F489980

General Info

Members Datasets Scaffolds Average Seq Length
1096 440 1090 79

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10117093|Ga0081455_101170933
Length 93
Sequence VTPGALASYGRAMDDKEILGHIDELIATEHQLRTKLAAGELSSEEEHAQLRSAEEALDQCWDLLRQRRARREYGEDPSAAVPRPANQVEGYLQ

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
100 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
152 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
153 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
155 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
159 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
160 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
162 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
163 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
235 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
236 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
237 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
238 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
239 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
240 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
241 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
242 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
243 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
244 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
245 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
246 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
247 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
248 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
249 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
250 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
251 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
252 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
253 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
254 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
255 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
256 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
259 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
260 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
261 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
264 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
265 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
266 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
268 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
269 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
270 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
271 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
272 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
273 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
274 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
275 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
276 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
278 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
286 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
287 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
288 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
289 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
290 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
291 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
292 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
293 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
294 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
295 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
296 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
297 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
298 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
299 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
300 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
301 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
302 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
303 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
304 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
305 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
306 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
307 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
308 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
309 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
310 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
311 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
312 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
313 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
314 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
315 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
316 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
317 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
318 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
323 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
324 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
325 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
328 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
329 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
330 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
331 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
332 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
333 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
334 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
335 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
336 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
337 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
338 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
339 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
340 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
341 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
342 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
343 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
344 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
345 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
346 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
347 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
348 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
349 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
350 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
351 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
352 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
353 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
354 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
355 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
356 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
357 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
358 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
359 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
362 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
363 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
364 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
365 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
366 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
367 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
372 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
373 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
378 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
386 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
387 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
388 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
389 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
390 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
391 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
392 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
393 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
394 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
395 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
397 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
398 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
399 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
400 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
401 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
402 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
403 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
404 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
405 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
406 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
407 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
408 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
409 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
410 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
411 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
412 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
413 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
414 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
415 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
416 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
417 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
418 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
419 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
420 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
421 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
422 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
423 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
424 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
425 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
426 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
427 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
428 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
429 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
430 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
431 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
432 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
433 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
434 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
435 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
436 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
437 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
438 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
439 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
440 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 1.19
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.39
Nodule 0
Rhizoplane 3.83
Rhizosphere 84.31
Stem 0
Stem Tuber 0
Unclassified 4.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000976 3300000549 Bacteria 4401
2 LJQas_1001572 3300000549 Bacteria 3370
3 JGI24739J22299_10007711 3300001989 Bacteria 4026
4 JGI24737J22298_10006112 3300001990 Bacteria 4125
5 JGI25156J39149_1000441 3300002705 Bacteria 25512
6 JGI25154J39366_1001707 3300002738 Bacteria 7190
7 JGI25157J39369_1000029 3300002741 Bacteria 146928
8 JGI25153J46596_10001226 3300003215 Bacteria 15462
9 rootH1_10004301 3300003316 Bacteria 2946
10 rootH1_10004301 3300003323 Bacteria 21275
11 rootH1_10005893 3300003316 Bacteria 1508
12 rootH1_10013444 3300003316 Bacteria 15245
13 rootL2_10339283 3300003322 Bacteria 1360
14 rootH1_10027097 3300003323 Bacteria 3091
15 rootH1_10087369 3300003323 Bacteria 8042
16 rootH1_10170894 3300003323 Bacteria 1540
17 Ga0055539_1000310 3300003752 Bacteria 25571
18 Ga0055539_1000600 3300003752 Bacteria 9986
19 Ga0055533_1000010 3300003756 Bacteria 491196
20 Ga0055525_1001518 3300003759 Bacteria 3957
21 Ga0055528_1068003 3300003790 Bacteria 651
22 Ga0055530_10074810 3300003791 Bacteria 723
23 Ga0055540_1030422 3300003792 Bacteria 1253
24 Ga0055531_10001045 3300003794 Bacteria 21867
25 Ga0065165_1012529 3300005262 Bacteria 3447
26 Ga0065715_10766672 3300005293 Bacteria 623
27 Ga0070658_10001118 3300005327 Bacteria 22898
28 Ga0070658_10108531 3300005327 Bacteria 2297
29 Ga0070658_10385524 3300005327 Bacteria 1203
30 Ga0070658_10441595 3300005327 Bacteria 1121
31 Ga0070676_10008789 3300005328 Bacteria 5451
32 Ga0070676_10018572 3300005328 Bacteria 3855
33 Ga0070676_10937356 3300005328 Bacteria 647
34 Ga0070683_100128063 3300005329 Bacteria 2401
35 Ga0070683_102292911 3300005329 Bacteria 518
36 Ga0070690_101141857 3300005330 Bacteria 619
37 Ga0070670_100040204 3300005331 Bacteria 4021
38 Ga0070670_100635295 3300005331 Bacteria 957
39 Ga0068869_100051754 3300005334 Bacteria 2980
40 Ga0068869_100212462 3300005334 Bacteria 1530
41 Ga0068869_100983923 3300005334 Bacteria 734
42 Ga0070666_10412331 3300005335 Unclassified 972
43 Ga0070666_10554206 3300005335 Bacteria 836
44 Ga0070680_100391522 3300005336 Unclassified 1184
45 Ga0070682_101421735 3300005337 Bacteria 594
46 Ga0068868_100114538 3300005338 Bacteria 2194
47 Ga0068868_101031307 3300005338 Bacteria 754
48 Ga0068868_101238843 3300005338 Bacteria 691
49 Ga0068868_101322194 3300005338 Bacteria 670
50 Ga0068868_101918070 3300005338 Bacteria 561
51 Ga0070660_100681414 3300005339 Bacteria 861
52 Ga0070660_101202257 3300005339 Bacteria 643
53 Ga0070660_101266582 3300005339 Bacteria 625
54 Ga0070689_100861541 3300005340 Bacteria 800
55 Ga0070691_10100826 3300005341 Bacteria 1434
56 Ga0070691_10866205 3300005341 Bacteria 555
57 Ga0070691_11087739 3300005341 Bacteria 503
58 Ga0070687_100487859 3300005343 Bacteria 827
59 Ga0070687_100946310 3300005343 Bacteria 621
60 Ga0070661_100876160 3300005344 Bacteria 740
61 Ga0070661_101045492 3300005344 Bacteria 679
62 Ga0070668_100085107 3300005347 Bacteria 2485
63 Ga0070669_100769414 3300005353 Bacteria 817
64 Ga0070669_100981446 3300005353 Bacteria 724
65 Ga0070669_101108097 3300005353 Bacteria 682
66 Ga0070675_100006299 3300005354 Bacteria 9107
67 Ga0070671_100013087 3300005355 Bacteria 6685
68 Ga0070671_100015588 3300005355 Bacteria 6142
69 Ga0070671_100066906 3300005355 Bacteria 2995
70 Ga0070671_100229098 3300005355 Bacteria 1577
71 Ga0070671_101188361 3300005355 Bacteria 671
72 Ga0070671_101841547 3300005355 Bacteria 538
73 Ga0070674_100275680 3300005356 Bacteria 1331
74 Ga0070674_101404058 3300005356 Bacteria 625
75 Ga0070674_102180306 3300005356 Unclassified 506
76 Ga0070673_100053065 3300005364 Bacteria 3183
77 Ga0070673_100904123 3300005364 Bacteria 819
78 Ga0070688_100077300 3300005365 Bacteria 2144
79 Ga0070688_100116360 3300005365 Bacteria 1785
80 Ga0070659_100250401 3300005366 Bacteria 1468
81 Ga0070659_100263450 3300005366 Bacteria 1430
82 Ga0070659_101221801 3300005366 Bacteria 665
83 Ga0070667_100150804 3300005367 Bacteria 2042
84 Ga0070667_100322274 3300005367 Bacteria 1395
85 Ga0070667_100844611 3300005367 Bacteria 851
86 Ga0070667_100856409 3300005367 Bacteria 845
87 Ga0070667_101652783 3300005367 Bacteria 602
88 Ga0070703_10555755 3300005406 Bacteria 524
89 Ga0070709_10041876 3300005434 Bacteria 2824
90 Ga0070709_10100876 3300005434 Bacteria 1923
91 Ga0070709_10131650 3300005434 Bacteria 1708
92 Ga0070714_100078197 3300005435 Bacteria 2875
93 Ga0070714_100142587 3300005435 Bacteria 2152
94 Ga0070714_100195186 3300005435 Bacteria 1849
95 Ga0070714_101114212 3300005435 Bacteria 769
96 Ga0070713_100042266 3300005436 Bacteria 3719
97 Ga0070713_100058351 3300005436 Bacteria 3219
98 Ga0070713_100395700 3300005436 Bacteria 1289
99 Ga0070713_100968809 3300005436 Bacteria 820
100 Ga0070710_10008149 3300005437 Bacteria 5094
101 Ga0070710_10068524 3300005437 Bacteria 2039
102 Ga0070710_10234782 3300005437 Bacteria 1172
103 Ga0070710_10406824 3300005437 Bacteria 913
104 Ga0070711_100032103 3300005439 Bacteria 3489
105 Ga0070711_100071894 3300005439 Bacteria 2439
106 Ga0070711_100446528 3300005439 Bacteria 1058
107 Ga0070711_101176717 3300005439 Bacteria 662
108 Ga0070711_101267664 3300005439 Bacteria 639
109 Ga0070705_100608479 3300005440 Bacteria 846
110 Ga0070700_100102740 3300005441 Bacteria 1886
111 Ga0070708_100015319 3300005445 Bacteria 6328
112 Ga0070708_100171208 3300005445 Bacteria 2027
113 Ga0070708_100365147 3300005445 Bacteria 1361
114 Ga0070708_100408118 3300005445 Bacteria 1281
115 Ga0070708_101090363 3300005445 Bacteria 748
116 Ga0070708_101321288 3300005445 Bacteria 673
117 Ga0070663_100924907 3300005455 Bacteria 755
