_0096762 | 3300049572 | Bacteria | 2496 |
| 833 | Ga0501036_0140446 | 3300049572 | Bacteria | 2038 |
| 834 | Ga0501036_0185206 | 3300049572 | Bacteria | 1752 |
| 835 | Ga0501036_0188215 | 3300049572 | Bacteria | 1737 |
| 836 | Ga0501036_0312155 | 3300049572 | Bacteria | 1314 |
| 837 | Ga0501036_0645948 | 3300049572 | Bacteria | 876 |
| 838 | Ga0501037_0006850 | 3300049573 | Bacteria | 8325 |
| 839 | Ga0501037_0020528 | 3300049573 | Bacteria | 4878 |
| 840 | Ga0501037_0025665 | 3300049573 | Bacteria | 4353 |
| 841 | Ga0501037_0032572 | 3300049573 | Bacteria | 3849 |
| 842 | Ga0501037_0042558 | 3300049573 | Bacteria | 3337 |
| 843 | Ga0501037_0043927 | 3300049573 | Bacteria | 3284 |
| 844 | Ga0501037_0109332 | 3300049573 | Bacteria | 1992 |
| 845 | Ga0501037_0110501 | 3300049573 | Bacteria | 1980 |
| 846 | Ga0501037_0305365 | 3300049573 | Bacteria | 1104 |
| 847 | Ga0501037_0336440 | 3300049573 | Bacteria | 1043 |
| 848 | Ga0501037_0415263 | 3300049573 | Bacteria | 921 |
| 849 | Ga0501038_0039495 | 3300049574 | Bacteria | 4128 |
| 850 | Ga0501038_0194763 | 3300049574 | Bacteria | 1629 |
| 851 | Ga0501038_0217033 | 3300049574 | Bacteria | 1528 |
| 852 | Ga0501038_0328366 | 3300049574 | Bacteria | 1195 |
| 853 | Ga0501038_0365027 | 3300049574 | Bacteria | 1122 |
| 854 | Ga0501039_0059068 | 3300049575 | Bacteria | 2970 |
| 855 | Ga0501039_0130775 | 3300049575 | Bacteria | 1970 |
| 856 | Ga0501039_0269245 | 3300049575 | Bacteria | 1339 |
| 857 | Ga0501041_0077265 | 3300049577 | Bacteria | 2048 |
| 858 | Ga0501041_0251540 | 3300049577 | Bacteria | 1111 |
| 859 | Ga0501042_0043643 | 3300049578 | Bacteria | 3193 |
| 860 | Ga0501042_0165313 | 3300049578 | Bacteria | 1597 |
| 861 | Ga0501042_0330442 | 3300049578 | Bacteria | 1102 |
| 862 | Ga0501042_0735531 | 3300049578 | Bacteria | 717 |
| 863 | Ga0501043_0003947 | 3300049579 | Bacteria | 12164 |
| 864 | Ga0501043_0008747 | 3300049579 | Bacteria | 7970 |
| 865 | Ga0501043_0017115 | 3300049579 | Bacteria | 5684 |
| 866 | Ga0501043_0022990 | 3300049579 | Bacteria | 4889 |
| 867 | Ga0501043_0069685 | 3300049579 | Bacteria | 2762 |
| 868 | Ga0501043_0076267 | 3300049579 | Bacteria | 2634 |
| 869 | Ga0501043_0197278 | 3300049579 | Bacteria | 1563 |
| 870 | Ga0501043_0407220 | 3300049579 | Bacteria | 1027 |
| 871 | Ga0501043_0413606 | 3300049579 | Bacteria | 1017 |
| 872 | Ga0501046_0000636 | 3300049580 | Bacteria | 34297 |
| 873 | Ga0501046_0017066 | 3300049580 | Bacteria | 6068 |
| 874 | Ga0501046_0048921 | 3300049580 | Bacteria | 3346 |
| 875 | Ga0501046_0131919 | 3300049580 | Bacteria | 1894 |
| 876 | Ga0501046_0183850 | 3300049580 | Bacteria | 1562 |
| 877 | Ga0501046_0567589 | 3300049580 | Bacteria | 807 |
| 878 | Ga0501047_0000079 | 3300049581 | Bacteria | 122998 |
| 879 | Ga0501047_0010064 | 3300049581 | Bacteria | 8941 |
| 880 | Ga0501047_0019694 | 3300049581 | Bacteria | 6475 |
| 881 | Ga0501047_0032713 | 3300049581 | Bacteria | 5021 |
| 882 | Ga0501047_0039859 | 3300049581 | Bacteria | 4543 |
| 883 | Ga0501047_0098845 | 3300049581 | Bacteria | 2797 |
| 884 | Ga0501047_0128466 | 3300049581 | Bacteria | 2414 |
| 885 | Ga0501047_0132988 | 3300049581 | Bacteria | 2367 |
| 886 | Ga0501047_0180029 | 3300049581 | Bacteria | 1980 |
| 887 | Ga0501047_0216244 | 3300049581 | Bacteria | 1773 |
| 888 | Ga0501047_0367130 | 3300049581 | Bacteria | 1275 |
| 889 | Ga0501047_0442776 | 3300049581 | Bacteria | 1129 |
| 890 | Ga0501047_0675219 | 3300049581 | Bacteria | 851 |
| 891 | Ga0501048_0000263 | 3300049582 | Bacteria | 35151 |
| 892 | Ga0501048_0000312 | 3300049582 | Bacteria | 33190 |
| 893 | Ga0501048_0164427 | 3300049582 | Bacteria | 1571 |
| 894 | Ga0501048_0204992 | 3300049582 | Bacteria | 1398 |
| 895 | Ga0501067_0005701 | 3300049583 | Bacteria | 6916 |
| 896 | Ga0501067_0023416 | 3300049583 | Bacteria | 3422 |
| 897 | Ga0501068_0188006 | 3300049584 | Bacteria | 1307 |
| 898 | Ga0501069_0005748 | 3300049585 | Bacteria | 6465 |
| 899 | Ga0501069_0012922 | 3300049585 | Bacteria | 4447 |
| 900 | Ga0501069_0030096 | 3300049585 | Bacteria | 2981 |
| 901 | Ga0501069_0052480 | 3300049585 | Bacteria | 2270 |
| 902 | Ga0501069_0099802 | 3300049585 | Bacteria | 1647 |
| 903 | Ga0501070_0000111 | 3300049586 | Bacteria | 71786 |
| 904 | Ga0501070_0004624 | 3300049586 | Bacteria | 11801 |
| 905 | Ga0501070_0012304 | 3300049586 | Bacteria | 7222 |
| 906 | Ga0501070_0023416 | 3300049586 | Bacteria | 5173 |
| 907 | Ga0501070_0039302 | 3300049586 | Bacteria | 3947 |
| 908 | Ga0501070_0074206 | 3300049586 | Bacteria | 2816 |
| 909 | Ga0501070_0113198 | 3300049586 | Bacteria | 2242 |
| 910 | Ga0501070_0141498 | 3300049586 | Bacteria | 1986 |
| 911 | Ga0501070_0219503 | 3300049586 | Bacteria | 1559 |
| 912 | Ga0501070_0311032 | 3300049586 | Bacteria | 1282 |
| 913 | Ga0501070_0781915 | 3300049586 | Bacteria | 751 |
| 914 | Ga0501071_0074774 | 3300049587 | Bacteria | 2473 |
| 915 | Ga0501071_0112232 | 3300049587 | Bacteria | 2015 |
| 916 | Ga0501071_0498439 | 3300049587 | Bacteria | 934 |
| 917 | Ga0501072_0062563 | 3300049588 | Bacteria | 2936 |
| 918 | Ga0501073_0009478 | 3300049589 | Bacteria | 7188 |
| 919 | Ga0501073_0016585 | 3300049589 | Bacteria | 5337 |
| 920 | Ga0501073_0069206 | 3300049589 | Bacteria | 2459 |
| 921 | Ga0501073_0099611 | 3300049589 | Bacteria | 2018 |
| 922 | Ga0501073_0116163 | 3300049589 | Bacteria | 1854 |
| 923 | Ga0501073_0134155 | 3300049589 | Bacteria | 1716 |
| 924 | Ga0501073_0206817 | 3300049589 | Bacteria | 1356 |
| 925 | Ga0501073_0321865 | 3300049589 | Bacteria | 1067 |
| 926 | Ga0501073_0663568 | 3300049589 | Bacteria | 720 |
| 927 | Ga0501074_0008490 | 3300049590 | Bacteria | 7442 |
| 928 | Ga0501074_0010279 | 3300049590 | Bacteria | 6792 |
| 929 | Ga0501074_0089575 | 3300049590 | Bacteria | 2203 |
| 930 | Ga0501074_0091464 | 3300049590 | Bacteria | 2179 |
| 931 | Ga0501074_0111176 | 3300049590 | Bacteria | 1960 |
| 932 | Ga0501074_0248247 | 3300049590 | Bacteria | 1266 |
| 933 | Ga0501074_0916200 | 3300049590 | Bacteria | 617 |
| 934 | Ga0501075_0120714 | 3300049591 | Bacteria | 1995 |
| 935 | Ga0501076_0275950 | 3300049592 | Bacteria | 1377 |
| 936 | Ga0501202_048970 | 3300049652 | Bacteria | 932 |
| 937 | Ga0501261_022849 | 3300049690 | Bacteria | 907 |
| 938 | Ga0501079_0043670 | 3300049741 | Bacteria | 3460 |
| 939 | Ga0501079_0083656 | 3300049741 | Bacteria | 2468 |
| 940 | Ga0501080_0000069 | 3300049742 | Bacteria | 68222 |
| 941 | Ga0501080_0018192 | 3300049742 | Bacteria | 6504 |
| 942 | Ga0501080_0036380 | 3300049742 | Bacteria | 4595 |
| 943 | Ga0501080_0060319 | 3300049742 | Bacteria | 3531 |
| 944 | Ga0501080_0108289 | 3300049742 | Bacteria | 2575 |
| 945 | Ga0501080_0110137 | 3300049742 | Bacteria | 2552 |
| 946 | Ga0501080_0365708 | 3300049742 | Bacteria | 1301 |
| 947 | Ga0501080_0544111 | 3300049742 | Bacteria | 1034 |
| 948 | Ga0501080_0588411 | 3300049742 | Bacteria | 989 |
| 949 | Ga0501080_0701019 | 3300049742 | Bacteria | 893 |
| 950 | Ga0501080_0898142 | 3300049742 | Bacteria | 772 |
| 951 | Ga0501081_0107829 | 3300049743 | Bacteria | 1975 |
| 952 | Ga0501083_0001653 | 3300049744 | Bacteria | 15206 |
| 953 | Ga0501083_0116422 | 3300049744 | Bacteria | 1754 |
| 954 | Ga0501083_0211772 | 3300049744 | Bacteria | 1263 |
| 955 | Ga0501083_0668031 | 3300049744 | Bacteria | 676 |
| 956 | Ga0501035_0002206 | 3300049822 | Bacteria | 19336 |
| 957 | Ga0501035_0002523 | 3300049822 | Bacteria | 17906 |
| 958 | Ga0501035_0005014 | 3300049822 | Bacteria | 12538 |
| 959 | Ga0501035_0016319 | 3300049822 | Bacteria | 6851 |
| 960 | Ga0501035_0021716 | 3300049822 | Bacteria | 5902 |
| 961 | Ga0501035_0042448 | 3300049822 | Bacteria | 4102 |
| 962 | Ga0501035_0049511 | 3300049822 | Bacteria | 3765 |
| 963 | Ga0501035_0049988 | 3300049822 | Bacteria | 3748 |
| 964 | Ga0501035_0062337 | 3300049822 | Bacteria | 3318 |
| 965 | Ga0501035_0069769 | 3300049822 | Bacteria | 3114 |
| 966 | Ga0501035_0085641 | 3300049822 | Bacteria | 2777 |
| 967 | Ga0501035_0191463 | 3300049822 | Bacteria | 1758 |
| 968 | Ga0501044_0003903 | 3300049823 | Bacteria | 16713 |
| 969 | Ga0501044_0006571 | 3300049823 | Bacteria | 12839 |
| 970 | Ga0501044_0007608 | 3300049823 | Bacteria | 11911 |
| 971 | Ga0501044_0007813 | 3300049823 | Bacteria | 11757 |
| 972 | Ga0501044_0010260 | 3300049823 | Bacteria | 10174 |
| 973 | Ga0501044_0015004 | 3300049823 | Bacteria | 8352 |
| 974 | Ga0501044_0037484 | 3300049823 | Bacteria | 5067 |
| 975 | Ga0501044_0039733 | 3300049823 | Bacteria | 4906 |
| 976 | Ga0501044_0050354 | 3300049823 | Bacteria | 4298 |
| 977 | Ga0501044_0066380 | 3300049823 | Bacteria | 3679 |
| 978 | Ga0501044_0149787 | 3300049823 | Bacteria | 2316 |
| 979 | Ga0501044_0196394 | 3300049823 | Bacteria | 1977 |
| 980 | Ga0501044_0213000 | 3300049823 | Bacteria | 1885 |
| 981 | Ga0501044_0218307 | 3300049823 | Bacteria | 1858 |
| 982 | Ga0501044_0285933 | 3300049823 | Bacteria | 1581 |
| 983 | Ga0501044_0334316 | 3300049823 | Bacteria | 1437 |
| 984 | Ga0501044_0360028 | 3300049823 | Bacteria | 1373 |
| 985 | Ga0501044_0473340 | 3300049823 | Bacteria | 1156 |
| 986 | Ga0501044_0476958 | 3300049823 | Bacteria | 1151 |
| 987 | Ga0501044_0554917 | 3300049823 | Bacteria | 1045 |
| 988 | Ga0501044_0627177 | 3300049823 | Bacteria | 966 |
| 989 | Ga0501044_0728990 | 3300049823 | Bacteria | 875 |
| 990 | Ga0501045_0099474 | 3300049824 | Bacteria | 2152 |
| 991 | Ga0501045_0110225 | 3300049824 | Bacteria | 2041 |
| 992 | Ga0501045_0369673 | 3300049824 | Bacteria | 1067 |
| 993 | Ga0501045_0410009 | 3300049824 | Bacteria | 1008 |
| 994 | nmdc:mga03683_32624_c1 | 3300050489 | Bacteria | 2096 |
| 995 | nmdc:mga00v17_264714_c1 | 3300050491 | Bacteria | 1115 |
| 996 | nmdc:mga0yw44_196788_c1 | 3300050492 | Bacteria | 1330 |
| 997 | nmdc:mga06z11_105715_c1 | 3300050494 | Bacteria | 1551 |
| 998 | nmdc:mga06z11_475355_c1 | 3300050494 | Bacteria | 756 |
| 999 | nmdc:mga07m45_306219_c1 | 3300050496 | Bacteria | 924 |
| 1000 | nmdc:mga05p37_134173_c1 | 3300050507 | Bacteria | 3037 |
| 1001 | nmdc:mga05p37_300235_c1 | 3300050507 | Bacteria | 1908 |
| 1002 | nmdc:mga05p37_540_c1 | 3300050507 | Bacteria | 41709 |
| 1003 | nmdc:mga09592_848_c1 | 3300050508 | Bacteria | 23773 |
| 1004 | nmdc:mga0qj67_43893_c1 | 3300050509 | Bacteria | 3521 |
| 1005 | nmdc:mga06r32_3089_c1 | 3300050510 | Bacteria | 14903 |
| 1006 | nmdc:mga08y16_305102_c1 | 3300050511 | Bacteria | 1640 |
| 1007 | nmdc:mga08y16_326573_c1 | 3300050511 | Bacteria | 1579 |
| 1008 | nmdc:mga08y16_64111_c1 | 3300050511 | Bacteria | 3837 |
| 1009 | nmdc:mga08y16_7410_c1 | 3300050511 | Bacteria | 11496 |
| 1010 | nmdc:mga0n895_183410_c1 | 3300050512 | Bacteria | 2124 |
| 1011 | nmdc:mga0n895_185387_c1 | 3300050512 | Bacteria | 2112 |
| 1012 | nmdc:mga0n895_193867_c1 | 3300050512 | Bacteria | 2063 |
| 1013 | nmdc:mga0n895_54774_c1 | 3300050512 | Bacteria | 3924 |
| 1014 | nmdc:mga0rr50_193498_c1 | 3300050513 | Bacteria | 1668 |
| 1015 | nmdc:mga0rr50_30297_c1 | 3300050513 | Bacteria | 3829 |
| 1016 | nmdc:mga0rr50_433606_c1 | 3300050513 | Bacteria | 1113 |
| 1017 | nmdc:mga08x19_26279_c1 | 3300050514 | Bacteria | 3631 |
| 1018 | nmdc:mga08x19_6_c2 | 3300050514 | Bacteria | 52011 |
| 1019 | nmdc:mga0sz30_110484_c1 | 3300050516 | Bacteria | 1205 |
| 1020 | nmdc:mga0sz30_297217_c1 | 3300050516 | Bacteria | 720 |
| 1021 | Ga0495601_0007443 | 3300053077 | Bacteria | 6421 |
| 1022 | Ga0495601_0264478 | 3300053077 | Bacteria | 1123 |
| 1023 | Ga0495612_0008980 | 3300053078 | Bacteria | 4051 |
| 1024 | Ga0495612_0028639 | 3300053078 | Bacteria | 2243 |
| 1025 | Ga0495595_0002673 | 3300053084 | Bacteria | 6994 |
| 1026 | Ga0495595_0059267 | 3300053084 | Bacteria | 1789 |
| 1027 | Ga0495619_0012413 | 3300053085 | Bacteria | 5364 |
| 1028 | Ga0495619_0081396 | 3300053085 | Bacteria | 2180 |
| 1029 | Ga0495619_0169094 | 3300053085 | Bacteria | 1511 |
| 1030 | Ga0495619_0177710 | 3300053085 | Bacteria | 1472 |
| 1031 | Ga0500643_000027 | 3300053087 | Bacteria | 251062 |
| 1032 | Ga0500646_0109722 | 3300053090 | Bacteria | 876 |