118 Ga0070663_101708127 3300005455 Bacteria 563
119 Ga0070678_100193945 3300005456 Bacteria 1672
120 Ga0070678_100515575 3300005456 Bacteria 1057
121 Ga0070678_101049153 3300005456 Bacteria 751
122 Ga0070662_100189176 3300005457 Bacteria 1627
123 Ga0070681_11106185 3300005458 Bacteria 713
124 Ga0070681_12030703 3300005458 Bacteria 503
125 Ga0068867_100005302 3300005459 Bacteria 9104
126 Ga0068867_100007136 3300005459 Bacteria 7896
127 Ga0068867_100312774 3300005459 Bacteria 1298
128 Ga0068867_100478789 3300005459 Bacteria 1066
129 Ga0068867_101686593 3300005459 Bacteria 594
130 Ga0070685_10080895 3300005466 Bacteria 1947
131 Ga0070685_11044380 3300005466 Bacteria 615
132 Ga0070706_100002179 3300005467 Bacteria 19922
133 Ga0070706_100006593 3300005467 Bacteria 10947
134 Ga0070706_100026080 3300005467 Bacteria 5377
135 Ga0070706_100084698 3300005467 Bacteria 2937
136 Ga0070706_100094365 3300005467 Bacteria 2776
137 Ga0070706_100100824 3300005467 Bacteria 2683
138 Ga0070706_100215065 3300005467 Bacteria 1794
139 Ga0070707_100000181 3300005468 Bacteria 62074
140 Ga0070707_100021236 3300005468 Bacteria 6137
141 Ga0070707_100034951 3300005468 Bacteria 4792
142 Ga0070707_100041325 3300005468 Bacteria 4413
143 Ga0070707_100073713 3300005468 Bacteria 3291
144 Ga0070707_100272643 3300005468 Bacteria 1645
145 Ga0070707_100299894 3300005468 Bacteria 1561
146 Ga0070707_100449540 3300005468 Bacteria 1249
147 Ga0070698_100000823 3300005471 Bacteria 33938
148 Ga0070698_100032848 3300005471 Bacteria 5375
149 Ga0070698_100039524 3300005471 Bacteria 4855
150 Ga0070698_100062232 3300005471 Bacteria 3765
151 Ga0070698_100069878 3300005471 Bacteria 3525
152 Ga0070698_101049384 3300005471 Bacteria 763
153 Ga0070698_101347771 3300005471 Bacteria 664
154 Ga0070698_101513069 3300005471 Bacteria 622
155 Ga0070699_100196129 3300005518 Unclassified 1795
156 Ga0070699_100420997 3300005518 Bacteria 1209
157 Ga0070699_100477398 3300005518 Bacteria 1131
158 Ga0070679_100342572 3300005530 Bacteria 1443
159 Ga0070679_101150447 3300005530 Bacteria 721
160 Ga0070684_101887998 3300005535 Bacteria 564
161 Ga0068853_100051167 3300005539 Bacteria 3555
162 Ga0068853_100142950 3300005539 Bacteria 2149
163 Ga0068853_102261951 3300005539 Bacteria 527
164 Ga0070672_100032455 3300005543 Bacteria 3940
165 Ga0070672_100152541 3300005543 Bacteria 1912
166 Ga0070672_100314468 3300005543 Bacteria 1330
167 Ga0070695_101016895 3300005545 Bacteria 675
168 Ga0070693_101165555 3300005547 Bacteria 590
169 Ga0070665_100000098 3300005548 Bacteria 164407
170 Ga0070665_100383965 3300005548 Bacteria 1412
171 Ga0070665_101204944 3300005548 Bacteria 768
172 Ga0070704_101868437 3300005549 Bacteria 556
173 Ga0068855_100030535 3300005563 Bacteria 6444
174 Ga0068855_100299317 3300005563 Bacteria 1782
175 Ga0068855_100360939 3300005563 Bacteria 1598
176 Ga0068855_101170619 3300005563 Bacteria 801
177 Ga0068855_101182450 3300005563 Bacteria 796
178 Ga0070664_101345284 3300005564 Bacteria 675
179 Ga0068857_100002542 3300005577 Bacteria 14936
180 Ga0068857_100141255 3300005577 Bacteria 2177
181 Ga0068857_100486677 3300005577 Bacteria 1157
182 Ga0068854_100074461 3300005578 Bacteria 2491
183 Ga0068854_100076760 3300005578 Bacteria 2456
184 Ga0068854_100290993 3300005578 Bacteria 1318
185 Ga0068856_100003174 3300005614 Bacteria 16729
186 Ga0068856_100160421 3300005614 Bacteria 2259
187 Ga0070702_101206654 3300005615 Bacteria 610
188 Ga0068852_100198830 3300005616 Bacteria 1896
189 Ga0068852_100556722 3300005616 Bacteria 1147
190 Ga0068859_100608831 3300005617 Bacteria 1185
191 Ga0068859_100715138 3300005617 Bacteria 1092
192 Ga0068864_100344319 3300005618 Bacteria 1405
193 Ga0068866_10020806 3300005718 Bacteria 3012
194 Ga0068866_10383014 3300005718 Bacteria 902
195 Ga0068861_100000224 3300005719 Bacteria 30748
196 Ga0068861_100216964 3300005719 Bacteria 1614
197 Ga0068851_10218130 3300005834 Bacteria 1071
198 Ga0068851_10967389 3300005834 Unclassified 536
199 Ga0068870_10116133 3300005840 Bacteria 1535
200 Ga0068863_100371788 3300005841 Bacteria 1395
201 Ga0068863_101249438 3300005841 Bacteria 749
202 Ga0068858_100377146 3300005842 Bacteria 1361
203 Ga0068858_100454063 3300005842 Bacteria 1235
204 Ga0068858_101746546 3300005842 Bacteria 614
205 Ga0068860_100053262 3300005843 Bacteria 3848
206 Ga0068860_100055985 3300005843 Bacteria 3749
207 Ga0068860_100422789 3300005843 Bacteria 1321
208 Ga0068860_100736075 3300005843 Bacteria 997
209 Ga0068860_101068251 3300005843 Unclassified 826
210 Ga0068860_101669347 3300005843 Bacteria 659
211 Ga0068860_102684187 3300005843 Bacteria 517
212 Ga0068862_100014364 3300005844 Bacteria 6568
213 Ga0068862_100027091 3300005844 Bacteria 4822
214 Ga0081455_10117093 3300005937 Bacteria 2106
215 Ga0081455_10837403 3300005937 Bacteria 575
216 Ga0081538_10287076 3300005981 Bacteria 609
217 Ga0070717_10003520 3300006028 Bacteria 11220
218 Ga0070717_10056983 3300006028 Bacteria 3230
219 Ga0070717_10114234 3300006028 Bacteria 2306
220 Ga0070717_10164230 3300006028 Bacteria 1928
221 Ga0070717_10209095 3300006028 Bacteria 1712
222 Ga0070717_10482504 3300006028 Bacteria 1119
223 Ga0070717_10945342 3300006028 Bacteria 785
224 Ga0075365_10107068 3300006038 Bacteria 1919
225 Ga0075365_10150910 3300006038 Bacteria 1616
226 Ga0075365_10752618 3300006038 Bacteria 688
227 Ga0075365_11041903 3300006038 Unclassified 576
228 Ga0075364_10175284 3300006051 Bacteria 1450
229 Ga0075364_10336764 3300006051 Bacteria 1028
230 Ga0075432_10332979 3300006058 Bacteria 639
231 Ga0070715_10000176 3300006163 Bacteria 14876
232 Ga0070715_10031319 3300006163 Bacteria 2158
233 Ga0070716_100008911 3300006173 Bacteria 4989
234 Ga0070716_100036121 3300006173 Bacteria 2722
235 Ga0070716_100362870 3300006173 Bacteria 1029
236 Ga0070712_100018221 3300006175 Bacteria 4558
237 Ga0070712_100062788 3300006175 Bacteria 2628
238 Ga0070712_100629266 3300006175 Bacteria 910
239 Ga0070712_100636151 3300006175 Bacteria 905
240 Ga0070712_100677919 3300006175 Bacteria 877
241 Ga0070712_101747539 3300006175 Bacteria 545
242 Ga0075362_10159300 3300006177 Bacteria 1086
243 Ga0075362_10731284 3300006177 Bacteria 518
244 Ga0075367_10032057 3300006178 Bacteria 3020
245 Ga0075367_10433180 3300006178 Bacteria 833
246 Ga0075369_10377597 3300006186 Unclassified 667
247 Ga0075366_10003201 3300006195 Bacteria 8590
248 Ga0075366_10150430 3300006195 Bacteria 1409
249 Ga0075366_10157670 3300006195 Bacteria 1375
250 Ga0075366_10431793 3300006195 Bacteria 812
251 Ga0097621_101191406 3300006237 Bacteria 717
252 Ga0075370_10118338 3300006353 Bacteria 1541
253 Ga0075370_10944159 3300006353 Bacteria 528
254 Ga0068871_100841120 3300006358 Bacteria 848
255 Ga0068871_101284369 3300006358 Bacteria 688
256 Ga0068871_101704466 3300006358 Bacteria 598
257 Ga0075428_100045905 3300006844 Bacteria 4800
258 Ga0075433_10339717 3300006852 Bacteria 1327
259 Ga0075433_10804141 3300006852 Bacteria 821
260 Ga0075434_100028670 3300006871 Bacteria 5473
261 Ga0075434_100678140 3300006871 Bacteria 1048
262 Ga0075434_101123829 3300006871 Bacteria 799
263 Ga0075434_101208056 3300006871 Bacteria 768
264 Ga0075434_102272759 3300006871 Bacteria 545
265 Ga0068865_100018985 3300006881 Bacteria 4444
266 Ga0068865_100557594 3300006881 Bacteria 963
267 Ga0075436_100254164 3300006914 Bacteria 1252
268 Ga0075436_100703571 3300006914 Bacteria 748
269 Ga0097620_100608775 3300006931 Bacteria 1185
270 Ga0097620_100715238 3300006931 Bacteria 1092
271 Ga0075435_100148711 3300007076 Bacteria 1968
272 Ga0075435_100498732 3300007076 Bacteria 1052
273 Ga0075435_101520899 3300007076 Bacteria 587
274 Ga0099794_10030975 3300007265 Bacteria 2501
275 Ga0105240_10051215 3300009093 Bacteria 5198
276 Ga0111539_10208014 3300009094 Bacteria 2280
277 Ga0111539_10252618 3300009094 Bacteria 2053
278 Ga0111539_10946339 3300009094 Bacteria 1002
279 Ga0111539_12314771 3300009094 Bacteria 623
280 Ga0111539_12363162 3300009094 Bacteria 617
281 Ga0105245_10095768 3300009098 Bacteria 2739
282 Ga0105245_10372145 3300009098 Bacteria 1421
283 Ga0105245_10410317 3300009098 Bacteria 1356
284 Ga0105245_12335318 3300009098 Bacteria 588
285 Ga0105247_11164917 3300009101 Bacteria 612
286 Ga0105247_11623143 3300009101 Bacteria 532
287 Ga0114129_10006236 3300009147 Bacteria 16901
288 Ga0114129_10328013 3300009147 Bacteria 2033
289 Ga0114129_10504407 3300009147 Bacteria 1580
290 Ga0105243_10075868 3300009148 Bacteria 2730
291 Ga0105243_10101618 3300009148 Bacteria 2388
292 Ga0105243_10213881 3300009148 Bacteria 1699
293 Ga0105243_10475141 3300009148 Bacteria 1178
294 Ga0105243_10833584 3300009148 Bacteria 912
295 Ga0105243_11986279 3300009148 Bacteria 616
296 Ga0105243_12413153 3300009148 Bacteria 564
297 Ga0105241_10024859 3300009174 Bacteria 4450
298 Ga0105241_12171437 3300009174 Bacteria 550
299 Ga0105241_12417635 3300009174 Bacteria 525
300 Ga0105242_10163736 3300009176 Bacteria 1949
301 Ga0105242_12282082 3300009176 Bacteria 587
302 Ga0105248_10273784 3300009177 Bacteria 1901
303 Ga0105248_10428825 3300009177 Bacteria 1489
304 Ga0105248_11720954 3300009177 Bacteria 711
305 Ga0105248_13097283 3300009177 Unclassified 529
306 Ga0105237_10112238 3300009545 Bacteria 2718
307 Ga0105237_11588062 3300009545 Bacteria 661
308 Ga0105237_11592427 3300009545 Bacteria 660
309 Ga0105237_11767370 3300009545 Bacteria 626
310 Ga0105238_10234083 3300009551 Bacteria 1813
311 Ga0105238_10407160 3300009551 Bacteria 1354
312 Ga0105249_10029368 3300009553 Bacteria 4965
313 Ga0105249_10658774 3300009553 Bacteria 1105
314 Ga0105249_10816655 3300009553 Bacteria 997
315 Ga0105249_11427000 3300009553 Bacteria 764
316 Ga0105249_12965765 3300009553 Bacteria 545
317 Ga0105239_10029727 3300010375 Bacteria 6008
318 Ga0105239_11080390 3300010375 Bacteria 923
319 Ga0105246_10043217 3300011119 Bacteria 3057
320 Ga0105246_10245213 3300011119 Bacteria 1418
321 Ga0157369_10057405 3300013105 Bacteria 4200
322 Ga0157369_11323755 3300013105 Bacteria 734
323 Ga0157369_11705469 3300013105 Bacteria 640
324 Ga0157374_10690326 3300013296 Bacteria 1034
325 Ga0157378_10095544 3300013297 Bacteria 2707
326 Ga0157378_11248540 3300013297 Bacteria 783
327 Ga0157378_11500267 3300013297 Bacteria 719
328 Ga0163162_10193851 3300013306 Bacteria 2160
329 Ga0163162_11183552 3300013306 Bacteria 867
330 Ga0163162_12180957 3300013306 Bacteria 636
331 Ga0163162_12591010 3300013306 Bacteria 583
332 Ga0163162_13197703 3300013306 Bacteria 525
333 Ga0157372_10208871 3300013307 Bacteria 2262
334 Ga0157372_10239661 3300013307 Bacteria 2104
335 Ga0157372_11908803 3300013307 Bacteria 683
336 Ga0157375_10059822 3300013308 Bacteria 3776
337 Ga0157375_10361661 3300013308 Bacteria 1617
338 Ga0157375_10555136 3300013308 Bacteria 1310
339 Ga0157375_11154994 3300013308 Bacteria 907
340 Ga0157375_13337343 3300013308 Bacteria 535
341 Ga0163163_10894919 3300014325 Bacteria 951
342 Ga0163163_11152370 3300014325 Bacteria 838
343 Ga0163163_13055106 3300014325 Bacteria 522
344 Ga0157380_10194223 3300014326 Bacteria 1795
345 Ga0157380_10406487 3300014326 Bacteria 1293
346 Ga0157380_12153166 3300014326 Bacteria 621
347 Ga0157377_10870037 3300014745 Bacteria 671
348 Ga0157379_10054457 3300014968 Bacteria 3574
349 Ga0157379_10138447 3300014968 Bacteria 2194
350 Ga0157376_10190417 3300014969 Bacteria 1881
351 Ga0182007_10405209 3300015262 Bacteria 520
352 Ga0163161_10177384 3300017792 Bacteria 1632
353 Ga0206356_11133492 3300020070 Bacteria 1052
354 Ga0206356_11249086 3300020070 Bacteria 837
355 Ga0206349_1895358 3300020075 Bacteria 587
356 Ga0206350_10821574 3300020080 Bacteria 1512
357 Ga0206354_10029914 3300020081 Bacteria 655
358 Ga0206354_10133078 3300020081 Bacteria 763
359 Ga0206354_10736402 3300020081 Bacteria 722
360 Ga0206353_10114996 3300020082 Bacteria 866
361 Ga0206353_11094267 3300020082 Bacteria 689
362 Ga0206353_11840564 3300020082 Bacteria 799
363 Ga0154015_1051813 3300020610 Unclassified 614
364 Ga0213874_10167468 3300021377 Bacteria 775
365 Ga0213874_10261085 3300021377 Bacteria 641
366 Ga0213875_10000250 3300021388 Bacteria 54123
367 Ga0213875_10002024 3300021388 Bacteria 12495
368 Ga0213875_10137605 3300021388 Bacteria 1142
369 Ga0213875_10312986 3300021388 Bacteria 744
370 Ga0224712_10299958 3300022467 Bacteria 751
371 Ga0224572_1010763 3300024225 Bacteria 1725
372 Ga0224572_1028651 3300024225 Bacteria 1066
373 Ga0209674_100003 3300025226 Bacteria 2196646
374 Ga0209563_100049 3300025230 Bacteria 358472
375 Ga0209258_100700 3300025242 Bacteria 22801
376 Ga0209646_1000257 3300025246 Bacteria 52257
377 Ga0209026_1000054 3300025250 Bacteria 242508
378 Ga0209677_100050 3300025253 Bacteria 176828
379 Ga0209677_100316 3300025253 Bacteria 31473
380 Ga0209759_1000043 3300025256 Bacteria 242513
381 Ga0209759_1001086 3300025256 Bacteria 17708
382 Ga0209759_1007372 3300025256 Bacteria 3545
383 Ga0209129_1031800 3300025258 Bacteria 877
384 Ga0209673_1028349 3300025273 Bacteria 1805
385 Ga0209673_1042339 3300025273 Bacteria 1282
386 Ga0209758_1000146 3300025297 Bacteria 169246
387 Ga0209050_1000303 3300025298 Bacteria 101498
388 Ga0209051_1000823 3300025303 Bacteria 32078
389 Ga0209051_1026928 3300025303 Bacteria 2304
390 Ga0209257_1000161 3300025304 Bacteria 176089
391 Ga0207653_10130289 3300025885 Bacteria 912
392 Ga0207682_10460464 3300025893 Bacteria 602
393 Ga0207692_10003218 3300025898 Bacteria 6346
394 Ga0207692_10011020 3300025898 Bacteria 3828
395 Ga0207692_10063073 3300025898 Bacteria 1925
396 Ga0207692_10108524 3300025898 Bacteria 1536
397 Ga0207692_10494689 3300025898 Bacteria 775
398 Ga0207642_10026857 3300025899 Bacteria 2349
399 Ga0207680_10358678 3300025903 Bacteria 1025
400 Ga0207647_10011526 3300025904 Bacteria 6196
401 Ga0207685_10022260 3300025905 Bacteria 2138
402 Ga0207685_10053473 3300025905 Bacteria 1569
403 Ga0207685_10211536 3300025905 Bacteria 917
404 Ga0207699_10004354 3300025906 Bacteria 6772
405 Ga0207699_10006055 3300025906 Bacteria 5823
406 Ga0207699_10034155 3300025906 Bacteria 2882
407 Ga0207699_10259178 3300025906 Bacteria 1201
408 Ga0207645_10009049 3300025907 Bacteria 6910
409 Ga0207645_10034740 3300025907 Bacteria 3239
410 Ga0207645_10038721 3300025907 Bacteria 3056
411 Ga0207643_10220592 3300025908 Bacteria 1160
412 Ga0207705_10000251 3300025909 Bacteria 52410
413 Ga0207705_10116513 3300025909 Bacteria 1978
414 Ga0207684_10001290 3300025910 Bacteria 27619
415 Ga0207684_10001319 3300025910 Bacteria 27222
416 Ga0207684_10004232 3300025910 Bacteria 13617
417 Ga0207684_10113089 3300025910 Bacteria 2324
418 Ga0207684_10148325 3300025910 Bacteria 2018
419 Ga0207684_10487563 3300025910 Bacteria 1057
420 Ga0207684_10533858 3300025910 Bacteria 1004
421 Ga0207654_10131981 3300025911 Bacteria 1582
422 Ga0207654_10434129 3300025911 Bacteria 918
423 Ga0207695_10067716 3300025913 Bacteria 3661
424 Ga0207671_10162329 3300025914 Bacteria 1731
425 Ga0207671_10771495 3300025914 Bacteria 763
426 Ga0207693_10008315 3300025915 Bacteria 8492
427 Ga0207693_10036042 3300025915 Bacteria 3898
428 Ga0207693_10083441 3300025915 Bacteria 2503
429 Ga0207693_11299139 3300025915 Bacteria 544
430 Ga0207663_10004647 3300025916 Bacteria 6850
431 Ga0207663_10038404 3300025916 Bacteria 2894
432 Ga0207663_11016512 3300025916 Bacteria 665
433 Ga0207662_10219689 3300025918 Bacteria 1237
434 Ga0207657_10066537 3300025919 Bacteria 3067
435 Ga0207657_10374209 3300025919 Bacteria 1122
436 Ga0207657_10613542 3300025919 Bacteria 848
437 Ga0207657_11488214 3300025919 Bacteria 506
438 Ga0207649_10447022 3300025920 Bacteria 975
439 Ga0207646_10000690 3300025922 Bacteria 43616
440 Ga0207646_10001669 3300025922 Bacteria 27091
441 Ga0207646_10015118 3300025922 Bacteria 7304
442 Ga0207646_10077937 3300025922 Bacteria 2962
443 Ga0207646_10082304 3300025922 Bacteria 2879
444 Ga0207646_10189946 3300025922 Bacteria 1855
445 Ga0207646_10305638 3300025922 Bacteria 1437
446 Ga0207646_10474438 3300025922 Bacteria 1128
447 Ga0207646_10666003 3300025922 Bacteria 932
448 Ga0207681_10063600 3300025923 Bacteria 2545
449 Ga0207681_10595533 3300025923 Bacteria 913
450 Ga0207681_11589750 3300025923 Bacteria 547
451 Ga0207694_10187951 3300025924 Bacteria 1677
452 Ga0207694_11382103 3300025924 Bacteria 595
453 Ga0207650_10021982 3300025925 Bacteria 4514
454 Ga0207650_10353222 3300025925 Bacteria 1210
455 Ga0207659_10025362 3300025926 Bacteria 3983
456 Ga0207687_10134285 3300025927 Bacteria 1869
457 Ga0207700_10007201 3300025928 Bacteria 6783
458 Ga0207700_10029880 3300025928 Bacteria 3851
459 Ga0207700_10055685 3300025928 Bacteria 2973
460 Ga0207700_10113240 3300025928 Bacteria 2187
461 Ga0207700_10493236 3300025928 Bacteria 1083
462 Ga0207664_10000650 3300025929 Bacteria 24061
463 Ga0207664_10004546 3300025929 Bacteria 9405
464 Ga0207664_10004907 3300025929 Bacteria 9089
465 Ga0207664_10215369 3300025929 Bacteria 1663
466 Ga0207644_10015616 3300025931 Bacteria 5100
467 Ga0207644_10043701 3300025931 Bacteria 3181
468 Ga0207644_10109398 3300025931 Bacteria 2088
469 Ga0207690_10191708 3300025932 Bacteria 1546
470 Ga0207690_10650980 3300025932 Bacteria 863
471 Ga0207690_10942145 3300025932 Bacteria 717
472 Ga0207706_10385356 3300025933 Bacteria 1216
473 Ga0207686_10161057 3300025934 Bacteria 1573
474 Ga0207686_10627461 3300025934 Bacteria 848
475 Ga0207709_10105761 3300025935 Bacteria 1871
476 Ga0207709_10161557 3300025935 Bacteria 1563
477 Ga0207709_10610664 3300025935 Bacteria 864
478 Ga0207709_11434122 3300025935 Bacteria 572
479 Ga0207670_10555076 3300025936 Bacteria 939
480 Ga0207669_10340291 3300025937 Bacteria 1155
481 Ga0207704_10017341 3300025938 Bacteria 3729
482 Ga0207704_10860502 3300025938 Bacteria 760
483 Ga0207665_10002376 3300025939 Bacteria 12709
484 Ga0207665_10011702 3300025939 Bacteria 5765
485 Ga0207665_10059382 3300025939 Bacteria 2588
486 Ga0207691_10025458 3300025940 Bacteria 5555
487 Ga0207691_10104170 3300025940 Bacteria 2529
488 Ga0207691_10448022 3300025940 Bacteria 1099
489 Ga0207711_10094784 3300025941 Bacteria 2631
490 Ga0207689_10058653 3300025942 Bacteria 3166
491 Ga0207689_10178707 3300025942 Bacteria 1750
492 Ga0207689_11343711 3300025942 Bacteria 600
493 Ga0207661_10048992 3300025944 Bacteria 3361
494 Ga0207679_10546889 3300025945 Bacteria 1038
495 Ga0207667_10047907 3300025949 Bacteria 4521
496 Ga0207667_10760691 3300025949 Bacteria 967
497 Ga0207667_10998014 3300025949 Bacteria 825
498 Ga0207651_10016983 3300025960 Bacteria 4284
499 Ga0207651_10158756 3300025960 Bacteria 1770
500 Ga0207712_10009351 3300025961 Bacteria 6200
501 Ga0207712_10394822 3300025961 Bacteria 1161
502 Ga0207712_11750157 3300025961 Bacteria 557
503 Ga0207668_10068417 3300025972 Bacteria 2525
504 Ga0207668_11557321 3300025972 Bacteria 597
505 Ga0207668_11668200 3300025972 Bacteria 575
506 Ga0207640_10025835 3300025981 Bacteria 3560
507 Ga0207640_10106473 3300025981 Bacteria 1978
508 Ga0207658_10275315 3300025986 Bacteria 1440
509 Ga0207658_10591418 3300025986 Bacteria 996
510 Ga0207658_10820107 3300025986 Bacteria 845
511 Ga0207658_11460340 3300025986 Bacteria 625
512 Ga0207677_10072659 3300026023 Bacteria 2433
513 Ga0207677_11217122 3300026023 Bacteria 690
514 Ga0207677_11785345 3300026023 Bacteria 571
515 Ga0207703_10066634 3300026035 Bacteria 2962
516 Ga0207639_10062586 3300026041 Bacteria 2878
517 Ga0207678_10415264 3300026067 Bacteria 1166
518 Ga0207678_11059552 3300026067 Bacteria 718
519 Ga0207678_11189586 3300026067 Bacteria 675
520 Ga0207708_10025564 3300026075 Bacteria 4469
521 Ga0207708_10975471 3300026075 Bacteria 736
522 Ga0207702_10011854 3300026078 Bacteria 7255
523 Ga0207702_10480004 3300026078 Bacteria 1209
524 Ga0207641_10579289 3300026088 Bacteria 1097
525 Ga0207641_11248355 3300026088 Bacteria 743
526 Ga0207641_12273826 3300026088 Unclassified 542
527 Ga0207648_10000182 3300026089 Bacteria 66368
528 Ga0207648_10008440 3300026089 Bacteria 9978
529 Ga0207648_10117852 3300026089 Bacteria 2333
530 Ga0207648_10857061 3300026089 Bacteria 847
531 Ga0207648_11279528 3300026089 Bacteria 689
532 Ga0207648_11438087 3300026089 Bacteria 648
533 Ga0207648_12052192 3300026089 Bacteria 533
534 Ga0207676_11315795 3300026095 Bacteria 718
535 Ga0207674_10021066 3300026116 Bacteria 7031
536 Ga0207674_10090703 3300026116 Bacteria 3047
537 Ga0207674_10251700 3300026116 Bacteria 1714
538 Ga0207674_11102786 3300026116 Bacteria 763
539 Ga0207675_100000551 3300026118 Bacteria 36576
540 Ga0207675_100303940 3300026118 Bacteria 1554
541 Ga0207675_100363056 3300026118 Bacteria 1421
542 Ga0207675_101165500 3300026118 Bacteria 791
543 Ga0207675_101717799 3300026118 Bacteria 647
544 Ga0207698_10120685 3300026142 Bacteria 2218
545 Ga0207698_10439739 3300026142 Bacteria 1256
546 Ga0207698_11351819 3300026142 Bacteria 727
547 Ga0207698_12643693 3300026142 Bacteria 511
548 Ga0209983_1142946 3300027665 Bacteria 548
549 Ga0209588_1033098 3300027671 Bacteria 1657
550 Ga0207428_10878981 3300027907 Bacteria 634
551 Ga0207428_11290146 3300027907 Bacteria 506
552 Ga0268266_10000644 3300028379 Bacteria 47499
553 Ga0268266_10773250 3300028379 Bacteria 927
554 Ga0268266_11203417 3300028379 Bacteria 733
555 Ga0268266_11607450 3300028379 Bacteria 625
556 Ga0268266_11785159 3300028379 Bacteria 590
557 Ga0268265_10042088 3300028380 Bacteria 3386
558 Ga0268264_10058416 3300028381 Bacteria 3230
559 Ga0268264_10077247 3300028381 Bacteria 2836
560 Ga0268264_10305891 3300028381 Bacteria 1498
561 Ga0268264_10658548 3300028381 Bacteria 1037
562 Ga0268264_11029452 3300028381 Bacteria 830
563 Ga0268264_11239226 3300028381 Bacteria 756
564 Ga0268264_11250068 3300028381 Bacteria 752
565 Ga0265326_10131536 3300028558 Bacteria 713
566 Ga0265319_1063116 3300028563 Bacteria 1199
567 Ga0265336_10000006 3300028666 Bacteria 348453
568 Ga0307517_10194526 3300028786 Bacteria 1280
569 Ga0265338_10000241 3300028800 Bacteria 101431
570 Ga0265338_10003796 3300028800 Bacteria 20997
571 Ga0265338_10150506 3300028800 Bacteria 1809
572 Ga0265338_10245479 3300028800 Bacteria 1324
573 Ga0265324_10026123 3300029957 Bacteria 2067
574 Ga0307512_10108540 3300030522 Bacteria 1841
575 Ga0265320_10455223 3300031240 Bacteria 565
576 Ga0265325_10007889 3300031241 Bacteria 6335
577 Ga0265340_10226992 3300031247 Bacteria 836
578 Ga0265340_10228124 3300031247 Bacteria 833
579 Ga0265339_10000865 3300031249 Bacteria 23280
580 Ga0265339_10532045 3300031249 Bacteria 541
581 Ga0265316_10071814 3300031344 Bacteria 2668
582 Ga0307513_10555678 3300031456 Bacteria 860
583 Ga0307513_10612822 3300031456 Bacteria 797
584 Ga0307408_100026964 3300031548 Bacteria 3953
585 Ga0307408_100522269 3300031548 Bacteria 1043
586 Ga0307408_100529214 3300031548 Bacteria 1037
587 Ga0307408_100863869 3300031548 Bacteria 826
588 Ga0307408_102436969 3300031548 Bacteria 508
589 Ga0265313_10005615 3300031595 Bacteria 9174
590 Ga0307508_10524372 3300031616 Bacteria 781
591 Ga0265314_10072472 3300031711 Bacteria 2301
592 Ga0265314_10136451 3300031711 Bacteria 1523
593 Ga0265342_10035270 3300031712 Bacteria 3063
594 Ga0265342_10369636 3300031712 Bacteria 744
595 Ga0307516_10001515 3300031730 Bacteria 31972
596 Ga0307413_10021651 3300031824 Bacteria 3447
597 Ga0307413_10094713 3300031824 Bacteria 1956
598 Ga0307413_10290959 3300031824 Bacteria 1234
599 Ga0307413_11366499 3300031824 Bacteria 622
600 Ga0307413_11919791 3300031824 Bacteria 532
601 Ga0307410_10014089 3300031852 Bacteria 4690
602 Ga0307410_10151032 3300031852 Bacteria 1729
603 Ga0307410_10219114 3300031852 Bacteria 1463
604 Ga0307410_10690565 3300031852 Bacteria 859
605 Ga0307410_11271563 3300031852 Bacteria 643
606 Ga0307410_11509947 3300031852 Bacteria 592
607 Ga0307410_11611444 3300031852 Bacteria 574
608 Ga0307406_10251448 3300031901 Bacteria 1332
609 Ga0307406_10691846 3300031901 Bacteria 850
610 Ga0307406_10793760 3300031901 Bacteria 798
611 Ga0307406_11705335 3300031901 Bacteria 558
612 Ga0307407_10050043 3300031903 Bacteria 2388
613 Ga0307407_10052488 3300031903 Bacteria 2342
614 Ga0307407_10276519 3300031903 Bacteria 1161
615 Ga0307407_11135320 3300031903 Bacteria 608
616 Ga0307412_10390078 3300031911 Bacteria 1130
617 Ga0307412_11967731 3300031911 Bacteria 540
618 Ga0307409_100039770 3300031995 Bacteria 3493
619 Ga0307409_100573146 3300031995 Bacteria 1111
620 Ga0307409_100968328 3300031995 Bacteria 867
621 Ga0307416_100051141 3300032002 Bacteria 3298
622 Ga0307416_100298750 3300032002 Bacteria 1599
623 Ga0307416_100551137 3300032002 Bacteria 1226
624 Ga0307416_100578564 3300032002 Bacteria 1200
625 Ga0307414_10247405 3300032004 Bacteria 1480
626 Ga0307414_10785528 3300032004 Bacteria 867
627 Ga0307414_11255002 3300032004 Bacteria 687
628 Ga0307414_11764175 3300032004 Bacteria 577
629 Ga0307411_10666634 3300032005 Bacteria 902
630 Ga0307411_11268801 3300032005 Bacteria 670
631 Ga0307411_11677681 3300032005 Bacteria 588
632 Ga0307415_100122561 3300032126 Bacteria 1952
633 Ga0307415_100153449 3300032126 Bacteria 1775
634 Ga0307415_100246982 3300032126 Bacteria 1447
635 Ga0307415_100323594 3300032126 Bacteria 1287
636 Ga0307415_100897852 3300032126 Bacteria 817
637 Ga0307510_10427231 3300033180 Bacteria 767
638 Ga0307510_10660083 3300033180 Bacteria 505
639 Ga0373926_0014236 3300035083 Bacteria 2702
640 Ga0373926_0101926 3300035083 Bacteria 1074
641 Ga0373934_0000188 3300035086 Bacteria 22728
642 Ga0373934_0414235 3300035086 Bacteria 564
643 Ga0373923_0029014 3300035111 Bacteria 2216
644 Ga0373923_0270273 3300035111 Bacteria 799
645 Ga0373936_0115734 3300035113 Bacteria 1142
646 Ga0373936_0349941 3300035113 Bacteria 673
647 Ga0373936_0584871 3300035113 Bacteria 523
648 Ga0373939_0037436 3300035114 Bacteria 1441
649 Ga0373939_0323733 3300035114 Bacteria 620
650 Ga0373953_0002097 3300035117 Bacteria 5950
651 Ga0373953_0018644 3300035117 Bacteria 2571
652 Ga0373954_0017630 3300035118 Bacteria 3208
653 Ga0373956_0000657 3300035119 Bacteria 14200
654 Ga0373956_0012255 3300035119 Bacteria 3551
655 Ga0373956_0108788 3300035119 Bacteria 1289
656 Ga0373957_0000118 3300035120 Bacteria 19159
657 Ga0373957_0057697 3300035120 Bacteria 1498
658 Ga0373957_0103361 3300035120 Bacteria 1142
659 Ga0373946_0044684 3300035171 Bacteria 1830
660 Ga0373946_0203683 3300035171 Bacteria 949
661 Ga0373955_0000007 3300035172 Bacteria 87917
662 Ga0373955_0068377 3300035172 Bacteria 1979
663 Ga0373955_0387236 3300035172 Bacteria 849
664 Ga0373962_0177377 3300035242 Bacteria 711
665 Ga0373924_0001424 3300035410 Bacteria 7757
666 Ga0373924_0102183 3300035410 Bacteria 1234
667 Ga0373931_0438520 3300035691 Bacteria 833
668 Ga0373931_0876909 3300035691 Bacteria 602
669 Ga0373935_0004922 3300035692 Bacteria 7848
670 Ga0373935_0125630 3300035692 Bacteria 1718
671 Ga0373935_0190152 3300035692 Bacteria 1414
672 Ga0373935_0239570 3300035692 Bacteria 1266
673 Ga0373935_0356892 3300035692 Bacteria 1043
674 Ga0373935_0377617 3300035692 Bacteria 1014
675 Ga0373935_0718997 3300035692 Bacteria 735
676 Ga0373935_1022043 3300035692 Bacteria 614
677 Ga0373927_0020243 3300035695 Bacteria 4364
678 Ga0373927_0039628 3300035695 Bacteria 3058
679 Ga0373927_1177463 3300035695 Bacteria 505
680 Ga0373933_0000002 3300035724 Bacteria 151785
681 Ga0373933_0155018 3300035724 Bacteria 1452
682 Ga0373933_0277686 3300035724 Bacteria 1082
683 Ga0373947_0000737 3300035725 Bacteria 19605
684 Ga0373947_0165078 3300035725 Bacteria 1434
685 Ga0373947_0388373 3300035725 Bacteria 940
686 Ga0373947_1113014 3300035725 Bacteria 538
687 Ga0373937_0000014 3300036401 Bacteria 151785
688 Ga0373937_0028627 3300036401 Bacteria 5043
689 Ga0373937_0030802 3300036401 Bacteria 4860
690 Ga0373937_0086326 3300036401 Bacteria 2904
691 Ga0373937_0361545 3300036401 Bacteria 1375
692 Ga0373937_0489486 3300036401 Bacteria 1168
693 Ga0373937_1022848 3300036401 Bacteria 775
694 Ga0372808_006996 3300036459 Bacteria 1535
695 Ga0373925_0001809 3300037068 Bacteria 17846
696 Ga0373925_0005477 3300037068 Bacteria 9451
697 Ga0373925_0006470 3300037068 Bacteria 8616
698 Ga0373925_0113270 3300037068 Bacteria 2097
699 Ga0373925_0201269 3300037068 Bacteria 1584
700 Ga0373925_1241001 3300037068 Bacteria 612
701 Ga0395899_0005714 3300037312 Bacteria 9654
702 Ga0395899_0015928 3300037312 Bacteria 5734
703 Ga0395899_0407825 3300037312 Bacteria 898
704 Ga0395899_0454772 3300037312 Bacteria 838
705 Ga0395899_0570113 3300037312 Bacteria 725
706 Ga0395900_0010158 3300037418 Bacteria 9627
707 Ga0395900_0021811 3300037418 Bacteria 6548
708 Ga0395900_0041112 3300037418 Bacteria 4767
709 Ga0395898_0003690 3300037466 Bacteria 17014
710 Ga0395898_0008906 3300037466 Bacteria 10572
711 Ga0395898_0217991 3300037466 Bacteria 1820
712 Ga0395898_0420890 3300037466 Bacteria 1273
713 Ga0395905_0002683 3300037471 Bacteria 19510
714 Ga0395905_0037201 3300037471 Bacteria 4571
715 Ga0436364_0111682 3300037853 Bacteria 890
716 Ga0436364_0287407 3300037853 Bacteria 132611
717 Ga0436364_1192698 3300037853 Bacteria 1585
718 Ga0436364_1489807 3300037853 Bacteria 15421
719 Ga0395901_0002847 3300038443 Bacteria 17464
720 Ga0395901_0015358 3300038443 Bacteria 7792
721 Ga0395901_0019313 3300038443 Bacteria 6967
722 Ga0395901_0083145 3300038443 Bacteria 3346
723 Ga0395901_0507636 3300038443 Bacteria 1227
724 Ga0395901_0570984 3300038443 Bacteria 1144
725 Ga0242420_126987 3300038996 Bacteria 560
726 Ga0436365_0909018 3300039437 Bacteria 655
727 Ga0436363_0236204 3300039450 Bacteria 1462
728 Ga0436363_0433468 3300039450 Bacteria 1208
729 Ga0436363_0689210 3300039450 Bacteria 752
730 Ga0436363_1449032 3300039450 Bacteria 976
731 Ga0451789_0299630 3300041443 Bacteria 1026
732 Ga0451789_0416861 3300041443 Bacteria 1659
733 Ga0451791_0719694 3300041451 Bacteria 533
734 Ga0451791_1281330 3300041451 Bacteria 599
735 Ga0451791_1359482 3300041451 Bacteria 825
736 Ga0451793_0217027 3300041452 Unclassified 572
737 Ga0451793_0625656 3300041452 Bacteria 674
738 Ga0451793_0793246 3300041452 Bacteria 2564
739 Ga0451793_1643730 3300041452 Bacteria 814
740 Ga0451795_0536464 3300041456 Bacteria 1013
741 Ga0451798_0508301 3300041458 Bacteria 1114
742 Ga0451800_0155813 3300041459 Bacteria 1750
743 Ga0451800_1416307 3300041459 Bacteria 517
744 Ga0451800_1538363 3300041459 Bacteria 560
745 Ga0451807_0123301 3300041486 Bacteria 597
746 Ga0451807_1650466 3300041486 Bacteria 597
747 Ga0451833_0170977 3300041491 Bacteria 682
748 Ga0451835_0127159 3300041492 Bacteria 536
749 Ga0451843_0771240 3300041509 Bacteria 524
750 Ga0451853_0387231 3300041512 Bacteria 559
751 Ga0451853_1209586 3300041512 Bacteria 897
752 Ga0451853_1343160 3300041512 Bacteria 930
753 Ga0450897_030162 3300042128 Bacteria 611
754 Ga0439464_0103278 3300042439 Bacteria 867
755 Ga0466969_0005025 3300044656 Bacteria 7038
756 Ga0466969_0282293 3300044656 Bacteria 752
757 Ga0466965_0752234 3300044683 Bacteria 562
758 Ga0466965_0799980 3300044683 Bacteria 546
759 Ga0466966_0005905 3300044684 Bacteria 8077
760 Ga0466966_0009417 3300044684 Bacteria 6468
761 Ga0466966_0915987 3300044684 Bacteria 529
762 Ga0466966_0926611 3300044684 Bacteria 525
763 Ga0466961_0010761 3300044693 Bacteria 5843
764 Ga0466961_0164634 3300044693 Bacteria 1381
765 Ga0466961_0273286 3300044693 Bacteria 1035
766 Ga0466961_0532126 3300044693 Bacteria 708
767 Ga0466963_0005874 3300044694 Bacteria 7235
768 Ga0466963_0117485 3300044694 Bacteria 1828
769 Ga0466963_1094914 3300044694 Bacteria 560
770 Ga0466964_0007682 3300044706 Bacteria 4036
771 Ga0466964_0018940 3300044706 Bacteria 2644
772 Ga0466964_0521994 3300044706 Bacteria 641
773 Ga0466964_0793189 3300044706 Bacteria 535
774 Ga0466971_0164387 3300044719 Bacteria 1039
775 Ga0466971_0208355 3300044719 Bacteria 924
776 Ga0466971_0686630 3300044719 Unclassified 514
777 Ga0466970_0121409 3300044765 Bacteria 1431
778 Ga0466970_0135627 3300044765 Bacteria 1354
779 Ga0466970_0142614 3300044765 Bacteria 1320
780 Ga0466970_0170935 3300044765 Bacteria 1204
781 Ga0466957_0010494 3300044842 Bacteria 5324
782 Ga0466957_0060210 3300044842 Bacteria 2328
783 Ga0466957_0153559 3300044842 Bacteria 1491
784 Ga0466957_0214085 3300044842 Bacteria 1270
785 Ga0466957_0337254 3300044842 Bacteria 1020
786 Ga0466957_0525647 3300044842 Bacteria 822
787 Ga0466957_0741379 3300044842 Bacteria 695
788 Ga0466960_0107436 3300044901 Bacteria 1445
789 Ga0466960_0127649 3300044901 Bacteria 1339
790 Ga0466960_0557122 3300044901 Bacteria 677
791 Ga0466959_0188232 3300045049 Bacteria 1441
792 Ga0466959_0317928 3300045049 Bacteria 1064
793 Ga0466959_0320834 3300045049 Bacteria 1059
794 Ga0466959_0606724 3300045049 Bacteria 736
795 Ga0466959_0945674 3300045049 Bacteria 574
796 Ga0466958_0033247 3300045836 Bacteria 3071
797 Ga0466958_0176904 3300045836 Bacteria 1353
798 Ga0466958_0253648 3300045836 Bacteria 1126
799 Ga0466958_0728616 3300045836 Bacteria 646
800 Ga0466967_0021296 3300045976 Bacteria 5261
801 Ga0466967_0134170 3300045976 Bacteria 2301