| 1033 | Ga0500646_0153262 | 3300053090 | Bacteria | 764 |
| 1034 | Ga0500647_0245044 | 3300053091 | Bacteria | 791 |
| 1035 | Ga0500566_0188241 | 3300053094 | Bacteria | 1053 |
| 1036 | Ga0500641_0005361 | 3300053096 | Bacteria | 4542 |
| 1037 | Ga0500641_0182583 | 3300053096 | Bacteria | 900 |
| 1038 | Ga0500555_056667 | 3300053103 | Bacteria | 1062 |
| 1039 | Ga0500569_035235 | 3300053109 | Bacteria | 1434 |
| 1040 | Ga0500592_028468 | 3300053116 | Bacteria | 901 |
| 1041 | Ga0500593_000272 | 3300053117 | Bacteria | 21177 |
| 1042 | Ga0500594_0100436 | 3300053118 | Bacteria | 890 |
| 1043 | Ga0500595_000824 | 3300053119 | Bacteria | 17755 |
| 1044 | Ga0500595_030441 | 3300053119 | Bacteria | 1818 |
| 1045 | Ga0500595_040738 | 3300053119 | Bacteria | 1496 |
| 1046 | Ga0500595_103449 | 3300053119 | Bacteria | 814 |
| 1047 | Ga0500607_127316 | 3300053121 | Bacteria | 1221 |
| 1048 | Ga0500652_000696 | 3300053131 | Bacteria | 11444 |
| 1049 | Ga0500655_001513 | 3300053133 | Bacteria | 4400 |
| 1050 | Ga0500568_0000005 | 3300053139 | Bacteria | 614296 |
| 1051 | Ga0500568_0012317 | 3300053139 | Bacteria | 3939 |
| 1052 | Ga0500568_0122396 | 3300053139 | Bacteria | 969 |
| 1053 | Ga0500573_0000032 | 3300053140 | Bacteria | 131098 |
| 1054 | Ga0500577_0053674 | 3300053142 | Bacteria | 1524 |
| 1055 | Ga0500577_0081375 | 3300053142 | Bacteria | 1292 |
| 1056 | Ga0500616_0062236 | 3300053153 | Bacteria | 1929 |
| 1057 | Ga0500616_0325338 | 3300053153 | Bacteria | 632 |
| 1058 | Ga0500619_105033 | 3300053154 | Bacteria | 960 |
| 1059 | Ga0500622_0001386 | 3300053156 | Bacteria | 19529 |
| 1060 | Ga0500622_0113530 | 3300053156 | Bacteria | 1321 |
| 1061 | Ga0500639_030043 | 3300053163 | Bacteria | 2872 |
| 1062 | Ga0500636_0014170 | 3300053177 | Bacteria | 4687 |
| 1063 | Ga0500611_144920 | 3300053727 | Bacteria | 649 |
| 1064 | Ga0500645_004843 | 3300053730 | Bacteria | 5076 |
| 1065 | Ga0501084_0042460 | 3300054114 | Bacteria | 3804 |
| 1066 | Ga0501084_0062833 | 3300054114 | Bacteria | 3108 |
| 1067 | Ga0501084_0771418 | 3300054114 | Bacteria | 810 |
| 1068 | Ga0501084_1004112 | 3300054114 | Bacteria | 701 |
| 1069 | Ga0501084_1214094 | 3300054114 | Bacteria | 632 |
| 1070 | Ga0501082_0011504 | 3300060353 | Bacteria | 7617 |
| 1071 | Ga0501082_0118964 | 3300060353 | Bacteria | 2289 |
| 1072 | Ga0501082_0700984 | 3300060353 | Bacteria | 886 |
| 1073 | Ga0466962_0206282 | 3300061719 | Bacteria | 961 |
| 1074 | Ga0530510_0058376 | 3300061734 | Bacteria | 2790 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028800 | Ga0265338_10012082 | Ga0265338_100120823 | 155 |
| 2 | 3300031251 | Ga0265327_10012908 | Ga0265327_100129086 | 165 |
| 3 | 3300005439 | Ga0070711_100574444 | Ga0070711_1005744441 | 168 |
| 4 | 3300025916 | Ga0207663_10424707 | Ga0207663_104247072 | 168 |
| 5 | 3300037853 | Ga0436364_0517728 | Ga0436364_0517728_30_545 | 171 |
| 6 | 3300048907 | Ga0496104_0905407 | Ga0496104_0905407_174_689 | 171 |
| 7 | 3300048908 | Ga0496105_0330231 | Ga0496105_0330231_239_754 | 171 |
| 8 | 3300048911 | Ga0496108_1018291 | Ga0496108_1018291_104_619 | 171 |
| 9 | 3300048917 | Ga0496114_0085739 | Ga0496114_0085739_2012_2527 | 171 |
| 10 | 3300005843 | Ga0068860_100272964 | Ga0068860_1002729643 | 172 |
| 11 | 3300006042 | Ga0075368_10199700 | Ga0075368_101997002 | 172 |
| 12 | 3300009093 | Ga0105240_10033158 | Ga0105240_100331588 | 172 |
| 13 | 3300009098 | Ga0105245_10818295 | Ga0105245_108182952 | 172 |
| 14 | 3300009147 | Ga0114129_10054590 | Ga0114129_100545902 | 172 |
| 15 | 3300009147 | Ga0114129_11027880 | Ga0114129_110278801 | 172 |
| 16 | 3300009177 | Ga0105248_10695449 | Ga0105248_106954491 | 172 |
| 17 | 3300009545 | Ga0105237_10014301 | Ga0105237_100143019 | 172 |
| 18 | 3300009551 | Ga0105238_10003708 | Ga0105238_100037084 | 172 |
| 19 | 3300009553 | Ga0105249_10410476 | Ga0105249_104104762 | 172 |
| 20 | 3300009553 | Ga0105249_10702721 | Ga0105249_107027212 | 172 |
| 21 | 3300010159 | Ga0099796_10031529 | Ga0099796_100315292 | 172 |
| 22 | 3300010375 | Ga0105239_10068805 | Ga0105239_100688054 | 172 |
| 23 | 3300010375 | Ga0105239_10195832 | Ga0105239_101958324 | 172 |
| 24 | 3300010375 | Ga0105239_10710453 | Ga0105239_107104531 | 172 |
| 25 | 3300011119 | Ga0105246_10280295 | Ga0105246_102802952 | 172 |
| 26 | 3300013105 | Ga0157369_10835689 | Ga0157369_108356891 | 172 |
| 27 | 3300013297 | Ga0157378_10407490 | Ga0157378_104074902 | 172 |
| 28 | 3300013306 | Ga0163162_11042084 | Ga0163162_110420842 | 172 |
| 29 | 3300013306 | Ga0163162_11744522 | Ga0163162_117445221 | 172 |
| 30 | 3300013307 | Ga0157372_11203848 | Ga0157372_112038481 | 172 |
| 31 | 3300014326 | Ga0157380_10028596 | Ga0157380_100285962 | 172 |
| 32 | 3300026075 | Ga0207708_10155971 | Ga0207708_101559712 | 172 |
| 33 | 3300026075 | Ga0207708_11061115 | Ga0207708_110611152 | 172 |
| 34 | 3300026121 | Ga0207683_10049446 | Ga0207683_100494465 | 172 |
| 35 | 3300031241 | Ga0265325_10006623 | Ga0265325_1000662310 | 172 |
| 36 | 3300031711 | Ga0265314_10000857 | Ga0265314_1000085712 | 172 |
| 37 | 3300034820 | Ga0373959_0040066 | Ga0373959_0040066_193_711 | 172 |
| 38 | 3300035090 | Ga0373949_0045285 | Ga0373949_0045285_323_841 | 172 |
| 39 | 3300035114 | Ga0373939_0081535 | Ga0373939_0081535_523_1041 | 172 |
| 40 | 3300035115 | Ga0373941_0000530 | Ga0373941_0000530_2321_2839 | 172 |
| 41 | 3300035115 | Ga0373941_0195975 | Ga0373941_0195975_26_544 | 172 |
| 42 | 3300035170 | Ga0373943_0094383 | Ga0373943_0094383_486_1004 | 172 |
| 43 | 3300035172 | Ga0373955_0017515 | Ga0373955_0017515_23_541 | 172 |
| 44 | 3300035241 | Ga0373961_0261766 | Ga0373961_0261766_87_605 | 172 |
| 45 | 3300035242 | Ga0373962_0285248 | Ga0373962_0285248_26_544 | 172 |
| 46 | 3300035398 | Ga0316574_0120379 | Ga0316574_0120379_207_725 | 172 |
| 47 | 3300035691 | Ga0373931_0002610 | Ga0373931_0002610_4162_4680 | 172 |
| 48 | 3300035695 | Ga0373927_0039911 | Ga0373927_0039911_896_1414 | 172 |
| 49 | 3300036401 | Ga0373937_0386087 | Ga0373937_0386087_241_759 | 172 |
| 50 | 3300036647 | Ga0316582_0058451 | Ga0316582_0058451_859_1377 | 172 |
| 51 | 3300036712 | Ga0316584_0200958 | Ga0316584_0200958_94_612 | 172 |
| 52 | 3300036712 | Ga0316584_0382504 | Ga0316584_0382504_386_904 | 172 |
| 53 | 3300037068 | Ga0373925_0050470 | Ga0373925_0050470_28_546 | 172 |
| 54 | 3300037068 | Ga0373925_0075886 | Ga0373925_0075886_612_1130 | 172 |
| 55 | 3300037068 | Ga0373925_0984827 | Ga0373925_0984827_18_536 | 172 |
| 56 | 3300037466 | Ga0395898_0222074 | Ga0395898_0222074_846_1364 | 172 |
| 57 | 3300038443 | Ga0395901_0279117 | Ga0395901_0279117_10_528 | 172 |
| 58 | 3300039437 | Ga0436365_1850734 | Ga0436365_1850734_32_550 | 172 |
| 59 | 3300041404 | Ga0439436_0003726 | Ga0439436_0003726_1540_2058 | 172 |
| 60 | 3300041406 | Ga0439439_0006276 | Ga0439439_0006276_1999_2517 | 172 |
| 61 | 3300041408 | Ga0439453_0005016 | Ga0439453_0005016_953_1471 | 172 |
| 62 | 3300041411 | Ga0439466_0004428 | Ga0439466_0004428_2516_3034 | 172 |
| 63 | 3300041413 | Ga0439465_0010767 | Ga0439465_0010767_1741_2259 | 172 |
| 64 | 3300041512 | Ga0451853_0974959 | Ga0451853_0974959_175_693 | 172 |
| 65 | 3300042007 | Ga0439449_0004779 | Ga0439449_0004779_1268_1786 | 172 |
| 66 | 3300042013 | Ga0439456_010801 | Ga0439456_010801_383_901 | 172 |
| 67 | 3300042015 | Ga0439462_0034136 | Ga0439462_0034136_604_1122 | 172 |
| 68 | 3300042145 | Ga0450906_008964 | Ga0450906_008964_526_1044 | 172 |
| 69 | 3300042531 | Ga0450918_002668 | Ga0450918_002668_1132_1650 | 172 |
| 70 | 3300045976 | Ga0466967_0268247 | Ga0466967_0268247_1097_1615 | 172 |
| 71 | 3300046452 | Ga0495617_016190 | Ga0495617_016190_74_592 | 172 |
| 72 | 3300046453 | Ga0495627_057892 | Ga0495627_057892_196_714 | 172 |
| 73 | 3300046455 | Ga0495603_0221875 | Ga0495603_0221875_320_838 | 172 |
| 74 | 3300046459 | Ga0495629_0809914 | Ga0495629_0809914_52_570 | 172 |
| 75 | 3300046472 | Ga0495580_0444109 | Ga0495580_0444109_288_806 | 172 |
| 76 | 3300046473 | Ga0495582_0071437 | Ga0495582_0071437_157_675 | 172 |
| 77 | 3300046506 | Ga0495583_0114591 | Ga0495583_0114591_555_1073 | 172 |
| 78 | 3300046517 | Ga0495630_1053929 | Ga0495630_1053929_24_542 | 172 |
| 79 | 3300046523 | Ga0495644_0121737 | Ga0495644_0121737_202_720 | 172 |
| 80 | 3300046525 | Ga0495663_0184758 | Ga0495663_0184758_82_600 | 172 |
| 81 | 3300046533 | Ga0495640_0454885 | Ga0495640_0454885_251_769 | 172 |
| 82 | 3300046535 | Ga0495586_0302721 | Ga0495586_0302721_381_899 | 172 |
| 83 | 3300046535 | Ga0495586_0678223 | Ga0495586_0678223_55_573 | 172 |
| 84 | 3300046538 | Ga0495609_0017425 | Ga0495609_0017425_1294_1812 | 172 |
| 85 | 3300046558 | Ga0495633_0388340 | Ga0495633_0388340_85_603 | 172 |
| 86 | 3300046615 | Ga0495656_0672752 | Ga0495656_0672752_16_534 | 172 |
| 87 | 3300046681 | Ga0495647_0076697 | Ga0495647_0076697_730_1248 | 172 |
| 88 | 3300046681 | Ga0495647_0089092 | Ga0495647_0089092_513_1031 | 172 |
| 89 | 3300046683 | Ga0495658_0069000 | Ga0495658_0069000_636_1154 | 172 |
| 90 | 3300046690 | Ga0495624_0119317 | Ga0495624_0119317_902_1420 | 172 |
| 91 | 3300046694 | Ga0495649_0081253 | Ga0495649_0081253_1193_1711 | 172 |
| 92 | 3300047315 | Ga0495581_0253610 | Ga0495581_0253610_424_942 | 172 |
| 93 | 3300047318 | Ga0495636_0255343 | Ga0495636_0255343_128_646 | 172 |
| 94 | 3300047321 | Ga0495676_0390035 | Ga0495676_0390035_13_531 | 172 |
| 95 | 3300047472 | Ga0495686_0626729 | Ga0495686_0626729_13_531 | 172 |
| 96 | 3300048089 | Ga0495614_0061948 | Ga0495614_0061948_1036_1554 | 172 |
| 97 | 3300048903 | Ga0496100_0881906 | Ga0496100_0881906_132_650 | 172 |
| 98 | 3300048905 | Ga0496102_0235447 | Ga0496102_0235447_907_1425 | 172 |
| 99 | 3300048905 | Ga0496102_0331067 | Ga0496102_0331067_480_998 | 172 |
| 100 | 3300048906 | Ga0496103_0098768 | Ga0496103_0098768_1300_1818 | 172 |
| 101 | 3300048906 | Ga0496103_0155229 | Ga0496103_0155229_825_1343 | 172 |
| 102 | 3300048908 | Ga0496105_0033919 | Ga0496105_0033919_3156_3674 | 172 |
| 103 | 3300048908 | Ga0496105_0854285 | Ga0496105_0854285_108_626 | 172 |
| 104 | 3300048909 | Ga0496106_0041871 | Ga0496106_0041871_953_1471 | 172 |
| 105 | 3300048910 | Ga0496107_0484985 | Ga0496107_0484985_107_625 | 172 |
| 106 | 3300048911 | Ga0496108_1056445 | Ga0496108_1056445_67_585 | 172 |
| 107 | 3300048912 | Ga0496109_0028284 | Ga0496109_0028284_3816_4334 | 172 |
| 108 | 3300048913 | Ga0496110_0264135 | Ga0496110_0264135_888_1406 | 172 |
| 109 | 3300048914 | Ga0496111_0024359 | Ga0496111_0024359_2621_3139 | 172 |
| 110 | 3300048915 | Ga0496112_0035439 | Ga0496112_0035439_2833_3351 | 172 |
| 111 | 3300048916 | Ga0496113_0003117 | Ga0496113_0003117_1455_1973 | 172 |
| 112 | 3300048917 | Ga0496114_0133010 | Ga0496114_0133010_1389_1907 | 172 |
| 113 | 3300048918 | Ga0496115_0067074 | Ga0496115_0067074_461_979 | 172 |
| 114 | 3300048929 | Ga0496126_0587409 | Ga0496126_0587409_310_828 | 172 |
| 115 | 3300049568 | Ga0501031_0036251 | Ga0501031_0036251_1168_1686 | 172 |
| 116 | 3300049569 | Ga0501032_0014948 | Ga0501032_0014948_3116_3634 | 172 |
| 117 | 3300049570 | Ga0501033_0136356 | Ga0501033_0136356_542_1060 | 172 |
| 118 | 3300049571 | Ga0501034_0141858 | Ga0501034_0141858_589_1107 | 172 |
| 119 | 3300049571 | Ga0501034_1240380 | Ga0501034_1240380_93_611 | 172 |
| 120 | 3300049572 | Ga0501036_0001489 | Ga0501036_0001489_4411_4929 | 172 |
| 121 | 3300049572 | Ga0501036_0037534 | Ga0501036_0037534_1630_2148 | 172 |
| 122 | 3300049572 | Ga0501036_0140446 | Ga0501036_0140446_201_719 | 172 |
| 123 | 3300049573 | Ga0501037_0020528 | Ga0501037_0020528_1639_2157 | 172 |
| 124 | 3300049573 | Ga0501037_0032572 | Ga0501037_0032572_1193_1711 | 172 |
| 125 | 3300049573 | Ga0501037_0109332 | Ga0501037_0109332_753_1271 | 172 |
| 126 | 3300049573 | Ga0501037_0415263 | Ga0501037_0415263_274_792 | 172 |
| 127 | 3300049574 | Ga0501038_0194763 | Ga0501038_0194763_967_1485 | 172 |
| 128 | 3300049575 | Ga0501039_0059068 | Ga0501039_0059068_2366_2884 | 172 |
| 129 | 3300049575 | Ga0501039_0130775 | Ga0501039_0130775_112_630 | 172 |
| 130 | 3300049578 | Ga0501042_0043643 | Ga0501042_0043643_1007_1525 | 172 |
| 131 | 3300049578 | Ga0501042_0735531 | Ga0501042_0735531_148_666 | 172 |
| 132 | 3300049579 | Ga0501043_0003947 | Ga0501043_0003947_10956_11474 | 172 |
| 133 | 3300049579 | Ga0501043_0069685 | Ga0501043_0069685_1862_2380 | 172 |
| 134 | 3300049579 | Ga0501043_0413606 | Ga0501043_0413606_262_780 | 172 |
| 135 | 3300049580 | Ga0501046_0017066 | Ga0501046_0017066_2791_3309 | 172 |
| 136 | 3300049580 | Ga0501046_0048921 | Ga0501046_0048921_1132_1650 | 172 |
| 137 | 3300049580 | Ga0501046_0567589 | Ga0501046_0567589_130_648 | 172 |
| 138 | 3300049581 | Ga0501047_0000079 | Ga0501047_0000079_56746_57264 | 172 |
| 139 | 3300049581 | Ga0501047_0032713 | Ga0501047_0032713_4239_4757 | 172 |
| 140 | 3300049581 | Ga0501047_0180029 | Ga0501047_0180029_753_1271 | 172 |
| 141 | 3300049582 | Ga0501048_0000263 | Ga0501048_0000263_14398_14916 | 172 |
| 142 | 3300049582 | Ga0501048_0000312 | Ga0501048_0000312_24067_24585 | 172 |
| 143 | 3300049584 | Ga0501068_0188006 | Ga0501068_0188006_455_973 | 172 |
| 144 | 3300049585 | Ga0501069_0052480 | Ga0501069_0052480_1560_2078 | 172 |
| 145 | 3300049585 | Ga0501069_0099802 | Ga0501069_0099802_455_973 | 172 |
| 146 | 3300049586 | Ga0501070_0023416 | Ga0501070_0023416_618_1136 | 172 |
| 147 | 3300049586 | Ga0501070_0039302 | Ga0501070_0039302_1821_2339 | 172 |
| 148 | 3300049586 | Ga0501070_0113198 | Ga0501070_0113198_1009_1527 | 172 |
| 149 | 3300049587 | Ga0501071_0112232 | Ga0501071_0112232_1136_1654 | 172 |
| 150 | 3300049589 | Ga0501073_0116163 | Ga0501073_0116163_63_581 | 172 |
| 151 | 3300049589 | Ga0501073_0206817 | Ga0501073_0206817_627_1145 | 172 |
| 152 | 3300049589 | Ga0501073_0321865 | Ga0501073_0321865_496_1014 | 172 |
| 153 | 3300049590 | Ga0501074_0010279 | Ga0501074_0010279_1436_1954 | 172 |
| 154 | 3300049590 | Ga0501074_0111176 | Ga0501074_0111176_692_1210 | 172 |
| 155 | 3300049592 | Ga0501076_0275950 | Ga0501076_0275950_608_1126 | 172 |
| 156 | 3300049741 | Ga0501079_0083656 | Ga0501079_0083656_631_1149 | 172 |
| 157 | 3300049742 | Ga0501080_0000069 | Ga0501080_0000069_11058_11576 | 172 |
| 158 | 3300049742 | Ga0501080_0365708 | Ga0501080_0365708_14_532 | 172 |
| 159 | 3300049742 | Ga0501080_0544111 | Ga0501080_0544111_13_531 | 172 |
| 160 | 3300049743 | Ga0501081_0107829 | Ga0501081_0107829_712_1230 | 172 |
| 161 | 3300049744 | Ga0501083_0001653 | Ga0501083_0001653_8289_8807 | 172 |
| 162 | 3300049744 | Ga0501083_0116422 | Ga0501083_0116422_274_792 | 172 |
| 163 | 3300049823 | Ga0501044_0213000 | Ga0501044_0213000_670_1188 | 172 |
| 164 | 3300049823 | Ga0501044_0285933 | Ga0501044_0285933_362_880 | 172 |
| 165 | 3300049823 | Ga0501044_0554917 | Ga0501044_0554917_262_780 | 172 |
| 166 | 3300049823 | Ga0501044_0728990 | Ga0501044_0728990_277_807 | 172 |
| 167 | 3300049824 | Ga0501045_0110225 | Ga0501045_0110225_1009_1527 | 172 |
| 168 | 3300049824 | Ga0501045_0369673 | Ga0501045_0369673_537_1055 | 172 |
| 169 | 3300050494 | nmdc:mga06z11_105715_c1 | nmdc:mga06z11_105715_c1_222_740 | 172 |
| 170 | 3300050496 | nmdc:mga07m45_306219_c1 | nmdc:mga07m45_306219_c1_395_913 | 172 |
| 171 | 3300050507 | nmdc:mga05p37_134173_c1 | nmdc:mga05p37_134173_c1_1257_1775 | 172 |
| 172 | 3300050507 | nmdc:mga05p37_300235_c1 | nmdc:mga05p37_300235_c1_617_1135 | 172 |
| 173 | 3300050511 | nmdc:mga08y16_305102_c1 | nmdc:mga08y16_305102_c1_26_544 | 172 |
| 174 | 3300050512 | nmdc:mga0n895_193867_c1 | nmdc:mga0n895_193867_c1_1244_1762 | 172 |
| 175 | 3300050513 | nmdc:mga0rr50_193498_c1 | nmdc:mga0rr50_193498_c1_30_548 | 172 |
| 176 | 3300053085 | Ga0495619_0177710 | Ga0495619_0177710_363_881 | 172 |
| 177 | 3300053096 | Ga0500641_0182583 | Ga0500641_0182583_350_868 | 172 |
| 178 | 3300053131 | Ga0500652_000696 | Ga0500652_000696_3482_4012 | 172 |
| 179 | 3300054114 | Ga0501084_0062833 | Ga0501084_0062833_2435_2953 | 172 |
| 180 | 3300054114 | Ga0501084_1214094 | Ga0501084_1214094_93_611 | 172 |
| 181 | 3300060353 | Ga0501082_0700984 | Ga0501082_0700984_313_831 | 172 |
| 182 | 3300005339 | Ga0070660_100175509 | Ga0070660_1001755092 | 173 |
| 183 | 3300009093 | Ga0105240_10028212 | Ga0105240_100282124 | 173 |
| 184 | 3300009093 | Ga0105240_10187103 | Ga0105240_101871033 | 173 |
| 185 | 3300009545 | Ga0105237_10070274 | Ga0105237_100702741 | 173 |
| 186 | 3300009545 | Ga0105237_11693442 | Ga0105237_116934421 | 173 |
| 187 | 3300009551 | Ga0105238_10301334 | Ga0105238_103013342 | 173 |
| 188 | 3300010375 | Ga0105239_10590879 | Ga0105239_105908792 | 173 |
| 189 | 3300014497 | Ga0182008_10043533 | Ga0182008_100435333 | 173 |
| 190 | 3300035086 | Ga0373934_0266305 | Ga0373934_0266305_171_692 | 173 |
| 191 | 3300035111 | Ga0373923_0411414 | Ga0373923_0411414_38_559 | 173 |
| 192 | 3300035117 | Ga0373953_0339141 | Ga0373953_0339141_56_577 | 173 |
| 193 | 3300035398 | Ga0316574_0244371 | Ga0316574_0244371_350_871 | 173 |
| 194 | 3300036401 | Ga0373937_0333999 | Ga0373937_0333999_369_890 | 173 |
| 195 | 3300037853 | Ga0436364_1387285 | Ga0436364_1387285_198_728 | 173 |
| 196 | 3300039437 | Ga0436365_1247148 | Ga0436365_1247148_69_599 | 173 |
| 197 | 3300039438 | Ga0436360_0812316 | Ga0436360_0812316_535_1056 | 173 |
| 198 | 3300041486 | Ga0451807_0374610 | Ga0451807_0374610_435_959 | 173 |
| 199 | 3300046463 | Ga0495653_0728641 | Ga0495653_0728641_63_584 | 173 |
| 200 | 3300046516 | Ga0495628_0234909 | Ga0495628_0234909_390_911 | 173 |
| 201 | 3300046533 | Ga0495640_0417814 | Ga0495640_0417814_38_559 | 173 |
| 202 | 3300046536 | Ga0495587_0064240 | Ga0495587_0064240_651_1172 | 173 |
| 203 | 3300046536 | Ga0495587_0066469 | Ga0495587_0066469_1160_1681 | 173 |
| 204 | 3300046660 | Ga0495625_0124522 | Ga0495625_0124522_846_1367 | 173 |
| 205 | 3300047317 | Ga0495604_0269185 | Ga0495604_0269185_404_925 | 173 |
| 206 | 3300047319 | Ga0495674_0385092 | Ga0495674_0385092_505_1026 | 173 |
| 207 | 3300047444 | Ga0495675_0215194 | Ga0495675_0215194_578_1099 | 173 |
| 208 | 3300047444 | Ga0495675_0372148 | Ga0495675_0372148_237_758 | 173 |
| 209 | 3300048088 | Ga0495602_0222502 | Ga0495602_0222502_264_785 | 173 |
| 210 | 3300048088 | Ga0495602_0339163 | Ga0495602_0339163_302_823 | 173 |
| 211 | 3300048929 | Ga0496126_0518759 | Ga0496126_0518759_10_531 | 173 |
| 212 | 3300053077 | Ga0495601_0264478 | Ga0495601_0264478_53_574 | 173 |
| 213 | 3300053078 | Ga0495612_0028639 | Ga0495612_0028639_849_1370 | 173 |
| 214 | 3300053085 | Ga0495619_0169094 | Ga0495619_0169094_976_1497 | 173 |
| 215 | 3300053087 | Ga0500643_000027 | Ga0500643_000027_91414_91935 | 173 |
| 216 | 3300053090 | Ga0500646_0153262 | Ga0500646_0153262_204_725 | 173 |
| 217 | 3300053116 | Ga0500592_028468 | Ga0500592_028468_303_824 | 173 |
| 218 | 3300053119 | Ga0500595_030441 | Ga0500595_030441_89_610 | 173 |
| 219 | 3300053139 | Ga0500568_0122396 | Ga0500568_0122396_294_815 | 173 |
| 220 | 3300003659 | JGI25404J52841_10004507 | JGI25404J52841_100045072 | 174 |
| 221 | iso_pu_bacteria | 2738541281 | 2738746493 | 175 |
| 222 | iso_pu_bacteria | 2738543032 | 2739355723 | 175 |
| 223 | 3300005331 | Ga0070670_100209151 | Ga0070670_1002091512 | 176 |
| 224 | 3300005347 | Ga0070668_100000460 | Ga0070668_10000046020 | 176 |
| 225 | 3300005353 | Ga0070669_100008586 | Ga0070669_1000085868 | 176 |
| 226 | 3300005367 | Ga0070667_100000286 | Ga0070667_10000028629 | 176 |
| 227 | 3300005841 | Ga0068863_100000168 | Ga0068863_10000016845 | 176 |
| 228 | 3300025903 | Ga0207680_10065939 | Ga0207680_100659392 | 176 |
| 229 | 3300025923 | Ga0207681_10004489 | Ga0207681_100044892 | 176 |
| 230 | 3300025972 | Ga0207668_10000430 | Ga0207668_100004308 | 176 |
| 231 | 3300025986 | Ga0207658_10000243 | Ga0207658_1000024341 | 176 |
| 232 | 3300026088 | Ga0207641_10000241 | Ga0207641_1000024132 | 176 |
| 233 | 3300046453 | Ga0495627_002377 | Ga0495627_002377_2863_3429 | 176 |
| 234 | 3300046471 | Ga0495650_0002793 | Ga0495650_0002793_8893_9459 | 176 |
| 235 | 3300046491 | Ga0495584_0254407 | Ga0495584_0254407_57_623 | 176 |
| 236 | 3300046512 | Ga0495610_0000053 | Ga0495610_0000053_55754_56320 | 176 |
| 237 | 3300046520 | Ga0495637_0002782 | Ga0495637_0002782_4320_4886 | 176 |
| 238 | 3300046665 | Ga0495661_0026255 | Ga0495661_0026255_1775_2341 | 176 |
| 239 | 3300046810 | Ga0495660_0266371 | Ga0495660_0266371_185_751 | 176 |
| 240 | 3300047470 | Ga0495681_0000015 | Ga0495681_0000015_34661_35227 | 176 |
| 241 | 3300049459 | Ga0495678_042157 | Ga0495678_042157_701_1267 | 176 |
| 242 | 3300049569 | Ga0501032_0102978 | Ga0501032_0102978_792_1325 | 177 |
| 243 | 3300049570 | Ga0501033_0065358 | Ga0501033_0065358_544_1077 | 177 |
| 244 | 3300049571 | Ga0501034_0919631 | Ga0501034_0919631_200_733 | 177 |
| 245 | 3300049574 | Ga0501038_0217033 | Ga0501038_0217033_272_805 | 177 |
| 246 | 3300049581 | Ga0501047_0132988 | Ga0501047_0132988_363_896 | 177 |
| 247 | 3300049742 | Ga0501080_0588411 | Ga0501080_0588411_420_953 | 177 |
| 248 | 3300054114 | Ga0501084_0771418 | Ga0501084_0771418_142_675 | 177 |
| 249 | iso_pu_bacteria | 2917699015 | 2917703953 | 178 |
| 250 | 3300009094 | Ga0111539_10076197 | Ga0111539_100761972 | 179 |
| 251 | 3300009545 | Ga0105237_10706943 | Ga0105237_107069431 | 179 |
| 252 | 3300014326 | Ga0157380_10139607 | Ga0157380_101396073 | 179 |
| 253 | 3300046500 | Ga0495596_0235410 | Ga0495596_0235410_36_575 | 179 |
| 254 | 3300046511 | Ga0495608_0531636 | Ga0495608_0531636_153_692 | 179 |
| 255 | 3300046689 | Ga0495613_0338420 | Ga0495613_0338420_264_803 | 179 |
| 256 | 3300050511 | nmdc:mga08y16_64111_c1 | nmdc:mga08y16_64111_c1_522_1061 | 179 |
| 257 | 3300050512 | nmdc:mga0n895_54774_c1 | nmdc:mga0n895_54774_c1_578_1117 | 179 |
| 258 | 3300050513 | nmdc:mga0rr50_30297_c1 | nmdc:mga0rr50_30297_c1_2111_2650 | 179 |
| 259 | 3300053119 | Ga0500595_040738 | Ga0500595_040738_52_591 | 179 |
| 260 | 3300053142 | Ga0500577_0081375 | Ga0500577_0081375_550_1089 | 179 |
| 261 | 3300004803 | Ga0058862_12227048 | Ga0058862_122270481 | 180 |
| 262 | 3300031240 | Ga0265320_10003153 | Ga0265320_1000315310 | 180 |
| 263 | 3300031241 | Ga0265325_10002838 | Ga0265325_100028384 | 180 |
| 264 | 3300031247 | Ga0265340_10018994 | Ga0265340_100189945 | 180 |
| 265 | 3300035691 | Ga0373931_0431111 | Ga0373931_0431111_38_592 | 180 |
| 266 | 3300039438 | Ga0436360_0543230 | Ga0436360_0543230_114_671 | 180 |
| 267 | 3300044658 | Ga0466972_0471867 | Ga0466972_0471867_23_565 | 180 |
| 268 | 3300045836 | Ga0466958_0169328 | Ga0466958_0169328_185_742 | 180 |
| 269 | 3300045976 | Ga0466967_0244384 | Ga0466967_0244384_686_1243 | 180 |
| 270 | 3300049569 | Ga0501032_0087223 | Ga0501032_0087223_558_1100 | 180 |
| 271 | 3300049570 | Ga0501033_0014827 | Ga0501033_0014827_3464_4006 | 180 |
| 272 | 3300049571 | Ga0501034_0077548 | Ga0501034_0077548_1380_1922 | 180 |
| 273 | 3300049572 | Ga0501036_0185206 | Ga0501036_0185206_1190_1732 | 180 |
| 274 | 3300049579 | Ga0501043_0197278 | Ga0501043_0197278_348_890 | 180 |
| 275 | 3300049581 | Ga0501047_0675219 | Ga0501047_0675219_86_628 | 180 |
| 276 | 3300049586 | Ga0501070_0141498 | Ga0501070_0141498_1032_1574 | 180 |
| 277 | 3300049590 | Ga0501074_0248247 | Ga0501074_0248247_524_1066 | 180 |
| 278 | 3300005545 | Ga0070695_100016895 | Ga0070695_1000168956 | 181 |
| 279 | 3300006178 | Ga0075367_10102956 | Ga0075367_101029563 | 181 |
| 280 | 3300006844 | Ga0075428_100028440 | Ga0075428_1000284407 | 181 |
| 281 | 3300006846 | Ga0075430_100013832 | Ga0075430_1000138329 | 181 |
| 282 | 3300006847 | Ga0075431_100000880 | Ga0075431_10000088029 | 181 |
| 283 | 3300006880 | Ga0075429_100000855 | Ga0075429_10000085523 | 181 |
| 284 | 3300007076 | Ga0075435_100367529 | Ga0075435_1003675292 | 181 |
| 285 | 3300009094 | Ga0111539_10000367 | Ga0111539_1000036730 | 181 |
| 286 | 3300009147 | Ga0114129_10000825 | Ga0114129_1000082530 | 181 |
| 287 | 3300009147 | Ga0114129_10176535 | Ga0114129_101765352 | 181 |
| 288 | 3300013306 | Ga0163162_10585205 | Ga0163162_105852052 | 181 |
| 289 | 3300025949 | Ga0207667_10054254 | Ga0207667_100542543 | 181 |
| 290 | 3300027907 | Ga0207428_10008616 | Ga0207428_100086168 | 181 |