802 Ga0466967_0135714 3300045976 Bacteria 2288
803 Ga0466967_0483308 3300045976 Bacteria 1214
804 Ga0466967_0684263 3300045976 Bacteria 1015
805 Ga0466967_0887005 3300045976 Bacteria 887
806 Ga0466967_1773452 3300045976 Bacteria 614
807 Ga0495592_0000077 3300046454 Bacteria 85837
808 Ga0495592_0004580 3300046454 Bacteria 10124
809 Ga0495592_0145851 3300046454 Bacteria 1641
810 Ga0495592_0308285 3300046454 Bacteria 1027
811 Ga0495592_0372834 3300046454 Bacteria 910
812 Ga0495592_0476749 3300046454 Bacteria 778
813 Ga0495592_0535168 3300046454 Bacteria 722
814 Ga0495603_0175429 3300046455 Bacteria 1241
815 Ga0495641_0498407 3300046461 Bacteria 555
816 Ga0495651_0000019 3300046462 Bacteria 120970
817 Ga0495651_0045029 3300046462 Bacteria 3418
818 Ga0495651_0054910 3300046462 Bacteria 3061
819 Ga0495651_0083155 3300046462 Bacteria 2414
820 Ga0495651_0602431 3300046462 Bacteria 693
821 Ga0495653_0001268 3300046463 Bacteria 19539
822 Ga0495653_0016762 3300046463 Bacteria 5962
823 Ga0495653_0345006 3300046463 Bacteria 959
824 Ga0495653_0613886 3300046463 Unclassified 667
825 Ga0495650_0016153 3300046471 Bacteria 3794
826 Ga0495580_0028947 3300046472 Bacteria 4024
827 Ga0495639_0017448 3300046475 Bacteria 3118
828 Ga0495639_0521745 3300046475 Bacteria 607
829 Ga0495662_0005382 3300046476 Bacteria 6408
830 Ga0495664_0008766 3300046477 Bacteria 5649
831 Ga0495664_0049870 3300046477 Bacteria 2485
832 Ga0495664_0075798 3300046477 Bacteria 2012
833 Ga0495664_0322152 3300046477 Bacteria 932
834 Ga0495664_0359818 3300046477 Bacteria 876
835 Ga0495664_0380495 3300046477 Bacteria 848
836 Ga0495664_0586851 3300046477 Unclassified 663
837 Ga0495664_0650425 3300046477 Bacteria 625
838 Ga0495583_0143019 3300046506 Bacteria 995
839 Ga0495608_0000028 3300046511 Bacteria 151829
840 Ga0495608_0012419 3300046511 Bacteria 5912
841 Ga0495608_0017771 3300046511 Bacteria 4917
842 Ga0495608_0295359 3300046511 Bacteria 1004
843 Ga0495618_0025694 3300046514 Bacteria 3657
844 Ga0495618_0178415 3300046514 Bacteria 1350
845 Ga0495628_0001918 3300046516 Bacteria 18867
846 Ga0495628_0006885 3300046516 Bacteria 9880
847 Ga0495628_0026832 3300046516 Bacteria 4689
848 Ga0495628_0103939 3300046516 Bacteria 2190
849 Ga0495628_0237842 3300046516 Bacteria 1363
850 Ga0495628_0496787 3300046516 Bacteria 881
851 Ga0495630_0006388 3300046517 Bacteria 8381
852 Ga0495630_0102218 3300046517 Bacteria 2168
853 Ga0495630_0520624 3300046517 Unclassified 912
854 Ga0495630_0664209 3300046517 Bacteria 798
855 Ga0495632_0001505 3300046519 Bacteria 19261
856 Ga0495637_0216222 3300046520 Bacteria 699
857 Ga0495666_0002010 3300046526 Bacteria 10047
858 Ga0495666_0009785 3300046526 Bacteria 4791
859 Ga0495652_0000031 3300046529 Bacteria 151765
860 Ga0495652_0103665 3300046529 Bacteria 2302
861 Ga0495652_0309847 3300046529 Bacteria 1144
862 Ga0495652_0446218 3300046529 Bacteria 906
863 Ga0495665_0015478 3300046531 Bacteria 4107
864 Ga0495665_0548606 3300046531 Bacteria 580
865 Ga0495640_0019201 3300046533 Bacteria 5049
866 Ga0495640_0041400 3300046533 Bacteria 3219
867 Ga0495640_0071341 3300046533 Bacteria 2331
868 Ga0495640_0200721 3300046533 Bacteria 1264
869 Ga0495640_0325527 3300046533 Bacteria 951
870 Ga0495586_0005073 3300046535 Bacteria 7046
871 Ga0495586_0667811 3300046535 Bacteria 600
872 Ga0495587_0000023 3300046536 Bacteria 151763
873 Ga0495587_0016275 3300046536 Bacteria 4628
874 Ga0495587_0058223 3300046536 Bacteria 2270
875 Ga0495645_0011765 3300046543 Bacteria 6163
876 Ga0495645_0077699 3300046543 Bacteria 2386
877 Ga0495645_0187043 3300046543 Bacteria 1414
878 Ga0495645_0348635 3300046543 Bacteria 954
879 Ga0495645_0415880 3300046543 Bacteria 854
880 Ga0495645_0465015 3300046543 Bacteria 796
881 Ga0495645_0581349 3300046543 Bacteria 691
882 Ga0495645_0960812 3300046543 Bacteria 504
883 Ga0495667_0000373 3300046559 Bacteria 28432
884 Ga0495667_0000913 3300046559 Bacteria 19089
885 Ga0495667_0026848 3300046559 Bacteria 3879
886 Ga0495667_0214846 3300046559 Bacteria 1228
887 Ga0495667_0835981 3300046559 Bacteria 567
888 Ga0495668_0548487 3300046616 Bacteria 638
889 Ga0495634_0060857 3300046642 Bacteria 2511
890 Ga0495634_0883196 3300046642 Bacteria 506
891 Ga0495635_0013180 3300046663 Bacteria 5787
892 Ga0495635_0048120 3300046663 Bacteria 2939
893 Ga0495635_0097633 3300046663 Bacteria 2008
894 Ga0495635_0194617 3300046663 Bacteria 1376
895 Ga0495635_0202400 3300046663 Bacteria 1346
896 Ga0495635_0359002 3300046663 Bacteria 971
897 Ga0495588_0356262 3300046674 Bacteria 769
898 Ga0495657_0000022 3300046675 Bacteria 151837
899 Ga0495657_0044444 3300046675 Bacteria 3021
900 Ga0495657_0354777 3300046675 Bacteria 867
901 Ga0495657_0401404 3300046675 Bacteria 806
902 Ga0495599_0000174 3300046678 Bacteria 42332
903 Ga0495599_0016524 3300046678 Bacteria 4582
904 Ga0495599_0025442 3300046678 Bacteria 3705
905 Ga0495599_0058597 3300046678 Bacteria 2409
906 Ga0495599_0069003 3300046678 Bacteria 2207
907 Ga0495623_0011541 3300046679 Bacteria 5718
908 Ga0495623_0075512 3300046679 Bacteria 2092
909 Ga0495623_0311102 3300046679 Bacteria 868
910 Ga0495646_0013004 3300046680 Bacteria 5292
911 Ga0495646_0025270 3300046680 Bacteria 3736
912 Ga0495646_0040869 3300046680 Bacteria 2853
913 Ga0495646_0212791 3300046680 Bacteria 1048
914 Ga0495646_0405261 3300046680 Bacteria 708
915 Ga0495647_0051074 3300046681 Unclassified 1606
916 Ga0495647_0355221 3300046681 Bacteria 667
917 Ga0495658_0010354 3300046683 Bacteria 4664
918 Ga0495658_1015596 3300046683 Bacteria 529
919 Ga0495613_0077197 3300046689 Bacteria 2423
920 Ga0495613_0271754 3300046689 Bacteria 1179
921 Ga0495624_0905725 3300046690 Bacteria 519
922 Ga0495600_0011341 3300046809 Bacteria 5553
923 Ga0495600_0049830 3300046809 Bacteria 2732
924 Ga0495600_0501315 3300046809 Bacteria 746
925 Ga0495600_0749741 3300046809 Bacteria 584
926 Ga0495581_0326247 3300047315 Bacteria 897
927 Ga0495581_0553724 3300047315 Unclassified 667
928 Ga0495604_0000022 3300047317 Bacteria 151744
929 Ga0495604_0000132 3300047317 Bacteria 63177
930 Ga0495604_0009677 3300047317 Bacteria 7620
931 Ga0495604_0118825 3300047317 Bacteria 1916
932 Ga0495604_0772212 3300047317 Bacteria 607
933 Ga0495674_0004392 3300047319 Bacteria 13556
934 Ga0495674_0012867 3300047319 Bacteria 7880
935 Ga0495674_0022817 3300047319 Bacteria 5768
936 Ga0495674_0085661 3300047319 Bacteria 2699
937 Ga0495674_0480681 3300047319 Bacteria 995
938 Ga0495676_0061477 3300047321 Bacteria 2938
939 Ga0495676_0260381 3300047321 Bacteria 1180
940 Ga0495676_0303493 3300047321 Bacteria 1076
941 Ga0495680_0001555 3300047322 Bacteria 24556
942 Ga0495680_0039799 3300047322 Bacteria 3747
943 Ga0495680_0054859 3300047322 Bacteria 3093
944 Ga0495680_0309366 3300047322 Bacteria 1108
945 Ga0495675_0001285 3300047444 Bacteria 15206
946 Ga0495675_0086137 3300047444 Bacteria 1975
947 Ga0495675_0086933 3300047444 Bacteria 1964
948 Ga0495675_0226830 3300047444 Bacteria 1128
949 Ga0495675_0279794 3300047444 Bacteria 995
950 Ga0495684_0010588 3300047471 Bacteria 7127
951 Ga0495684_0153870 3300047471 Bacteria 1718
952 Ga0495593_0197128 3300047673 Bacteria 1012
953 Ga0495593_0651527 3300047673 Bacteria 529
954 Ga0495602_0000169 3300048088 Bacteria 60858
955 Ga0495602_0031701 3300048088 Bacteria 4992
956 Ga0495602_0135570 3300048088 Bacteria 1956
957 Ga0495602_0688943 3300048088 Bacteria 694
958 Ga0496100_0404680 3300048903 Bacteria 1040
959 Ga0496100_1181794 3300048903 Bacteria 603
960 Ga0496102_0135235 3300048905 Bacteria 2310
961 Ga0496104_0075454 3300048907 Bacteria 3210
962 Ga0496104_0800194 3300048907 Bacteria 849
963 Ga0496105_0108894 3300048908 Bacteria 2287
964 Ga0496105_0267328 3300048908 Bacteria 1382
965 Ga0496105_1004003 3300048908 Bacteria 624
966 Ga0496106_0381372 3300048909 Bacteria 1133
967 Ga0496106_0443450 3300048909 Bacteria 1043
968 Ga0496106_1183642 3300048909 Bacteria 597
969 Ga0496108_0075084 3300048911 Bacteria 2855
970 Ga0496108_0300554 3300048911 Bacteria 1398
971 Ga0496108_0586784 3300048911 Bacteria 971
972 Ga0496109_0081888 3300048912 Bacteria 2974
973 Ga0496112_0094243 3300048915 Bacteria 2964
974 Ga0496112_0541407 3300048915 Bacteria 1098
975 Ga0496112_0638487 3300048915 Bacteria 995
976 Ga0496112_1039101 3300048915 Bacteria 738
977 Ga0496113_0048622 3300048916 Bacteria 3156
978 Ga0496113_0393100 3300048916 Bacteria 1113
979 Ga0496114_0193978 3300048917 Bacteria 1778
980 Ga0496114_0894470 3300048917 Unclassified 769
981 Ga0496114_1243382 3300048917 Bacteria 631
982 Ga0496114_1562689 3300048917 Bacteria 548
983 Ga0496115_0131802 3300048918 Bacteria 2060
984 Ga0501033_0876018 3300049570 Bacteria 604
985 Ga0501036_0137951 3300049572 Bacteria 2058
986 Ga0501039_0030630 3300049575 Bacteria 4149
987 Ga0501040_0065530 3300049576 Bacteria 2502
988 Ga0501041_0045336 3300049577 Bacteria 2673
989 Ga0501042_0017499 3300049578 Bacteria 4943
990 Ga0501042_0037006 3300049578 Bacteria 3463
991 Ga0501048_0242172 3300049582 Bacteria 1280
992 Ga0501067_0000471 3300049583 Bacteria 21958
993 Ga0501067_0399902 3300049583 Bacteria 766
994 Ga0501068_0000400 3300049584 Bacteria 21980
995 Ga0501069_0001363 3300049585 Bacteria 11987
996 Ga0501071_0482249 3300049587 Bacteria 950
997 Ga0501072_0057835 3300049588 Bacteria 3056
998 Ga0501074_0722138 3300049590 Bacteria 703
999 Ga0501075_0187350 3300049591 Bacteria 1578
1000 Ga0501076_0989178 3300049592 Bacteria 693
1001 Ga0501079_0454986 3300049741 Bacteria 1005
1002 Ga0501081_0550352 3300049743 Bacteria 862
1003 Ga0501081_0696577 3300049743 Bacteria 763
1004 Ga0501044_0241222 3300049823 Bacteria 1751
1005 Ga0501044_0378082 3300049823 Bacteria 1332
1006 Ga0501045_0010962 3300049824 Bacteria 6349
1007 nmdc:mga03n38_764603_c1 3300050490 Bacteria 560
1008 nmdc:mga03n38_914024_c1 3300050490 Unclassified 516
1009 nmdc:mga00v17_145660_c1 3300050491 Bacteria 1520
1010 nmdc:mga00v17_60460_c1 3300050491 Bacteria 2327
1011 nmdc:mga00v17_813616_c1 3300050491 Bacteria 595
1012 nmdc:mga0yw44_1022012_c1 3300050492 Unclassified 559
1013 nmdc:mga0yw44_389588_c1 3300050492 Bacteria 941
1014 nmdc:mga0k408_148398_c1 3300050493 Bacteria 1396
1015 nmdc:mga0k408_58177_c1 3300050493 Bacteria 2245
1016 nmdc:mga0k408_65654_c1 3300050493 Bacteria 2113
1017 nmdc:mga06z11_175692_c1 3300050494 Bacteria 1232
1018 nmdc:mga06z11_293452_c1 3300050494 Bacteria 965
1019 nmdc:mga07m45_116862_c1 3300050496 Bacteria 1539
1020 nmdc:mga07m45_65691_c1 3300050496 Bacteria 2060
1021 nmdc:mga05p37_488298_c1 3300050507 Bacteria 1416
1022 nmdc:mga05p37_8079_c1 3300050507 Bacteria 12433
1023 nmdc:mga08y16_121804_c1 3300050511 Bacteria 2714
1024 nmdc:mga08y16_175621_c1 3300050511 Bacteria 2224
1025 nmdc:mga0n895_1050625_c1 3300050512 Bacteria 794
1026 nmdc:mga0n895_1517643_c1 3300050512 Bacteria 636
1027 nmdc:mga0n895_3349_c1 3300050512 Bacteria 12885
1028 nmdc:mga0n895_40777_c1 3300050512 Bacteria 4511
1029 nmdc:mga0n895_447392_c1 3300050512 Bacteria 1305
1030 nmdc:mga0n895_690106_c1 3300050512 Bacteria 1018
1031 nmdc:mga0rr50_162087_c1 3300050513 Bacteria 1816
1032 nmdc:mga0rr50_4906_c1 3300050513 Bacteria 7916
1033 nmdc:mga0rr50_746027_c1 3300050513 Bacteria 836
1034 nmdc:mga08x19_1330458_c1 3300050514 Bacteria 509
1035 nmdc:mga08x19_536741_c1 3300050514 Bacteria 827
1036 nmdc:mga08x19_704531_c1 3300050514 Bacteria 717
1037 nmdc:mga08x19_896287_c1 3300050514 Bacteria 630
1038 nmdc:mga0a205_203326_c1 3300050515 Bacteria 1871
1039 nmdc:mga0a205_919529_c1 3300050515 Bacteria 722
1040 nmdc:mga0sz30_198803_c1 3300050516 Unclassified 890
1041 Ga0495601_0046684 3300053077 Bacteria 2726
1042 Ga0495601_0059285 3300053077 Bacteria 2427
1043 Ga0495601_0060951 3300053077 Bacteria 2395
1044 Ga0495601_0086273 3300053077 Bacteria 2017
1045 Ga0495601_0997819 3300053077 Bacteria 526
1046 Ga0495612_0023863 3300053078 Bacteria 2456
1047 Ga0495612_0057263 3300053078 Bacteria 1609
1048 Ga0500635_0000007 3300053080 Bacteria 169379
1049 Ga0500635_0433326 3300053080 Bacteria 521
1050 Ga0495655_0001829 3300053083 Bacteria 3314
1051 Ga0495595_0003146 3300053084 Bacteria 6541
1052 Ga0495595_0182804 3300053084 Bacteria 1040
1053 Ga0495595_0186417 3300053084 Bacteria 1030
1054 Ga0495595_0291387 3300053084 Bacteria 820
1055 Ga0495595_0487289 3300053084 Bacteria 628
1056 Ga0495619_0055053 3300053085 Bacteria 2634
1057 Ga0495619_0190723 3300053085 Bacteria 1418
1058 Ga0495619_0363951 3300053085 Bacteria 1000
1059 Ga0495619_0749394 3300053085 Bacteria 662
1060 Ga0500578_0000213 3300053086 Bacteria 71211
1061 Ga0500644_0023657 3300053088 Bacteria 1868
1062 Ga0500646_0138572 3300053090 Bacteria 796
1063 Ga0500651_0107982 3300053093 Bacteria 1700
1064 Ga0500650_0193225 3300053098 Bacteria 929
1065 Ga0500572_081457 3300053111 Bacteria 1015
1066 Ga0500628_013690 3300053129 Bacteria 1519
1067 Ga0500642_0002873 3300053130 Bacteria 5120
1068 Ga0500652_000430 3300053131 Bacteria 14948
1069 Ga0500655_011150 3300053133 Bacteria 1627
1070 Ga0500658_0361323 3300053134 Bacteria 666
1071 Ga0500559_0023824 3300053136 Bacteria 2600
1072 Ga0500559_0042432 3300053136 Bacteria 1984
1073 Ga0500564_029657 3300053138 Bacteria 2521
1074 Ga0500568_0009296 3300053139 Bacteria 4681
1075 Ga0500577_0006261 3300053142 Bacteria 3269
1076 Ga0500579_058777 3300053143 Bacteria 2298
1077 Ga0500604_0013805 3300053151 Bacteria 2192
1078 Ga0500604_0024587 3300053151 Bacteria 1725
1079 Ga0500604_0205690 3300053151 Bacteria 677
1080 Ga0500622_0000631 3300053156 Bacteria 31645
1081 Ga0500622_0154784 3300053156 Bacteria 1080
1082 Ga0500570_201134 3300053724 Bacteria 604
1083 Ga0500601_007612 3300053737 Bacteria 1202
1084 Ga0501084_0305761 3300054114 Bacteria 1343
1085 Ga0501084_1737224 3300054114 Bacteria 521
1086 Ga0501082_1123901 3300060353 Bacteria 687
1087 Ga0466962_0008558 3300061719 Bacteria 4904
1088 Ga0466962_0059868 3300061719 Bacteria 1818
1089 Ga0466962_0655581 3300061719 Bacteria 537
1090 Ga0530510_0006186 3300061734 Bacteria 8321

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041459 Ga0451800_1538363 Ga0451800_1538363_272_463 62
2 3300044706 Ga0466964_0018940 Ga0466964_0018940_2078_2311 64
3 3300044765 Ga0466970_0135627 Ga0466970_0135627_689_922 64
4 3300044842 Ga0466957_0525647 Ga0466957_0525647_487_720 64
5 3300044719 Ga0466971_0686630 Ga0466971_0686630_166_396 68
6 3300044765 Ga0466970_0170935 Ga0466970_0170935_815_1045 68
7 3300044901 Ga0466960_0557122 Ga0466960_0557122_169_399 68
8 3300044693 Ga0466961_0164634 Ga0466961_0164634_1126_1359 70
9 3300061719 Ga0466962_0655581 Ga0466962_0655581_285_518 70
10 iso_pu_bacteria 2585428057 2587724890 72
11 iso_pu_bacteria 2585428058 2587736704 72
12 iso_pu_bacteria 2588253510 2588295315 72
13 iso_pu_bacteria 2643221592 2643970186 72
14 iso_pu_bacteria 2643221625 2644142416 72
15 iso_pu_bacteria 2643221648 2644275118 72
16 3300005330 Ga0070690_101141857 Ga0070690_1011418572 73
17 3300005355 Ga0070671_101841547 Ga0070671_1018415472 73
18 3300005356 Ga0070674_102180306 Ga0070674_1021803061 73
19 3300005440 Ga0070705_100608479 Ga0070705_1006084792 73
20 3300005549 Ga0070704_101868437 Ga0070704_1018684372 73
21 3300005843 Ga0068860_101068251 Ga0068860_1010682512 73
22 3300006038 Ga0075365_11041903 Ga0075365_110419032 73
23 3300006358 Ga0068871_101284369 Ga0068871_1012843692 73
24 3300009098 Ga0105245_10095768 Ga0105245_100957682 73
25 3300009148 Ga0105243_10475141 Ga0105243_104751412 73
26 3300009148 Ga0105243_11986279 Ga0105243_119862791 73
27 3300009176 Ga0105242_12282082 Ga0105242_122820822 73
28 3300009545 Ga0105237_11588062 Ga0105237_115880622 73
29 3300009553 Ga0105249_11427000 Ga0105249_114270002 73
30 3300013297 Ga0157378_11248540 Ga0157378_112485402 73
31 3300013306 Ga0163162_11183552 Ga0163162_111835522 73
32 3300014326 Ga0157380_12153166 Ga0157380_121531662 73
33 3300014968 Ga0157379_10138447 Ga0157379_101384471 73
34 3300025918 Ga0207662_10219689 Ga0207662_102196892 73
35 3300025934 Ga0207686_10627461 Ga0207686_106274612 73
36 3300025935 Ga0207709_11434122 Ga0207709_114341222 73
37 3300025942 Ga0207689_11343711 Ga0207689_113437112 73
38 3300025961 Ga0207712_11750157 Ga0207712_117501572 73
39 3300025972 Ga0207668_11557321 Ga0207668_115573211 73
40 3300026088 Ga0207641_12273826 Ga0207641_122738262 73
41 3300026095 Ga0207676_11315795 Ga0207676_113157952 73
42 3300026118 Ga0207675_101165500 Ga0207675_1011655002 73
43 3300028558 Ga0265326_10131536 Ga0265326_101315362 73