| 291 | 3300028379 | Ga0268266_10088010 | Ga0268266_100880104 | 181 |
| 292 | 3300031250 | Ga0265331_10018315 | Ga0265331_100183152 | 181 |
| 293 | 3300046678 | Ga0495599_0224687 | Ga0495599_0224687_19_567 | 181 |
| 294 | 3300048910 | Ga0496107_0218161 | Ga0496107_0218161_13_558 | 181 |
| 295 | 3300049568 | Ga0501031_0037269 | Ga0501031_0037269_1783_2328 | 181 |
| 296 | 3300049570 | Ga0501033_0374984 | Ga0501033_0374984_46_603 | 181 |
| 297 | 3300049573 | Ga0501037_0336440 | Ga0501037_0336440_242_799 | 181 |
| 298 | 3300049652 | Ga0501202_048970 | Ga0501202_048970_372_917 | 181 |
| 299 | 3300049822 | Ga0501035_0016319 | Ga0501035_0016319_5069_5626 | 181 |
| 300 | 3300049822 | Ga0501035_0069769 | Ga0501035_0069769_2107_2652 | 181 |
| 301 | 3300049823 | Ga0501044_0050354 | Ga0501044_0050354_2404_2949 | 181 |
| 302 | 3300050507 | nmdc:mga05p37_540_c1 | nmdc:mga05p37_540_c1_23558_24103 | 181 |
| 303 | 3300050508 | nmdc:mga09592_848_c1 | nmdc:mga09592_848_c1_1164_1709 | 181 |
| 304 | 3300050509 | nmdc:mga0qj67_43893_c1 | nmdc:mga0qj67_43893_c1_652_1197 | 181 |
| 305 | 3300050510 | nmdc:mga06r32_3089_c1 | nmdc:mga06r32_3089_c1_2344_2889 | 181 |
| 306 | 3300050511 | nmdc:mga08y16_326573_c1 | nmdc:mga08y16_326573_c1_840_1385 | 181 |
| 307 | 3300050511 | nmdc:mga08y16_7410_c1 | nmdc:mga08y16_7410_c1_3771_4316 | 181 |
| 308 | 3300050514 | nmdc:mga08x19_6_c2 | nmdc:mga08x19_6_c2_3799_4344 | 181 |
| 309 | iso_pu_bacteria | 2513237087 | 2513594079 | 181 |
| 310 | iso_pu_bacteria | 2643221547 | 2643758482 | 181 |
| 311 | 3300005327 | Ga0070658_10168949 | Ga0070658_101689492 | 182 |
| 312 | 3300005539 | Ga0068853_100093302 | Ga0068853_1000933022 | 182 |
| 313 | 3300005563 | Ga0068855_100006202 | Ga0068855_10000620216 | 182 |
| 314 | 3300006186 | Ga0075369_10132287 | Ga0075369_101322872 | 182 |
| 315 | 3300006846 | Ga0075430_100093408 | Ga0075430_1000934083 | 182 |
| 316 | 3300009093 | Ga0105240_10011987 | Ga0105240_100119873 | 182 |
| 317 | 3300009093 | Ga0105240_10015552 | Ga0105240_100155527 | 182 |
| 318 | 3300009148 | Ga0105243_11242240 | Ga0105243_112422401 | 182 |
| 319 | 3300010375 | Ga0105239_10036916 | Ga0105239_100369163 | 182 |
| 320 | 3300010375 | Ga0105239_10140823 | Ga0105239_101408233 | 182 |
| 321 | 3300013105 | Ga0157369_10705866 | Ga0157369_107058662 | 182 |
| 322 | 3300025913 | Ga0207695_10026509 | Ga0207695_100265096 | 182 |
| 323 | 3300025919 | Ga0207657_10127414 | Ga0207657_101274142 | 182 |
| 324 | 3300025924 | Ga0207694_10265334 | Ga0207694_102653342 | 182 |
| 325 | 3300025949 | Ga0207667_10015427 | Ga0207667_100154279 | 182 |
| 326 | 3300026116 | Ga0207674_10410658 | Ga0207674_104106581 | 182 |
| 327 | 3300031456 | Ga0307513_10230922 | Ga0307513_102309223 | 182 |
| 328 | 3300031616 | Ga0307508_10196407 | Ga0307508_101964072 | 182 |
| 329 | 3300039437 | Ga0436365_1887606 | Ga0436365_1887606_2377_2937 | 182 |
| 330 | 3300044712 | Ga0453684_0010839 | Ga0453684_0010839_7832_8395 | 182 |
| 331 | 3300048920 | Ga0496117_0067198 | Ga0496117_0067198_385_933 | 182 |
| 332 | 3300049571 | Ga0501034_0076368 | Ga0501034_0076368_1980_2528 | 182 |
| 333 | 3300049571 | Ga0501034_0351369 | Ga0501034_0351369_53_601 | 182 |
| 334 | 3300049573 | Ga0501037_0006850 | Ga0501037_0006850_1925_2485 | 182 |
| 335 | 3300049574 | Ga0501038_0365027 | Ga0501038_0365027_396_956 | 182 |
| 336 | 3300049579 | Ga0501043_0076267 | Ga0501043_0076267_973_1533 | 182 |
| 337 | 3300049580 | Ga0501046_0183850 | Ga0501046_0183850_55_615 | 182 |
| 338 | 3300049822 | Ga0501035_0049988 | Ga0501035_0049988_2669_3229 | 182 |
| 339 | 3300050494 | nmdc:mga06z11_475355_c1 | nmdc:mga06z11_475355_c1_58_606 | 182 |
| 340 | 3300050516 | nmdc:mga0sz30_297217_c1 | nmdc:mga0sz30_297217_c1_141_701 | 182 |
| 341 | 3300053096 | Ga0500641_0005361 | Ga0500641_0005361_2804_3358 | 182 |
| 342 | 3300053139 | Ga0500568_0012317 | Ga0500568_0012317_1059_1619 | 182 |
| 343 | 3300053142 | Ga0500577_0053674 | Ga0500577_0053674_565_1128 | 182 |
| 344 | 3300053177 | Ga0500636_0014170 | Ga0500636_0014170_2713_3261 | 182 |
| 345 | 3300028794 | Ga0307515_10347015 | Ga0307515_103470151 | 183 |
| 346 | 3300031901 | Ga0307406_11017709 | Ga0307406_110177091 | 183 |
| 347 | 3300047317 | Ga0495604_0450737 | Ga0495604_0450737_19_570 | 183 |
| 348 | 3300049571 | Ga0501034_0056463 | Ga0501034_0056463_3295_3855 | 183 |
| 349 | 3300049587 | Ga0501071_0498439 | Ga0501071_0498439_63_614 | 183 |
| 350 | 3300049823 | Ga0501044_0149787 | Ga0501044_0149787_144_707 | 183 |
| 351 | 3300054114 | Ga0501084_1004112 | Ga0501084_1004112_62_625 | 183 |
| 352 | 3300005341 | Ga0070691_10000082 | Ga0070691_1000008229 | 184 |
| 353 | 3300005367 | Ga0070667_100003377 | Ga0070667_1000033773 | 184 |
| 354 | 3300005434 | Ga0070709_10000238 | Ga0070709_1000023836 | 184 |
| 355 | 3300005434 | Ga0070709_10045744 | Ga0070709_100457442 | 184 |
| 356 | 3300005436 | Ga0070713_100000011 | Ga0070713_10000001178 | 184 |
| 357 | 3300005436 | Ga0070713_100151412 | Ga0070713_1001514122 | 184 |
| 358 | 3300005437 | Ga0070710_10454226 | Ga0070710_104542262 | 184 |
| 359 | 3300005439 | Ga0070711_100356823 | Ga0070711_1003568232 | 184 |
| 360 | 3300005458 | Ga0070681_10233974 | Ga0070681_102339742 | 184 |
| 361 | 3300005539 | Ga0068853_100047449 | Ga0068853_1000474493 | 184 |
| 362 | 3300005545 | Ga0070695_100055449 | Ga0070695_1000554492 | 184 |
| 363 | 3300005547 | Ga0070693_100033589 | Ga0070693_1000335893 | 184 |
| 364 | 3300005563 | Ga0068855_100027939 | Ga0068855_1000279392 | 184 |
| 365 | 3300005564 | Ga0070664_100039249 | Ga0070664_1000392493 | 184 |
| 366 | 3300005577 | Ga0068857_100005182 | Ga0068857_1000051829 | 184 |
| 367 | 3300005614 | Ga0068856_100000964 | Ga0068856_10000096413 | 184 |
| 368 | 3300005614 | Ga0068856_100003424 | Ga0068856_1000034248 | 184 |
| 369 | 3300005616 | Ga0068852_100005817 | Ga0068852_1000058178 | 184 |
| 370 | 3300005841 | Ga0068863_100986815 | Ga0068863_1009868151 | 184 |
| 371 | 3300006173 | Ga0070716_100155533 | Ga0070716_1001555331 | 184 |
| 372 | 3300006175 | Ga0070712_100000014 | Ga0070712_10000001485 | 184 |
| 373 | 3300006175 | Ga0070712_100000314 | Ga0070712_10000031418 | 184 |
| 374 | 3300006871 | Ga0075434_100108181 | Ga0075434_1001081815 | 184 |
| 375 | 3300006914 | Ga0075436_100000047 | Ga0075436_10000004744 | 184 |
| 376 | 3300006914 | Ga0075436_100098258 | Ga0075436_1000982583 | 184 |
| 377 | 3300007076 | Ga0075435_100075730 | Ga0075435_1000757302 | 184 |
| 378 | 3300009177 | Ga0105248_10039182 | Ga0105248_100391826 | 184 |
| 379 | 3300014968 | Ga0157379_10022783 | Ga0157379_100227836 | 184 |
| 380 | 3300025903 | Ga0207680_10001937 | Ga0207680_100019378 | 184 |
| 381 | 3300025906 | Ga0207699_10000233 | Ga0207699_100002337 | 184 |
| 382 | 3300025906 | Ga0207699_10138978 | Ga0207699_101389783 | 184 |
| 383 | 3300025906 | Ga0207699_10205688 | Ga0207699_102056882 | 184 |
| 384 | 3300025913 | Ga0207695_10016906 | Ga0207695_100169064 | 184 |
| 385 | 3300025915 | Ga0207693_10000018 | Ga0207693_1000001838 | 184 |
| 386 | 3300025915 | Ga0207693_10000276 | Ga0207693_1000027642 | 184 |
| 387 | 3300025916 | Ga0207663_10255259 | Ga0207663_102552593 | 184 |
| 388 | 3300025928 | Ga0207700_10000005 | Ga0207700_1000000543 | 184 |
| 389 | 3300025928 | Ga0207700_10156506 | Ga0207700_101565062 | 184 |
| 390 | 3300025939 | Ga0207665_10190158 | Ga0207665_101901583 | 184 |
| 391 | 3300025949 | Ga0207667_10007703 | Ga0207667_100077039 | 184 |
| 392 | 3300025949 | Ga0207667_10347395 | Ga0207667_103473952 | 184 |
| 393 | 3300025986 | Ga0207658_10016628 | Ga0207658_100166286 | 184 |
| 394 | 3300026041 | Ga0207639_10039304 | Ga0207639_100393043 | 184 |
| 395 | 3300026078 | Ga0207702_10001080 | Ga0207702_1000108015 | 184 |
| 396 | 3300026078 | Ga0207702_10414983 | Ga0207702_104149832 | 184 |
| 397 | 3300026116 | Ga0207674_10000112 | Ga0207674_1000011242 | 184 |
| 398 | 3300026142 | Ga0207698_10007028 | Ga0207698_100070284 | 184 |
| 399 | 3300028556 | Ga0265337_1077861 | Ga0265337_10778611 | 184 |
| 400 | 3300028800 | Ga0265338_10025211 | Ga0265338_100252118 | 184 |
| 401 | 3300028800 | Ga0265338_10373225 | Ga0265338_103732252 | 184 |
| 402 | 3300031238 | Ga0265332_10086948 | Ga0265332_100869482 | 184 |
| 403 | 3300031238 | Ga0265332_10118928 | Ga0265332_101189281 | 184 |
| 404 | 3300031241 | Ga0265325_10000094 | Ga0265325_1000009458 | 184 |
| 405 | 3300031249 | Ga0265339_10007160 | Ga0265339_100071609 | 184 |
| 406 | 3300031249 | Ga0265339_10025613 | Ga0265339_100256134 | 184 |
| 407 | 3300031344 | Ga0265316_10020381 | Ga0265316_100203812 | 184 |
| 408 | 3300031711 | Ga0265314_10057403 | Ga0265314_100574032 | 184 |
| 409 | 3300031711 | Ga0265314_10105286 | Ga0265314_101052862 | 184 |
| 410 | 3300031712 | Ga0265342_10042692 | Ga0265342_100426922 | 184 |
| 411 | 3300035112 | Ga0373932_0021687 | Ga0373932_0021687_287_844 | 184 |
| 412 | 3300035118 | Ga0373954_0208443 | Ga0373954_0208443_197_799 | 184 |
| 413 | 3300035691 | Ga0373931_0010215 | Ga0373931_0010215_2685_3242 | 184 |
| 414 | 3300035695 | Ga0373927_0090159 | Ga0373927_0090159_1231_1833 | 184 |
| 415 | 3300035724 | Ga0373933_0017974 | Ga0373933_0017974_510_1112 | 184 |
| 416 | 3300037068 | Ga0373925_0136744 | Ga0373925_0136744_631_1233 | 184 |
| 417 | 3300039437 | Ga0436365_0703435 | Ga0436365_0703435_2841_3398 | 184 |
| 418 | 3300039453 | Ga0436362_1131996 | Ga0436362_1131996_509_1063 | 184 |
| 419 | 3300045051 | Ga0451576_0614764 | Ga0451576_0614764_435_992 | 184 |
| 420 | 3300048929 | Ga0496126_0000653 | Ga0496126_0000653_41301_41858 | 184 |
| 421 | 3300049589 | Ga0501073_0663568 | Ga0501073_0663568_90_692 | 184 |
| 422 | 3300050512 | nmdc:mga0n895_185387_c1 | nmdc:mga0n895_185387_c1_14_571 | 184 |
| 423 | 3300050513 | nmdc:mga0rr50_433606_c1 | nmdc:mga0rr50_433606_c1_515_1072 | 184 |
| 424 | 3300050514 | nmdc:mga08x19_26279_c1 | nmdc:mga08x19_26279_c1_1780_2337 | 184 |
| 425 | 3300003215 | JGI25153J46596_10001002 | JGI25153J46596_1000100221 | 185 |
| 426 | 3300005327 | Ga0070658_10065932 | Ga0070658_100659322 | 185 |
| 427 | 3300005327 | Ga0070658_10392359 | Ga0070658_103923592 | 185 |
| 428 | 3300005329 | Ga0070683_100538067 | Ga0070683_1005380671 | 185 |
| 429 | 3300005339 | Ga0070660_100048071 | Ga0070660_1000480712 | 185 |
| 430 | 3300005339 | Ga0070660_100245190 | Ga0070660_1002451902 | 185 |
| 431 | 3300005339 | Ga0070660_100294341 | Ga0070660_1002943412 | 185 |
| 432 | 3300005341 | Ga0070691_10005590 | Ga0070691_100055906 | 185 |
| 433 | 3300005341 | Ga0070691_10208519 | Ga0070691_102085192 | 185 |
| 434 | 3300005344 | Ga0070661_100263221 | Ga0070661_1002632211 | 185 |
| 435 | 3300005344 | Ga0070661_100855708 | Ga0070661_1008557081 | 185 |
| 436 | 3300005366 | Ga0070659_100072331 | Ga0070659_1000723315 | 185 |
| 437 | 3300005435 | Ga0070714_100102534 | Ga0070714_1001025344 | 185 |
| 438 | 3300005435 | Ga0070714_100783559 | Ga0070714_1007835592 | 185 |
| 439 | 3300005437 | Ga0070710_10127880 | Ga0070710_101278802 | 185 |
| 440 | 3300005440 | Ga0070705_100064547 | Ga0070705_1000645472 | 185 |
| 441 | 3300005455 | Ga0070663_100077387 | Ga0070663_1000773872 | 185 |
| 442 | 3300005471 | Ga0070698_100937610 | Ga0070698_1009376101 | 185 |
| 443 | 3300005530 | Ga0070679_100057246 | Ga0070679_1000572466 | 185 |
| 444 | 3300005530 | Ga0070679_100195179 | Ga0070679_1001951792 | 185 |
| 445 | 3300005536 | Ga0070697_100041945 | Ga0070697_1000419452 | 185 |
| 446 | 3300005539 | Ga0068853_100177958 | Ga0068853_1001779583 | 185 |
| 447 | 3300005539 | Ga0068853_100258552 | Ga0068853_1002585523 | 185 |
| 448 | 3300005546 | Ga0070696_100110164 | Ga0070696_1001101642 | 185 |
| 449 | 3300005548 | Ga0070665_100043299 | Ga0070665_1000432992 | 185 |
| 450 | 3300005548 | Ga0070665_100492091 | Ga0070665_1004920912 | 185 |
| 451 | 3300005548 | Ga0070665_101045588 | Ga0070665_1010455881 | 185 |
| 452 | 3300005563 | Ga0068855_100000106 | Ga0068855_100000106101 | 185 |
| 453 | 3300005563 | Ga0068855_100014142 | Ga0068855_10001414211 | 185 |
| 454 | 3300005563 | Ga0068855_100055070 | Ga0068855_1000550706 | 185 |
| 455 | 3300005563 | Ga0068855_100077683 | Ga0068855_1000776833 | 185 |
| 456 | 3300005563 | Ga0068855_100138942 | Ga0068855_1001389422 | 185 |
| 457 | 3300005563 | Ga0068855_100483284 | Ga0068855_1004832842 | 185 |
| 458 | 3300005563 | Ga0068855_100528692 | Ga0068855_1005286922 | 185 |
| 459 | 3300005577 | Ga0068857_100088072 | Ga0068857_1000880722 | 185 |
| 460 | 3300005577 | Ga0068857_100584454 | Ga0068857_1005844541 | 185 |
| 461 | 3300005614 | Ga0068856_100210874 | Ga0068856_1002108744 | 185 |
| 462 | 3300005614 | Ga0068856_100258190 | Ga0068856_1002581902 | 185 |
| 463 | 3300005616 | Ga0068852_101474884 | Ga0068852_1014748841 | 185 |
| 464 | 3300005981 | Ga0081538_10000555 | Ga0081538_100005559 | 185 |
| 465 | 3300005983 | Ga0081540_1000085 | Ga0081540_100008593 | 185 |
| 466 | 3300005983 | Ga0081540_1012270 | Ga0081540_10122704 | 185 |
| 467 | 3300006028 | Ga0070717_10602427 | Ga0070717_106024272 | 185 |
| 468 | 3300006051 | Ga0075364_10257245 | Ga0075364_102572452 | 185 |
| 469 | 3300006178 | Ga0075367_10358281 | Ga0075367_103582811 | 185 |
| 470 | 3300006846 | Ga0075430_100094425 | Ga0075430_1000944251 | 185 |
| 471 | 3300006852 | Ga0075433_10204790 | Ga0075433_102047902 | 185 |
| 472 | 3300006871 | Ga0075434_100194094 | Ga0075434_1001940942 | 185 |
| 473 | 3300006881 | Ga0068865_100293988 | Ga0068865_1002939882 | 185 |
| 474 | 3300006914 | Ga0075436_100015996 | Ga0075436_1000159967 | 185 |
| 475 | 3300007076 | Ga0075435_100030692 | Ga0075435_1000306923 | 185 |
| 476 | 3300007076 | Ga0075435_100455725 | Ga0075435_1004557252 | 185 |
| 477 | 3300007265 | Ga0099794_10479520 | Ga0099794_104795201 | 185 |
| 478 | 3300009036 | Ga0105244_10149710 | Ga0105244_101497102 | 185 |
| 479 | 3300009093 | Ga0105240_10000055 | Ga0105240_1000005545 | 185 |
| 480 | 3300009098 | Ga0105245_11251745 | Ga0105245_112517451 | 185 |
| 481 | 3300009101 | Ga0105247_10016288 | Ga0105247_100162886 | 185 |
| 482 | 3300009147 | Ga0114129_10203225 | Ga0114129_102032253 | 185 |
| 483 | 3300009174 | Ga0105241_10301851 | Ga0105241_103018513 | 185 |
| 484 | 3300009176 | Ga0105242_10495986 | Ga0105242_104959862 | 185 |
| 485 | 3300009551 | Ga0105238_10059046 | Ga0105238_100590465 | 185 |
| 486 | 3300010375 | Ga0105239_10004084 | Ga0105239_100040849 | 185 |
| 487 | 3300013100 | Ga0157373_10166258 | Ga0157373_101662582 | 185 |
| 488 | 3300013104 | Ga0157370_10004453 | Ga0157370_1000445313 | 185 |
| 489 | 3300013104 | Ga0157370_10123082 | Ga0157370_101230822 | 185 |
| 490 | 3300013250 | Ga0171462_1012 | Ga0171462_1012191 | 185 |
| 491 | 3300013307 | Ga0157372_10001838 | Ga0157372_100018387 | 185 |
| 492 | 3300013307 | Ga0157372_10021266 | Ga0157372_100212664 | 185 |
| 493 | 3300013307 | Ga0157372_10153838 | Ga0157372_101538383 | 185 |
| 494 | 3300013307 | Ga0157372_10172222 | Ga0157372_101722223 | 185 |
| 495 | 3300014325 | Ga0163163_10440936 | Ga0163163_104409361 | 185 |
| 496 | 3300014326 | Ga0157380_10646276 | Ga0157380_106462761 | 185 |
| 497 | 3300017792 | Ga0163161_10572422 | Ga0163161_105724221 | 185 |
| 498 | 3300021377 | Ga0213874_10142791 | Ga0213874_101427912 | 185 |
| 499 | 3300021384 | Ga0213876_10000537 | Ga0213876_1000053727 | 185 |
| 500 | 3300021384 | Ga0213876_10020516 | Ga0213876_100205164 | 185 |
| 501 | 3300021384 | Ga0213876_10208064 | Ga0213876_102080641 | 185 |
| 502 | 3300025261 | Ga0209233_1010276 | Ga0209233_10102764 | 185 |
| 503 | 3300025272 | Ga0209455_1020699 | Ga0209455_10206992 | 185 |
| 504 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008236 | 185 |
| 505 | 3300025297 | Ga0209758_1084564 | Ga0209758_10845641 | 185 |
| 506 | 3300025898 | Ga0207692_10096178 | Ga0207692_100961782 | 185 |
| 507 | 3300025900 | Ga0207710_10131905 | Ga0207710_101319052 | 185 |
| 508 | 3300025904 | Ga0207647_10460503 | Ga0207647_104605031 | 185 |
| 509 | 3300025909 | Ga0207705_10000058 | Ga0207705_10000058135 | 185 |
| 510 | 3300025909 | Ga0207705_10004973 | Ga0207705_100049734 | 185 |
| 511 | 3300025912 | Ga0207707_10100605 | Ga0207707_101006052 | 185 |
| 512 | 3300025912 | Ga0207707_10601225 | Ga0207707_106012251 | 185 |
| 513 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012291 | 185 |
| 514 | 3300025913 | Ga0207695_10003622 | Ga0207695_100036226 | 185 |
| 515 | 3300025913 | Ga0207695_10009386 | Ga0207695_100093863 | 185 |
| 516 | 3300025913 | Ga0207695_10022595 | Ga0207695_100225958 | 185 |
| 517 | 3300025914 | Ga0207671_10041489 | Ga0207671_100414894 | 185 |
| 518 | 3300025914 | Ga0207671_10054219 | Ga0207671_100542191 | 185 |
| 519 | 3300025914 | Ga0207671_10103585 | Ga0207671_101035852 | 185 |
| 520 | 3300025914 | Ga0207671_10904575 | Ga0207671_109045751 | 185 |
| 521 | 3300025917 | Ga0207660_10003913 | Ga0207660_100039133 | 185 |
| 522 | 3300025917 | Ga0207660_10111876 | Ga0207660_101118762 | 185 |
| 523 | 3300025917 | Ga0207660_10556548 | Ga0207660_105565482 | 185 |
| 524 | 3300025919 | Ga0207657_10001163 | Ga0207657_1000116311 | 185 |
| 525 | 3300025919 | Ga0207657_10076217 | Ga0207657_100762173 | 185 |
| 526 | 3300025919 | Ga0207657_10209736 | Ga0207657_102097362 | 185 |
| 527 | 3300025921 | Ga0207652_10017999 | Ga0207652_100179997 | 185 |
| 528 | 3300025921 | Ga0207652_10223206 | Ga0207652_102232061 | 185 |
| 529 | 3300025924 | Ga0207694_10000006 | Ga0207694_10000006373 | 185 |
| 530 | 3300025924 | Ga0207694_10048560 | Ga0207694_100485605 | 185 |
| 531 | 3300025924 | Ga0207694_10071716 | Ga0207694_100717164 | 185 |
| 532 | 3300025924 | Ga0207694_10095479 | Ga0207694_100954793 | 185 |
| 533 | 3300025928 | Ga0207700_10297353 | Ga0207700_102973532 | 185 |
| 534 | 3300025929 | Ga0207664_10016200 | Ga0207664_100162008 | 185 |
| 535 | 3300025929 | Ga0207664_10245800 | Ga0207664_102458003 | 185 |
| 536 | 3300025929 | Ga0207664_10433441 | Ga0207664_104334412 | 185 |
| 537 | 3300025932 | Ga0207690_10012687 | Ga0207690_1001268710 | 185 |
| 538 | 3300025932 | Ga0207690_10974988 | Ga0207690_109749881 | 185 |
| 539 | 3300025938 | Ga0207704_10176381 | Ga0207704_101763812 | 185 |
| 540 | 3300025940 | Ga0207691_10450005 | Ga0207691_104500052 | 185 |
| 541 | 3300025941 | Ga0207711_10274730 | Ga0207711_102747302 | 185 |
| 542 | 3300025941 | Ga0207711_10991979 | Ga0207711_109919791 | 185 |
| 543 | 3300025949 | Ga0207667_10000026 | Ga0207667_1000002674 | 185 |
| 544 | 3300025949 | Ga0207667_10002838 | Ga0207667_1000283812 | 185 |
| 545 | 3300025949 | Ga0207667_10158337 | Ga0207667_101583372 | 185 |
| 546 | 3300025981 | Ga0207640_10821368 | Ga0207640_108213681 | 185 |
| 547 | 3300025981 | Ga0207640_11213628 | Ga0207640_112136281 | 185 |
| 548 | 3300026041 | Ga0207639_10231800 | Ga0207639_102318002 | 185 |
| 549 | 3300026067 | Ga0207678_10038547 | Ga0207678_100385474 | 185 |
| 550 | 3300026078 | Ga0207702_10378154 | Ga0207702_103781542 | 185 |
| 551 | 3300026078 | Ga0207702_11279586 | Ga0207702_112795861 | 185 |
| 552 | 3300026116 | Ga0207674_10087310 | Ga0207674_100873103 | 185 |
| 553 | 3300026116 | Ga0207674_10141586 | Ga0207674_101415862 | 185 |
| 554 | 3300026142 | Ga0207698_10173140 | Ga0207698_101731401 | 185 |
| 555 | 3300026142 | Ga0207698_11146899 | Ga0207698_111468991 | 185 |
| 556 | 3300028379 | Ga0268266_10156033 | Ga0268266_101560332 | 185 |
| 557 | 3300028380 | Ga0268265_10512437 | Ga0268265_105124372 | 185 |
| 558 | 3300028573 | Ga0265334_10008085 | Ga0265334_100080852 | 185 |
| 559 | 3300028577 | Ga0265318_10000444 | Ga0265318_1000044428 | 185 |
| 560 | 3300028577 | Ga0265318_10003610 | Ga0265318_100036101 | 185 |
| 561 | 3300028800 | Ga0265338_10000011 | Ga0265338_10000011230 | 185 |
| 562 | 3300028800 | Ga0265338_10072660 | Ga0265338_100726602 | 185 |
| 563 | 3300028800 | Ga0265338_10128693 | Ga0265338_101286932 | 185 |
| 564 | 3300031235 | Ga0265330_10011184 | Ga0265330_100111843 | 185 |
| 565 | 3300031235 | Ga0265330_10030973 | Ga0265330_100309733 | 185 |
| 566 | 3300031238 | Ga0265332_10006040 | Ga0265332_100060406 | 185 |
| 567 | 3300031238 | Ga0265332_10017334 | Ga0265332_100173342 | 185 |
| 568 | 3300031238 | Ga0265332_10045050 | Ga0265332_100450502 | 185 |
| 569 | 3300031239 | Ga0265328_10026476 | Ga0265328_100264763 | 185 |
| 570 | 3300031240 | Ga0265320_10015770 | Ga0265320_100157705 | 185 |
| 571 | 3300031241 | Ga0265325_10000009 | Ga0265325_10000009109 | 185 |
| 572 | 3300031241 | Ga0265325_10001690 | Ga0265325_1000169015 | 185 |
| 573 | 3300031241 | Ga0265325_10033081 | Ga0265325_100330813 | 185 |
| 574 | 3300031241 | Ga0265325_10041342 | Ga0265325_100413423 | 185 |
| 575 | 3300031241 | Ga0265325_10061936 | Ga0265325_100619364 | 185 |
| 576 | 3300031241 | Ga0265325_10092700 | Ga0265325_100927001 | 185 |
| 577 | 3300031242 | Ga0265329_10016573 | Ga0265329_100165732 | 185 |
| 578 | 3300031247 | Ga0265340_10000159 | Ga0265340_1000015910 | 185 |
| 579 | 3300031247 | Ga0265340_10000562 | Ga0265340_100005627 | 185 |
| 580 | 3300031247 | Ga0265340_10007094 | Ga0265340_100070945 | 185 |
| 581 | 3300031247 | Ga0265340_10029135 | Ga0265340_100291353 | 185 |
| 582 | 3300031247 | Ga0265340_10034288 | Ga0265340_100342884 | 185 |
| 583 | 3300031247 | Ga0265340_10123891 | Ga0265340_101238912 | 185 |
| 584 | 3300031249 | Ga0265339_10000320 | Ga0265339_1000032047 | 185 |
| 585 | 3300031249 | Ga0265339_10029739 | Ga0265339_100297394 | 185 |
| 586 | 3300031249 | Ga0265339_10048309 | Ga0265339_100483094 | 185 |
| 587 | 3300031249 | Ga0265339_10072044 | Ga0265339_100720442 | 185 |
| 588 | 3300031249 | Ga0265339_10155506 | Ga0265339_101555062 | 185 |
| 589 | 3300031250 | Ga0265331_10045617 | Ga0265331_100456171 | 185 |
| 590 | 3300031250 | Ga0265331_10066308 | Ga0265331_100663083 | 185 |
| 591 | 3300031344 | Ga0265316_10063310 | Ga0265316_100633102 | 185 |
| 592 | 3300031344 | Ga0265316_10106193 | Ga0265316_101061932 | 185 |
| 593 | 3300031344 | Ga0265316_10126519 | Ga0265316_101265192 | 185 |
| 594 | 3300031595 | Ga0265313_10000176 | Ga0265313_1000017642 | 185 |
| 595 | 3300031595 | Ga0265313_10002778 | Ga0265313_1000277813 | 185 |
| 596 | 3300031595 | Ga0265313_10016249 | Ga0265313_100162492 | 185 |
| 597 | 3300031595 | Ga0265313_10028797 | Ga0265313_100287973 | 185 |
| 598 | 3300031616 | Ga0307508_10436681 | Ga0307508_104366811 | 185 |
| 599 | 3300031711 | Ga0265314_10022487 | Ga0265314_100224875 | 185 |
| 600 | 3300031711 | Ga0265314_10085255 | Ga0265314_100852554 | 185 |
| 601 | 3300031711 | Ga0265314_10225858 | Ga0265314_102258582 | 185 |
| 602 | 3300031711 | Ga0265314_10304631 | Ga0265314_103046312 | 185 |
| 603 | 3300031712 | Ga0265342_10016987 | Ga0265342_100169872 | 185 |
| 604 | 3300031712 | Ga0265342_10025710 | Ga0265342_100257104 | 185 |
| 605 | 3300031712 | Ga0265342_10038212 | Ga0265342_100382122 | 185 |
| 606 | 3300031712 | Ga0265342_10062969 | Ga0265342_100629691 | 185 |
| 607 | 3300031712 | Ga0265342_10199850 | Ga0265342_101998502 | 185 |
| 608 | 3300031730 | Ga0307516_10112004 | Ga0307516_101120043 | 185 |
| 609 | 3300031852 | Ga0307410_10343984 | Ga0307410_103439841 | 185 |
| 610 | 3300031995 | Ga0307409_100483777 | Ga0307409_1004837771 | 185 |
| 611 | 3300035089 | Ga0373944_0023315 | Ga0373944_0023315_561_1121 | 185 |
| 612 | 3300035113 | Ga0373936_0049106 | Ga0373936_0049106_499_1059 | 185 |
| 613 | 3300035115 | Ga0373941_0071756 | Ga0373941_0071756_25_585 | 185 |
| 614 | 3300035116 | Ga0373945_0136157 | Ga0373945_0136157_345_905 | 185 |
| 615 | 3300035117 | Ga0373953_0151197 | Ga0373953_0151197_85_642 | 185 |
| 616 | 3300035118 | Ga0373954_0154300 | Ga0373954_0154300_357_914 | 185 |
| 617 | 3300035119 | Ga0373956_0078062 | Ga0373956_0078062_674_1231 | 185 |
| 618 | 3300035119 | Ga0373956_0186587 | Ga0373956_0186587_341_898 | 185 |
| 619 | 3300035120 | Ga0373957_0047902 | Ga0373957_0047902_988_1545 | 185 |
| 620 | 3300035170 | Ga0373943_0002306 | Ga0373943_0002306_3770_4330 | 185 |
| 621 | 3300035172 | Ga0373955_0016037 | Ga0373955_0016037_547_1104 | 185 |
| 622 | 3300035242 | Ga0373962_0049178 | Ga0373962_0049178_263_823 | 185 |
| 623 | 3300035695 | Ga0373927_0137697 | Ga0373927_0137697_422_982 | 185 |
| 624 | 3300035695 | Ga0373927_0761336 | Ga0373927_0761336_54_611 | 185 |
| 625 | 3300035724 | Ga0373933_0030381 | Ga0373933_0030381_1184_1741 | 185 |