44 3300028563 Ga0265319_1063116 Ga0265319_10631162 73
45 3300028800 Ga0265338_10000241 Ga0265338_1000024138 73
46 3300028800 Ga0265338_10150506 Ga0265338_101505062 73
47 3300031240 Ga0265320_10455223 Ga0265320_104552231 73
48 3300031241 Ga0265325_10007889 Ga0265325_100078892 73
49 3300031247 Ga0265340_10226992 Ga0265340_102269922 73
50 3300031247 Ga0265340_10228124 Ga0265340_102281241 73
51 3300031249 Ga0265339_10000865 Ga0265339_1000086514 73
52 3300031249 Ga0265339_10532045 Ga0265339_105320452 73
53 3300031344 Ga0265316_10071814 Ga0265316_100718142 73
54 3300031595 Ga0265313_10005615 Ga0265313_100056157 73
55 3300031711 Ga0265314_10136451 Ga0265314_101364512 73
56 3300031712 Ga0265342_10369636 Ga0265342_103696361 73
57 3300044683 Ga0466965_0799980 Ga0466965_0799980_283_510 73
58 3300046463 Ga0495653_0613886 Ga0495653_0613886_411_635 73
59 3300046511 Ga0495608_0295359 Ga0495608_0295359_320_544 73
60 3300046517 Ga0495630_0520624 Ga0495630_0520624_437_661 73
61 3300047321 Ga0495676_0061477 Ga0495676_0061477_1874_2104 73
62 3300047322 Ga0495680_0309366 Ga0495680_0309366_472_696 73
63 3300048915 Ga0496112_0541407 Ga0496112_0541407_851_1075 73
64 3300048915 Ga0496112_0638487 Ga0496112_0638487_220_444 73
65 3300048917 Ga0496114_1562689 Ga0496114_1562689_26_250 73
66 3300050492 nmdc:mga0yw44_1022012_c1 nmdc:mga0yw44_1022012_c1_145_369 73
67 3300005343 Ga0070687_100487859 Ga0070687_1004878592 74
68 3300005367 Ga0070667_100844611 Ga0070667_1008446112 74
69 3300005456 Ga0070678_101049153 Ga0070678_1010491532 74
70 3300005843 Ga0068860_102684187 Ga0068860_1026841872 74
71 3300006038 Ga0075365_10107068 Ga0075365_101070682 74
72 3300006038 Ga0075365_10752618 Ga0075365_107526182 74
73 3300006178 Ga0075367_10433180 Ga0075367_104331802 74
74 3300009094 Ga0111539_10208014 Ga0111539_102080142 74
75 3300009094 Ga0111539_12363162 Ga0111539_123631622 74
76 3300009553 Ga0105249_10816655 Ga0105249_108166552 74
77 3300014325 Ga0163163_13055106 Ga0163163_130551062 74
78 3300014326 Ga0157380_10406487 Ga0157380_104064872 74
79 3300014745 Ga0157377_10870037 Ga0157377_108700371 74
80 3300026067 Ga0207678_11189586 Ga0207678_111895862 74
81 3300026075 Ga0207708_10975471 Ga0207708_109754711 74
82 3300027907 Ga0207428_11290146 Ga0207428_112901461 74
83 3300031824 Ga0307413_10094713 Ga0307413_100947131 74
84 3300031852 Ga0307410_10690565 Ga0307410_106905652 74
85 3300031852 Ga0307410_11271563 Ga0307410_112715631 74
86 3300031901 Ga0307406_10251448 Ga0307406_102514482 74
87 3300032002 Ga0307416_100551137 Ga0307416_1005511372 74
88 3300032126 Ga0307415_100897852 Ga0307415_1008978522 74
89 3300041443 Ga0451789_0299630 Ga0451789_0299630_29_259 74
90 3300041451 Ga0451791_1359482 Ga0451791_1359482_520_747 74
91 3300041452 Ga0451793_0217027 Ga0451793_0217027_237_464 74
92 3300041509 Ga0451843_0771240 Ga0451843_0771240_229_456 74
93 3300041512 Ga0451853_1343160 Ga0451853_1343160_37_264 74
94 3300044706 Ga0466964_0521994 Ga0466964_0521994_178_408 74
95 3300044842 Ga0466957_0741379 Ga0466957_0741379_237_467 74
96 3300044901 Ga0466960_0127649 Ga0466960_0127649_806_1036 74
97 3300045976 Ga0466967_0021296 Ga0466967_0021296_51_281 74
98 3300046477 Ga0495664_0650425 Ga0495664_0650425_327_557 74
99 3300046543 Ga0495645_0960812 Ga0495645_0960812_65_295 74
100 3300046663 Ga0495635_0194617 Ga0495635_0194617_509_739 74
101 3300048917 Ga0496114_0193978 Ga0496114_0193978_741_971 74
102 3300049570 Ga0501033_0876018 Ga0501033_0876018_92_316 74
103 3300049572 Ga0501036_0137951 Ga0501036_0137951_362_586 74
104 3300049575 Ga0501039_0030630 Ga0501039_0030630_2083_2307 74
105 3300049576 Ga0501040_0065530 Ga0501040_0065530_232_456 74
106 3300049577 Ga0501041_0045336 Ga0501041_0045336_2239_2463 74
107 3300049578 Ga0501042_0037006 Ga0501042_0037006_3049_3273 74
108 3300049582 Ga0501048_0242172 Ga0501048_0242172_145_369 74
109 3300049587 Ga0501071_0482249 Ga0501071_0482249_533_757 74
110 3300049588 Ga0501072_0057835 Ga0501072_0057835_361_585 74
111 3300049590 Ga0501074_0722138 Ga0501074_0722138_231_455 74
112 3300049591 Ga0501075_0187350 Ga0501075_0187350_526_750 74
113 3300049592 Ga0501076_0989178 Ga0501076_0989178_152_376 74
114 3300049741 Ga0501079_0454986 Ga0501079_0454986_636_860 74
115 3300049743 Ga0501081_0550352 Ga0501081_0550352_470_694 74
116 3300049824 Ga0501045_0010962 Ga0501045_0010962_4947_5171 74
117 3300050490 nmdc:mga03n38_764603_c1 nmdc:mga03n38_764603_c1_143_373 74
118 3300050494 nmdc:mga06z11_293452_c1 nmdc:mga06z11_293452_c1_453_680 74
119 3300050511 nmdc:mga08y16_175621_c1 nmdc:mga08y16_175621_c1_1743_1967 74
120 3300053077 Ga0495601_0046684 Ga0495601_0046684_2192_2422 74
121 3300054114 Ga0501084_0305761 Ga0501084_0305761_691_915 74
122 3300060353 Ga0501082_1123901 Ga0501082_1123901_380_604 74
123 3300005335 Ga0070666_10554206 Ga0070666_105542062 75
124 3300005356 Ga0070674_101404058 Ga0070674_1014040582 75
125 3300005543 Ga0070672_100314468 Ga0070672_1003144682 75
126 3300006871 Ga0075434_101208056 Ga0075434_1012080562 75
127 3300009177 Ga0105248_10428825 Ga0105248_104288252 75
128 3300025923 Ga0207681_11589750 Ga0207681_115897501 75
129 3300025940 Ga0207691_10448022 Ga0207691_104480222 75
130 3300025986 Ga0207658_10820107 Ga0207658_108201072 75
131 3300026089 Ga0207648_11438087 Ga0207648_114380871 75
132 3300027665 Ga0209983_1142946 Ga0209983_11429462 75
133 3300028381 Ga0268264_10305891 Ga0268264_103058914 75
134 3300028381 Ga0268264_11239226 Ga0268264_112392262 75
135 3300031824 Ga0307413_11366499 Ga0307413_113664992 75
136 3300050490 nmdc:mga03n38_914024_c1 nmdc:mga03n38_914024_c1_151_390 75
137 3300002705 JGI25156J39149_1000441 JGI25156J39149_100044117 76
138 3300002738 JGI25154J39366_1001707 JGI25154J39366_10017075 76
139 3300002741 JGI25157J39369_1000029 JGI25157J39369_1000029118 76
140 3300003215 JGI25153J46596_10001226 JGI25153J46596_1000122611 76
141 3300003316 rootH1_10004301 rootH1_100043012 76
142 3300003316 rootH1_10005893 rootH1_100058932 76
143 3300003316 rootH1_10013444 rootH1_100134444 76
144 3300003322 rootL2_10339283 rootL2_103392832 76
145 3300003323 rootH1_10027097 rootH1_100270973 76
146 3300003323 rootH1_10087369 rootH1_100873692 76
147 3300003323 rootH1_10170894 rootH1_101708943 76
148 3300003752 Ga0055539_1000310 Ga0055539_100031014 76
149 3300003752 Ga0055539_1000600 Ga0055539_10006007 76
150 3300003756 Ga0055533_1000010 Ga0055533_1000010387 76
151 3300003759 Ga0055525_1001518 Ga0055525_10015183 76
152 3300003790 Ga0055528_1068003 Ga0055528_10680031 76
153 3300003791 Ga0055530_10074810 Ga0055530_100748101 76
154 3300003792 Ga0055540_1030422 Ga0055540_10304222 76
155 3300003794 Ga0055531_10001045 Ga0055531_1000104510 76
156 3300005262 Ga0065165_1012529 Ga0065165_10125293 76
157 3300005293 Ga0065715_10766672 Ga0065715_107666722 76
158 3300005327 Ga0070658_10108531 Ga0070658_101085311 76
159 3300005327 Ga0070658_10385524 Ga0070658_103855242 76
160 3300005327 Ga0070658_10441595 Ga0070658_104415952 76
161 3300005328 Ga0070676_10008789 Ga0070676_100087895 76
162 3300005328 Ga0070676_10018572 Ga0070676_100185721 76
163 3300005328 Ga0070676_10937356 Ga0070676_109373561 76
164 3300005331 Ga0070670_100040204 Ga0070670_1000402042 76
165 3300005331 Ga0070670_100635295 Ga0070670_1006352952 76
166 3300005334 Ga0068869_100051754 Ga0068869_1000517544 76
167 3300005334 Ga0068869_100212462 Ga0068869_1002124623 76
168 3300005334 Ga0068869_100983923 Ga0068869_1009839232 76
169 3300005335 Ga0070666_10412331 Ga0070666_104123311 76
170 3300005336 Ga0070680_100391522 Ga0070680_1003915223 76
171 3300005337 Ga0070682_101421735 Ga0070682_1014217351 76
172 3300005338 Ga0068868_100114538 Ga0068868_1001145385 76
173 3300005338 Ga0068868_101238843 Ga0068868_1012388432 76
174 3300005339 Ga0070660_100681414 Ga0070660_1006814141 76
175 3300005339 Ga0070660_101202257 Ga0070660_1012022571 76
176 3300005339 Ga0070660_101266582 Ga0070660_1012665821 76
177 3300005340 Ga0070689_100861541 Ga0070689_1008615412 76
178 3300005343 Ga0070687_100946310 Ga0070687_1009463101 76
179 3300005344 Ga0070661_100876160 Ga0070661_1008761603 76
180 3300005344 Ga0070661_101045492 Ga0070661_1010454922 76
181 3300005347 Ga0070668_100085107 Ga0070668_1000851072 76
182 3300005353 Ga0070669_100769414 Ga0070669_1007694142 76
183 3300005353 Ga0070669_100981446 Ga0070669_1009814462 76
184 3300005353 Ga0070669_101108097 Ga0070669_1011080972 76
185 3300005354 Ga0070675_100006299 Ga0070675_1000062996 76
186 3300005355 Ga0070671_100013087 Ga0070671_1000130872 76
187 3300005355 Ga0070671_100015588 Ga0070671_10001558810 76
188 3300005355 Ga0070671_100229098 Ga0070671_1002290983 76
189 3300005356 Ga0070674_100275680 Ga0070674_1002756801 76
190 3300005364 Ga0070673_100053065 Ga0070673_1000530655 76
191 3300005364 Ga0070673_100904123 Ga0070673_1009041232 76
192 3300005365 Ga0070688_100077300 Ga0070688_1000773004 76
193 3300005365 Ga0070688_100116360 Ga0070688_1001163604 76
194 3300005366 Ga0070659_100250401 Ga0070659_1002504011 76
195 3300005366 Ga0070659_100263450 Ga0070659_1002634503 76
196 3300005366 Ga0070659_101221801 Ga0070659_1012218012 76
197 3300005367 Ga0070667_100322274 Ga0070667_1003222741 76
198 3300005367 Ga0070667_100856409 Ga0070667_1008564091 76
199 3300005367 Ga0070667_101652783 Ga0070667_1016527832 76
200 3300005406 Ga0070703_10555755 Ga0070703_105557552 76
201 3300005441 Ga0070700_100102740 Ga0070700_1001027403 76
202 3300005455 Ga0070663_101708127 Ga0070663_1017081271 76
203 3300005456 Ga0070678_100193945 Ga0070678_1001939454 76
204 3300005456 Ga0070678_100515575 Ga0070678_1005155751 76
205 3300005457 Ga0070662_100189176 Ga0070662_1001891761 76
206 3300005459 Ga0068867_100005302 Ga0068867_10000530211 76
207 3300005459 Ga0068867_100007136 Ga0068867_1000071363 76
208 3300005459 Ga0068867_100312774 Ga0068867_1003127742 76
209 3300005459 Ga0068867_100478789 Ga0068867_1004787892 76
210 3300005459 Ga0068867_101686593 Ga0068867_1016865931 76
211 3300005466 Ga0070685_10080895 Ga0070685_100808952 76
212 3300005466 Ga0070685_11044380 Ga0070685_110443801 76
213 3300005535 Ga0070684_101887998 Ga0070684_1018879981 76
214 3300005539 Ga0068853_100051167 Ga0068853_1000511673 76
215 3300005543 Ga0070672_100032455 Ga0070672_1000324551 76
216 3300005543 Ga0070672_100152541 Ga0070672_1001525413 76
217 3300005547 Ga0070693_101165555 Ga0070693_1011655552 76
218 3300005548 Ga0070665_100000098 Ga0070665_10000009885 76
219 3300005548 Ga0070665_101204944 Ga0070665_1012049442 76
220 3300005563 Ga0068855_100030535 Ga0068855_1000305354 76
221 3300005563 Ga0068855_100299317 Ga0068855_1002993172 76
222 3300005563 Ga0068855_100360939 Ga0068855_1003609392 76
223 3300005563 Ga0068855_101170619 Ga0068855_1011706193 76
224 3300005564 Ga0070664_101345284 Ga0070664_1013452841 76
225 3300005577 Ga0068857_100002542 Ga0068857_1000025427 76
226 3300005577 Ga0068857_100486677 Ga0068857_1004866771 76
227 3300005578 Ga0068854_100074461 Ga0068854_1000744613 76
228 3300005578 Ga0068854_100076760 Ga0068854_1000767602 76
229 3300005578 Ga0068854_100290993 Ga0068854_1002909932 76
230 3300005614 Ga0068856_100003174 Ga0068856_1000031743 76
231 3300005615 Ga0070702_101206654 Ga0070702_1012066541 76
232 3300005616 Ga0068852_100198830 Ga0068852_1001988303 76
233 3300005616 Ga0068852_100556722 Ga0068852_1005567222 76
234 3300005617 Ga0068859_100715138 Ga0068859_1007151382 76
235 3300005618 Ga0068864_100344319 Ga0068864_1003443193 76
236 3300005718 Ga0068866_10020806 Ga0068866_100208062 76
237 3300005718 Ga0068866_10383014 Ga0068866_103830142 76
238 3300005719 Ga0068861_100000224 Ga0068861_1000002244 76
239 3300005834 Ga0068851_10218130 Ga0068851_102181302 76
240 3300005834 Ga0068851_10967389 Ga0068851_109673891 76
241 3300005840 Ga0068870_10116133 Ga0068870_101161334 76
242 3300005841 Ga0068863_100371788 Ga0068863_1003717882 76
243 3300005841 Ga0068863_101249438 Ga0068863_1012494381 76
244 3300005842 Ga0068858_100377146 Ga0068858_1003771462 76
245 3300005842 Ga0068858_101746546 Ga0068858_1017465462 76
246 3300005843 Ga0068860_100055985 Ga0068860_1000559853 76
247 3300005843 Ga0068860_100422789 Ga0068860_1004227892 76
248 3300005844 Ga0068862_100027091 Ga0068862_1000270915 76
249 3300006038 Ga0075365_10150910 Ga0075365_101509102 76
250 3300006051 Ga0075364_10336764 Ga0075364_103367642 76
251 3300006173 Ga0070716_100362870 Ga0070716_1003628702 76
252 3300006177 Ga0075362_10159300 Ga0075362_101593001 76
253 3300006177 Ga0075362_10731284 Ga0075362_107312841 76
254 3300006178 Ga0075367_10032057 Ga0075367_100320573 76
255 3300006186 Ga0075369_10377597 Ga0075369_103775972 76
256 3300006195 Ga0075366_10003201 Ga0075366_100032019 76
257 3300006195 Ga0075366_10150430 Ga0075366_101504302 76
258 3300006195 Ga0075366_10157670 Ga0075366_101576702 76
259 3300006195 Ga0075366_10431793 Ga0075366_104317931 76
260 3300006353 Ga0075370_10118338 Ga0075370_101183382 76
261 3300006353 Ga0075370_10944159 Ga0075370_109441592 76
262 3300006358 Ga0068871_100841120 Ga0068871_1008411201 76
263 3300006358 Ga0068871_101704466 Ga0068871_1017044662 76
264 3300006871 Ga0075434_100028670 Ga0075434_1000286705 76
265 3300006881 Ga0068865_100018985 Ga0068865_1000189854 76
266 3300006881 Ga0068865_100557594 Ga0068865_1005575942 76
267 3300006931 Ga0097620_100715238 Ga0097620_1007152382 76
268 3300009093 Ga0105240_10051215 Ga0105240_100512153 76
269 3300009098 Ga0105245_10372145 Ga0105245_103721453 76
270 3300009098 Ga0105245_10410317 Ga0105245_104103172 76
271 3300009098 Ga0105245_12335318 Ga0105245_123353182 76
272 3300009148 Ga0105243_10075868 Ga0105243_100758682 76
273 3300009148 Ga0105243_10101618 Ga0105243_101016182 76
274 3300009148 Ga0105243_10213881 Ga0105243_102138811 76
275 3300009148 Ga0105243_10833584 Ga0105243_108335841 76
276 3300009174 Ga0105241_10024859 Ga0105241_100248591 76
277 3300009174 Ga0105241_12171437 Ga0105241_121714372 76
278 3300009174 Ga0105241_12417635 Ga0105241_124176351 76
279 3300009176 Ga0105242_10163736 Ga0105242_101637362 76
280 3300009177 Ga0105248_10273784 Ga0105248_102737842 76
281 3300009545 Ga0105237_10112238 Ga0105237_101122382 76
282 3300009545 Ga0105237_11592427 Ga0105237_115924271 76
283 3300009545 Ga0105237_11767370 Ga0105237_117673701 76
284 3300009551 Ga0105238_10234083 Ga0105238_102340831 76
285 3300009551 Ga0105238_10407160 Ga0105238_104071602 76
286 3300009553 Ga0105249_10658774 Ga0105249_106587742 76
287 3300009553 Ga0105249_12965765 Ga0105249_129657652 76
288 3300010375 Ga0105239_10029727 Ga0105239_100297273 76
289 3300013105 Ga0157369_10057405 Ga0157369_100574053 76
290 3300013296 Ga0157374_10690326 Ga0157374_106903263 76
291 3300013297 Ga0157378_10095544 Ga0157378_100955445 76
292 3300013297 Ga0157378_11500267 Ga0157378_115002672 76
293 3300013306 Ga0163162_10193851 Ga0163162_101938514 76
294 3300013306 Ga0163162_12180957 Ga0163162_121809572 76
295 3300013307 Ga0157372_10239661 Ga0157372_102396613 76
296 3300013308 Ga0157375_10059822 Ga0157375_100598224 76
297 3300013308 Ga0157375_10361661 Ga0157375_103616614 76
298 3300013308 Ga0157375_10555136 Ga0157375_105551362 76
299 3300013308 Ga0157375_13337343 Ga0157375_133373432 76
300 3300014325 Ga0163163_11152370 Ga0163163_111523701 76
301 3300014326 Ga0157380_10194223 Ga0157380_101942232 76
302 3300014968 Ga0157379_10054457 Ga0157379_100544573 76
303 3300014969 Ga0157376_10190417 Ga0157376_101904172 76
304 3300015262 Ga0182007_10405209 Ga0182007_104052092 76
305 3300017792 Ga0163161_10177384 Ga0163161_101773843 76
306 3300020070 Ga0206356_11133492 Ga0206356_111334921 76
307 3300020070 Ga0206356_11249086 Ga0206356_112490862 76
308 3300020081 Ga0206354_10736402 Ga0206354_107364021 76
309 3300020082 Ga0206353_11840564 Ga0206353_118405641 76
310 3300025226 Ga0209674_100003 Ga0209674_1000031721 76
311 3300025230 Ga0209563_100049 Ga0209563_100049183 76
312 3300025242 Ga0209258_100700 Ga0209258_10070015 76
313 3300025246 Ga0209646_1000257 Ga0209646_100025735 76
314 3300025250 Ga0209026_1000054 Ga0209026_100005469 76
315 3300025253 Ga0209677_100050 Ga0209677_100050140 76
316 3300025253 Ga0209677_100316 Ga0209677_10031611 76
317 3300025256 Ga0209759_1000043 Ga0209759_1000043158 76
318 3300025256 Ga0209759_1001086 Ga0209759_100108614 76
319 3300025256 Ga0209759_1007372 Ga0209759_10073722 76
320 3300025258 Ga0209129_1031800 Ga0209129_10318002 76
321 3300025273 Ga0209673_1028349 Ga0209673_10283492 76
322 3300025273 Ga0209673_1042339 Ga0209673_10423392 76
323 3300025297 Ga0209758_1000146 Ga0209758_100014646 76