| 626 | 3300035724 | Ga0373933_0331724 | Ga0373933_0331724_10_567 | 185 |
| 627 | 3300035725 | Ga0373947_0005370 | Ga0373947_0005370_4767_5327 | 185 |
| 628 | 3300035725 | Ga0373947_0082089 | Ga0373947_0082089_1316_1876 | 185 |
| 629 | 3300036401 | Ga0373937_0048874 | Ga0373937_0048874_2227_2784 | 185 |
| 630 | 3300036401 | Ga0373937_0066672 | Ga0373937_0066672_988_1545 | 185 |
| 631 | 3300036401 | Ga0373937_0424626 | Ga0373937_0424626_382_942 | 185 |
| 632 | 3300037068 | Ga0373925_0012671 | Ga0373925_0012671_3577_4137 | 185 |
| 633 | 3300037312 | Ga0395899_0269714 | Ga0395899_0269714_188_748 | 185 |
| 634 | 3300037418 | Ga0395900_0323529 | Ga0395900_0323529_360_920 | 185 |
| 635 | 3300037466 | Ga0395898_0230496 | Ga0395898_0230496_611_1171 | 185 |
| 636 | 3300039437 | Ga0436365_0257402 | Ga0436365_0257402_125995_126555 | 185 |
| 637 | 3300039437 | Ga0436365_1581781 | Ga0436365_1581781_241_798 | 185 |
| 638 | 3300039437 | Ga0436365_1740837 | Ga0436365_1740837_273_833 | 185 |
| 639 | 3300039450 | Ga0436363_1097369 | Ga0436363_1097369_20_577 | 185 |
| 640 | 3300039450 | Ga0436363_1599936 | Ga0436363_1599936_102_662 | 185 |
| 641 | 3300042147 | Ga0450910_060756 | Ga0450910_060756_14_571 | 185 |
| 642 | 3300042184 | Ga0450908_033908 | Ga0450908_033908_228_785 | 185 |
| 643 | 3300044694 | Ga0466963_0596339 | Ga0466963_0596339_134_691 | 185 |
| 644 | 3300046459 | Ga0495629_0054668 | Ga0495629_0054668_2207_2767 | 185 |
| 645 | 3300046462 | Ga0495651_0099841 | Ga0495651_0099841_1493_2050 | 185 |
| 646 | 3300046462 | Ga0495651_0519508 | Ga0495651_0519508_152_709 | 185 |
| 647 | 3300046463 | Ga0495653_0137762 | Ga0495653_0137762_302_859 | 185 |
| 648 | 3300046472 | Ga0495580_0056424 | Ga0495580_0056424_374_934 | 185 |
| 649 | 3300046477 | Ga0495664_0048077 | Ga0495664_0048077_667_1227 | 185 |
| 650 | 3300046524 | Ga0495648_0225185 | Ga0495648_0225185_89_646 | 185 |
| 651 | 3300046529 | Ga0495652_0062800 | Ga0495652_0062800_2355_2915 | 185 |
| 652 | 3300046529 | Ga0495652_0160489 | Ga0495652_0160489_756_1316 | 185 |
| 653 | 3300046543 | Ga0495645_0006290 | Ga0495645_0006290_2144_2704 | 185 |
| 654 | 3300046559 | Ga0495667_0146213 | Ga0495667_0146213_115_672 | 185 |
| 655 | 3300046678 | Ga0495599_0156034 | Ga0495599_0156034_346_906 | 185 |
| 656 | 3300046683 | Ga0495658_0001623 | Ga0495658_0001623_7341_7901 | 185 |
| 657 | 3300046691 | Ga0495670_0100510 | Ga0495670_0100510_141_698 | 185 |
| 658 | 3300046809 | Ga0495600_0044792 | Ga0495600_0044792_1120_1677 | 185 |
| 659 | 3300047315 | Ga0495581_0198013 | Ga0495581_0198013_337_897 | 185 |
| 660 | 3300047444 | Ga0495675_0063178 | Ga0495675_0063178_1420_1980 | 185 |
| 661 | 3300047444 | Ga0495675_0171663 | Ga0495675_0171663_520_1077 | 185 |
| 662 | 3300047471 | Ga0495684_0277025 | Ga0495684_0277025_517_1077 | 185 |
| 663 | 3300048088 | Ga0495602_0105949 | Ga0495602_0105949_1646_2203 | 185 |
| 664 | 3300048903 | Ga0496100_0137655 | Ga0496100_0137655_627_1184 | 185 |
| 665 | 3300048904 | Ga0496101_0062638 | Ga0496101_0062638_634_1191 | 185 |
| 666 | 3300048905 | Ga0496102_0036294 | Ga0496102_0036294_337_894 | 185 |
| 667 | 3300048908 | Ga0496105_0201827 | Ga0496105_0201827_1037_1594 | 185 |
| 668 | 3300048910 | Ga0496107_0106538 | Ga0496107_0106538_741_1301 | 185 |
| 669 | 3300048912 | Ga0496109_0072059 | Ga0496109_0072059_1198_1755 | 185 |
| 670 | 3300048916 | Ga0496113_0307785 | Ga0496113_0307785_409_966 | 185 |
| 671 | 3300048920 | Ga0496117_0106859 | Ga0496117_0106859_311_868 | 185 |
| 672 | 3300048925 | Ga0496122_0233827 | Ga0496122_0233827_91_648 | 185 |
| 673 | 3300048926 | Ga0496123_0018805 | Ga0496123_0018805_2238_2795 | 185 |
| 674 | 3300048926 | Ga0496123_0026687 | Ga0496123_0026687_2443_3000 | 185 |
| 675 | 3300048929 | Ga0496126_0047387 | Ga0496126_0047387_2810_3367 | 185 |
| 676 | 3300048929 | Ga0496126_0295692 | Ga0496126_0295692_75_635 | 185 |
| 677 | 3300049460 | Ga0495682_0005324 | Ga0495682_0005324_151_711 | 185 |
| 678 | 3300049568 | Ga0501031_0161199 | Ga0501031_0161199_77_637 | 185 |
| 679 | 3300049568 | Ga0501031_0255051 | Ga0501031_0255051_544_1110 | 185 |
| 680 | 3300049569 | Ga0501032_0022010 | Ga0501032_0022010_3730_4302 | 185 |
| 681 | 3300049570 | Ga0501033_0002118 | Ga0501033_0002118_1064_1630 | 185 |
| 682 | 3300049570 | Ga0501033_0003652 | Ga0501033_0003652_4861_5421 | 185 |
| 683 | 3300049570 | Ga0501033_0005897 | Ga0501033_0005897_7201_7773 | 185 |
| 684 | 3300049570 | Ga0501033_0096022 | Ga0501033_0096022_522_1082 | 185 |
| 685 | 3300049570 | Ga0501033_0118761 | Ga0501033_0118761_860_1420 | 185 |
| 686 | 3300049570 | Ga0501033_0155031 | Ga0501033_0155031_213_779 | 185 |
| 687 | 3300049570 | Ga0501033_0194356 | Ga0501033_0194356_859_1419 | 185 |
| 688 | 3300049571 | Ga0501034_0000319 | Ga0501034_0000319_60263_60820 | 185 |
| 689 | 3300049571 | Ga0501034_0012726 | Ga0501034_0012726_7740_8312 | 185 |
| 690 | 3300049571 | Ga0501034_0070593 | Ga0501034_0070593_689_1249 | 185 |
| 691 | 3300049571 | Ga0501034_0095123 | Ga0501034_0095123_1983_2543 | 185 |
| 692 | 3300049571 | Ga0501034_1054309 | Ga0501034_1054309_88_648 | 185 |
| 693 | 3300049572 | Ga0501036_0003952 | Ga0501036_0003952_4452_5024 | 185 |
| 694 | 3300049572 | Ga0501036_0077192 | Ga0501036_0077192_1839_2396 | 185 |
| 695 | 3300049572 | Ga0501036_0312155 | Ga0501036_0312155_726_1298 | 185 |
| 696 | 3300049572 | Ga0501036_0645948 | Ga0501036_0645948_226_783 | 185 |
| 697 | 3300049573 | Ga0501037_0025665 | Ga0501037_0025665_697_1263 | 185 |
| 698 | 3300049573 | Ga0501037_0043927 | Ga0501037_0043927_2567_3124 | 185 |
| 699 | 3300049573 | Ga0501037_0110501 | Ga0501037_0110501_685_1257 | 185 |
| 700 | 3300049573 | Ga0501037_0305365 | Ga0501037_0305365_103_681 | 185 |
| 701 | 3300049574 | Ga0501038_0039495 | Ga0501038_0039495_36_596 | 185 |
| 702 | 3300049574 | Ga0501038_0328366 | Ga0501038_0328366_247_807 | 185 |
| 703 | 3300049575 | Ga0501039_0269245 | Ga0501039_0269245_13_573 | 185 |
| 704 | 3300049577 | Ga0501041_0251540 | Ga0501041_0251540_482_1039 | 185 |
| 705 | 3300049578 | Ga0501042_0165313 | Ga0501042_0165313_365_937 | 185 |
| 706 | 3300049578 | Ga0501042_0330442 | Ga0501042_0330442_314_874 | 185 |
| 707 | 3300049579 | Ga0501043_0008747 | Ga0501043_0008747_365_937 | 185 |
| 708 | 3300049579 | Ga0501043_0017115 | Ga0501043_0017115_3451_4023 | 185 |
| 709 | 3300049579 | Ga0501043_0022990 | Ga0501043_0022990_264_824 | 185 |
| 710 | 3300049579 | Ga0501043_0407220 | Ga0501043_0407220_125_682 | 185 |
| 711 | 3300049580 | Ga0501046_0000636 | Ga0501046_0000636_14154_14726 | 185 |
| 712 | 3300049581 | Ga0501047_0010064 | Ga0501047_0010064_6678_7244 | 185 |
| 713 | 3300049581 | Ga0501047_0019694 | Ga0501047_0019694_5227_5787 | 185 |
| 714 | 3300049581 | Ga0501047_0039859 | Ga0501047_0039859_3403_3975 | 185 |
| 715 | 3300049581 | Ga0501047_0098845 | Ga0501047_0098845_1428_1985 | 185 |
| 716 | 3300049581 | Ga0501047_0128466 | Ga0501047_0128466_1743_2303 | 185 |
| 717 | 3300049581 | Ga0501047_0367130 | Ga0501047_0367130_19_579 | 185 |
| 718 | 3300049582 | Ga0501048_0164427 | Ga0501048_0164427_572_1144 | 185 |
| 719 | 3300049582 | Ga0501048_0204992 | Ga0501048_0204992_815_1375 | 185 |
| 720 | 3300049583 | Ga0501067_0005701 | Ga0501067_0005701_5563_6123 | 185 |
| 721 | 3300049583 | Ga0501067_0023416 | Ga0501067_0023416_2435_3007 | 185 |
| 722 | 3300049585 | Ga0501069_0005748 | Ga0501069_0005748_1842_2402 | 185 |
| 723 | 3300049585 | Ga0501069_0012922 | Ga0501069_0012922_3401_3973 | 185 |
| 724 | 3300049585 | Ga0501069_0030096 | Ga0501069_0030096_2093_2653 | 185 |
| 725 | 3300049586 | Ga0501070_0000111 | Ga0501070_0000111_5573_6133 | 185 |
| 726 | 3300049586 | Ga0501070_0004624 | Ga0501070_0004624_734_1306 | 185 |
| 727 | 3300049586 | Ga0501070_0012304 | Ga0501070_0012304_1033_1593 | 185 |
| 728 | 3300049586 | Ga0501070_0074206 | Ga0501070_0074206_1578_2138 | 185 |
| 729 | 3300049586 | Ga0501070_0219503 | Ga0501070_0219503_235_795 | 185 |
| 730 | 3300049586 | Ga0501070_0311032 | Ga0501070_0311032_681_1238 | 185 |
| 731 | 3300049586 | Ga0501070_0781915 | Ga0501070_0781915_16_576 | 185 |
| 732 | 3300049588 | Ga0501072_0062563 | Ga0501072_0062563_249_806 | 185 |
| 733 | 3300049589 | Ga0501073_0009478 | Ga0501073_0009478_706_1278 | 185 |
| 734 | 3300049589 | Ga0501073_0016585 | Ga0501073_0016585_1338_1910 | 185 |
| 735 | 3300049589 | Ga0501073_0069206 | Ga0501073_0069206_1135_1695 | 185 |
| 736 | 3300049589 | Ga0501073_0099611 | Ga0501073_0099611_151_711 | 185 |
| 737 | 3300049589 | Ga0501073_0134155 | Ga0501073_0134155_266_838 | 185 |
| 738 | 3300049590 | Ga0501074_0008490 | Ga0501074_0008490_6850_7422 | 185 |
| 739 | 3300049590 | Ga0501074_0089575 | Ga0501074_0089575_1329_1889 | 185 |
| 740 | 3300049590 | Ga0501074_0091464 | Ga0501074_0091464_1225_1782 | 185 |
| 741 | 3300049590 | Ga0501074_0916200 | Ga0501074_0916200_13_585 | 185 |
| 742 | 3300049591 | Ga0501075_0120714 | Ga0501075_0120714_1356_1913 | 185 |
| 743 | 3300049741 | Ga0501079_0043670 | Ga0501079_0043670_1314_1874 | 185 |
| 744 | 3300049742 | Ga0501080_0018192 | Ga0501080_0018192_2473_3033 | 185 |
| 745 | 3300049742 | Ga0501080_0036380 | Ga0501080_0036380_3252_3824 | 185 |
| 746 | 3300049742 | Ga0501080_0108289 | Ga0501080_0108289_1166_1726 | 185 |
| 747 | 3300049742 | Ga0501080_0110137 | Ga0501080_0110137_1780_2352 | 185 |
| 748 | 3300049742 | Ga0501080_0898142 | Ga0501080_0898142_133_693 | 185 |
| 749 | 3300049744 | Ga0501083_0211772 | Ga0501083_0211772_335_895 | 185 |
| 750 | 3300049822 | Ga0501035_0002206 | Ga0501035_0002206_9097_9657 | 185 |
| 751 | 3300049822 | Ga0501035_0002523 | Ga0501035_0002523_15659_16225 | 185 |
| 752 | 3300049822 | Ga0501035_0005014 | Ga0501035_0005014_5480_6040 | 185 |
| 753 | 3300049822 | Ga0501035_0021716 | Ga0501035_0021716_4739_5311 | 185 |
| 754 | 3300049822 | Ga0501035_0042448 | Ga0501035_0042448_62_622 | 185 |
| 755 | 3300049822 | Ga0501035_0049511 | Ga0501035_0049511_2203_2763 | 185 |
| 756 | 3300049822 | Ga0501035_0062337 | Ga0501035_0062337_1117_1689 | 185 |
| 757 | 3300049822 | Ga0501035_0085641 | Ga0501035_0085641_860_1417 | 185 |
| 758 | 3300049823 | Ga0501044_0003903 | Ga0501044_0003903_2975_3535 | 185 |
| 759 | 3300049823 | Ga0501044_0006571 | Ga0501044_0006571_5638_6198 | 185 |
| 760 | 3300049823 | Ga0501044_0007608 | Ga0501044_0007608_157_723 | 185 |
| 761 | 3300049823 | Ga0501044_0010260 | Ga0501044_0010260_7996_8568 | 185 |
| 762 | 3300049823 | Ga0501044_0015004 | Ga0501044_0015004_4645_5217 | 185 |
| 763 | 3300049823 | Ga0501044_0037484 | Ga0501044_0037484_2913_3473 | 185 |
| 764 | 3300049823 | Ga0501044_0039733 | Ga0501044_0039733_4296_4856 | 185 |
| 765 | 3300049823 | Ga0501044_0066380 | Ga0501044_0066380_1860_2420 | 185 |
| 766 | 3300049823 | Ga0501044_0196394 | Ga0501044_0196394_422_979 | 185 |
| 767 | 3300049823 | Ga0501044_0218307 | Ga0501044_0218307_904_1461 | 185 |
| 768 | 3300049823 | Ga0501044_0334316 | Ga0501044_0334316_33_593 | 185 |
| 769 | 3300049823 | Ga0501044_0360028 | Ga0501044_0360028_783_1355 | 185 |
| 770 | 3300049823 | Ga0501044_0476958 | Ga0501044_0476958_25_585 | 185 |
| 771 | 3300049823 | Ga0501044_0627177 | Ga0501044_0627177_38_604 | 185 |
| 772 | 3300049824 | Ga0501045_0410009 | Ga0501045_0410009_158_730 | 185 |
| 773 | 3300050489 | nmdc:mga03683_32624_c1 | nmdc:mga03683_32624_c1_308_865 | 185 |
| 774 | 3300050491 | nmdc:mga00v17_264714_c1 | nmdc:mga00v17_264714_c1_277_834 | 185 |
| 775 | 3300050492 | nmdc:mga0yw44_196788_c1 | nmdc:mga0yw44_196788_c1_560_1117 | 185 |
| 776 | 3300050512 | nmdc:mga0n895_183410_c1 | nmdc:mga0n895_183410_c1_43_621 | 185 |
| 777 | 3300050516 | nmdc:mga0sz30_110484_c1 | nmdc:mga0sz30_110484_c1_458_1015 | 185 |
| 778 | 3300053077 | Ga0495601_0007443 | Ga0495601_0007443_2423_2980 | 185 |
| 779 | 3300053078 | Ga0495612_0008980 | Ga0495612_0008980_2022_2579 | 185 |
| 780 | 3300053084 | Ga0495595_0002673 | Ga0495595_0002673_790_1347 | 185 |
| 781 | 3300053084 | Ga0495595_0059267 | Ga0495595_0059267_827_1384 | 185 |
| 782 | 3300053085 | Ga0495619_0012413 | Ga0495619_0012413_134_691 | 185 |
| 783 | 3300053085 | Ga0495619_0081396 | Ga0495619_0081396_706_1263 | 185 |