324 3300025298 Ga0209050_1000303 Ga0209050_100030371 76
325 3300025303 Ga0209051_1000823 Ga0209051_100082324 76
326 3300025303 Ga0209051_1026928 Ga0209051_10269282 76
327 3300025304 Ga0209257_1000161 Ga0209257_1000161158 76
328 3300025893 Ga0207682_10460464 Ga0207682_104604641 76
329 3300025899 Ga0207642_10026857 Ga0207642_100268572 76
330 3300025903 Ga0207680_10358678 Ga0207680_103586782 76
331 3300025907 Ga0207645_10009049 Ga0207645_100090496 76
332 3300025907 Ga0207645_10034740 Ga0207645_100347401 76
333 3300025907 Ga0207645_10038721 Ga0207645_100387212 76
334 3300025908 Ga0207643_10220592 Ga0207643_102205922 76
335 3300025909 Ga0207705_10116513 Ga0207705_101165134 76
336 3300025911 Ga0207654_10131981 Ga0207654_101319813 76
337 3300025911 Ga0207654_10434129 Ga0207654_104341293 76
338 3300025913 Ga0207695_10067716 Ga0207695_100677163 76
339 3300025914 Ga0207671_10162329 Ga0207671_101623292 76
340 3300025914 Ga0207671_10771495 Ga0207671_107714951 76
341 3300025919 Ga0207657_10066537 Ga0207657_100665375 76
342 3300025919 Ga0207657_10374209 Ga0207657_103742093 76
343 3300025919 Ga0207657_10613542 Ga0207657_106135422 76
344 3300025919 Ga0207657_11488214 Ga0207657_114882142 76
345 3300025920 Ga0207649_10447022 Ga0207649_104470222 76
346 3300025923 Ga0207681_10063600 Ga0207681_100636003 76
347 3300025923 Ga0207681_10595533 Ga0207681_105955332 76
348 3300025924 Ga0207694_10187951 Ga0207694_101879511 76
349 3300025924 Ga0207694_11382103 Ga0207694_113821032 76
350 3300025925 Ga0207650_10021982 Ga0207650_100219825 76
351 3300025925 Ga0207650_10353222 Ga0207650_103532222 76
352 3300025926 Ga0207659_10025362 Ga0207659_100253625 76
353 3300025927 Ga0207687_10134285 Ga0207687_101342854 76
354 3300025931 Ga0207644_10015616 Ga0207644_100156165 76
355 3300025931 Ga0207644_10043701 Ga0207644_100437013 76
356 3300025932 Ga0207690_10191708 Ga0207690_101917082 76
357 3300025932 Ga0207690_10650980 Ga0207690_106509801 76
358 3300025932 Ga0207690_10942145 Ga0207690_109421452 76
359 3300025933 Ga0207706_10385356 Ga0207706_103853562 76
360 3300025934 Ga0207686_10161057 Ga0207686_101610572 76
361 3300025935 Ga0207709_10105761 Ga0207709_101057612 76
362 3300025935 Ga0207709_10161557 Ga0207709_101615572 76
363 3300025935 Ga0207709_10610664 Ga0207709_106106641 76
364 3300025936 Ga0207670_10555076 Ga0207670_105550762 76
365 3300025937 Ga0207669_10340291 Ga0207669_103402913 76
366 3300025938 Ga0207704_10017341 Ga0207704_100173413 76
367 3300025938 Ga0207704_10860502 Ga0207704_108605022 76
368 3300025940 Ga0207691_10025458 Ga0207691_100254581 76
369 3300025940 Ga0207691_10104170 Ga0207691_101041702 76
370 3300025941 Ga0207711_10094784 Ga0207711_100947842 76
371 3300025942 Ga0207689_10058653 Ga0207689_100586532 76
372 3300025942 Ga0207689_10178707 Ga0207689_101787073 76
373 3300025945 Ga0207679_10546889 Ga0207679_105468893 76
374 3300025949 Ga0207667_10047907 Ga0207667_100479075 76
375 3300025949 Ga0207667_10998014 Ga0207667_109980142 76
376 3300025960 Ga0207651_10016983 Ga0207651_100169832 76
377 3300025960 Ga0207651_10158756 Ga0207651_101587563 76
378 3300025961 Ga0207712_10394822 Ga0207712_103948222 76
379 3300025972 Ga0207668_10068417 Ga0207668_100684173 76
380 3300025981 Ga0207640_10025835 Ga0207640_100258353 76
381 3300025981 Ga0207640_10106473 Ga0207640_101064732 76
382 3300025986 Ga0207658_10275315 Ga0207658_102753151 76
383 3300025986 Ga0207658_11460340 Ga0207658_114603401 76
384 3300026023 Ga0207677_10072659 Ga0207677_100726592 76
385 3300026023 Ga0207677_11217122 Ga0207677_112171221 76
386 3300026035 Ga0207703_10066634 Ga0207703_100666342 76
387 3300026041 Ga0207639_10062586 Ga0207639_100625863 76
388 3300026067 Ga0207678_10415264 Ga0207678_104152642 76
389 3300026067 Ga0207678_11059552 Ga0207678_110595522 76
390 3300026075 Ga0207708_10025564 Ga0207708_100255644 76
391 3300026078 Ga0207702_10011854 Ga0207702_100118541 76
392 3300026088 Ga0207641_10579289 Ga0207641_105792892 76
393 3300026088 Ga0207641_11248355 Ga0207641_112483551 76
394 3300026089 Ga0207648_10000182 Ga0207648_1000018228 76
395 3300026089 Ga0207648_10008440 Ga0207648_100084407 76
396 3300026089 Ga0207648_10117852 Ga0207648_101178523 76
397 3300026089 Ga0207648_10857061 Ga0207648_108570612 76
398 3300026089 Ga0207648_11279528 Ga0207648_112795282 76
399 3300026089 Ga0207648_12052192 Ga0207648_120521921 76
400 3300026116 Ga0207674_10021066 Ga0207674_100210663 76
401 3300026116 Ga0207674_10090703 Ga0207674_100907032 76
402 3300026116 Ga0207674_11102786 Ga0207674_111027861 76
403 3300026118 Ga0207675_100000551 Ga0207675_1000005517 76
404 3300026118 Ga0207675_101717799 Ga0207675_1017177991 76
405 3300026142 Ga0207698_10120685 Ga0207698_101206854 76
406 3300026142 Ga0207698_10439739 Ga0207698_104397392 76
407 3300026142 Ga0207698_11351819 Ga0207698_113518192 76
408 3300026142 Ga0207698_12643693 Ga0207698_126436932 76
409 3300028379 Ga0268266_10000644 Ga0268266_100006448 76
410 3300028379 Ga0268266_11607450 Ga0268266_116074502 76
411 3300028380 Ga0268265_10042088 Ga0268265_100420882 76
412 3300028381 Ga0268264_10058416 Ga0268264_100584163 76
413 3300028381 Ga0268264_10658548 Ga0268264_106585482 76
414 3300028666 Ga0265336_10000006 Ga0265336_10000006183 76
415 3300028786 Ga0307517_10194526 Ga0307517_101945262 76
416 3300029957 Ga0265324_10026123 Ga0265324_100261232 76
417 3300031456 Ga0307513_10612822 Ga0307513_106128222 76
418 3300031548 Ga0307408_100522269 Ga0307408_1005222692 76
419 3300031548 Ga0307408_100529214 Ga0307408_1005292142 76
420 3300031548 Ga0307408_102436969 Ga0307408_1024369692 76
421 3300031616 Ga0307508_10524372 Ga0307508_105243722 76
422 3300031711 Ga0265314_10072472 Ga0265314_100724722 76
423 3300031712 Ga0265342_10035270 Ga0265342_100352703 76
424 3300031730 Ga0307516_10001515 Ga0307516_1000151513 76
425 3300031824 Ga0307413_10290959 Ga0307413_102909593 76
426 3300031824 Ga0307413_11919791 Ga0307413_119197912 76
427 3300031852 Ga0307410_10151032 Ga0307410_101510322 76
428 3300031852 Ga0307410_11509947 Ga0307410_115099471 76
429 3300031852 Ga0307410_11611444 Ga0307410_116114441 76
430 3300031901 Ga0307406_10793760 Ga0307406_107937601 76
431 3300031903 Ga0307407_10050043 Ga0307407_100500433 76
432 3300031903 Ga0307407_11135320 Ga0307407_111353202 76
433 3300031911 Ga0307412_10390078 Ga0307412_103900782 76
434 3300031995 Ga0307409_100573146 Ga0307409_1005731462 76
435 3300031995 Ga0307409_100968328 Ga0307409_1009683282 76
436 3300032004 Ga0307414_10785528 Ga0307414_107855282 76
437 3300032004 Ga0307414_11764175 Ga0307414_117641752 76
438 3300032005 Ga0307411_10666634 Ga0307411_106666341 76
439 3300032126 Ga0307415_100153449 Ga0307415_1001534493 76
440 3300032126 Ga0307415_100246982 Ga0307415_1002469822 76
441 3300033180 Ga0307510_10427231 Ga0307510_104272311 76
442 3300033180 Ga0307510_10660083 Ga0307510_106600831 76
443 3300035114 Ga0373939_0037436 Ga0373939_0037436_49_282 76
444 3300035171 Ga0373946_0203683 Ga0373946_0203683_358_591 76
445 3300035172 Ga0373955_0387236 Ga0373955_0387236_455_688 76
446 3300035692 Ga0373935_1022043 Ga0373935_1022043_110_391 76
447 3300035695 Ga0373927_0039628 Ga0373927_0039628_1938_2171 76
448 3300035725 Ga0373947_0165078 Ga0373947_0165078_272_505 76
449 3300036401 Ga0373937_0489486 Ga0373937_0489486_624_857 76
450 3300037068 Ga0373925_0005477 Ga0373925_0005477_6272_6505 76
451 3300037068 Ga0373925_0006470 Ga0373925_0006470_8253_8534 76
452 3300037068 Ga0373925_1241001 Ga0373925_1241001_300_533 76
453 3300037312 Ga0395899_0005714 Ga0395899_0005714_8620_8853 76
454 3300037312 Ga0395899_0407825 Ga0395899_0407825_415_648 76
455 3300037312 Ga0395899_0570113 Ga0395899_0570113_429_662 76
456 3300037418 Ga0395900_0010158 Ga0395900_0010158_2405_2638 76
457 3300037466 Ga0395898_0003690 Ga0395898_0003690_14578_14811 76
458 3300037471 Ga0395905_0002683 Ga0395905_0002683_9350_9583 76
459 3300038443 Ga0395901_0002847 Ga0395901_0002847_4164_4397 76
460 3300038443 Ga0395901_0015358 Ga0395901_0015358_356_589 76
461 3300041443 Ga0451789_0416861 Ga0451789_0416861_1140_1373 76
462 3300041451 Ga0451791_1281330 Ga0451791_1281330_352_585 76
463 3300041452 Ga0451793_0793246 Ga0451793_0793246_1791_2024 76
464 3300041452 Ga0451793_1643730 Ga0451793_1643730_325_558 76
465 3300041456 Ga0451795_0536464 Ga0451795_0536464_425_658 76
466 3300041458 Ga0451798_0508301 Ga0451798_0508301_580_813 76
467 3300041459 Ga0451800_0155813 Ga0451800_0155813_38_271 76
468 3300041459 Ga0451800_1416307 Ga0451800_1416307_131_403 76
469 3300041486 Ga0451807_0123301 Ga0451807_0123301_26_259 76
470 3300041486 Ga0451807_1650466 Ga0451807_1650466_352_585 76
471 3300041491 Ga0451833_0170977 Ga0451833_0170977_17_250 76
472 3300041492 Ga0451835_0127159 Ga0451835_0127159_231_464 76
473 3300041512 Ga0451853_0387231 Ga0451853_0387231_301_534 76
474 3300041512 Ga0451853_1209586 Ga0451853_1209586_318_551 76
475 3300042128 Ga0450897_030162 Ga0450897_030162_212_445 76
476 3300042439 Ga0439464_0103278 Ga0439464_0103278_612_857 76
477 3300044656 Ga0466969_0005025 Ga0466969_0005025_4546_4779 76
478 3300044656 Ga0466969_0282293 Ga0466969_0282293_357_590 76
479 3300044683 Ga0466965_0752234 Ga0466965_0752234_312_545 76
480 3300044684 Ga0466966_0005905 Ga0466966_0005905_6031_6264 76
481 3300044684 Ga0466966_0915987 Ga0466966_0915987_184_417 76
482 3300044684 Ga0466966_0926611 Ga0466966_0926611_138_371 76
483 3300044693 Ga0466961_0010761 Ga0466961_0010761_3040_3273 76
484 3300044693 Ga0466961_0273286 Ga0466961_0273286_409_642 76
485 3300044693 Ga0466961_0532126 Ga0466961_0532126_51_284 76
486 3300044694 Ga0466963_0117485 Ga0466963_0117485_1154_1387 76
487 3300044694 Ga0466963_1094914 Ga0466963_1094914_10_243 76
488 3300044706 Ga0466964_0007682 Ga0466964_0007682_406_639 76
489 3300044706 Ga0466964_0793189 Ga0466964_0793189_75_308 76
490 3300044719 Ga0466971_0164387 Ga0466971_0164387_758_991 76
491 3300044719 Ga0466971_0208355 Ga0466971_0208355_270_503 76
492 3300044765 Ga0466970_0121409 Ga0466970_0121409_1106_1339 76
493 3300044765 Ga0466970_0142614 Ga0466970_0142614_612_845 76
494 3300044842 Ga0466957_0010494 Ga0466957_0010494_3310_3543 76
495 3300044842 Ga0466957_0060210 Ga0466957_0060210_1562_1795 76
496 3300044842 Ga0466957_0214085 Ga0466957_0214085_223_456 76
497 3300044842 Ga0466957_0337254 Ga0466957_0337254_580_813 76
498 3300044901 Ga0466960_0107436 Ga0466960_0107436_103_336 76
499 3300045049 Ga0466959_0188232 Ga0466959_0188232_550_783 76
500 3300045049 Ga0466959_0317928 Ga0466959_0317928_688_921 76
501 3300045049 Ga0466959_0320834 Ga0466959_0320834_463_696 76
502 3300045049 Ga0466959_0606724 Ga0466959_0606724_378_611 76
503 3300045049 Ga0466959_0945674 Ga0466959_0945674_274_507 76
504 3300045836 Ga0466958_0033247 Ga0466958_0033247_874_1107 76
505 3300045836 Ga0466958_0176904 Ga0466958_0176904_1046_1279 76
506 3300045836 Ga0466958_0728616 Ga0466958_0728616_146_379 76
507 3300045976 Ga0466967_0135714 Ga0466967_0135714_1675_1908 76
508 3300045976 Ga0466967_0483308 Ga0466967_0483308_29_262 76
509 3300045976 Ga0466967_0684263 Ga0466967_0684263_556_789 76
510 3300045976 Ga0466967_0887005 Ga0466967_0887005_209_442 76
511 3300045976 Ga0466967_1773452 Ga0466967_1773452_143_376 76
512 3300046455 Ga0495603_0175429 Ga0495603_0175429_830_1075 76
513 3300046471 Ga0495650_0016153 Ga0495650_0016153_1733_1966 76
514 3300046475 Ga0495639_0017448 Ga0495639_0017448_175_456 76
515 3300046519 Ga0495632_0001505 Ga0495632_0001505_13727_13960 76
516 3300046520 Ga0495637_0216222 Ga0495637_0216222_448_681 76
517 3300046526 Ga0495666_0009785 Ga0495666_0009785_101_382 76
518 3300046535 Ga0495586_0005073 Ga0495586_0005073_4097_4378 76
519 3300046535 Ga0495586_0667811 Ga0495586_0667811_156_389 76
520 3300046543 Ga0495645_0465015 Ga0495645_0465015_146_379 76
521 3300046616 Ga0495668_0548487 Ga0495668_0548487_308_541 76
522 3300046681 Ga0495647_0051074 Ga0495647_0051074_1260_1541 76
523 3300046681 Ga0495647_0355221 Ga0495647_0355221_266_499 76
524 3300046683 Ga0495658_0010354 Ga0495658_0010354_3823_4056 76
525 3300046683 Ga0495658_1015596 Ga0495658_1015596_227_460 76
526 3300046689 Ga0495613_0271754 Ga0495613_0271754_83_364 76
527 3300047315 Ga0495581_0553724 Ga0495581_0553724_232_513 76
528 3300048908 Ga0496105_0267328 Ga0496105_0267328_1127_1360 76
529 3300048908 Ga0496105_1004003 Ga0496105_1004003_108_341 76
530 3300048909 Ga0496106_0381372 Ga0496106_0381372_126_359 76
531 3300048911 Ga0496108_0586784 Ga0496108_0586784_559_792 76
532 3300048915 Ga0496112_1039101 Ga0496112_1039101_178_411 76
533 3300048916 Ga0496113_0393100 Ga0496113_0393100_765_998 76
534 3300048917 Ga0496114_0894470 Ga0496114_0894470_493_738 76
535 3300048917 Ga0496114_1243382 Ga0496114_1243382_312_545 76
536 3300049823 Ga0501044_0378082 Ga0501044_0378082_898_1131 76
537 3300050491 nmdc:mga00v17_813616_c1 nmdc:mga00v17_813616_c1_94_327 76
538 3300050493 nmdc:mga0k408_148398_c1 nmdc:mga0k408_148398_c1_1055_1288 76
539 3300050493 nmdc:mga0k408_58177_c1 nmdc:mga0k408_58177_c1_566_799 76
540 3300050493 nmdc:mga0k408_65654_c1 nmdc:mga0k408_65654_c1_1698_1931 76
541 3300050494 nmdc:mga06z11_175692_c1 nmdc:mga06z11_175692_c1_413_646 76
542 3300050496 nmdc:mga07m45_116862_c1 nmdc:mga07m45_116862_c1_943_1176 76
543 3300050496 nmdc:mga07m45_65691_c1 nmdc:mga07m45_65691_c1_624_857 76
544 3300050512 nmdc:mga0n895_40777_c1 nmdc:mga0n895_40777_c1_447_680 76
545 3300050516 nmdc:mga0sz30_198803_c1 nmdc:mga0sz30_198803_c1_320_553 76
546 3300053080 Ga0500635_0000007 Ga0500635_0000007_102049_102282 76
547 3300053080 Ga0500635_0433326 Ga0500635_0433326_112_345 76
548 3300053084 Ga0495595_0487289 Ga0495595_0487289_134_367 76
549 3300053086 Ga0500578_0000213 Ga0500578_0000213_50140_50373 76
550 3300053088 Ga0500644_0023657 Ga0500644_0023657_184_417 76
551 3300053090 Ga0500646_0138572 Ga0500646_0138572_84_317 76
552 3300053093 Ga0500651_0107982 Ga0500651_0107982_69_302 76
553 3300053098 Ga0500650_0193225 Ga0500650_0193225_231_464 76
554 3300053129 Ga0500628_013690 Ga0500628_013690_248_481 76
555 3300053130 Ga0500642_0002873 Ga0500642_0002873_1286_1519 76
556 3300053131 Ga0500652_000430 Ga0500652_000430_4954_5187 76
557 3300053133 Ga0500655_011150 Ga0500655_011150_274_507 76
558 3300053134 Ga0500658_0361323 Ga0500658_0361323_177_410 76
559 3300053136 Ga0500559_0042432 Ga0500559_0042432_1529_1762 76
560 3300053138 Ga0500564_029657 Ga0500564_029657_137_370 76
561 3300053139 Ga0500568_0009296 Ga0500568_0009296_3273_3506 76
562 3300053142 Ga0500577_0006261 Ga0500577_0006261_1998_2231 76
563 3300053143 Ga0500579_058777 Ga0500579_058777_1643_1876 76
564 3300053151 Ga0500604_0013805 Ga0500604_0013805_1628_1861 76
565 3300053151 Ga0500604_0024587 Ga0500604_0024587_1180_1413 76
566 3300053151 Ga0500604_0205690 Ga0500604_0205690_80_313 76
567 3300053156 Ga0500622_0000631 Ga0500622_0000631_24248_24481 76
568 3300053156 Ga0500622_0154784 Ga0500622_0154784_497_730 76
569 3300053724 Ga0500570_201134 Ga0500570_201134_141_374 76
570 3300061719 Ga0466962_0008558 Ga0466962_0008558_4187_4420 76
571 3300061719 Ga0466962_0059868 Ga0466962_0059868_677_910 76
572 iso_pu_bacteria 8055066027 8055067178 76
573 3300009147 Ga0114129_10328013 Ga0114129_103280133 77
574 3300050507 nmdc:mga05p37_488298_c1 nmdc:mga05p37_488298_c1_182_421 77
575 3300005355 Ga0070671_100066906 Ga0070671_1000669063 78
576 3300005445 Ga0070708_101321288 Ga0070708_1013212881 78
577 3300005471 Ga0070698_101049384 Ga0070698_1010493841 78
578 3300005842 Ga0068858_100454063 Ga0068858_1004540632 78
579 3300005843 Ga0068860_100736075 Ga0068860_1007360752 78
580 3300006028 Ga0070717_10945342 Ga0070717_109453421 78
581 3300009177 Ga0105248_13097283 Ga0105248_130972831 78
582 3300014325 Ga0163163_10894919 Ga0163163_108949193 78
583 3300025931 Ga0207644_10109398 Ga0207644_101093983 78
584 3300028379 Ga0268266_11203417 Ga0268266_112034172 78
585 3300028381 Ga0268264_11029452 Ga0268264_110294522 78
586 3300028800 Ga0265338_10245479 Ga0265338_102454792 78
587 3300048903 Ga0496100_1181794 Ga0496100_1181794_91_330 78
588 3300048907 Ga0496104_0800194 Ga0496104_0800194_248_487 78
589 3300053111 Ga0500572_081457 Ga0500572_081457_653_895 78
590 3300053737 Ga0500601_007612 Ga0500601_007612_754_996 78
591 3300005338 Ga0068868_101031307 Ga0068868_1010313072 79
592 3300005341 Ga0070691_10866205 Ga0070691_108662052 79
593 3300005355 Ga0070671_101188361 Ga0070671_1011883612 79
594 3300005539 Ga0068853_102261951 Ga0068853_1022619512 79