| 784 | 3300053090 | Ga0500646_0109722 | Ga0500646_0109722_288_848 | 185 |
| 785 | 3300053091 | Ga0500647_0245044 | Ga0500647_0245044_137_697 | 185 |
| 786 | 3300053109 | Ga0500569_035235 | Ga0500569_035235_362_919 | 185 |
| 787 | 3300053117 | Ga0500593_000272 | Ga0500593_000272_1048_1605 | 185 |
| 788 | 3300053118 | Ga0500594_0100436 | Ga0500594_0100436_20_577 | 185 |
| 789 | 3300053121 | Ga0500607_127316 | Ga0500607_127316_416_973 | 185 |
| 790 | 3300053133 | Ga0500655_001513 | Ga0500655_001513_2804_3364 | 185 |
| 791 | 3300053139 | Ga0500568_0000005 | Ga0500568_0000005_170894_171451 | 185 |
| 792 | 3300053153 | Ga0500616_0062236 | Ga0500616_0062236_1229_1786 | 185 |
| 793 | 3300053153 | Ga0500616_0325338 | Ga0500616_0325338_18_614 | 185 |
| 794 | 3300053156 | Ga0500622_0001386 | Ga0500622_0001386_2053_2613 | 185 |
| 795 | 3300053156 | Ga0500622_0113530 | Ga0500622_0113530_228_785 | 185 |
| 796 | 3300053727 | Ga0500611_144920 | Ga0500611_144920_21_593 | 185 |
| 797 | 3300054114 | Ga0501084_0042460 | Ga0501084_0042460_815_1375 | 185 |
| 798 | 3300060353 | Ga0501082_0011504 | Ga0501082_0011504_3861_4433 | 185 |
| 799 | 3300060353 | Ga0501082_0118964 | Ga0501082_0118964_59_619 | 185 |
| 800 | 3300061734 | Ga0530510_0058376 | Ga0530510_0058376_1352_1909 | 185 |
| 801 | iso_pu_bacteria | 2508501050 | 2508727363 | 185 |
| 802 | iso_pu_bacteria | 2508501114 | 2509077094 | 185 |
| 803 | iso_pu_bacteria | 2773857925 | 2774873044 | 185 |
| 804 | iso_pu_bacteria | 2775506901 | 2776262402 | 185 |
| 805 | iso_pu_bacteria | 2835312727 | 2835313005 | 185 |
| 806 | iso_pu_bacteria | 2882456835 | 2882461350 | 185 |
| 807 | iso_pu_bacteria | 2884298095 | 2884298784 | 185 |
| 808 | iso_pu_bacteria | 2894232714 | 2894234187 | 185 |
| 809 | 3300035724 | Ga0373933_0394071 | Ga0373933_0394071_262_822 | 186 |
| 810 | iso_pu_bacteria | 2643221733 | 2644730081 | 186 |
| 811 | iso_pu_bacteria | 2643221734 | 2644737148 | 186 |
| 812 | iso_pu_bacteria | 2643221736 | 2644742925 | 186 |
| 813 | iso_pu_bacteria | 2818991467 | 2819720050 | 186 |
| 814 | iso_pu_bacteria | 2841760612 | 2841765273 | 186 |
| 815 | iso_pu_bacteria | 2844104063 | 2844106883 | 186 |
| 816 | iso_pu_bacteria | 2851182111 | 2851185856 | 186 |
| 817 | iso_pu_bacteria | 2851246043 | 2851248923 | 186 |
| 818 | iso_pu_bacteria | 8057529695 | 8057532721 | 186 |
| 819 | 3300031727 | Ga0316576_10109452 | Ga0316576_101094523 | 187 |
| 820 | 3300031728 | Ga0316578_10060257 | Ga0316578_100602573 | 187 |
| 821 | 3300039062 | Ga0400483_031136 | Ga0400483_031136_1810_2394 | 187 |
| 822 | 3300039062 | Ga0400483_261441 | Ga0400483_261441_1047_1631 | 187 |
| 823 | 3300039447 | Ga0436361_0290139 | Ga0436361_0290139_817_1440 | 187 |
| 824 | 3300005354 | Ga0070675_101055289 | Ga0070675_1010552891 | 188 |
| 825 | 3300005456 | Ga0070678_100193757 | Ga0070678_1001937572 | 188 |
| 826 | 3300005459 | Ga0068867_100120838 | Ga0068867_1001208382 | 188 |
| 827 | 3300005548 | Ga0070665_100623458 | Ga0070665_1006234581 | 188 |
| 828 | 3300006881 | Ga0068865_100125667 | Ga0068865_1001256672 | 188 |
| 829 | 3300009093 | Ga0105240_10059737 | Ga0105240_100597374 | 188 |
| 830 | 3300009148 | Ga0105243_10395671 | Ga0105243_103956712 | 188 |
| 831 | 3300009545 | Ga0105237_10208069 | Ga0105237_102080691 | 188 |
| 832 | 3300013104 | Ga0157370_10389712 | Ga0157370_103897121 | 188 |
| 833 | 3300013306 | Ga0163162_10051883 | Ga0163162_100518834 | 188 |
| 834 | 3300021358 | Ga0213873_10060593 | Ga0213873_100605932 | 188 |
| 835 | 3300021361 | Ga0213872_10044499 | Ga0213872_100444991 | 188 |
| 836 | 3300021441 | Ga0213871_10042895 | Ga0213871_100428951 | 188 |
| 837 | 3300025913 | Ga0207695_10177592 | Ga0207695_101775923 | 188 |
| 838 | 3300025919 | Ga0207657_10406424 | Ga0207657_104064241 | 188 |
| 839 | 3300025928 | Ga0207700_10980997 | Ga0207700_109809971 | 188 |
| 840 | 3300025935 | Ga0207709_10592101 | Ga0207709_105921011 | 188 |
| 841 | 3300025938 | Ga0207704_10126082 | Ga0207704_101260822 | 188 |
| 842 | 3300026035 | Ga0207703_10030782 | Ga0207703_100307826 | 188 |
| 843 | 3300026121 | Ga0207683_10296793 | Ga0207683_102967931 | 188 |
| 844 | 3300028379 | Ga0268266_10256215 | Ga0268266_102562152 | 188 |
| 845 | 3300028786 | Ga0307517_10265289 | Ga0307517_102652891 | 188 |
| 846 | 3300031239 | Ga0265328_10059621 | Ga0265328_100596212 | 188 |
| 847 | 3300031249 | Ga0265339_10020568 | Ga0265339_100205684 | 188 |
| 848 | 3300031344 | Ga0265316_10399989 | Ga0265316_103999891 | 188 |
| 849 | 3300031344 | Ga0265316_10561778 | Ga0265316_105617781 | 188 |
| 850 | 3300031456 | Ga0307513_10164521 | Ga0307513_101645212 | 188 |
| 851 | 3300031711 | Ga0265314_10016114 | Ga0265314_100161142 | 188 |
| 852 | 3300031711 | Ga0265314_10062004 | Ga0265314_100620045 | 188 |
| 853 | 3300039438 | Ga0436360_0009637 | Ga0436360_0009637_110_676 | 188 |
| 854 | 3300039438 | Ga0436360_0234379 | Ga0436360_0234379_4420_4986 | 188 |
| 855 | 3300039438 | Ga0436360_0409435 | Ga0436360_0409435_332_898 | 188 |
| 856 | 3300039438 | Ga0436360_0573541 | Ga0436360_0573541_548_1114 | 188 |
| 857 | 3300039438 | Ga0436360_1008458 | Ga0436360_1008458_38_604 | 188 |
| 858 | 3300039447 | Ga0436361_0801523 | Ga0436361_0801523_719_1285 | 188 |
| 859 | 3300039447 | Ga0436361_0856042 | Ga0436361_0856042_2287_2856 | 188 |
| 860 | 3300039447 | Ga0436361_0956481 | Ga0436361_0956481_553_1122 | 188 |
| 861 | 3300039450 | Ga0436363_0243575 | Ga0436363_0243575_1180_1746 | 188 |
| 862 | 3300039450 | Ga0436363_0521106 | Ga0436363_0521106_1043_1609 | 188 |
| 863 | 3300039453 | Ga0436362_0160092 | Ga0436362_0160092_111_677 | 188 |
| 864 | 3300039453 | Ga0436362_0283225 | Ga0436362_0283225_583_1149 | 188 |
| 865 | 3300039453 | Ga0436362_0508487 | Ga0436362_0508487_129_695 | 188 |
| 866 | 3300039453 | Ga0436362_1168099 | Ga0436362_1168099_321_887 | 188 |
| 867 | 3300044684 | Ga0466966_0016096 | Ga0466966_0016096_2509_3075 | 188 |
| 868 | 3300045049 | Ga0466959_0032618 | Ga0466959_0032618_1078_1644 | 188 |
| 869 | 3300045836 | Ga0466958_0096417 | Ga0466958_0096417_234_800 | 188 |
| 870 | 3300046557 | Ga0495622_0002344 | Ga0495622_0002344_5934_6503 | 188 |
| 871 | 3300046675 | Ga0495657_0248353 | Ga0495657_0248353_340_909 | 188 |
| 872 | 3300048908 | Ga0496105_0141411 | Ga0496105_0141411_287_853 | 188 |
| 873 | 3300048924 | Ga0496121_0000987 | Ga0496121_0000987_3890_4459 | 188 |
| 874 | 3300053094 | Ga0500566_0188241 | Ga0500566_0188241_154_723 | 188 |
| 875 | 3300053103 | Ga0500555_056667 | Ga0500555_056667_359_934 | 188 |
| 876 | 3300053119 | Ga0500595_103449 | Ga0500595_103449_13_582 | 188 |
| 877 | 3300053154 | Ga0500619_105033 | Ga0500619_105033_328_897 | 188 |
| 878 | 3300061719 | Ga0466962_0206282 | Ga0466962_0206282_221_787 | 188 |
| 879 | iso_pu_bacteria | 3000017691 | 3000018114 | 188 |
| 880 | 3300005331 | Ga0070670_101232511 | Ga0070670_1012325111 | 189 |
| 881 | 3300005615 | Ga0070702_100416808 | Ga0070702_1004168081 | 189 |
| 882 | 3300005985 | Ga0081539_10056561 | Ga0081539_100565614 | 189 |
| 883 | 3300025935 | Ga0207709_10228974 | Ga0207709_102289742 | 189 |
| 884 | 3300031824 | Ga0307413_10051479 | Ga0307413_100514792 | 189 |
| 885 | 3300031852 | Ga0307410_10892682 | Ga0307410_108926821 | 189 |
| 886 | 3300031901 | Ga0307406_10619097 | Ga0307406_106190972 | 189 |
| 887 | 3300031911 | Ga0307412_10106318 | Ga0307412_101063182 | 189 |
| 888 | 3300031995 | Ga0307409_100229034 | Ga0307409_1002290342 | 189 |
| 889 | 3300032002 | Ga0307416_101052819 | Ga0307416_1010528192 | 189 |
| 890 | 3300049568 | Ga0501031_0241277 | Ga0501031_0241277_25_594 | 189 |
| 891 | 3300049577 | Ga0501041_0077265 | Ga0501041_0077265_599_1168 | 189 |
| 892 | 3300049580 | Ga0501046_0131919 | Ga0501046_0131919_1299_1868 | 189 |
| 893 | 3300049690 | Ga0501261_022849 | Ga0501261_022849_50_637 | 189 |
| 894 | 3300049742 | Ga0501080_0701019 | Ga0501080_0701019_305_874 | 189 |
| 895 | 3300049824 | Ga0501045_0099474 | Ga0501045_0099474_936_1505 | 189 |
| 896 | 3300053163 | Ga0500639_030043 | Ga0500639_030043_1372_1956 | 189 |
| 897 | 3300003187 | JGI25151J46595_10065118 | JGI25151J46595_100651183 | 190 |
| 898 | 3300003214 | JGI25165J46597_1000035 | JGI25165J46597_1000035204 | 190 |
| 899 | 3300003771 | Ga0055526_1000017 | Ga0055526_100001775 | 190 |
| 900 | 3300003775 | Ga0055524_1000346 | Ga0055524_100034619 | 190 |
| 901 | 3300003784 | Ga0055534_1020864 | Ga0055534_10208641 | 190 |
| 902 | 3300005262 | Ga0065165_1000014 | Ga0065165_1000014222 | 190 |
| 903 | 3300005327 | Ga0070658_10013783 | Ga0070658_100137832 | 190 |
| 904 | 3300005336 | Ga0070680_100019997 | Ga0070680_1000199975 | 190 |
| 905 | 3300005338 | Ga0068868_100074643 | Ga0068868_1000746434 | 190 |
| 906 | 3300005338 | Ga0068868_100777868 | Ga0068868_1007778681 | 190 |
| 907 | 3300005339 | Ga0070660_100026293 | Ga0070660_1000262932 | 190 |
| 908 | 3300005340 | Ga0070689_100562049 | Ga0070689_1005620491 | 190 |
| 909 | 3300005344 | Ga0070661_100037883 | Ga0070661_1000378834 | 190 |
| 910 | 3300005344 | Ga0070661_100054716 | Ga0070661_1000547164 | 190 |
| 911 | 3300005356 | Ga0070674_100156460 | Ga0070674_1001564601 | 190 |
| 912 | 3300005367 | Ga0070667_100012865 | Ga0070667_1000128654 | 190 |
| 913 | 3300005438 | Ga0070701_10119472 | Ga0070701_101194722 | 190 |
| 914 | 3300005456 | Ga0070678_100002013 | Ga0070678_1000020136 | 190 |
| 915 | 3300005456 | Ga0070678_100031753 | Ga0070678_1000317534 | 190 |
| 916 | 3300005458 | Ga0070681_10030628 | Ga0070681_100306286 | 190 |
| 917 | 3300005459 | Ga0068867_100014884 | Ga0068867_1000148846 | 190 |
| 918 | 3300005530 | Ga0070679_100111217 | Ga0070679_1001112172 | 190 |
| 919 | 3300005535 | Ga0070684_100089015 | Ga0070684_1000890153 | 190 |
| 920 | 3300005539 | Ga0068853_100801823 | Ga0068853_1008018232 | 190 |
| 921 | 3300005547 | Ga0070693_100402999 | Ga0070693_1004029991 | 190 |
| 922 | 3300005548 | Ga0070665_100002597 | Ga0070665_10000259722 | 190 |
| 923 | 3300005548 | Ga0070665_100057758 | Ga0070665_1000577584 | 190 |
| 924 | 3300005548 | Ga0070665_100151997 | Ga0070665_1001519973 | 190 |
| 925 | 3300005548 | Ga0070665_100272665 | Ga0070665_1002726652 | 190 |
| 926 | 3300005548 | Ga0070665_100288383 | Ga0070665_1002883832 | 190 |
| 927 | 3300005563 | Ga0068855_100012271 | Ga0068855_10001227112 | 190 |
| 928 | 3300005564 | Ga0070664_100362090 | Ga0070664_1003620902 | 190 |
| 929 | 3300005614 | Ga0068856_100546245 | Ga0068856_1005462451 | 190 |
| 930 | 3300005614 | Ga0068856_101287059 | Ga0068856_1012870591 | 190 |
| 931 | 3300005616 | Ga0068852_100244694 | Ga0068852_1002446942 | 190 |
| 932 | 3300005617 | Ga0068859_100166394 | Ga0068859_1001663943 | 190 |
| 933 | 3300005617 | Ga0068859_100448827 | Ga0068859_1004488272 | 190 |
| 934 | 3300005618 | Ga0068864_100070798 | Ga0068864_1000707982 | 190 |
| 935 | 3300005718 | Ga0068866_10026254 | Ga0068866_100262543 | 190 |
| 936 | 3300005719 | Ga0068861_101100664 | Ga0068861_1011006641 | 190 |
| 937 | 3300005834 | Ga0068851_10074425 | Ga0068851_100744252 | 190 |
| 938 | 3300005841 | Ga0068863_100201536 | Ga0068863_1002015363 | 190 |
| 939 | 3300005842 | Ga0068858_100028088 | Ga0068858_1000280882 | 190 |
| 940 | 3300005842 | Ga0068858_100132435 | Ga0068858_1001324354 | 190 |
| 941 | 3300005843 | Ga0068860_100170056 | Ga0068860_1001700562 | 190 |
| 942 | 3300005844 | Ga0068862_100380837 | Ga0068862_1003808372 | 190 |
| 943 | 3300005844 | Ga0068862_100684859 | Ga0068862_1006848592 | 190 |
| 944 | 3300006186 | Ga0075369_10030068 | Ga0075369_100300683 | 190 |
| 945 | 3300006237 | Ga0097621_100011176 | Ga0097621_1000111765 | 190 |
| 946 | 3300006358 | Ga0068871_100007657 | Ga0068871_10000765710 | 190 |
| 947 | 3300006881 | Ga0068865_100025832 | Ga0068865_1000258325 | 190 |
| 948 | 3300006881 | Ga0068865_100639903 | Ga0068865_1006399031 | 190 |
| 949 | 3300006931 | Ga0097620_100166403 | Ga0097620_1001664033 | 190 |
| 950 | 3300006931 | Ga0097620_100448782 | Ga0097620_1004487822 | 190 |
| 951 | 3300009093 | Ga0105240_10318352 | Ga0105240_103183523 | 190 |
| 952 | 3300009093 | Ga0105240_11199516 | Ga0105240_111995161 | 190 |