595 3300005843 Ga0068860_100053262 Ga0068860_1000532625 79
596 3300005843 Ga0068860_101669347 Ga0068860_1016693472 79
597 3300005844 Ga0068862_100014364 Ga0068862_1000143644 79
598 3300005981 Ga0081538_10287076 Ga0081538_102870762 79
599 3300006175 Ga0070712_101747539 Ga0070712_1017475392 79
600 3300009101 Ga0105247_11623143 Ga0105247_116231431 79
601 3300009553 Ga0105249_10029368 Ga0105249_100293681 79
602 3300013306 Ga0163162_12591010 Ga0163162_125910101 79
603 3300025915 Ga0207693_11299139 Ga0207693_112991391 79
604 3300025961 Ga0207712_10009351 Ga0207712_100093515 79
605 3300025972 Ga0207668_11668200 Ga0207668_116682002 79
606 3300026118 Ga0207675_100363056 Ga0207675_1003630563 79
607 3300028379 Ga0268266_11785159 Ga0268266_117851592 79
608 3300028381 Ga0268264_10077247 Ga0268264_100772473 79
609 3300028381 Ga0268264_11250068 Ga0268264_112500682 79
610 3300031548 Ga0307408_100863869 Ga0307408_1008638692 79
611 3300031852 Ga0307410_10219114 Ga0307410_102191143 79
612 3300031901 Ga0307406_10691846 Ga0307406_106918462 79
613 3300031903 Ga0307407_10052488 Ga0307407_100524883 79
614 3300032002 Ga0307416_100298750 Ga0307416_1002987503 79
615 3300032004 Ga0307414_11255002 Ga0307414_112550022 79
616 3300032005 Ga0307411_11268801 Ga0307411_112688011 79
617 3300032005 Ga0307411_11677681 Ga0307411_116776812 79
618 3300035692 Ga0373935_0190152 Ga0373935_0190152_489_731 79
619 3300037312 Ga0395899_0015928 Ga0395899_0015928_3449_3691 79
620 3300037418 Ga0395900_0041112 Ga0395900_0041112_3937_4179 79
621 3300037466 Ga0395898_0008906 Ga0395898_0008906_7075_7317 79
622 3300037466 Ga0395898_0420890 Ga0395898_0420890_907_1149 79
623 3300037471 Ga0395905_0037201 Ga0395905_0037201_2134_2376 79
624 3300038443 Ga0395901_0083145 Ga0395901_0083145_2223_2465 79
625 3300038443 Ga0395901_0507636 Ga0395901_0507636_242_484 79
626 3300038443 Ga0395901_0570984 Ga0395901_0570984_856_1098 79
627 3300039450 Ga0436363_0433468 Ga0436363_0433468_574_816 79
628 3300044684 Ga0466966_0009417 Ga0466966_0009417_2088_2333 79
629 3300046454 Ga0495592_0476749 Ga0495592_0476749_69_311 79
630 3300046477 Ga0495664_0586851 Ga0495664_0586851_129_371 79
631 3300046533 Ga0495640_0200721 Ga0495640_0200721_748_990 79
632 3300046663 Ga0495635_0359002 Ga0495635_0359002_127_369 79
633 3300047319 Ga0495674_0085661 Ga0495674_0085661_1151_1393 79
634 3300048905 Ga0496102_0135235 Ga0496102_0135235_1996_2238 79
635 3300048909 Ga0496106_1183642 Ga0496106_1183642_284_526 79
636 3300049583 Ga0501067_0000471 Ga0501067_0000471_13579_13821 79
637 3300049584 Ga0501068_0000400 Ga0501068_0000400_4237_4479 79
638 3300049585 Ga0501069_0001363 Ga0501069_0001363_68_310 79
639 3300049743 Ga0501081_0696577 Ga0501081_0696577_387_629 79
640 3300053077 Ga0495601_0086273 Ga0495601_0086273_939_1181 79
641 3300053078 Ga0495612_0057263 Ga0495612_0057263_614_856 79
642 3300053083 Ga0495655_0001829 Ga0495655_0001829_2478_2720 79
643 3300053084 Ga0495595_0291387 Ga0495595_0291387_463_705 79
644 3300053085 Ga0495619_0363951 Ga0495619_0363951_670_912 79
645 3300054114 Ga0501084_1737224 Ga0501084_1737224_169_411 79
646 3300061734 Ga0530510_0006186 Ga0530510_0006186_265_507 79
647 3300001989 JGI24739J22299_10007711 JGI24739J22299_100077114 80
648 3300001990 JGI24737J22298_10006112 JGI24737J22298_100061122 80
649 3300005327 Ga0070658_10001118 Ga0070658_1000111815 80
650 3300005329 Ga0070683_100128063 Ga0070683_1001280632 80
651 3300005329 Ga0070683_102292911 Ga0070683_1022929111 80
652 3300005338 Ga0068868_101322194 Ga0068868_1013221942 80
653 3300005338 Ga0068868_101918070 Ga0068868_1019180701 80
654 3300005341 Ga0070691_10100826 Ga0070691_101008263 80
655 3300005341 Ga0070691_11087739 Ga0070691_110877391 80
656 3300005367 Ga0070667_100150804 Ga0070667_1001508042 80
657 3300005434 Ga0070709_10041876 Ga0070709_100418762 80
658 3300005434 Ga0070709_10100876 Ga0070709_101008763 80
659 3300005434 Ga0070709_10131650 Ga0070709_101316502 80
660 3300005435 Ga0070714_100078197 Ga0070714_1000781973 80
661 3300005435 Ga0070714_100142587 Ga0070714_1001425873 80
662 3300005435 Ga0070714_100195186 Ga0070714_1001951862 80
663 3300005435 Ga0070714_101114212 Ga0070714_1011142121 80
664 3300005436 Ga0070713_100042266 Ga0070713_1000422662 80
665 3300005436 Ga0070713_100058351 Ga0070713_1000583512 80
666 3300005436 Ga0070713_100395700 Ga0070713_1003957002 80
667 3300005436 Ga0070713_100968809 Ga0070713_1009688092 80
668 3300005437 Ga0070710_10008149 Ga0070710_100081492 80
669 3300005437 Ga0070710_10068524 Ga0070710_100685243 80
670 3300005437 Ga0070710_10234782 Ga0070710_102347822 80
671 3300005437 Ga0070710_10406824 Ga0070710_104068241 80
672 3300005439 Ga0070711_100032103 Ga0070711_1000321032 80
673 3300005439 Ga0070711_100071894 Ga0070711_1000718943 80
674 3300005439 Ga0070711_100446528 Ga0070711_1004465281 80
675 3300005439 Ga0070711_101176717 Ga0070711_1011767172 80
676 3300005439 Ga0070711_101267664 Ga0070711_1012676642 80
677 3300005445 Ga0070708_100015319 Ga0070708_1000153193 80
678 3300005445 Ga0070708_100171208 Ga0070708_1001712082 80
679 3300005445 Ga0070708_100365147 Ga0070708_1003651472 80
680 3300005445 Ga0070708_100408118 Ga0070708_1004081182 80
681 3300005445 Ga0070708_101090363 Ga0070708_1010903631 80
682 3300005455 Ga0070663_100924907 Ga0070663_1009249072 80
683 3300005458 Ga0070681_11106185 Ga0070681_111061851 80
684 3300005458 Ga0070681_12030703 Ga0070681_120307031 80
685 3300005467 Ga0070706_100002179 Ga0070706_10000217915 80
686 3300005467 Ga0070706_100006593 Ga0070706_1000065932 80
687 3300005467 Ga0070706_100026080 Ga0070706_1000260804 80
688 3300005467 Ga0070706_100084698 Ga0070706_1000846983 80
689 3300005467 Ga0070706_100094365 Ga0070706_1000943655 80
690 3300005467 Ga0070706_100100824 Ga0070706_1001008243 80
691 3300005467 Ga0070706_100215065 Ga0070706_1002150652 80
692 3300005468 Ga0070707_100000181 Ga0070707_10000018141 80
693 3300005468 Ga0070707_100021236 Ga0070707_1000212363 80
694 3300005468 Ga0070707_100034951 Ga0070707_1000349515 80
695 3300005468 Ga0070707_100041325 Ga0070707_1000413254 80
696 3300005468 Ga0070707_100073713 Ga0070707_1000737132 80
697 3300005468 Ga0070707_100272643 Ga0070707_1002726432 80
698 3300005468 Ga0070707_100299894 Ga0070707_1002998943 80
699 3300005468 Ga0070707_100449540 Ga0070707_1004495402 80
700 3300005471 Ga0070698_100000823 Ga0070698_10000082325 80
701 3300005471 Ga0070698_100032848 Ga0070698_1000328482 80
702 3300005471 Ga0070698_100039524 Ga0070698_1000395247 80
703 3300005471 Ga0070698_100062232 Ga0070698_1000622322 80
704 3300005471 Ga0070698_100069878 Ga0070698_1000698783 80
705 3300005471 Ga0070698_101347771 Ga0070698_1013477712 80
706 3300005471 Ga0070698_101513069 Ga0070698_1015130692 80
707 3300005518 Ga0070699_100196129 Ga0070699_1001961291 80
708 3300005518 Ga0070699_100420997 Ga0070699_1004209972 80
709 3300005518 Ga0070699_100477398 Ga0070699_1004773981 80
710 3300005530 Ga0070679_100342572 Ga0070679_1003425721 80
711 3300005530 Ga0070679_101150447 Ga0070679_1011504472 80
712 3300005539 Ga0068853_100142950 Ga0068853_1001429501 80
713 3300005545 Ga0070695_101016895 Ga0070695_1010168951 80
714 3300005548 Ga0070665_100383965 Ga0070665_1003839653 80
715 3300005563 Ga0068855_101182450 Ga0068855_1011824502 80
716 3300005577 Ga0068857_100141255 Ga0068857_1001412553 80
717 3300005614 Ga0068856_100160421 Ga0068856_1001604212 80
718 3300005617 Ga0068859_100608831 Ga0068859_1006088312 80
719 3300005719 Ga0068861_100216964 Ga0068861_1002169642 80
720 3300005937 Ga0081455_10117093 Ga0081455_101170933 80
721 3300005937 Ga0081455_10837403 Ga0081455_108374032 80
722 3300006028 Ga0070717_10003520 Ga0070717_100035208 80
723 3300006028 Ga0070717_10056983 Ga0070717_100569833 80
724 3300006028 Ga0070717_10114234 Ga0070717_101142342 80
725 3300006028 Ga0070717_10164230 Ga0070717_101642302 80
726 3300006028 Ga0070717_10209095 Ga0070717_102090952 80
727 3300006028 Ga0070717_10482504 Ga0070717_104825041 80
728 3300006051 Ga0075364_10175284 Ga0075364_101752843 80
729 3300006058 Ga0075432_10332979 Ga0075432_103329791 80
730 3300006163 Ga0070715_10000176 Ga0070715_100001768 80
731 3300006163 Ga0070715_10031319 Ga0070715_100313192 80
732 3300006173 Ga0070716_100008911 Ga0070716_1000089112 80
733 3300006173 Ga0070716_100036121 Ga0070716_1000361211 80
734 3300006175 Ga0070712_100018221 Ga0070712_1000182212 80
735 3300006175 Ga0070712_100062788 Ga0070712_1000627882 80
736 3300006175 Ga0070712_100629266 Ga0070712_1006292662 80
737 3300006175 Ga0070712_100636151 Ga0070712_1006361512 80
738 3300006175 Ga0070712_100677919 Ga0070712_1006779191 80
739 3300006237 Ga0097621_101191406 Ga0097621_1011914062 80
740 3300006844 Ga0075428_100045905 Ga0075428_1000459052 80
741 3300006852 Ga0075433_10339717 Ga0075433_103397172 80
742 3300006852 Ga0075433_10804141 Ga0075433_108041411 80
743 3300006871 Ga0075434_100678140 Ga0075434_1006781402 80
744 3300006871 Ga0075434_101123829 Ga0075434_1011238292 80
745 3300006871 Ga0075434_102272759 Ga0075434_1022727591 80
746 3300006914 Ga0075436_100254164 Ga0075436_1002541642 80
747 3300006914 Ga0075436_100703571 Ga0075436_1007035712 80
748 3300006931 Ga0097620_100608775 Ga0097620_1006087752 80
749 3300007076 Ga0075435_100148711 Ga0075435_1001487113 80
750 3300007076 Ga0075435_100498732 Ga0075435_1004987322 80
751 3300007076 Ga0075435_101520899 Ga0075435_1015208992 80
752 3300007265 Ga0099794_10030975 Ga0099794_100309752 80
753 3300009094 Ga0111539_10252618 Ga0111539_102526182 80
754 3300009094 Ga0111539_10946339 Ga0111539_109463392 80
755 3300009094 Ga0111539_12314771 Ga0111539_123147712 80
756 3300009101 Ga0105247_11164917 Ga0105247_111649172 80
757 3300009147 Ga0114129_10006236 Ga0114129_100062363 80
758 3300009147 Ga0114129_10504407 Ga0114129_105044072 80
759 3300009148 Ga0105243_12413153 Ga0105243_124131531 80
760 3300009177 Ga0105248_11720954 Ga0105248_117209542 80
761 3300010375 Ga0105239_11080390 Ga0105239_110803902 80
762 3300011119 Ga0105246_10043217 Ga0105246_100432173 80
763 3300011119 Ga0105246_10245213 Ga0105246_102452133 80
764 3300013105 Ga0157369_11323755 Ga0157369_113237551 80
765 3300013105 Ga0157369_11705469 Ga0157369_117054691 80
766 3300013306 Ga0163162_13197703 Ga0163162_131977031 80
767 3300013307 Ga0157372_10208871 Ga0157372_102088713 80
768 3300013307 Ga0157372_11908803 Ga0157372_119088031 80
769 3300013308 Ga0157375_11154994 Ga0157375_111549942 80
770 3300020075 Ga0206349_1895358 Ga0206349_18953581 80
771 3300020080 Ga0206350_10821574 Ga0206350_108215741 80
772 3300020081 Ga0206354_10029914 Ga0206354_100299142 80
773 3300020081 Ga0206354_10133078 Ga0206354_101330781 80
774 3300020082 Ga0206353_10114996 Ga0206353_101149962 80
775 3300020082 Ga0206353_11094267 Ga0206353_110942672 80
776 3300020610 Ga0154015_1051813 Ga0154015_10518132 80
777 3300021377 Ga0213874_10167468 Ga0213874_101674681 80
778 3300021377 Ga0213874_10261085 Ga0213874_102610852 80
779 3300021388 Ga0213875_10000250 Ga0213875_1000025035 80
780 3300021388 Ga0213875_10002024 Ga0213875_100020248 80
781 3300021388 Ga0213875_10137605 Ga0213875_101376052 80
782 3300021388 Ga0213875_10312986 Ga0213875_103129862 80
783 3300022467 Ga0224712_10299958 Ga0224712_102999581 80
784 3300024225 Ga0224572_1010763 Ga0224572_10107633 80
785 3300024225 Ga0224572_1028651 Ga0224572_10286512 80
786 3300025885 Ga0207653_10130289 Ga0207653_101302891 80
787 3300025898 Ga0207692_10003218 Ga0207692_100032187 80
788 3300025898 Ga0207692_10011020 Ga0207692_100110202 80
789 3300025898 Ga0207692_10063073 Ga0207692_100630732 80
790 3300025898 Ga0207692_10108524 Ga0207692_101085242 80
791 3300025898 Ga0207692_10494689 Ga0207692_104946891 80
792 3300025904 Ga0207647_10011526 Ga0207647_100115263 80
793 3300025905 Ga0207685_10022260 Ga0207685_100222602 80
794 3300025905 Ga0207685_10053473 Ga0207685_100534732 80
795 3300025905 Ga0207685_10211536 Ga0207685_102115362 80
796 3300025906 Ga0207699_10004354 Ga0207699_100043543 80
797 3300025906 Ga0207699_10006055 Ga0207699_100060556 80
798 3300025906 Ga0207699_10034155 Ga0207699_100341553 80
799 3300025906 Ga0207699_10259178 Ga0207699_102591782 80
800 3300025909 Ga0207705_10000251 Ga0207705_100002518 80
801 3300025910 Ga0207684_10001290 Ga0207684_100012903 80
802 3300025910 Ga0207684_10001319 Ga0207684_1000131912 80
803 3300025910 Ga0207684_10004232 Ga0207684_100042324 80
804 3300025910 Ga0207684_10113089 Ga0207684_101130893 80
805 3300025910 Ga0207684_10148325 Ga0207684_101483251 80
806 3300025910 Ga0207684_10487563 Ga0207684_104875632 80
807 3300025910 Ga0207684_10533858 Ga0207684_105338582 80
808 3300025915 Ga0207693_10008315 Ga0207693_100083156 80
809 3300025915 Ga0207693_10036042 Ga0207693_100360425 80
810 3300025915 Ga0207693_10083441 Ga0207693_100834412 80
811 3300025916 Ga0207663_10004647 Ga0207663_100046473 80
812 3300025916 Ga0207663_10038404 Ga0207663_100384041 80
813 3300025916 Ga0207663_11016512 Ga0207663_110165122 80
814 3300025922 Ga0207646_10000690 Ga0207646_1000069025 80
815 3300025922 Ga0207646_10001669 Ga0207646_1000166920 80
816 3300025922 Ga0207646_10015118 Ga0207646_100151184 80
817 3300025922 Ga0207646_10077937 Ga0207646_100779372 80
818 3300025922 Ga0207646_10082304 Ga0207646_100823043 80
819 3300025922 Ga0207646_10189946 Ga0207646_101899462 80
820 3300025922 Ga0207646_10305638 Ga0207646_103056383 80
821 3300025922 Ga0207646_10474438 Ga0207646_104744381 80
822 3300025922 Ga0207646_10666003 Ga0207646_106660032 80
823 3300025928 Ga0207700_10007201 Ga0207700_100072013 80
824 3300025928 Ga0207700_10029880 Ga0207700_100298805 80
825 3300025928 Ga0207700_10055685 Ga0207700_100556852 80
826 3300025928 Ga0207700_10113240 Ga0207700_101132402 80
827 3300025928 Ga0207700_10493236 Ga0207700_104932362 80
828 3300025929 Ga0207664_10000650 Ga0207664_100006503 80
829 3300025929 Ga0207664_10004546 Ga0207664_100045463 80
830 3300025929 Ga0207664_10004907 Ga0207664_100049073 80
831 3300025929 Ga0207664_10215369 Ga0207664_102153691 80
832 3300025939 Ga0207665_10002376 Ga0207665_1000237615 80
833 3300025939 Ga0207665_10011702 Ga0207665_100117027 80
834 3300025939 Ga0207665_10059382 Ga0207665_100593823 80
835 3300025944 Ga0207661_10048992 Ga0207661_100489923 80
836 3300025949 Ga0207667_10760691 Ga0207667_107606912 80
837 3300025986 Ga0207658_10591418 Ga0207658_105914181 80
838 3300026023 Ga0207677_11785345 Ga0207677_117853451 80
839 3300026078 Ga0207702_10480004 Ga0207702_104800042 80
840 3300026116 Ga0207674_10251700 Ga0207674_102517004 80
841 3300026118 Ga0207675_100303940 Ga0207675_1003039402 80
842 3300027671 Ga0209588_1033098 Ga0209588_10330982 80
843 3300027907 Ga0207428_10878981 Ga0207428_108789812 80
844 3300028379 Ga0268266_10773250 Ga0268266_107732502 80
845 3300028800 Ga0265338_10003796 Ga0265338_100037962 80
846 3300030522 Ga0307512_10108540 Ga0307512_101085402 80
847 3300031456 Ga0307513_10555678 Ga0307513_105556781 80
848 3300032002 Ga0307416_100578564 Ga0307416_1005785642 80
849 3300032126 Ga0307415_100323594 Ga0307415_1003235943 80
850 3300035083 Ga0373926_0014236 Ga0373926_0014236_1147_1392 80
851 3300035083 Ga0373926_0101926 Ga0373926_0101926_606_851 80
852 3300035086 Ga0373934_0000188 Ga0373934_0000188_2531_2776 80
853 3300035086 Ga0373934_0414235 Ga0373934_0414235_178_423 80
854 3300035111 Ga0373923_0029014 Ga0373923_0029014_1153_1398 80
855 3300035111 Ga0373923_0270273 Ga0373923_0270273_496_741 80
856 3300035113 Ga0373936_0115734 Ga0373936_0115734_331_576 80
857 3300035113 Ga0373936_0349941 Ga0373936_0349941_134_379 80
858 3300035113 Ga0373936_0584871 Ga0373936_0584871_76_321 80
859 3300035114 Ga0373939_0323733 Ga0373939_0323733_121_366 80
860 3300035117 Ga0373953_0002097 Ga0373953_0002097_3068_3313 80
861 3300035117 Ga0373953_0018644 Ga0373953_0018644_915_1160 80
862 3300035118 Ga0373954_0017630 Ga0373954_0017630_736_981 80
863 3300035119 Ga0373956_0000657 Ga0373956_0000657_2081_2326 80
864 3300035119 Ga0373956_0012255 Ga0373956_0012255_2352_2597 80
865 3300035119 Ga0373956_0108788 Ga0373956_0108788_805_1050 80
866 3300035120 Ga0373957_0000118 Ga0373957_0000118_8685_8930 80
867 3300035120 Ga0373957_0057697 Ga0373957_0057697_857_1102 80
868 3300035120 Ga0373957_0103361 Ga0373957_0103361_766_1011 80
869 3300035171 Ga0373946_0044684 Ga0373946_0044684_1529_1774 80
870 3300035172 Ga0373955_0000007 Ga0373955_0000007_79083_79328 80
871 3300035172 Ga0373955_0068377 Ga0373955_0068377_886_1131 80
872 3300035242 Ga0373962_0177377 Ga0373962_0177377_364_609 80
873 3300035410 Ga0373924_0001424 Ga0373924_0001424_4180_4425 80
874 3300035410 Ga0373924_0102183 Ga0373924_0102183_354_599 80
875 3300035691 Ga0373931_0438520 Ga0373931_0438520_393_638 80
876 3300035691 Ga0373931_0876909 Ga0373931_0876909_22_267 80
877 3300035692 Ga0373935_0004922 Ga0373935_0004922_4756_5001 80
878 3300035692 Ga0373935_0125630 Ga0373935_0125630_1416_1661 80
879 3300035692 Ga0373935_0239570 Ga0373935_0239570_144_389 80
880 3300035692 Ga0373935_0356892 Ga0373935_0356892_751_996 80
881 3300035692 Ga0373935_0377617 Ga0373935_0377617_520_765 80
882 3300035692 Ga0373935_0718997 Ga0373935_0718997_78_323 80
883 3300035695 Ga0373927_0020243 Ga0373927_0020243_2313_2558 80
884 3300035695 Ga0373927_1177463 Ga0373927_1177463_101_346 80
885 3300035724 Ga0373933_0000002 Ga0373933_0000002_142925_143170 80
886 3300035724 Ga0373933_0155018 Ga0373933_0155018_398_643 80
887 3300035724 Ga0373933_0277686 Ga0373933_0277686_579_824 80
888 3300035725 Ga0373947_0000737 Ga0373947_0000737_11521_11766 80
889 3300035725 Ga0373947_0388373 Ga0373947_0388373_638_883 80
890 3300035725 Ga0373947_1113014 Ga0373947_1113014_142_387 80
891 3300036401 Ga0373937_0000014 Ga0373937_0000014_8616_8861 80
892 3300036401 Ga0373937_0028627 Ga0373937_0028627_546_791 80
893 3300036401 Ga0373937_0030802 Ga0373937_0030802_4261_4506 80
894 3300036401 Ga0373937_0086326 Ga0373937_0086326_1752_1997 80
895 3300036401 Ga0373937_0361545 Ga0373937_0361545_564_809 80
896 3300036401 Ga0373937_1022848 Ga0373937_1022848_332_577 80
897 3300036459 Ga0372808_006996 Ga0372808_006996_242_487 80
898 3300037068 Ga0373925_0001809 Ga0373925_0001809_13659_13904 80
899 3300037068 Ga0373925_0113270 Ga0373925_0113270_1662_1907 80
900 3300037068 Ga0373925_0201269 Ga0373925_0201269_559_804 80
901 3300037312 Ga0395899_0454772 Ga0395899_0454772_125_373 80
902 3300037418 Ga0395900_0021811 Ga0395900_0021811_866_1114 80
903 3300037466 Ga0395898_0217991 Ga0395898_0217991_569_817 80
904 3300037853 Ga0436364_0111682 Ga0436364_0111682_486_731 80
905 3300037853 Ga0436364_0287407 Ga0436364_0287407_94002_94247 80
906 3300037853 Ga0436364_1192698 Ga0436364_1192698_505_750 80
907 3300037853 Ga0436364_1489807 Ga0436364_1489807_7484_7729 80
908 3300038443 Ga0395901_0019313 Ga0395901_0019313_6188_6436 80
909 3300038996 Ga0242420_126987 Ga0242420_126987_124_369 80
910 3300039437 Ga0436365_0909018 Ga0436365_0909018_143_388 80
911 3300039450 Ga0436363_0236204 Ga0436363_0236204_360_605 80
912 3300039450 Ga0436363_0689210 Ga0436363_0689210_83_328 80
913 3300039450 Ga0436363_1449032 Ga0436363_1449032_332_577 80
914 3300041451 Ga0451791_0719694 Ga0451791_0719694_124_372 80
915 3300041452 Ga0451793_0625656 Ga0451793_0625656_195_443 80
916 3300044694 Ga0466963_0005874 Ga0466963_0005874_6493_6738 80
917 3300044842 Ga0466957_0153559 Ga0466957_0153559_45_290 80
918 3300045836 Ga0466958_0253648 Ga0466958_0253648_163_408 80
919 3300045976 Ga0466967_0134170 Ga0466967_0134170_1876_2121 80
920 3300046454 Ga0495592_0000077 Ga0495592_0000077_76977_77222 80
921 3300046454 Ga0495592_0004580 Ga0495592_0004580_7444_7689 80
922 3300046454 Ga0495592_0145851 Ga0495592_0145851_1028_1273 80
923 3300046454 Ga0495592_0308285 Ga0495592_0308285_671_916 80
924 3300046454 Ga0495592_0372834 Ga0495592_0372834_535_780 80
925 3300046454 Ga0495592_0535168 Ga0495592_0535168_67_312 80
926 3300046461 Ga0495641_0498407 Ga0495641_0498407_229_474 80
927 3300046462 Ga0495651_0000019 Ga0495651_0000019_8616_8861 80
928 3300046462 Ga0495651_0045029 Ga0495651_0045029_2409_2654 80
929 3300046462 Ga0495651_0054910 Ga0495651_0054910_1051_1296 80
930 3300046462 Ga0495651_0083155 Ga0495651_0083155_225_470 80
931 3300046462 Ga0495651_0602431 Ga0495651_0602431_44_289 80
932 3300046463 Ga0495653_0001268 Ga0495653_0001268_10679_10924 80
933 3300046463 Ga0495653_0016762 Ga0495653_0016762_3947_4192 80
934 3300046463 Ga0495653_0345006 Ga0495653_0345006_129_374 80
935 3300046472 Ga0495580_0028947 Ga0495580_0028947_53_298 80
936 3300046475 Ga0495639_0521745 Ga0495639_0521745_192_437 80
937 3300046476 Ga0495662_0005382 Ga0495662_0005382_6097_6342 80
938 3300046477 Ga0495664_0008766 Ga0495664_0008766_4704_4949 80
939 3300046477 Ga0495664_0049870 Ga0495664_0049870_729_974 80
940 3300046477 Ga0495664_0075798 Ga0495664_0075798_295_540 80
941 3300046477 Ga0495664_0322152 Ga0495664_0322152_643_888 80
942 3300046477 Ga0495664_0359818 Ga0495664_0359818_84_329 80
943 3300046477 Ga0495664_0380495 Ga0495664_0380495_514_759 80
944 3300046506 Ga0495583_0143019 Ga0495583_0143019_308_553 80
945 3300046511 Ga0495608_0000028 Ga0495608_0000028_142917_143162 80
946 3300046511 Ga0495608_0012419 Ga0495608_0012419_5456_5701 80
947 3300046511 Ga0495608_0017771 Ga0495608_0017771_4129_4374 80
948 3300046514 Ga0495618_0025694 Ga0495618_0025694_1355_1600 80
949 3300046514 Ga0495618_0178415 Ga0495618_0178415_611_856 80
950 3300046516 Ga0495628_0001918 Ga0495628_0001918_8393_8638 80
951 3300046516 Ga0495628_0006885 Ga0495628_0006885_9432_9677 80
952 3300046516 Ga0495628_0026832 Ga0495628_0026832_769_1014 80
953 3300046516 Ga0495628_0103939 Ga0495628_0103939_1298_1543 80
954 3300046516 Ga0495628_0237842 Ga0495628_0237842_274_519 80
955 3300046516 Ga0495628_0496787 Ga0495628_0496787_217_462 80
956 3300046517 Ga0495630_0006388 Ga0495630_0006388_6134_6379 80
957 3300046517 Ga0495630_0102218 Ga0495630_0102218_1186_1431 80
958 3300046517 Ga0495630_0664209 Ga0495630_0664209_259_504 80
959 3300046526 Ga0495666_0002010 Ga0495666_0002010_7962_8207 80
960 3300046529 Ga0495652_0000031 Ga0495652_0000031_142905_143150 80
961 3300046529 Ga0495652_0103665 Ga0495652_0103665_259_504 80
962 3300046529 Ga0495652_0309847 Ga0495652_0309847_533_778 80
963 3300046529 Ga0495652_0446218 Ga0495652_0446218_392_637 80
964 3300046531 Ga0495665_0015478 Ga0495665_0015478_3776_4021 80
965 3300046531 Ga0495665_0548606 Ga0495665_0548606_113_358 80
966 3300046533 Ga0495640_0019201 Ga0495640_0019201_1968_2213 80
967 3300046533 Ga0495640_0041400 Ga0495640_0041400_2939_3184 80
968 3300046533 Ga0495640_0071341 Ga0495640_0071341_973_1218 80
969 3300046533 Ga0495640_0325527 Ga0495640_0325527_480_725 80
970 3300046536 Ga0495587_0000023 Ga0495587_0000023_8594_8839 80
971 3300046536 Ga0495587_0016275 Ga0495587_0016275_204_449 80
972 3300046536 Ga0495587_0058223 Ga0495587_0058223_998_1243 80
973 3300046543 Ga0495645_0011765 Ga0495645_0011765_5715_5960 80
974 3300046543 Ga0495645_0077699 Ga0495645_0077699_1606_1851 80
975 3300046543 Ga0495645_0187043 Ga0495645_0187043_102_347 80
976 3300046543 Ga0495645_0348635 Ga0495645_0348635_200_445 80
977 3300046543 Ga0495645_0415880 Ga0495645_0415880_117_362 80
978 3300046543 Ga0495645_0581349 Ga0495645_0581349_359_604 80
979 3300046559 Ga0495667_0000373 Ga0495667_0000373_27012_27257 80
980 3300046559 Ga0495667_0000913 Ga0495667_0000913_8615_8860 80
981 3300046559 Ga0495667_0026848 Ga0495667_0026848_2553_2798 80
982 3300046559 Ga0495667_0214846 Ga0495667_0214846_86_331 80
983 3300046559 Ga0495667_0835981 Ga0495667_0835981_282_527 80
984 3300046642 Ga0495634_0060857 Ga0495634_0060857_264_509 80
985 3300046642 Ga0495634_0883196 Ga0495634_0883196_223_468 80
986 3300046663 Ga0495635_0013180 Ga0495635_0013180_32_277 80
987 3300046663 Ga0495635_0048120 Ga0495635_0048120_142_387 80
988 3300046663 Ga0495635_0097633 Ga0495635_0097633_523_768 80
989 3300046663 Ga0495635_0202400 Ga0495635_0202400_54_299 80
990 3300046674 Ga0495588_0356262 Ga0495588_0356262_309_554 80
991 3300046675 Ga0495657_0000022 Ga0495657_0000022_142925_143170 80
992 3300046675 Ga0495657_0044444 Ga0495657_0044444_212_457 80
993 3300046675 Ga0495657_0354777 Ga0495657_0354777_543_788 80
994 3300046675 Ga0495657_0401404 Ga0495657_0401404_492_737 80
995 3300046678 Ga0495599_0000174 Ga0495599_0000174_38865_39110 80
996 3300046678 Ga0495599_0016524 Ga0495599_0016524_922_1167 80
997 3300046678 Ga0495599_0025442 Ga0495599_0025442_2909_3154 80
998 3300046678 Ga0495599_0058597 Ga0495599_0058597_1127_1372 80
999 3300046678 Ga0495599_0069003 Ga0495599_0069003_1873_2118 80
1000 3300046679 Ga0495623_0011541 Ga0495623_0011541_2894_3139 80
1001 3300046679 Ga0495623_0075512 Ga0495623_0075512_392_637 80
1002 3300046679 Ga0495623_0311102 Ga0495623_0311102_428_673 80
1003 3300046680 Ga0495646_0013004 Ga0495646_0013004_2518_2763 80
1004 3300046680 Ga0495646_0025270 Ga0495646_0025270_76_321 80
1005 3300046680 Ga0495646_0040869 Ga0495646_0040869_537_782 80
1006 3300046680 Ga0495646_0212791 Ga0495646_0212791_560_805 80
1007 3300046680 Ga0495646_0405261 Ga0495646_0405261_302_547 80
1008 3300046689 Ga0495613_0077197 Ga0495613_0077197_1909_2154 80
1009 3300046690 Ga0495624_0905725 Ga0495624_0905725_244_489 80
1010 3300046809 Ga0495600_0011341 Ga0495600_0011341_844_1089 80
1011 3300046809 Ga0495600_0049830 Ga0495600_0049830_1629_1874 80
1012 3300046809 Ga0495600_0501315 Ga0495600_0501315_86_331 80
1013 3300046809 Ga0495600_0749741 Ga0495600_0749741_264_509 80
1014 3300047315 Ga0495581_0326247 Ga0495581_0326247_505_750 80
1015 3300047317 Ga0495604_0000022 Ga0495604_0000022_142884_143129 80
1016 3300047317 Ga0495604_0000132 Ga0495604_0000132_50125_50370 80
1017 3300047317 Ga0495604_0009677 Ga0495604_0009677_6156_6401 80
1018 3300047317 Ga0495604_0118825 Ga0495604_0118825_1223_1468 80
1019 3300047317 Ga0495604_0772212 Ga0495604_0772212_134_379 80
1020 3300047319 Ga0495674_0004392 Ga0495674_0004392_2300_2545 80
1021 3300047319 Ga0495674_0012867 Ga0495674_0012867_6444_6689 80
1022 3300047319 Ga0495674_0022817 Ga0495674_0022817_4085_4330 80
1023 3300047319 Ga0495674_0480681 Ga0495674_0480681_125_370 80
1024 3300047321 Ga0495676_0260381 Ga0495676_0260381_922_1167 80
1025 3300047321 Ga0495676_0303493 Ga0495676_0303493_558_803 80
1026 3300047322 Ga0495680_0001555 Ga0495680_0001555_8614_8859 80
1027 3300047322 Ga0495680_0039799 Ga0495680_0039799_490_735 80
1028 3300047322 Ga0495680_0054859 Ga0495680_0054859_2064_2309 80
1029 3300047444 Ga0495675_0001285 Ga0495675_0001285_6346_6591 80
1030 3300047444 Ga0495675_0086137 Ga0495675_0086137_381_626 80
1031 3300047444 Ga0495675_0086933 Ga0495675_0086933_264_509 80
1032 3300047444 Ga0495675_0226830 Ga0495675_0226830_312_557 80
1033 3300047444 Ga0495675_0279794 Ga0495675_0279794_137_382 80
1034 3300047471 Ga0495684_0010588 Ga0495684_0010588_6840_7085 80
1035 3300047471 Ga0495684_0153870 Ga0495684_0153870_392_637 80
1036 3300047673 Ga0495593_0197128 Ga0495593_0197128_728_973 80
1037 3300047673 Ga0495593_0651527 Ga0495593_0651527_145_390 80
1038 3300048088 Ga0495602_0000169 Ga0495602_0000169_8616_8861 80
1039 3300048088 Ga0495602_0031701 Ga0495602_0031701_4411_4656 80
1040 3300048088 Ga0495602_0135570 Ga0495602_0135570_1041_1286 80
1041 3300048088 Ga0495602_0688943 Ga0495602_0688943_398_643 80
1042 3300048903 Ga0496100_0404680 Ga0496100_0404680_206_451 80
1043 3300048907 Ga0496104_0075454 Ga0496104_0075454_690_935 80
1044 3300048908 Ga0496105_0108894 Ga0496105_0108894_84_329 80
1045 3300048909 Ga0496106_0443450 Ga0496106_0443450_489_734 80
1046 3300048911 Ga0496108_0075084 Ga0496108_0075084_1518_1763 80
1047 3300048911 Ga0496108_0300554 Ga0496108_0300554_418_666 80
1048 3300048912 Ga0496109_0081888 Ga0496109_0081888_2282_2527 80
1049 3300048915 Ga0496112_0094243 Ga0496112_0094243_2490_2735 80
1050 3300048916 Ga0496113_0048622 Ga0496113_0048622_1979_2224 80
1051 3300048918 Ga0496115_0131802 Ga0496115_0131802_121_366 80
1052 3300049578 Ga0501042_0017499 Ga0501042_0017499_3739_3984 80
1053 3300049583 Ga0501067_0399902 Ga0501067_0399902_128_373 80
1054 3300049823 Ga0501044_0241222 Ga0501044_0241222_58_306 80
1055 3300050491 nmdc:mga00v17_145660_c1 nmdc:mga00v17_145660_c1_369_614 80
1056 3300050491 nmdc:mga00v17_60460_c1 nmdc:mga00v17_60460_c1_1824_2069 80
1057 3300050492 nmdc:mga0yw44_389588_c1 nmdc:mga0yw44_389588_c1_275_523 80
1058 3300050507 nmdc:mga05p37_8079_c1 nmdc:mga05p37_8079_c1_5410_5655 80
1059 3300050511 nmdc:mga08y16_121804_c1 nmdc:mga08y16_121804_c1_1393_1638 80
1060 3300050512 nmdc:mga0n895_1050625_c1 nmdc:mga0n895_1050625_c1_369_614 80
1061 3300050512 nmdc:mga0n895_1517643_c1 nmdc:mga0n895_1517643_c1_257_502 80
1062 3300050512 nmdc:mga0n895_3349_c1 nmdc:mga0n895_3349_c1_5022_5267 80
1063 3300050512 nmdc:mga0n895_447392_c1 nmdc:mga0n895_447392_c1_188_433 80
1064 3300050512 nmdc:mga0n895_690106_c1 nmdc:mga0n895_690106_c1_210_455 80
1065 3300050513 nmdc:mga0rr50_162087_c1 nmdc:mga0rr50_162087_c1_187_432 80
1066 3300050513 nmdc:mga0rr50_4906_c1 nmdc:mga0rr50_4906_c1_7383_7628 80
1067 3300050513 nmdc:mga0rr50_746027_c1 nmdc:mga0rr50_746027_c1_189_434 80
1068 3300050514 nmdc:mga08x19_1330458_c1 nmdc:mga08x19_1330458_c1_155_400 80
1069 3300050514 nmdc:mga08x19_536741_c1 nmdc:mga08x19_536741_c1_534_779 80
1070 3300050514 nmdc:mga08x19_704531_c1 nmdc:mga08x19_704531_c1_63_308 80
1071 3300050514 nmdc:mga08x19_896287_c1 nmdc:mga08x19_896287_c1_195_440 80
1072 3300050515 nmdc:mga0a205_203326_c1 nmdc:mga0a205_203326_c1_1144_1389 80
1073 3300050515 nmdc:mga0a205_919529_c1 nmdc:mga0a205_919529_c1_99_344 80
1074 3300053077 Ga0495601_0059285 Ga0495601_0059285_2147_2392 80
1075 3300053077 Ga0495601_0060951 Ga0495601_0060951_499_744 80
1076 3300053077 Ga0495601_0997819 Ga0495601_0997819_89_334 80
1077 3300053078 Ga0495612_0023863 Ga0495612_0023863_637_882 80
1078 3300053084 Ga0495595_0003146 Ga0495595_0003146_2620_2865 80
1079 3300053084 Ga0495595_0182804 Ga0495595_0182804_80_325 80
1080 3300053084 Ga0495595_0186417 Ga0495595_0186417_732_977 80
1081 3300053085 Ga0495619_0055053 Ga0495619_0055053_1644_1889 80
1082 3300053085 Ga0495619_0190723 Ga0495619_0190723_289_534 80
1083 3300053085 Ga0495619_0749394 Ga0495619_0749394_81_326 80
1084 3300053136 Ga0500559_0023824 Ga0500559_0023824_1679_1924 80
1085 3300000549 LJQas_1000976 LJQas_10009767 83
1086 3300000549 LJQas_1001572 LJQas_10015723 83
1087 3300031548 Ga0307408_100026964 Ga0307408_1000269645 83
1088 3300031824 Ga0307413_10021651 Ga0307413_100216514 83
1089 3300031852 Ga0307410_10014089 Ga0307410_100140896 83
1090 3300031901 Ga0307406_11705335 Ga0307406_117053351 83
1091 3300031903 Ga0307407_10276519 Ga0307407_102765191 83
1092 3300031911 Ga0307412_11967731 Ga0307412_119677311 83
1093 3300031995 Ga0307409_100039770 Ga0307409_1000397706 83
1094 3300032002 Ga0307416_100051141 Ga0307416_1000511414 83
1095 3300032004 Ga0307414_10247405 Ga0307414_102474051 83
1096 3300032126 Ga0307415_100122561 Ga0307415_1001225612 83

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10944

DUF2630

Protein of unknown function (DUF2630)

14

93

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v6u-assembly1.cif.gz_BW promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes 0.8564 1 64
8btr-assembly1.cif.gz_Li giardia ribosome in pre-t hybrid state (d2) 0.8338 1 62
4afl-assembly2.cif.gz_F the crystal structure of the ing4 dimerization domain reveals the functional organization of the ing family of chromatin binding proteins. 0.8028 3 64
4afl-assembly3.cif.gz_D the crystal structure of the ing4 dimerization domain reveals the functional organization of the ing family of chromatin binding proteins. 0.7894 4 64
3vpv-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa tsi2 0.7872 1 56
ID Description Score Start End Superfamily
af_Q9HGM9_19_131_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8665 32 64 1.25.40.10
af_O04482_225_309_1.20.58.860 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.866 6 64 1.20.58.860
1lrzA03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8331 3 63 1.20.58.90
af_A0A0R0EY02_5_123_1.20.5.4130 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.814 3 60 1.20.5.4130
af_I1JNT6_11_252_3.30.900.20 Alpha Beta;2-Layer Sandwich;Cell Cycle, Spindle Assembly Checkpoint Protein; Chain A; 0.8107 4 56 3.30.900.20
ID Description Score Start End GO Terms
AF-A0A0B8MZF6-F1-model_v4 Transcriptional regulator 0.9127 1 79 GO:0003677
GO:0003700
GO:0009058
GO:0030170
AF-A0A424YL92-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8984 6 56 GO:0016301
AF-A0A1S9M7U1-F1-model_v4 DUF2630 domain-containing protein 0.892 1 83
AF-A0A542QSC6-F1-model_v4 Zinc-binding alcohol dehydrogenase family protein 0.88 1 83
AF-A0A212RIA7-F1-model_v4 Transcriptional regulator, AraC family with amidase-like domain 0.8767 1 83 GO:0003700
GO:0043565

Feature Viewer

pLDDT pTM Quality
86.89 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map