| 953 | 3300009101 | Ga0105247_10200079 | Ga0105247_102000792 | 190 |
| 954 | 3300009174 | Ga0105241_10022531 | Ga0105241_100225315 | 190 |
| 955 | 3300009174 | Ga0105241_10230233 | Ga0105241_102302332 | 190 |
| 956 | 3300009176 | Ga0105242_10219682 | Ga0105242_102196822 | 190 |
| 957 | 3300009177 | Ga0105248_10031038 | Ga0105248_100310382 | 190 |
| 958 | 3300009177 | Ga0105248_10109932 | Ga0105248_101099324 | 190 |
| 959 | 3300009177 | Ga0105248_10482647 | Ga0105248_104826472 | 190 |
| 960 | 3300009545 | Ga0105237_10015763 | Ga0105237_100157634 | 190 |
| 961 | 3300009545 | Ga0105237_10259103 | Ga0105237_102591032 | 190 |
| 962 | 3300009551 | Ga0105238_10171582 | Ga0105238_101715823 | 190 |
| 963 | 3300009551 | Ga0105238_10347755 | Ga0105238_103477552 | 190 |
| 964 | 3300009553 | Ga0105249_10017761 | Ga0105249_100177616 | 190 |
| 965 | 3300010375 | Ga0105239_10150764 | Ga0105239_101507641 | 190 |
| 966 | 3300011119 | Ga0105246_10009904 | Ga0105246_100099044 | 190 |
| 967 | 3300013104 | Ga0157370_10280808 | Ga0157370_102808083 | 190 |
| 968 | 3300013105 | Ga0157369_10395457 | Ga0157369_103954571 | 190 |
| 969 | 3300013296 | Ga0157374_10025468 | Ga0157374_100254683 | 190 |
| 970 | 3300013296 | Ga0157374_10053771 | Ga0157374_100537712 | 190 |
| 971 | 3300013296 | Ga0157374_10119881 | Ga0157374_101198813 | 190 |
| 972 | 3300013297 | Ga0157378_10217130 | Ga0157378_102171302 | 190 |
| 973 | 3300013306 | Ga0163162_10044647 | Ga0163162_100446475 | 190 |
| 974 | 3300013306 | Ga0163162_10283378 | Ga0163162_102833782 | 190 |
| 975 | 3300013307 | Ga0157372_10071967 | Ga0157372_100719675 | 190 |
| 976 | 3300013308 | Ga0157375_10022440 | Ga0157375_100224403 | 190 |
| 977 | 3300013308 | Ga0157375_10358402 | Ga0157375_103584023 | 190 |
| 978 | 3300014325 | Ga0163163_10000012 | Ga0163163_10000012201 | 190 |
| 979 | 3300014325 | Ga0163163_10589756 | Ga0163163_105897562 | 190 |
| 980 | 3300014968 | Ga0157379_10002345 | Ga0157379_100023456 | 190 |
| 981 | 3300014968 | Ga0157379_10014522 | Ga0157379_100145225 | 190 |
| 982 | 3300014968 | Ga0157379_10102466 | Ga0157379_101024662 | 190 |
| 983 | 3300014968 | Ga0157379_10155032 | Ga0157379_101550323 | 190 |
| 984 | 3300014969 | Ga0157376_10002383 | Ga0157376_100023839 | 190 |
| 985 | 3300014969 | Ga0157376_10163184 | Ga0157376_101631842 | 190 |
| 986 | 3300017792 | Ga0163161_10003599 | Ga0163161_100035994 | 190 |
| 987 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006698 | 190 |
| 988 | 3300025261 | Ga0209233_1002157 | Ga0209233_10021572 | 190 |
| 989 | 3300025284 | Ga0209130_1000024 | Ga0209130_100002454 | 190 |
| 990 | 3300025291 | Ga0209675_1000712 | Ga0209675_10007122 | 190 |
| 991 | 3300025294 | Ga0209025_1000008 | Ga0209025_100000836 | 190 |
| 992 | 3300025294 | Ga0209025_1001592 | Ga0209025_10015921 | 190 |
| 993 | 3300025295 | Ga0209564_1000015 | Ga0209564_100001590 | 190 |
| 994 | 3300025295 | Ga0209564_1000031 | Ga0209564_1000031132 | 190 |
| 995 | 3300025299 | Ga0209256_1000181 | Ga0209256_1000181114 | 190 |
| 996 | 3300025299 | Ga0209256_1000205 | Ga0209256_100020540 | 190 |
| 997 | 3300025304 | Ga0209257_1068891 | Ga0209257_10688911 | 190 |
| 998 | 3300025321 | Ga0207656_10061995 | Ga0207656_100619952 | 190 |
| 999 | 3300025893 | Ga0207682_10143384 | Ga0207682_101433842 | 190 |
| 1000 | 3300025899 | Ga0207642_10108754 | Ga0207642_101087542 | 190 |
| 1001 | 3300025900 | Ga0207710_10256332 | Ga0207710_102563322 | 190 |
| 1002 | 3300025903 | Ga0207680_10005414 | Ga0207680_100054144 | 190 |
| 1003 | 3300025907 | Ga0207645_10005584 | Ga0207645_100055844 | 190 |
| 1004 | 3300025909 | Ga0207705_10013975 | Ga0207705_100139755 | 190 |
| 1005 | 3300025911 | Ga0207654_10011752 | Ga0207654_100117526 | 190 |
| 1006 | 3300025912 | Ga0207707_10131316 | Ga0207707_101313164 | 190 |
| 1007 | 3300025913 | Ga0207695_10084002 | Ga0207695_100840025 | 190 |
| 1008 | 3300025913 | Ga0207695_10111558 | Ga0207695_101115582 | 190 |
| 1009 | 3300025913 | Ga0207695_10135676 | Ga0207695_101356763 | 190 |
| 1010 | 3300025913 | Ga0207695_10210009 | Ga0207695_102100093 | 190 |
| 1011 | 3300025914 | Ga0207671_10032398 | Ga0207671_100323985 | 190 |
| 1012 | 3300025917 | Ga0207660_10059809 | Ga0207660_100598092 | 190 |
| 1013 | 3300025919 | Ga0207657_10048575 | Ga0207657_100485753 | 190 |
| 1014 | 3300025920 | Ga0207649_10060208 | Ga0207649_100602084 | 190 |
| 1015 | 3300025920 | Ga0207649_10212659 | Ga0207649_102126592 | 190 |
| 1016 | 3300025921 | Ga0207652_10094808 | Ga0207652_100948083 | 190 |
| 1017 | 3300025924 | Ga0207694_10276699 | Ga0207694_102766991 | 190 |
| 1018 | 3300025925 | Ga0207650_10588503 | Ga0207650_105885031 | 190 |
| 1019 | 3300025925 | Ga0207650_10777761 | Ga0207650_107777611 | 190 |
| 1020 | 3300025926 | Ga0207659_10112193 | Ga0207659_101121932 | 190 |
| 1021 | 3300025927 | Ga0207687_10058007 | Ga0207687_100580072 | 190 |
| 1022 | 3300025927 | Ga0207687_10058623 | Ga0207687_100586234 | 190 |
| 1023 | 3300025928 | Ga0207700_10098721 | Ga0207700_100987213 | 190 |
| 1024 | 3300025934 | Ga0207686_10070923 | Ga0207686_100709233 | 190 |
| 1025 | 3300025934 | Ga0207686_10332011 | Ga0207686_103320112 | 190 |
| 1026 | 3300025935 | Ga0207709_10014211 | Ga0207709_100142114 | 190 |
| 1027 | 3300025936 | Ga0207670_10595891 | Ga0207670_105958911 | 190 |
| 1028 | 3300025937 | Ga0207669_10258786 | Ga0207669_102587862 | 190 |
| 1029 | 3300025938 | Ga0207704_10069864 | Ga0207704_100698642 | 190 |
| 1030 | 3300025941 | Ga0207711_10013219 | Ga0207711_100132195 | 190 |
| 1031 | 3300025941 | Ga0207711_10336468 | Ga0207711_103364681 | 190 |
| 1032 | 3300025941 | Ga0207711_10779036 | Ga0207711_107790361 | 190 |
| 1033 | 3300025945 | Ga0207679_10467744 | Ga0207679_104677442 | 190 |
| 1034 | 3300025949 | Ga0207667_10010294 | Ga0207667_100102941 | 190 |
| 1035 | 3300025960 | Ga0207651_10074676 | Ga0207651_100746764 | 190 |
| 1036 | 3300025961 | Ga0207712_10014867 | Ga0207712_100148674 | 190 |
| 1037 | 3300025981 | Ga0207640_10040754 | Ga0207640_100407542 | 190 |
| 1038 | 3300025986 | Ga0207658_10023373 | Ga0207658_100233732 | 190 |
| 1039 | 3300026023 | Ga0207677_10004318 | Ga0207677_100043185 | 190 |
| 1040 | 3300026035 | Ga0207703_10108592 | Ga0207703_101085922 | 190 |
| 1041 | 3300026041 | Ga0207639_10123960 | Ga0207639_101239603 | 190 |
| 1042 | 3300026078 | Ga0207702_10144432 | Ga0207702_101444321 | 190 |
| 1043 | 3300026089 | Ga0207648_10009495 | Ga0207648_100094959 | 190 |
| 1044 | 3300026089 | Ga0207648_10032185 | Ga0207648_100321852 | 190 |
| 1045 | 3300026089 | Ga0207648_10160988 | Ga0207648_101609882 | 190 |
| 1046 | 3300026095 | Ga0207676_10043534 | Ga0207676_100435342 | 190 |
| 1047 | 3300026116 | Ga0207674_10125019 | Ga0207674_101250192 | 190 |
| 1048 | 3300026118 | Ga0207675_100507766 | Ga0207675_1005077662 | 190 |
| 1049 | 3300026121 | Ga0207683_10003082 | Ga0207683_100030827 | 190 |
| 1050 | 3300026121 | Ga0207683_10049440 | Ga0207683_100494404 | 190 |
| 1051 | 3300026121 | Ga0207683_10079367 | Ga0207683_100793671 | 190 |
| 1052 | 3300026121 | Ga0207683_10130897 | Ga0207683_101308972 | 190 |
| 1053 | 3300026142 | Ga0207698_10126006 | Ga0207698_101260063 | 190 |
| 1054 | 3300028379 | Ga0268266_10000463 | Ga0268266_100004636 | 190 |
| 1055 | 3300028379 | Ga0268266_10051760 | Ga0268266_100517601 | 190 |
| 1056 | 3300028379 | Ga0268266_10172741 | Ga0268266_101727412 | 190 |
| 1057 | 3300028379 | Ga0268266_10337188 | Ga0268266_103371882 | 190 |
| 1058 | 3300028380 | Ga0268265_10443931 | Ga0268265_104439312 | 190 |
| 1059 | 3300028381 | Ga0268264_10051832 | Ga0268264_100518324 | 190 |
| 1060 | 3300028381 | Ga0268264_10109120 | Ga0268264_101091202 | 190 |
| 1061 | 3300028794 | Ga0307515_10158798 | Ga0307515_101587982 | 190 |
| 1062 | 3300028800 | Ga0265338_10001087 | Ga0265338_1000108724 | 190 |
| 1063 | 3300031247 | Ga0265340_10064703 | Ga0265340_100647032 | 190 |
| 1064 | 3300031249 | Ga0265339_10077525 | Ga0265339_100775251 | 190 |
| 1065 | 3300031595 | Ga0265313_10032291 | Ga0265313_100322912 | 190 |
| 1066 | 3300031711 | Ga0265314_10031751 | Ga0265314_100317512 | 190 |
| 1067 | 3300031711 | Ga0265314_10149712 | Ga0265314_101497121 | 190 |
| 1068 | 3300031730 | Ga0307516_10061230 | Ga0307516_100612304 | 190 |
| 1069 | 3300035172 | Ga0373955_0681603 | Ga0373955_0681603_25_621 | 190 |
| 1070 | 3300035207 | Ga0373942_0061565 | Ga0373942_0061565_463_1041 | 190 |
| 1071 | 3300035691 | Ga0373931_0425147 | Ga0373931_0425147_243_821 | 190 |
| 1072 | 3300037418 | Ga0395900_0088308 | Ga0395900_0088308_1509_2084 | 190 |
| 1073 | 3300037466 | Ga0395898_0026131 | Ga0395898_0026131_483_1058 | 190 |
| 1074 | 3300037471 | Ga0395905_0970765 | Ga0395905_0970765_33_611 | 190 |
| 1075 | 3300038443 | Ga0395901_0043778 | Ga0395901_0043778_4036_4611 | 190 |
| 1076 | 3300039437 | Ga0436365_0683017 | Ga0436365_0683017_448_1023 | 190 |
| 1077 | 3300044842 | Ga0466957_0159678 | Ga0466957_0159678_368_943 | 190 |
| 1078 | 3300046507 | Ga0495606_0134503 | Ga0495606_0134503_615_1193 | 190 |
| 1079 | 3300046539 | Ga0495621_0046217 | Ga0495621_0046217_40_618 | 190 |
| 1080 | 3300046616 | Ga0495668_0161649 | Ga0495668_0161649_112_690 | 190 |
| 1081 | 3300047318 | Ga0495636_0018272 | Ga0495636_0018272_2206_2784 | 190 |
| 1082 | 3300049569 | Ga0501032_0131087 | Ga0501032_0131087_529_1101 | 190 |
| 1083 | 3300049571 | Ga0501034_0218897 | Ga0501034_0218897_576_1154 | 190 |
| 1084 | 3300049572 | Ga0501036_0096762 | Ga0501036_0096762_322_894 | 190 |
| 1085 | 3300049572 | Ga0501036_0188215 | Ga0501036_0188215_1026_1601 | 190 |
| 1086 | 3300049573 | Ga0501037_0042558 | Ga0501037_0042558_1470_2045 | 190 |
| 1087 | 3300049581 | Ga0501047_0216244 | Ga0501047_0216244_217_789 | 190 |
| 1088 | 3300049581 | Ga0501047_0442776 | Ga0501047_0442776_177_755 | 190 |
| 1089 | 3300049587 | Ga0501071_0074774 | Ga0501071_0074774_933_1505 | 190 |
| 1090 | 3300049742 | Ga0501080_0060319 | Ga0501080_0060319_949_1524 | 190 |
| 1091 | 3300049744 | Ga0501083_0668031 | Ga0501083_0668031_44_622 | 190 |
| 1092 | 3300049822 | Ga0501035_0191463 | Ga0501035_0191463_858_1433 | 190 |
| 1093 | 3300049823 | Ga0501044_0007813 | Ga0501044_0007813_11041_11616 | 190 |
| 1094 | 3300049823 | Ga0501044_0473340 | Ga0501044_0473340_79_651 | 190 |
| 1095 | 3300053119 | Ga0500595_000824 | Ga0500595_000824_2083_2658 | 190 |
| 1096 | 3300053140 | Ga0500573_0000032 | Ga0500573_0000032_13222_13800 | 190 |
| 1097 | 3300053730 | Ga0500645_004843 | Ga0500645_004843_1747_2376 | 190 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mpz-assembly1.cif.gz_A | hnh nuclease domain from g. stearothermophilus cas9 | 0.8652 | 89 | 146 |
| 5vgb-assembly1.cif.gz_A | crystal structure of nmecas9 hnh domain bound to anti-crispr acriic1 | 0.8072 | 89 | 146 |
| 6j9n-assembly1.cif.gz_A | nmehnh+acriic3 | 0.8053 | 89 | 146 |
| 5x1h-assembly4.cif.gz_I | structure of legionella pneumophila dotn | 0.8003 | 88 | 131 |
| 4l0k-assembly2.cif.gz_D | crystal structure of a type ii restriction endonuclease | 0.7732 | 98 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MTW9_33_119_1.10.30.50 | Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; | 0.9568 | 108 | 142 | 1.10.30.50 |
| af_P71806_355_434_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8021 | 86 | 138 | 2.30.29.30 |
| 4h9dB00 | Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; | 0.7126 | 87 | 146 | 1.10.30.50 |
| af_I1MTU7_87_181_1.10.30.50 | Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; | 0.7078 | 110 | 166 | 1.10.30.50 |
| 2qgpB00 | Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; | 0.5868 | 76 | 147 | 1.10.30.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1HRD6-F1-model_v4 | deleted | 0.9918 | 88 | 147 |
|
| AF-A0A3D2L8Y0-F1-model_v4 | HNH endonuclease | 0.9684 | 79 | 157 |
GO:0004519
|
| AF-A0A2H1HV63-F1-model_v4 | HNH endonuclease | 0.9573 | 83 | 163 |
GO:0004519
|
| AF-A0A3D2L8Y0-F1-model_v4 | HNH endonuclease | 0.9565 | 79 | 157 |
GO:0004519
|
| AF-A0A257VR97-F1-model_v4 | HNH nuclease domain-containing protein | 0.9561 | 79 | 158 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar