F489980
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1096 | 440 | 1090 | 79 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10117093|Ga0081455_101170933 |
| Length | 93 |
| Sequence | VTPGALASYGRAMDDKEILGHIDELIATEHQLRTKLAAGELSSEEEHAQLRSAEEALDQCWDLLRQRRARREYGEDPSAAVPRPANQVEGYLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 5 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 6 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 7 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 11 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 100 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 114 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 152 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 153 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 155 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 162 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 235 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 236 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 238 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 241 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 242 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 243 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 244 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 247 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 248 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 249 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 250 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 251 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 252 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 253 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 254 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 255 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 256 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 259 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 260 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 261 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 262 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 263 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 264 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 265 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 268 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 269 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 273 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 284 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 286 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 287 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 288 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 289 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 290 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 291 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 292 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 293 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 294 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 299 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 301 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 302 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 303 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 304 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 305 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 306 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 307 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 308 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 309 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 310 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 311 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 312 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 313 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 314 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 315 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 316 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 317 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 318 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 370 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 371 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 372 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 377 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 378 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 398 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 401 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 402 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 403 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 410 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 413 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 417 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 418 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 419 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 420 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 421 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 422 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 423 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 424 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 425 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 426 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 428 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 430 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 431 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 432 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 433 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 434 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 435 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 436 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 439 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 440 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.18 |
| Metatranscriptomes | 1.19 |
| Isolates | 0.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.39 |
| Nodule | 0 |
| Rhizoplane | 3.83 |
| Rhizosphere | 84.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000976 | 3300000549 | Bacteria | 4401 |
| 2 | LJQas_1001572 | 3300000549 | Bacteria | 3370 |
| 3 | JGI24739J22299_10007711 | 3300001989 | Bacteria | 4026 |
| 4 | JGI24737J22298_10006112 | 3300001990 | Bacteria | 4125 |
| 5 | JGI25156J39149_1000441 | 3300002705 | Bacteria | 25512 |
| 6 | JGI25154J39366_1001707 | 3300002738 | Bacteria | 7190 |
| 7 | JGI25157J39369_1000029 | 3300002741 | Bacteria | 146928 |
| 8 | JGI25153J46596_10001226 | 3300003215 | Bacteria | 15462 |
| 9 | rootH1_10004301 | 3300003316 | Bacteria | 2946 |
| 10 | rootH1_10004301 | 3300003323 | Bacteria | 21275 |
| 11 | rootH1_10005893 | 3300003316 | Bacteria | 1508 |
| 12 | rootH1_10013444 | 3300003316 | Bacteria | 15245 |
| 13 | rootL2_10339283 | 3300003322 | Bacteria | 1360 |
| 14 | rootH1_10027097 | 3300003323 | Bacteria | 3091 |
| 15 | rootH1_10087369 | 3300003323 | Bacteria | 8042 |
| 16 | rootH1_10170894 | 3300003323 | Bacteria | 1540 |
| 17 | Ga0055539_1000310 | 3300003752 | Bacteria | 25571 |
| 18 | Ga0055539_1000600 | 3300003752 | Bacteria | 9986 |
| 19 | Ga0055533_1000010 | 3300003756 | Bacteria | 491196 |
| 20 | Ga0055525_1001518 | 3300003759 | Bacteria | 3957 |
| 21 | Ga0055528_1068003 | 3300003790 | Bacteria | 651 |
| 22 | Ga0055530_10074810 | 3300003791 | Bacteria | 723 |
| 23 | Ga0055540_1030422 | 3300003792 | Bacteria | 1253 |
| 24 | Ga0055531_10001045 | 3300003794 | Bacteria | 21867 |
| 25 | Ga0065165_1012529 | 3300005262 | Bacteria | 3447 |
| 26 | Ga0065715_10766672 | 3300005293 | Bacteria | 623 |
| 27 | Ga0070658_10001118 | 3300005327 | Bacteria | 22898 |
| 28 | Ga0070658_10108531 | 3300005327 | Bacteria | 2297 |
| 29 | Ga0070658_10385524 | 3300005327 | Bacteria | 1203 |
| 30 | Ga0070658_10441595 | 3300005327 | Bacteria | 1121 |
| 31 | Ga0070676_10008789 | 3300005328 | Bacteria | 5451 |
| 32 | Ga0070676_10018572 | 3300005328 | Bacteria | 3855 |
| 33 | Ga0070676_10937356 | 3300005328 | Bacteria | 647 |
| 34 | Ga0070683_100128063 | 3300005329 | Bacteria | 2401 |
| 35 | Ga0070683_102292911 | 3300005329 | Bacteria | 518 |
| 36 | Ga0070690_101141857 | 3300005330 | Bacteria | 619 |
| 37 | Ga0070670_100040204 | 3300005331 | Bacteria | 4021 |
| 38 | Ga0070670_100635295 | 3300005331 | Bacteria | 957 |
| 39 | Ga0068869_100051754 | 3300005334 | Bacteria | 2980 |
| 40 | Ga0068869_100212462 | 3300005334 | Bacteria | 1530 |
| 41 | Ga0068869_100983923 | 3300005334 | Bacteria | 734 |
| 42 | Ga0070666_10412331 | 3300005335 | Unclassified | 972 |
| 43 | Ga0070666_10554206 | 3300005335 | Bacteria | 836 |
| 44 | Ga0070680_100391522 | 3300005336 | Unclassified | 1184 |
| 45 | Ga0070682_101421735 | 3300005337 | Bacteria | 594 |
| 46 | Ga0068868_100114538 | 3300005338 | Bacteria | 2194 |
| 47 | Ga0068868_101031307 | 3300005338 | Bacteria | 754 |
| 48 | Ga0068868_101238843 | 3300005338 | Bacteria | 691 |
| 49 | Ga0068868_101322194 | 3300005338 | Bacteria | 670 |
| 50 | Ga0068868_101918070 | 3300005338 | Bacteria | 561 |
| 51 | Ga0070660_100681414 | 3300005339 | Bacteria | 861 |
| 52 | Ga0070660_101202257 | 3300005339 | Bacteria | 643 |
| 53 | Ga0070660_101266582 | 3300005339 | Bacteria | 625 |
| 54 | Ga0070689_100861541 | 3300005340 | Bacteria | 800 |
| 55 | Ga0070691_10100826 | 3300005341 | Bacteria | 1434 |
| 56 | Ga0070691_10866205 | 3300005341 | Bacteria | 555 |
| 57 | Ga0070691_11087739 | 3300005341 | Bacteria | 503 |
| 58 | Ga0070687_100487859 | 3300005343 | Bacteria | 827 |
| 59 | Ga0070687_100946310 | 3300005343 | Bacteria | 621 |
| 60 | Ga0070661_100876160 | 3300005344 | Bacteria | 740 |
| 61 | Ga0070661_101045492 | 3300005344 | Bacteria | 679 |
| 62 | Ga0070668_100085107 | 3300005347 | Bacteria | 2485 |
| 63 | Ga0070669_100769414 | 3300005353 | Bacteria | 817 |
| 64 | Ga0070669_100981446 | 3300005353 | Bacteria | 724 |
| 65 | Ga0070669_101108097 | 3300005353 | Bacteria | 682 |
| 66 | Ga0070675_100006299 | 3300005354 | Bacteria | 9107 |
| 67 | Ga0070671_100013087 | 3300005355 | Bacteria | 6685 |
| 68 | Ga0070671_100015588 | 3300005355 | Bacteria | 6142 |
| 69 | Ga0070671_100066906 | 3300005355 | Bacteria | 2995 |
| 70 | Ga0070671_100229098 | 3300005355 | Bacteria | 1577 |
| 71 | Ga0070671_101188361 | 3300005355 | Bacteria | 671 |
| 72 | Ga0070671_101841547 | 3300005355 | Bacteria | 538 |
| 73 | Ga0070674_100275680 | 3300005356 | Bacteria | 1331 |
| 74 | Ga0070674_101404058 | 3300005356 | Bacteria | 625 |
| 75 | Ga0070674_102180306 | 3300005356 | Unclassified | 506 |
| 76 | Ga0070673_100053065 | 3300005364 | Bacteria | 3183 |
| 77 | Ga0070673_100904123 | 3300005364 | Bacteria | 819 |
| 78 | Ga0070688_100077300 | 3300005365 | Bacteria | 2144 |
| 79 | Ga0070688_100116360 | 3300005365 | Bacteria | 1785 |
| 80 | Ga0070659_100250401 | 3300005366 | Bacteria | 1468 |
| 81 | Ga0070659_100263450 | 3300005366 | Bacteria | 1430 |
| 82 | Ga0070659_101221801 | 3300005366 | Bacteria | 665 |
| 83 | Ga0070667_100150804 | 3300005367 | Bacteria | 2042 |
| 84 | Ga0070667_100322274 | 3300005367 | Bacteria | 1395 |
| 85 | Ga0070667_100844611 | 3300005367 | Bacteria | 851 |
| 86 | Ga0070667_100856409 | 3300005367 | Bacteria | 845 |
| 87 | Ga0070667_101652783 | 3300005367 | Bacteria | 602 |
| 88 | Ga0070703_10555755 | 3300005406 | Bacteria | 524 |
| 89 | Ga0070709_10041876 | 3300005434 | Bacteria | 2824 |
| 90 | Ga0070709_10100876 | 3300005434 | Bacteria | 1923 |
| 91 | Ga0070709_10131650 | 3300005434 | Bacteria | 1708 |
| 92 | Ga0070714_100078197 | 3300005435 | Bacteria | 2875 |
| 93 | Ga0070714_100142587 | 3300005435 | Bacteria | 2152 |
| 94 | Ga0070714_100195186 | 3300005435 | Bacteria | 1849 |
| 95 | Ga0070714_101114212 | 3300005435 | Bacteria | 769 |
| 96 | Ga0070713_100042266 | 3300005436 | Bacteria | 3719 |
| 97 | Ga0070713_100058351 | 3300005436 | Bacteria | 3219 |
| 98 | Ga0070713_100395700 | 3300005436 | Bacteria | 1289 |
| 99 | Ga0070713_100968809 | 3300005436 | Bacteria | 820 |
| 100 | Ga0070710_10008149 | 3300005437 | Bacteria | 5094 |
| 101 | Ga0070710_10068524 | 3300005437 | Bacteria | 2039 |
| 102 | Ga0070710_10234782 | 3300005437 | Bacteria | 1172 |
| 103 | Ga0070710_10406824 | 3300005437 | Bacteria | 913 |
| 104 | Ga0070711_100032103 | 3300005439 | Bacteria | 3489 |
| 105 | Ga0070711_100071894 | 3300005439 | Bacteria | 2439 |
| 106 | Ga0070711_100446528 | 3300005439 | Bacteria | 1058 |
| 107 | Ga0070711_101176717 | 3300005439 | Bacteria | 662 |
| 108 | Ga0070711_101267664 | 3300005439 | Bacteria | 639 |
| 109 | Ga0070705_100608479 | 3300005440 | Bacteria | 846 |
| 110 | Ga0070700_100102740 | 3300005441 | Bacteria | 1886 |
| 111 | Ga0070708_100015319 | 3300005445 | Bacteria | 6328 |
| 112 | Ga0070708_100171208 | 3300005445 | Bacteria | 2027 |
| 113 | Ga0070708_100365147 | 3300005445 | Bacteria | 1361 |
| 114 | Ga0070708_100408118 | 3300005445 | Bacteria | 1281 |
| 115 | Ga0070708_101090363 | 3300005445 | Bacteria | 748 |
| 116 | Ga0070708_101321288 | 3300005445 | Bacteria | 673 |
| 117 | Ga0070663_100924907 | 3300005455 | Bacteria | 755 |
| 118 | Ga0070663_101708127 | 3300005455 | Bacteria | 563 |
| 119 | Ga0070678_100193945 | 3300005456 | Bacteria | 1672 |
| 120 | Ga0070678_100515575 | 3300005456 | Bacteria | 1057 |
| 121 | Ga0070678_101049153 | 3300005456 | Bacteria | 751 |
| 122 | Ga0070662_100189176 | 3300005457 | Bacteria | 1627 |
| 123 | Ga0070681_11106185 | 3300005458 | Bacteria | 713 |
| 124 | Ga0070681_12030703 | 3300005458 | Bacteria | 503 |
| 125 | Ga0068867_100005302 | 3300005459 | Bacteria | 9104 |
| 126 | Ga0068867_100007136 | 3300005459 | Bacteria | 7896 |
| 127 | Ga0068867_100312774 | 3300005459 | Bacteria | 1298 |
| 128 | Ga0068867_100478789 | 3300005459 | Bacteria | 1066 |
| 129 | Ga0068867_101686593 | 3300005459 | Bacteria | 594 |
| 130 | Ga0070685_10080895 | 3300005466 | Bacteria | 1947 |
| 131 | Ga0070685_11044380 | 3300005466 | Bacteria | 615 |
| 132 | Ga0070706_100002179 | 3300005467 | Bacteria | 19922 |
| 133 | Ga0070706_100006593 | 3300005467 | Bacteria | 10947 |
| 134 | Ga0070706_100026080 | 3300005467 | Bacteria | 5377 |
| 135 | Ga0070706_100084698 | 3300005467 | Bacteria | 2937 |
| 136 | Ga0070706_100094365 | 3300005467 | Bacteria | 2776 |
| 137 | Ga0070706_100100824 | 3300005467 | Bacteria | 2683 |
| 138 | Ga0070706_100215065 | 3300005467 | Bacteria | 1794 |
| 139 | Ga0070707_100000181 | 3300005468 | Bacteria | 62074 |
| 140 | Ga0070707_100021236 | 3300005468 | Bacteria | 6137 |
| 141 | Ga0070707_100034951 | 3300005468 | Bacteria | 4792 |
| 142 | Ga0070707_100041325 | 3300005468 | Bacteria | 4413 |
| 143 | Ga0070707_100073713 | 3300005468 | Bacteria | 3291 |
| 144 | Ga0070707_100272643 | 3300005468 | Bacteria | 1645 |
| 145 | Ga0070707_100299894 | 3300005468 | Bacteria | 1561 |
| 146 | Ga0070707_100449540 | 3300005468 | Bacteria | 1249 |
| 147 | Ga0070698_100000823 | 3300005471 | Bacteria | 33938 |
| 148 | Ga0070698_100032848 | 3300005471 | Bacteria | 5375 |
| 149 | Ga0070698_100039524 | 3300005471 | Bacteria | 4855 |
| 150 | Ga0070698_100062232 | 3300005471 | Bacteria | 3765 |
| 151 | Ga0070698_100069878 | 3300005471 | Bacteria | 3525 |
| 152 | Ga0070698_101049384 | 3300005471 | Bacteria | 763 |
| 153 | Ga0070698_101347771 | 3300005471 | Bacteria | 664 |
| 154 | Ga0070698_101513069 | 3300005471 | Bacteria | 622 |
| 155 | Ga0070699_100196129 | 3300005518 | Unclassified | 1795 |
| 156 | Ga0070699_100420997 | 3300005518 | Bacteria | 1209 |
| 157 | Ga0070699_100477398 | 3300005518 | Bacteria | 1131 |
| 158 | Ga0070679_100342572 | 3300005530 | Bacteria | 1443 |
| 159 | Ga0070679_101150447 | 3300005530 | Bacteria | 721 |
| 160 | Ga0070684_101887998 | 3300005535 | Bacteria | 564 |
| 161 | Ga0068853_100051167 | 3300005539 | Bacteria | 3555 |
| 162 | Ga0068853_100142950 | 3300005539 | Bacteria | 2149 |
| 163 | Ga0068853_102261951 | 3300005539 | Bacteria | 527 |
| 164 | Ga0070672_100032455 | 3300005543 | Bacteria | 3940 |
| 165 | Ga0070672_100152541 | 3300005543 | Bacteria | 1912 |
| 166 | Ga0070672_100314468 | 3300005543 | Bacteria | 1330 |
| 167 | Ga0070695_101016895 | 3300005545 | Bacteria | 675 |
| 168 | Ga0070693_101165555 | 3300005547 | Bacteria | 590 |
| 169 | Ga0070665_100000098 | 3300005548 | Bacteria | 164407 |
| 170 | Ga0070665_100383965 | 3300005548 | Bacteria | 1412 |
| 171 | Ga0070665_101204944 | 3300005548 | Bacteria | 768 |
| 172 | Ga0070704_101868437 | 3300005549 | Bacteria | 556 |
| 173 | Ga0068855_100030535 | 3300005563 | Bacteria | 6444 |
| 174 | Ga0068855_100299317 | 3300005563 | Bacteria | 1782 |
| 175 | Ga0068855_100360939 | 3300005563 | Bacteria | 1598 |
| 176 | Ga0068855_101170619 | 3300005563 | Bacteria | 801 |
| 177 | Ga0068855_101182450 | 3300005563 | Bacteria | 796 |
| 178 | Ga0070664_101345284 | 3300005564 | Bacteria | 675 |
| 179 | Ga0068857_100002542 | 3300005577 | Bacteria | 14936 |
| 180 | Ga0068857_100141255 | 3300005577 | Bacteria | 2177 |
| 181 | Ga0068857_100486677 | 3300005577 | Bacteria | 1157 |
| 182 | Ga0068854_100074461 | 3300005578 | Bacteria | 2491 |
| 183 | Ga0068854_100076760 | 3300005578 | Bacteria | 2456 |
| 184 | Ga0068854_100290993 | 3300005578 | Bacteria | 1318 |
| 185 | Ga0068856_100003174 | 3300005614 | Bacteria | 16729 |
| 186 | Ga0068856_100160421 | 3300005614 | Bacteria | 2259 |
| 187 | Ga0070702_101206654 | 3300005615 | Bacteria | 610 |
| 188 | Ga0068852_100198830 | 3300005616 | Bacteria | 1896 |
| 189 | Ga0068852_100556722 | 3300005616 | Bacteria | 1147 |
| 190 | Ga0068859_100608831 | 3300005617 | Bacteria | 1185 |
| 191 | Ga0068859_100715138 | 3300005617 | Bacteria | 1092 |
| 192 | Ga0068864_100344319 | 3300005618 | Bacteria | 1405 |
| 193 | Ga0068866_10020806 | 3300005718 | Bacteria | 3012 |
| 194 | Ga0068866_10383014 | 3300005718 | Bacteria | 902 |
| 195 | Ga0068861_100000224 | 3300005719 | Bacteria | 30748 |
| 196 | Ga0068861_100216964 | 3300005719 | Bacteria | 1614 |
| 197 | Ga0068851_10218130 | 3300005834 | Bacteria | 1071 |
| 198 | Ga0068851_10967389 | 3300005834 | Unclassified | 536 |
| 199 | Ga0068870_10116133 | 3300005840 | Bacteria | 1535 |
| 200 | Ga0068863_100371788 | 3300005841 | Bacteria | 1395 |
| 201 | Ga0068863_101249438 | 3300005841 | Bacteria | 749 |
| 202 | Ga0068858_100377146 | 3300005842 | Bacteria | 1361 |
| 203 | Ga0068858_100454063 | 3300005842 | Bacteria | 1235 |
| 204 | Ga0068858_101746546 | 3300005842 | Bacteria | 614 |
| 205 | Ga0068860_100053262 | 3300005843 | Bacteria | 3848 |
| 206 | Ga0068860_100055985 | 3300005843 | Bacteria | 3749 |
| 207 | Ga0068860_100422789 | 3300005843 | Bacteria | 1321 |
| 208 | Ga0068860_100736075 | 3300005843 | Bacteria | 997 |
| 209 | Ga0068860_101068251 | 3300005843 | Unclassified | 826 |
| 210 | Ga0068860_101669347 | 3300005843 | Bacteria | 659 |
| 211 | Ga0068860_102684187 | 3300005843 | Bacteria | 517 |
| 212 | Ga0068862_100014364 | 3300005844 | Bacteria | 6568 |
| 213 | Ga0068862_100027091 | 3300005844 | Bacteria | 4822 |
| 214 | Ga0081455_10117093 | 3300005937 | Bacteria | 2106 |
| 215 | Ga0081455_10837403 | 3300005937 | Bacteria | 575 |
| 216 | Ga0081538_10287076 | 3300005981 | Bacteria | 609 |
| 217 | Ga0070717_10003520 | 3300006028 | Bacteria | 11220 |
| 218 | Ga0070717_10056983 | 3300006028 | Bacteria | 3230 |
| 219 | Ga0070717_10114234 | 3300006028 | Bacteria | 2306 |
| 220 | Ga0070717_10164230 | 3300006028 | Bacteria | 1928 |
| 221 | Ga0070717_10209095 | 3300006028 | Bacteria | 1712 |
| 222 | Ga0070717_10482504 | 3300006028 | Bacteria | 1119 |
| 223 | Ga0070717_10945342 | 3300006028 | Bacteria | 785 |
| 224 | Ga0075365_10107068 | 3300006038 | Bacteria | 1919 |
| 225 | Ga0075365_10150910 | 3300006038 | Bacteria | 1616 |
| 226 | Ga0075365_10752618 | 3300006038 | Bacteria | 688 |
| 227 | Ga0075365_11041903 | 3300006038 | Unclassified | 576 |
| 228 | Ga0075364_10175284 | 3300006051 | Bacteria | 1450 |
| 229 | Ga0075364_10336764 | 3300006051 | Bacteria | 1028 |
| 230 | Ga0075432_10332979 | 3300006058 | Bacteria | 639 |
| 231 | Ga0070715_10000176 | 3300006163 | Bacteria | 14876 |
| 232 | Ga0070715_10031319 | 3300006163 | Bacteria | 2158 |
| 233 | Ga0070716_100008911 | 3300006173 | Bacteria | 4989 |
| 234 | Ga0070716_100036121 | 3300006173 | Bacteria | 2722 |
| 235 | Ga0070716_100362870 | 3300006173 | Bacteria | 1029 |
| 236 | Ga0070712_100018221 | 3300006175 | Bacteria | 4558 |
| 237 | Ga0070712_100062788 | 3300006175 | Bacteria | 2628 |
| 238 | Ga0070712_100629266 | 3300006175 | Bacteria | 910 |
| 239 | Ga0070712_100636151 | 3300006175 | Bacteria | 905 |
| 240 | Ga0070712_100677919 | 3300006175 | Bacteria | 877 |
| 241 | Ga0070712_101747539 | 3300006175 | Bacteria | 545 |
| 242 | Ga0075362_10159300 | 3300006177 | Bacteria | 1086 |
| 243 | Ga0075362_10731284 | 3300006177 | Bacteria | 518 |
| 244 | Ga0075367_10032057 | 3300006178 | Bacteria | 3020 |
| 245 | Ga0075367_10433180 | 3300006178 | Bacteria | 833 |
| 246 | Ga0075369_10377597 | 3300006186 | Unclassified | 667 |
| 247 | Ga0075366_10003201 | 3300006195 | Bacteria | 8590 |
| 248 | Ga0075366_10150430 | 3300006195 | Bacteria | 1409 |
| 249 | Ga0075366_10157670 | 3300006195 | Bacteria | 1375 |
| 250 | Ga0075366_10431793 | 3300006195 | Bacteria | 812 |
| 251 | Ga0097621_101191406 | 3300006237 | Bacteria | 717 |
| 252 | Ga0075370_10118338 | 3300006353 | Bacteria | 1541 |
| 253 | Ga0075370_10944159 | 3300006353 | Bacteria | 528 |
| 254 | Ga0068871_100841120 | 3300006358 | Bacteria | 848 |
| 255 | Ga0068871_101284369 | 3300006358 | Bacteria | 688 |
| 256 | Ga0068871_101704466 | 3300006358 | Bacteria | 598 |
| 257 | Ga0075428_100045905 | 3300006844 | Bacteria | 4800 |
| 258 | Ga0075433_10339717 | 3300006852 | Bacteria | 1327 |
| 259 | Ga0075433_10804141 | 3300006852 | Bacteria | 821 |
| 260 | Ga0075434_100028670 | 3300006871 | Bacteria | 5473 |
| 261 | Ga0075434_100678140 | 3300006871 | Bacteria | 1048 |
| 262 | Ga0075434_101123829 | 3300006871 | Bacteria | 799 |
| 263 | Ga0075434_101208056 | 3300006871 | Bacteria | 768 |
| 264 | Ga0075434_102272759 | 3300006871 | Bacteria | 545 |
| 265 | Ga0068865_100018985 | 3300006881 | Bacteria | 4444 |
| 266 | Ga0068865_100557594 | 3300006881 | Bacteria | 963 |
| 267 | Ga0075436_100254164 | 3300006914 | Bacteria | 1252 |
| 268 | Ga0075436_100703571 | 3300006914 | Bacteria | 748 |
| 269 | Ga0097620_100608775 | 3300006931 | Bacteria | 1185 |
| 270 | Ga0097620_100715238 | 3300006931 | Bacteria | 1092 |
| 271 | Ga0075435_100148711 | 3300007076 | Bacteria | 1968 |
| 272 | Ga0075435_100498732 | 3300007076 | Bacteria | 1052 |
| 273 | Ga0075435_101520899 | 3300007076 | Bacteria | 587 |
| 274 | Ga0099794_10030975 | 3300007265 | Bacteria | 2501 |
| 275 | Ga0105240_10051215 | 3300009093 | Bacteria | 5198 |
| 276 | Ga0111539_10208014 | 3300009094 | Bacteria | 2280 |
| 277 | Ga0111539_10252618 | 3300009094 | Bacteria | 2053 |
| 278 | Ga0111539_10946339 | 3300009094 | Bacteria | 1002 |
| 279 | Ga0111539_12314771 | 3300009094 | Bacteria | 623 |
| 280 | Ga0111539_12363162 | 3300009094 | Bacteria | 617 |
| 281 | Ga0105245_10095768 | 3300009098 | Bacteria | 2739 |
| 282 | Ga0105245_10372145 | 3300009098 | Bacteria | 1421 |
| 283 | Ga0105245_10410317 | 3300009098 | Bacteria | 1356 |
| 284 | Ga0105245_12335318 | 3300009098 | Bacteria | 588 |
| 285 | Ga0105247_11164917 | 3300009101 | Bacteria | 612 |
| 286 | Ga0105247_11623143 | 3300009101 | Bacteria | 532 |
| 287 | Ga0114129_10006236 | 3300009147 | Bacteria | 16901 |
| 288 | Ga0114129_10328013 | 3300009147 | Bacteria | 2033 |
| 289 | Ga0114129_10504407 | 3300009147 | Bacteria | 1580 |
| 290 | Ga0105243_10075868 | 3300009148 | Bacteria | 2730 |
| 291 | Ga0105243_10101618 | 3300009148 | Bacteria | 2388 |
| 292 | Ga0105243_10213881 | 3300009148 | Bacteria | 1699 |
| 293 | Ga0105243_10475141 | 3300009148 | Bacteria | 1178 |
| 294 | Ga0105243_10833584 | 3300009148 | Bacteria | 912 |
| 295 | Ga0105243_11986279 | 3300009148 | Bacteria | 616 |
| 296 | Ga0105243_12413153 | 3300009148 | Bacteria | 564 |
| 297 | Ga0105241_10024859 | 3300009174 | Bacteria | 4450 |
| 298 | Ga0105241_12171437 | 3300009174 | Bacteria | 550 |
| 299 | Ga0105241_12417635 | 3300009174 | Bacteria | 525 |
| 300 | Ga0105242_10163736 | 3300009176 | Bacteria | 1949 |
| 301 | Ga0105242_12282082 | 3300009176 | Bacteria | 587 |
| 302 | Ga0105248_10273784 | 3300009177 | Bacteria | 1901 |
| 303 | Ga0105248_10428825 | 3300009177 | Bacteria | 1489 |
| 304 | Ga0105248_11720954 | 3300009177 | Bacteria | 711 |
| 305 | Ga0105248_13097283 | 3300009177 | Unclassified | 529 |
| 306 | Ga0105237_10112238 | 3300009545 | Bacteria | 2718 |
| 307 | Ga0105237_11588062 | 3300009545 | Bacteria | 661 |
| 308 | Ga0105237_11592427 | 3300009545 | Bacteria | 660 |
| 309 | Ga0105237_11767370 | 3300009545 | Bacteria | 626 |
| 310 | Ga0105238_10234083 | 3300009551 | Bacteria | 1813 |
| 311 | Ga0105238_10407160 | 3300009551 | Bacteria | 1354 |
| 312 | Ga0105249_10029368 | 3300009553 | Bacteria | 4965 |
| 313 | Ga0105249_10658774 | 3300009553 | Bacteria | 1105 |
| 314 | Ga0105249_10816655 | 3300009553 | Bacteria | 997 |
| 315 | Ga0105249_11427000 | 3300009553 | Bacteria | 764 |
| 316 | Ga0105249_12965765 | 3300009553 | Bacteria | 545 |
| 317 | Ga0105239_10029727 | 3300010375 | Bacteria | 6008 |
| 318 | Ga0105239_11080390 | 3300010375 | Bacteria | 923 |
| 319 | Ga0105246_10043217 | 3300011119 | Bacteria | 3057 |
| 320 | Ga0105246_10245213 | 3300011119 | Bacteria | 1418 |
| 321 | Ga0157369_10057405 | 3300013105 | Bacteria | 4200 |
| 322 | Ga0157369_11323755 | 3300013105 | Bacteria | 734 |
| 323 | Ga0157369_11705469 | 3300013105 | Bacteria | 640 |
| 324 | Ga0157374_10690326 | 3300013296 | Bacteria | 1034 |
| 325 | Ga0157378_10095544 | 3300013297 | Bacteria | 2707 |
| 326 | Ga0157378_11248540 | 3300013297 | Bacteria | 783 |
| 327 | Ga0157378_11500267 | 3300013297 | Bacteria | 719 |
| 328 | Ga0163162_10193851 | 3300013306 | Bacteria | 2160 |
| 329 | Ga0163162_11183552 | 3300013306 | Bacteria | 867 |
| 330 | Ga0163162_12180957 | 3300013306 | Bacteria | 636 |
| 331 | Ga0163162_12591010 | 3300013306 | Bacteria | 583 |
| 332 | Ga0163162_13197703 | 3300013306 | Bacteria | 525 |
| 333 | Ga0157372_10208871 | 3300013307 | Bacteria | 2262 |
| 334 | Ga0157372_10239661 | 3300013307 | Bacteria | 2104 |
| 335 | Ga0157372_11908803 | 3300013307 | Bacteria | 683 |
| 336 | Ga0157375_10059822 | 3300013308 | Bacteria | 3776 |
| 337 | Ga0157375_10361661 | 3300013308 | Bacteria | 1617 |
| 338 | Ga0157375_10555136 | 3300013308 | Bacteria | 1310 |
| 339 | Ga0157375_11154994 | 3300013308 | Bacteria | 907 |
| 340 | Ga0157375_13337343 | 3300013308 | Bacteria | 535 |
| 341 | Ga0163163_10894919 | 3300014325 | Bacteria | 951 |
| 342 | Ga0163163_11152370 | 3300014325 | Bacteria | 838 |
| 343 | Ga0163163_13055106 | 3300014325 | Bacteria | 522 |
| 344 | Ga0157380_10194223 | 3300014326 | Bacteria | 1795 |
| 345 | Ga0157380_10406487 | 3300014326 | Bacteria | 1293 |
| 346 | Ga0157380_12153166 | 3300014326 | Bacteria | 621 |
| 347 | Ga0157377_10870037 | 3300014745 | Bacteria | 671 |
| 348 | Ga0157379_10054457 | 3300014968 | Bacteria | 3574 |
| 349 | Ga0157379_10138447 | 3300014968 | Bacteria | 2194 |
| 350 | Ga0157376_10190417 | 3300014969 | Bacteria | 1881 |
| 351 | Ga0182007_10405209 | 3300015262 | Bacteria | 520 |
| 352 | Ga0163161_10177384 | 3300017792 | Bacteria | 1632 |
| 353 | Ga0206356_11133492 | 3300020070 | Bacteria | 1052 |
| 354 | Ga0206356_11249086 | 3300020070 | Bacteria | 837 |
| 355 | Ga0206349_1895358 | 3300020075 | Bacteria | 587 |
| 356 | Ga0206350_10821574 | 3300020080 | Bacteria | 1512 |
| 357 | Ga0206354_10029914 | 3300020081 | Bacteria | 655 |
| 358 | Ga0206354_10133078 | 3300020081 | Bacteria | 763 |
| 359 | Ga0206354_10736402 | 3300020081 | Bacteria | 722 |
| 360 | Ga0206353_10114996 | 3300020082 | Bacteria | 866 |
| 361 | Ga0206353_11094267 | 3300020082 | Bacteria | 689 |
| 362 | Ga0206353_11840564 | 3300020082 | Bacteria | 799 |
| 363 | Ga0154015_1051813 | 3300020610 | Unclassified | 614 |
| 364 | Ga0213874_10167468 | 3300021377 | Bacteria | 775 |
| 365 | Ga0213874_10261085 | 3300021377 | Bacteria | 641 |
| 366 | Ga0213875_10000250 | 3300021388 | Bacteria | 54123 |
| 367 | Ga0213875_10002024 | 3300021388 | Bacteria | 12495 |
| 368 | Ga0213875_10137605 | 3300021388 | Bacteria | 1142 |
| 369 | Ga0213875_10312986 | 3300021388 | Bacteria | 744 |
| 370 | Ga0224712_10299958 | 3300022467 | Bacteria | 751 |
| 371 | Ga0224572_1010763 | 3300024225 | Bacteria | 1725 |
| 372 | Ga0224572_1028651 | 3300024225 | Bacteria | 1066 |
| 373 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 374 | Ga0209563_100049 | 3300025230 | Bacteria | 358472 |
| 375 | Ga0209258_100700 | 3300025242 | Bacteria | 22801 |
| 376 | Ga0209646_1000257 | 3300025246 | Bacteria | 52257 |
| 377 | Ga0209026_1000054 | 3300025250 | Bacteria | 242508 |
| 378 | Ga0209677_100050 | 3300025253 | Bacteria | 176828 |
| 379 | Ga0209677_100316 | 3300025253 | Bacteria | 31473 |
| 380 | Ga0209759_1000043 | 3300025256 | Bacteria | 242513 |
| 381 | Ga0209759_1001086 | 3300025256 | Bacteria | 17708 |
| 382 | Ga0209759_1007372 | 3300025256 | Bacteria | 3545 |
| 383 | Ga0209129_1031800 | 3300025258 | Bacteria | 877 |
| 384 | Ga0209673_1028349 | 3300025273 | Bacteria | 1805 |
| 385 | Ga0209673_1042339 | 3300025273 | Bacteria | 1282 |
| 386 | Ga0209758_1000146 | 3300025297 | Bacteria | 169246 |
| 387 | Ga0209050_1000303 | 3300025298 | Bacteria | 101498 |
| 388 | Ga0209051_1000823 | 3300025303 | Bacteria | 32078 |
| 389 | Ga0209051_1026928 | 3300025303 | Bacteria | 2304 |
| 390 | Ga0209257_1000161 | 3300025304 | Bacteria | 176089 |
| 391 | Ga0207653_10130289 | 3300025885 | Bacteria | 912 |
| 392 | Ga0207682_10460464 | 3300025893 | Bacteria | 602 |
| 393 | Ga0207692_10003218 | 3300025898 | Bacteria | 6346 |
| 394 | Ga0207692_10011020 | 3300025898 | Bacteria | 3828 |
| 395 | Ga0207692_10063073 | 3300025898 | Bacteria | 1925 |
| 396 | Ga0207692_10108524 | 3300025898 | Bacteria | 1536 |
| 397 | Ga0207692_10494689 | 3300025898 | Bacteria | 775 |
| 398 | Ga0207642_10026857 | 3300025899 | Bacteria | 2349 |
| 399 | Ga0207680_10358678 | 3300025903 | Bacteria | 1025 |
| 400 | Ga0207647_10011526 | 3300025904 | Bacteria | 6196 |
| 401 | Ga0207685_10022260 | 3300025905 | Bacteria | 2138 |
| 402 | Ga0207685_10053473 | 3300025905 | Bacteria | 1569 |
| 403 | Ga0207685_10211536 | 3300025905 | Bacteria | 917 |
| 404 | Ga0207699_10004354 | 3300025906 | Bacteria | 6772 |
| 405 | Ga0207699_10006055 | 3300025906 | Bacteria | 5823 |
| 406 | Ga0207699_10034155 | 3300025906 | Bacteria | 2882 |
| 407 | Ga0207699_10259178 | 3300025906 | Bacteria | 1201 |
| 408 | Ga0207645_10009049 | 3300025907 | Bacteria | 6910 |
| 409 | Ga0207645_10034740 | 3300025907 | Bacteria | 3239 |
| 410 | Ga0207645_10038721 | 3300025907 | Bacteria | 3056 |
| 411 | Ga0207643_10220592 | 3300025908 | Bacteria | 1160 |
| 412 | Ga0207705_10000251 | 3300025909 | Bacteria | 52410 |
| 413 | Ga0207705_10116513 | 3300025909 | Bacteria | 1978 |
| 414 | Ga0207684_10001290 | 3300025910 | Bacteria | 27619 |
| 415 | Ga0207684_10001319 | 3300025910 | Bacteria | 27222 |
| 416 | Ga0207684_10004232 | 3300025910 | Bacteria | 13617 |
| 417 | Ga0207684_10113089 | 3300025910 | Bacteria | 2324 |
| 418 | Ga0207684_10148325 | 3300025910 | Bacteria | 2018 |
| 419 | Ga0207684_10487563 | 3300025910 | Bacteria | 1057 |
| 420 | Ga0207684_10533858 | 3300025910 | Bacteria | 1004 |
| 421 | Ga0207654_10131981 | 3300025911 | Bacteria | 1582 |
| 422 | Ga0207654_10434129 | 3300025911 | Bacteria | 918 |
| 423 | Ga0207695_10067716 | 3300025913 | Bacteria | 3661 |
| 424 | Ga0207671_10162329 | 3300025914 | Bacteria | 1731 |
| 425 | Ga0207671_10771495 | 3300025914 | Bacteria | 763 |
| 426 | Ga0207693_10008315 | 3300025915 | Bacteria | 8492 |
| 427 | Ga0207693_10036042 | 3300025915 | Bacteria | 3898 |
| 428 | Ga0207693_10083441 | 3300025915 | Bacteria | 2503 |
| 429 | Ga0207693_11299139 | 3300025915 | Bacteria | 544 |
| 430 | Ga0207663_10004647 | 3300025916 | Bacteria | 6850 |
| 431 | Ga0207663_10038404 | 3300025916 | Bacteria | 2894 |
| 432 | Ga0207663_11016512 | 3300025916 | Bacteria | 665 |
| 433 | Ga0207662_10219689 | 3300025918 | Bacteria | 1237 |
| 434 | Ga0207657_10066537 | 3300025919 | Bacteria | 3067 |
| 435 | Ga0207657_10374209 | 3300025919 | Bacteria | 1122 |
| 436 | Ga0207657_10613542 | 3300025919 | Bacteria | 848 |
| 437 | Ga0207657_11488214 | 3300025919 | Bacteria | 506 |
| 438 | Ga0207649_10447022 | 3300025920 | Bacteria | 975 |
| 439 | Ga0207646_10000690 | 3300025922 | Bacteria | 43616 |
| 440 | Ga0207646_10001669 | 3300025922 | Bacteria | 27091 |
| 441 | Ga0207646_10015118 | 3300025922 | Bacteria | 7304 |
| 442 | Ga0207646_10077937 | 3300025922 | Bacteria | 2962 |
| 443 | Ga0207646_10082304 | 3300025922 | Bacteria | 2879 |
| 444 | Ga0207646_10189946 | 3300025922 | Bacteria | 1855 |
| 445 | Ga0207646_10305638 | 3300025922 | Bacteria | 1437 |
| 446 | Ga0207646_10474438 | 3300025922 | Bacteria | 1128 |
| 447 | Ga0207646_10666003 | 3300025922 | Bacteria | 932 |
| 448 | Ga0207681_10063600 | 3300025923 | Bacteria | 2545 |
| 449 | Ga0207681_10595533 | 3300025923 | Bacteria | 913 |
| 450 | Ga0207681_11589750 | 3300025923 | Bacteria | 547 |
| 451 | Ga0207694_10187951 | 3300025924 | Bacteria | 1677 |
| 452 | Ga0207694_11382103 | 3300025924 | Bacteria | 595 |
| 453 | Ga0207650_10021982 | 3300025925 | Bacteria | 4514 |
| 454 | Ga0207650_10353222 | 3300025925 | Bacteria | 1210 |
| 455 | Ga0207659_10025362 | 3300025926 | Bacteria | 3983 |
| 456 | Ga0207687_10134285 | 3300025927 | Bacteria | 1869 |
| 457 | Ga0207700_10007201 | 3300025928 | Bacteria | 6783 |
| 458 | Ga0207700_10029880 | 3300025928 | Bacteria | 3851 |
| 459 | Ga0207700_10055685 | 3300025928 | Bacteria | 2973 |
| 460 | Ga0207700_10113240 | 3300025928 | Bacteria | 2187 |
| 461 | Ga0207700_10493236 | 3300025928 | Bacteria | 1083 |
| 462 | Ga0207664_10000650 | 3300025929 | Bacteria | 24061 |
| 463 | Ga0207664_10004546 | 3300025929 | Bacteria | 9405 |
| 464 | Ga0207664_10004907 | 3300025929 | Bacteria | 9089 |
| 465 | Ga0207664_10215369 | 3300025929 | Bacteria | 1663 |
| 466 | Ga0207644_10015616 | 3300025931 | Bacteria | 5100 |
| 467 | Ga0207644_10043701 | 3300025931 | Bacteria | 3181 |
| 468 | Ga0207644_10109398 | 3300025931 | Bacteria | 2088 |
| 469 | Ga0207690_10191708 | 3300025932 | Bacteria | 1546 |
| 470 | Ga0207690_10650980 | 3300025932 | Bacteria | 863 |
| 471 | Ga0207690_10942145 | 3300025932 | Bacteria | 717 |
| 472 | Ga0207706_10385356 | 3300025933 | Bacteria | 1216 |
| 473 | Ga0207686_10161057 | 3300025934 | Bacteria | 1573 |
| 474 | Ga0207686_10627461 | 3300025934 | Bacteria | 848 |
| 475 | Ga0207709_10105761 | 3300025935 | Bacteria | 1871 |
| 476 | Ga0207709_10161557 | 3300025935 | Bacteria | 1563 |
| 477 | Ga0207709_10610664 | 3300025935 | Bacteria | 864 |
| 478 | Ga0207709_11434122 | 3300025935 | Bacteria | 572 |
| 479 | Ga0207670_10555076 | 3300025936 | Bacteria | 939 |
| 480 | Ga0207669_10340291 | 3300025937 | Bacteria | 1155 |
| 481 | Ga0207704_10017341 | 3300025938 | Bacteria | 3729 |
| 482 | Ga0207704_10860502 | 3300025938 | Bacteria | 760 |
| 483 | Ga0207665_10002376 | 3300025939 | Bacteria | 12709 |
| 484 | Ga0207665_10011702 | 3300025939 | Bacteria | 5765 |
| 485 | Ga0207665_10059382 | 3300025939 | Bacteria | 2588 |
| 486 | Ga0207691_10025458 | 3300025940 | Bacteria | 5555 |
| 487 | Ga0207691_10104170 | 3300025940 | Bacteria | 2529 |
| 488 | Ga0207691_10448022 | 3300025940 | Bacteria | 1099 |
| 489 | Ga0207711_10094784 | 3300025941 | Bacteria | 2631 |
| 490 | Ga0207689_10058653 | 3300025942 | Bacteria | 3166 |
| 491 | Ga0207689_10178707 | 3300025942 | Bacteria | 1750 |
| 492 | Ga0207689_11343711 | 3300025942 | Bacteria | 600 |
| 493 | Ga0207661_10048992 | 3300025944 | Bacteria | 3361 |
| 494 | Ga0207679_10546889 | 3300025945 | Bacteria | 1038 |
| 495 | Ga0207667_10047907 | 3300025949 | Bacteria | 4521 |
| 496 | Ga0207667_10760691 | 3300025949 | Bacteria | 967 |
| 497 | Ga0207667_10998014 | 3300025949 | Bacteria | 825 |
| 498 | Ga0207651_10016983 | 3300025960 | Bacteria | 4284 |
| 499 | Ga0207651_10158756 | 3300025960 | Bacteria | 1770 |
| 500 | Ga0207712_10009351 | 3300025961 | Bacteria | 6200 |
| 501 | Ga0207712_10394822 | 3300025961 | Bacteria | 1161 |
| 502 | Ga0207712_11750157 | 3300025961 | Bacteria | 557 |
| 503 | Ga0207668_10068417 | 3300025972 | Bacteria | 2525 |
| 504 | Ga0207668_11557321 | 3300025972 | Bacteria | 597 |
| 505 | Ga0207668_11668200 | 3300025972 | Bacteria | 575 |
| 506 | Ga0207640_10025835 | 3300025981 | Bacteria | 3560 |
| 507 | Ga0207640_10106473 | 3300025981 | Bacteria | 1978 |
| 508 | Ga0207658_10275315 | 3300025986 | Bacteria | 1440 |
| 509 | Ga0207658_10591418 | 3300025986 | Bacteria | 996 |
| 510 | Ga0207658_10820107 | 3300025986 | Bacteria | 845 |
| 511 | Ga0207658_11460340 | 3300025986 | Bacteria | 625 |
| 512 | Ga0207677_10072659 | 3300026023 | Bacteria | 2433 |
| 513 | Ga0207677_11217122 | 3300026023 | Bacteria | 690 |
| 514 | Ga0207677_11785345 | 3300026023 | Bacteria | 571 |
| 515 | Ga0207703_10066634 | 3300026035 | Bacteria | 2962 |
| 516 | Ga0207639_10062586 | 3300026041 | Bacteria | 2878 |
| 517 | Ga0207678_10415264 | 3300026067 | Bacteria | 1166 |
| 518 | Ga0207678_11059552 | 3300026067 | Bacteria | 718 |
| 519 | Ga0207678_11189586 | 3300026067 | Bacteria | 675 |
| 520 | Ga0207708_10025564 | 3300026075 | Bacteria | 4469 |
| 521 | Ga0207708_10975471 | 3300026075 | Bacteria | 736 |
| 522 | Ga0207702_10011854 | 3300026078 | Bacteria | 7255 |
| 523 | Ga0207702_10480004 | 3300026078 | Bacteria | 1209 |
| 524 | Ga0207641_10579289 | 3300026088 | Bacteria | 1097 |
| 525 | Ga0207641_11248355 | 3300026088 | Bacteria | 743 |
| 526 | Ga0207641_12273826 | 3300026088 | Unclassified | 542 |
| 527 | Ga0207648_10000182 | 3300026089 | Bacteria | 66368 |
| 528 | Ga0207648_10008440 | 3300026089 | Bacteria | 9978 |
| 529 | Ga0207648_10117852 | 3300026089 | Bacteria | 2333 |
| 530 | Ga0207648_10857061 | 3300026089 | Bacteria | 847 |
| 531 | Ga0207648_11279528 | 3300026089 | Bacteria | 689 |
| 532 | Ga0207648_11438087 | 3300026089 | Bacteria | 648 |
| 533 | Ga0207648_12052192 | 3300026089 | Bacteria | 533 |
| 534 | Ga0207676_11315795 | 3300026095 | Bacteria | 718 |
| 535 | Ga0207674_10021066 | 3300026116 | Bacteria | 7031 |
| 536 | Ga0207674_10090703 | 3300026116 | Bacteria | 3047 |
| 537 | Ga0207674_10251700 | 3300026116 | Bacteria | 1714 |
| 538 | Ga0207674_11102786 | 3300026116 | Bacteria | 763 |
| 539 | Ga0207675_100000551 | 3300026118 | Bacteria | 36576 |
| 540 | Ga0207675_100303940 | 3300026118 | Bacteria | 1554 |
| 541 | Ga0207675_100363056 | 3300026118 | Bacteria | 1421 |
| 542 | Ga0207675_101165500 | 3300026118 | Bacteria | 791 |
| 543 | Ga0207675_101717799 | 3300026118 | Bacteria | 647 |
| 544 | Ga0207698_10120685 | 3300026142 | Bacteria | 2218 |
| 545 | Ga0207698_10439739 | 3300026142 | Bacteria | 1256 |
| 546 | Ga0207698_11351819 | 3300026142 | Bacteria | 727 |
| 547 | Ga0207698_12643693 | 3300026142 | Bacteria | 511 |
| 548 | Ga0209983_1142946 | 3300027665 | Bacteria | 548 |
| 549 | Ga0209588_1033098 | 3300027671 | Bacteria | 1657 |
| 550 | Ga0207428_10878981 | 3300027907 | Bacteria | 634 |
| 551 | Ga0207428_11290146 | 3300027907 | Bacteria | 506 |
| 552 | Ga0268266_10000644 | 3300028379 | Bacteria | 47499 |
| 553 | Ga0268266_10773250 | 3300028379 | Bacteria | 927 |
| 554 | Ga0268266_11203417 | 3300028379 | Bacteria | 733 |
| 555 | Ga0268266_11607450 | 3300028379 | Bacteria | 625 |
| 556 | Ga0268266_11785159 | 3300028379 | Bacteria | 590 |
| 557 | Ga0268265_10042088 | 3300028380 | Bacteria | 3386 |
| 558 | Ga0268264_10058416 | 3300028381 | Bacteria | 3230 |
| 559 | Ga0268264_10077247 | 3300028381 | Bacteria | 2836 |
| 560 | Ga0268264_10305891 | 3300028381 | Bacteria | 1498 |
| 561 | Ga0268264_10658548 | 3300028381 | Bacteria | 1037 |
| 562 | Ga0268264_11029452 | 3300028381 | Bacteria | 830 |
| 563 | Ga0268264_11239226 | 3300028381 | Bacteria | 756 |
| 564 | Ga0268264_11250068 | 3300028381 | Bacteria | 752 |
| 565 | Ga0265326_10131536 | 3300028558 | Bacteria | 713 |
| 566 | Ga0265319_1063116 | 3300028563 | Bacteria | 1199 |
| 567 | Ga0265336_10000006 | 3300028666 | Bacteria | 348453 |
| 568 | Ga0307517_10194526 | 3300028786 | Bacteria | 1280 |
| 569 | Ga0265338_10000241 | 3300028800 | Bacteria | 101431 |
| 570 | Ga0265338_10003796 | 3300028800 | Bacteria | 20997 |
| 571 | Ga0265338_10150506 | 3300028800 | Bacteria | 1809 |
| 572 | Ga0265338_10245479 | 3300028800 | Bacteria | 1324 |
| 573 | Ga0265324_10026123 | 3300029957 | Bacteria | 2067 |
| 574 | Ga0307512_10108540 | 3300030522 | Bacteria | 1841 |
| 575 | Ga0265320_10455223 | 3300031240 | Bacteria | 565 |
| 576 | Ga0265325_10007889 | 3300031241 | Bacteria | 6335 |
| 577 | Ga0265340_10226992 | 3300031247 | Bacteria | 836 |
| 578 | Ga0265340_10228124 | 3300031247 | Bacteria | 833 |
| 579 | Ga0265339_10000865 | 3300031249 | Bacteria | 23280 |
| 580 | Ga0265339_10532045 | 3300031249 | Bacteria | 541 |
| 581 | Ga0265316_10071814 | 3300031344 | Bacteria | 2668 |
| 582 | Ga0307513_10555678 | 3300031456 | Bacteria | 860 |
| 583 | Ga0307513_10612822 | 3300031456 | Bacteria | 797 |
| 584 | Ga0307408_100026964 | 3300031548 | Bacteria | 3953 |
| 585 | Ga0307408_100522269 | 3300031548 | Bacteria | 1043 |
| 586 | Ga0307408_100529214 | 3300031548 | Bacteria | 1037 |
| 587 | Ga0307408_100863869 | 3300031548 | Bacteria | 826 |
| 588 | Ga0307408_102436969 | 3300031548 | Bacteria | 508 |
| 589 | Ga0265313_10005615 | 3300031595 | Bacteria | 9174 |
| 590 | Ga0307508_10524372 | 3300031616 | Bacteria | 781 |
| 591 | Ga0265314_10072472 | 3300031711 | Bacteria | 2301 |
| 592 | Ga0265314_10136451 | 3300031711 | Bacteria | 1523 |
| 593 | Ga0265342_10035270 | 3300031712 | Bacteria | 3063 |
| 594 | Ga0265342_10369636 | 3300031712 | Bacteria | 744 |
| 595 | Ga0307516_10001515 | 3300031730 | Bacteria | 31972 |
| 596 | Ga0307413_10021651 | 3300031824 | Bacteria | 3447 |
| 597 | Ga0307413_10094713 | 3300031824 | Bacteria | 1956 |
| 598 | Ga0307413_10290959 | 3300031824 | Bacteria | 1234 |
| 599 | Ga0307413_11366499 | 3300031824 | Bacteria | 622 |
| 600 | Ga0307413_11919791 | 3300031824 | Bacteria | 532 |
| 601 | Ga0307410_10014089 | 3300031852 | Bacteria | 4690 |
| 602 | Ga0307410_10151032 | 3300031852 | Bacteria | 1729 |
| 603 | Ga0307410_10219114 | 3300031852 | Bacteria | 1463 |
| 604 | Ga0307410_10690565 | 3300031852 | Bacteria | 859 |
| 605 | Ga0307410_11271563 | 3300031852 | Bacteria | 643 |
| 606 | Ga0307410_11509947 | 3300031852 | Bacteria | 592 |
| 607 | Ga0307410_11611444 | 3300031852 | Bacteria | 574 |
| 608 | Ga0307406_10251448 | 3300031901 | Bacteria | 1332 |
| 609 | Ga0307406_10691846 | 3300031901 | Bacteria | 850 |
| 610 | Ga0307406_10793760 | 3300031901 | Bacteria | 798 |
| 611 | Ga0307406_11705335 | 3300031901 | Bacteria | 558 |
| 612 | Ga0307407_10050043 | 3300031903 | Bacteria | 2388 |
| 613 | Ga0307407_10052488 | 3300031903 | Bacteria | 2342 |
| 614 | Ga0307407_10276519 | 3300031903 | Bacteria | 1161 |
| 615 | Ga0307407_11135320 | 3300031903 | Bacteria | 608 |
| 616 | Ga0307412_10390078 | 3300031911 | Bacteria | 1130 |
| 617 | Ga0307412_11967731 | 3300031911 | Bacteria | 540 |
| 618 | Ga0307409_100039770 | 3300031995 | Bacteria | 3493 |
| 619 | Ga0307409_100573146 | 3300031995 | Bacteria | 1111 |
| 620 | Ga0307409_100968328 | 3300031995 | Bacteria | 867 |
| 621 | Ga0307416_100051141 | 3300032002 | Bacteria | 3298 |
| 622 | Ga0307416_100298750 | 3300032002 | Bacteria | 1599 |
| 623 | Ga0307416_100551137 | 3300032002 | Bacteria | 1226 |
| 624 | Ga0307416_100578564 | 3300032002 | Bacteria | 1200 |
| 625 | Ga0307414_10247405 | 3300032004 | Bacteria | 1480 |
| 626 | Ga0307414_10785528 | 3300032004 | Bacteria | 867 |
| 627 | Ga0307414_11255002 | 3300032004 | Bacteria | 687 |
| 628 | Ga0307414_11764175 | 3300032004 | Bacteria | 577 |
| 629 | Ga0307411_10666634 | 3300032005 | Bacteria | 902 |
| 630 | Ga0307411_11268801 | 3300032005 | Bacteria | 670 |
| 631 | Ga0307411_11677681 | 3300032005 | Bacteria | 588 |
| 632 | Ga0307415_100122561 | 3300032126 | Bacteria | 1952 |
| 633 | Ga0307415_100153449 | 3300032126 | Bacteria | 1775 |
| 634 | Ga0307415_100246982 | 3300032126 | Bacteria | 1447 |
| 635 | Ga0307415_100323594 | 3300032126 | Bacteria | 1287 |
| 636 | Ga0307415_100897852 | 3300032126 | Bacteria | 817 |
| 637 | Ga0307510_10427231 | 3300033180 | Bacteria | 767 |
| 638 | Ga0307510_10660083 | 3300033180 | Bacteria | 505 |
| 639 | Ga0373926_0014236 | 3300035083 | Bacteria | 2702 |
| 640 | Ga0373926_0101926 | 3300035083 | Bacteria | 1074 |
| 641 | Ga0373934_0000188 | 3300035086 | Bacteria | 22728 |
| 642 | Ga0373934_0414235 | 3300035086 | Bacteria | 564 |
| 643 | Ga0373923_0029014 | 3300035111 | Bacteria | 2216 |
| 644 | Ga0373923_0270273 | 3300035111 | Bacteria | 799 |
| 645 | Ga0373936_0115734 | 3300035113 | Bacteria | 1142 |
| 646 | Ga0373936_0349941 | 3300035113 | Bacteria | 673 |
| 647 | Ga0373936_0584871 | 3300035113 | Bacteria | 523 |
| 648 | Ga0373939_0037436 | 3300035114 | Bacteria | 1441 |
| 649 | Ga0373939_0323733 | 3300035114 | Bacteria | 620 |
| 650 | Ga0373953_0002097 | 3300035117 | Bacteria | 5950 |
| 651 | Ga0373953_0018644 | 3300035117 | Bacteria | 2571 |
| 652 | Ga0373954_0017630 | 3300035118 | Bacteria | 3208 |
| 653 | Ga0373956_0000657 | 3300035119 | Bacteria | 14200 |
| 654 | Ga0373956_0012255 | 3300035119 | Bacteria | 3551 |
| 655 | Ga0373956_0108788 | 3300035119 | Bacteria | 1289 |
| 656 | Ga0373957_0000118 | 3300035120 | Bacteria | 19159 |
| 657 | Ga0373957_0057697 | 3300035120 | Bacteria | 1498 |
| 658 | Ga0373957_0103361 | 3300035120 | Bacteria | 1142 |
| 659 | Ga0373946_0044684 | 3300035171 | Bacteria | 1830 |
| 660 | Ga0373946_0203683 | 3300035171 | Bacteria | 949 |
| 661 | Ga0373955_0000007 | 3300035172 | Bacteria | 87917 |
| 662 | Ga0373955_0068377 | 3300035172 | Bacteria | 1979 |
| 663 | Ga0373955_0387236 | 3300035172 | Bacteria | 849 |
| 664 | Ga0373962_0177377 | 3300035242 | Bacteria | 711 |
| 665 | Ga0373924_0001424 | 3300035410 | Bacteria | 7757 |
| 666 | Ga0373924_0102183 | 3300035410 | Bacteria | 1234 |
| 667 | Ga0373931_0438520 | 3300035691 | Bacteria | 833 |
| 668 | Ga0373931_0876909 | 3300035691 | Bacteria | 602 |
| 669 | Ga0373935_0004922 | 3300035692 | Bacteria | 7848 |
| 670 | Ga0373935_0125630 | 3300035692 | Bacteria | 1718 |
| 671 | Ga0373935_0190152 | 3300035692 | Bacteria | 1414 |
| 672 | Ga0373935_0239570 | 3300035692 | Bacteria | 1266 |
| 673 | Ga0373935_0356892 | 3300035692 | Bacteria | 1043 |
| 674 | Ga0373935_0377617 | 3300035692 | Bacteria | 1014 |
| 675 | Ga0373935_0718997 | 3300035692 | Bacteria | 735 |
| 676 | Ga0373935_1022043 | 3300035692 | Bacteria | 614 |
| 677 | Ga0373927_0020243 | 3300035695 | Bacteria | 4364 |
| 678 | Ga0373927_0039628 | 3300035695 | Bacteria | 3058 |
| 679 | Ga0373927_1177463 | 3300035695 | Bacteria | 505 |
| 680 | Ga0373933_0000002 | 3300035724 | Bacteria | 151785 |
| 681 | Ga0373933_0155018 | 3300035724 | Bacteria | 1452 |
| 682 | Ga0373933_0277686 | 3300035724 | Bacteria | 1082 |
| 683 | Ga0373947_0000737 | 3300035725 | Bacteria | 19605 |
| 684 | Ga0373947_0165078 | 3300035725 | Bacteria | 1434 |
| 685 | Ga0373947_0388373 | 3300035725 | Bacteria | 940 |
| 686 | Ga0373947_1113014 | 3300035725 | Bacteria | 538 |
| 687 | Ga0373937_0000014 | 3300036401 | Bacteria | 151785 |
| 688 | Ga0373937_0028627 | 3300036401 | Bacteria | 5043 |
| 689 | Ga0373937_0030802 | 3300036401 | Bacteria | 4860 |
| 690 | Ga0373937_0086326 | 3300036401 | Bacteria | 2904 |
| 691 | Ga0373937_0361545 | 3300036401 | Bacteria | 1375 |
| 692 | Ga0373937_0489486 | 3300036401 | Bacteria | 1168 |
| 693 | Ga0373937_1022848 | 3300036401 | Bacteria | 775 |
| 694 | Ga0372808_006996 | 3300036459 | Bacteria | 1535 |
| 695 | Ga0373925_0001809 | 3300037068 | Bacteria | 17846 |
| 696 | Ga0373925_0005477 | 3300037068 | Bacteria | 9451 |
| 697 | Ga0373925_0006470 | 3300037068 | Bacteria | 8616 |
| 698 | Ga0373925_0113270 | 3300037068 | Bacteria | 2097 |
| 699 | Ga0373925_0201269 | 3300037068 | Bacteria | 1584 |
| 700 | Ga0373925_1241001 | 3300037068 | Bacteria | 612 |
| 701 | Ga0395899_0005714 | 3300037312 | Bacteria | 9654 |
| 702 | Ga0395899_0015928 | 3300037312 | Bacteria | 5734 |
| 703 | Ga0395899_0407825 | 3300037312 | Bacteria | 898 |
| 704 | Ga0395899_0454772 | 3300037312 | Bacteria | 838 |
| 705 | Ga0395899_0570113 | 3300037312 | Bacteria | 725 |
| 706 | Ga0395900_0010158 | 3300037418 | Bacteria | 9627 |
| 707 | Ga0395900_0021811 | 3300037418 | Bacteria | 6548 |
| 708 | Ga0395900_0041112 | 3300037418 | Bacteria | 4767 |
| 709 | Ga0395898_0003690 | 3300037466 | Bacteria | 17014 |
| 710 | Ga0395898_0008906 | 3300037466 | Bacteria | 10572 |
| 711 | Ga0395898_0217991 | 3300037466 | Bacteria | 1820 |
| 712 | Ga0395898_0420890 | 3300037466 | Bacteria | 1273 |
| 713 | Ga0395905_0002683 | 3300037471 | Bacteria | 19510 |
| 714 | Ga0395905_0037201 | 3300037471 | Bacteria | 4571 |
| 715 | Ga0436364_0111682 | 3300037853 | Bacteria | 890 |
| 716 | Ga0436364_0287407 | 3300037853 | Bacteria | 132611 |
| 717 | Ga0436364_1192698 | 3300037853 | Bacteria | 1585 |
| 718 | Ga0436364_1489807 | 3300037853 | Bacteria | 15421 |
| 719 | Ga0395901_0002847 | 3300038443 | Bacteria | 17464 |
| 720 | Ga0395901_0015358 | 3300038443 | Bacteria | 7792 |
| 721 | Ga0395901_0019313 | 3300038443 | Bacteria | 6967 |
| 722 | Ga0395901_0083145 | 3300038443 | Bacteria | 3346 |
| 723 | Ga0395901_0507636 | 3300038443 | Bacteria | 1227 |
| 724 | Ga0395901_0570984 | 3300038443 | Bacteria | 1144 |
| 725 | Ga0242420_126987 | 3300038996 | Bacteria | 560 |
| 726 | Ga0436365_0909018 | 3300039437 | Bacteria | 655 |
| 727 | Ga0436363_0236204 | 3300039450 | Bacteria | 1462 |
| 728 | Ga0436363_0433468 | 3300039450 | Bacteria | 1208 |
| 729 | Ga0436363_0689210 | 3300039450 | Bacteria | 752 |
| 730 | Ga0436363_1449032 | 3300039450 | Bacteria | 976 |
| 731 | Ga0451789_0299630 | 3300041443 | Bacteria | 1026 |
| 732 | Ga0451789_0416861 | 3300041443 | Bacteria | 1659 |
| 733 | Ga0451791_0719694 | 3300041451 | Bacteria | 533 |
| 734 | Ga0451791_1281330 | 3300041451 | Bacteria | 599 |
| 735 | Ga0451791_1359482 | 3300041451 | Bacteria | 825 |
| 736 | Ga0451793_0217027 | 3300041452 | Unclassified | 572 |
| 737 | Ga0451793_0625656 | 3300041452 | Bacteria | 674 |
| 738 | Ga0451793_0793246 | 3300041452 | Bacteria | 2564 |
| 739 | Ga0451793_1643730 | 3300041452 | Bacteria | 814 |
| 740 | Ga0451795_0536464 | 3300041456 | Bacteria | 1013 |
| 741 | Ga0451798_0508301 | 3300041458 | Bacteria | 1114 |
| 742 | Ga0451800_0155813 | 3300041459 | Bacteria | 1750 |
| 743 | Ga0451800_1416307 | 3300041459 | Bacteria | 517 |
| 744 | Ga0451800_1538363 | 3300041459 | Bacteria | 560 |
| 745 | Ga0451807_0123301 | 3300041486 | Bacteria | 597 |
| 746 | Ga0451807_1650466 | 3300041486 | Bacteria | 597 |
| 747 | Ga0451833_0170977 | 3300041491 | Bacteria | 682 |
| 748 | Ga0451835_0127159 | 3300041492 | Bacteria | 536 |
| 749 | Ga0451843_0771240 | 3300041509 | Bacteria | 524 |
| 750 | Ga0451853_0387231 | 3300041512 | Bacteria | 559 |
| 751 | Ga0451853_1209586 | 3300041512 | Bacteria | 897 |
| 752 | Ga0451853_1343160 | 3300041512 | Bacteria | 930 |
| 753 | Ga0450897_030162 | 3300042128 | Bacteria | 611 |
| 754 | Ga0439464_0103278 | 3300042439 | Bacteria | 867 |
| 755 | Ga0466969_0005025 | 3300044656 | Bacteria | 7038 |
| 756 | Ga0466969_0282293 | 3300044656 | Bacteria | 752 |
| 757 | Ga0466965_0752234 | 3300044683 | Bacteria | 562 |
| 758 | Ga0466965_0799980 | 3300044683 | Bacteria | 546 |
| 759 | Ga0466966_0005905 | 3300044684 | Bacteria | 8077 |
| 760 | Ga0466966_0009417 | 3300044684 | Bacteria | 6468 |
| 761 | Ga0466966_0915987 | 3300044684 | Bacteria | 529 |
| 762 | Ga0466966_0926611 | 3300044684 | Bacteria | 525 |
| 763 | Ga0466961_0010761 | 3300044693 | Bacteria | 5843 |
| 764 | Ga0466961_0164634 | 3300044693 | Bacteria | 1381 |
| 765 | Ga0466961_0273286 | 3300044693 | Bacteria | 1035 |
| 766 | Ga0466961_0532126 | 3300044693 | Bacteria | 708 |
| 767 | Ga0466963_0005874 | 3300044694 | Bacteria | 7235 |
| 768 | Ga0466963_0117485 | 3300044694 | Bacteria | 1828 |
| 769 | Ga0466963_1094914 | 3300044694 | Bacteria | 560 |
| 770 | Ga0466964_0007682 | 3300044706 | Bacteria | 4036 |
| 771 | Ga0466964_0018940 | 3300044706 | Bacteria | 2644 |
| 772 | Ga0466964_0521994 | 3300044706 | Bacteria | 641 |
| 773 | Ga0466964_0793189 | 3300044706 | Bacteria | 535 |
| 774 | Ga0466971_0164387 | 3300044719 | Bacteria | 1039 |
| 775 | Ga0466971_0208355 | 3300044719 | Bacteria | 924 |
| 776 | Ga0466971_0686630 | 3300044719 | Unclassified | 514 |
| 777 | Ga0466970_0121409 | 3300044765 | Bacteria | 1431 |
| 778 | Ga0466970_0135627 | 3300044765 | Bacteria | 1354 |
| 779 | Ga0466970_0142614 | 3300044765 | Bacteria | 1320 |
| 780 | Ga0466970_0170935 | 3300044765 | Bacteria | 1204 |
| 781 | Ga0466957_0010494 | 3300044842 | Bacteria | 5324 |
| 782 | Ga0466957_0060210 | 3300044842 | Bacteria | 2328 |
| 783 | Ga0466957_0153559 | 3300044842 | Bacteria | 1491 |
| 784 | Ga0466957_0214085 | 3300044842 | Bacteria | 1270 |
| 785 | Ga0466957_0337254 | 3300044842 | Bacteria | 1020 |
| 786 | Ga0466957_0525647 | 3300044842 | Bacteria | 822 |
| 787 | Ga0466957_0741379 | 3300044842 | Bacteria | 695 |
| 788 | Ga0466960_0107436 | 3300044901 | Bacteria | 1445 |
| 789 | Ga0466960_0127649 | 3300044901 | Bacteria | 1339 |
| 790 | Ga0466960_0557122 | 3300044901 | Bacteria | 677 |
| 791 | Ga0466959_0188232 | 3300045049 | Bacteria | 1441 |
| 792 | Ga0466959_0317928 | 3300045049 | Bacteria | 1064 |
| 793 | Ga0466959_0320834 | 3300045049 | Bacteria | 1059 |
| 794 | Ga0466959_0606724 | 3300045049 | Bacteria | 736 |
| 795 | Ga0466959_0945674 | 3300045049 | Bacteria | 574 |
| 796 | Ga0466958_0033247 | 3300045836 | Bacteria | 3071 |
| 797 | Ga0466958_0176904 | 3300045836 | Bacteria | 1353 |
| 798 | Ga0466958_0253648 | 3300045836 | Bacteria | 1126 |
| 799 | Ga0466958_0728616 | 3300045836 | Bacteria | 646 |
| 800 | Ga0466967_0021296 | 3300045976 | Bacteria | 5261 |
| 801 | Ga0466967_0134170 | 3300045976 | Bacteria | 2301 |
| 802 | Ga0466967_0135714 | 3300045976 | Bacteria | 2288 |
| 803 | Ga0466967_0483308 | 3300045976 | Bacteria | 1214 |
| 804 | Ga0466967_0684263 | 3300045976 | Bacteria | 1015 |
| 805 | Ga0466967_0887005 | 3300045976 | Bacteria | 887 |
| 806 | Ga0466967_1773452 | 3300045976 | Bacteria | 614 |
| 807 | Ga0495592_0000077 | 3300046454 | Bacteria | 85837 |
| 808 | Ga0495592_0004580 | 3300046454 | Bacteria | 10124 |
| 809 | Ga0495592_0145851 | 3300046454 | Bacteria | 1641 |
| 810 | Ga0495592_0308285 | 3300046454 | Bacteria | 1027 |
| 811 | Ga0495592_0372834 | 3300046454 | Bacteria | 910 |
| 812 | Ga0495592_0476749 | 3300046454 | Bacteria | 778 |
| 813 | Ga0495592_0535168 | 3300046454 | Bacteria | 722 |
| 814 | Ga0495603_0175429 | 3300046455 | Bacteria | 1241 |
| 815 | Ga0495641_0498407 | 3300046461 | Bacteria | 555 |
| 816 | Ga0495651_0000019 | 3300046462 | Bacteria | 120970 |
| 817 | Ga0495651_0045029 | 3300046462 | Bacteria | 3418 |
| 818 | Ga0495651_0054910 | 3300046462 | Bacteria | 3061 |
| 819 | Ga0495651_0083155 | 3300046462 | Bacteria | 2414 |
| 820 | Ga0495651_0602431 | 3300046462 | Bacteria | 693 |
| 821 | Ga0495653_0001268 | 3300046463 | Bacteria | 19539 |
| 822 | Ga0495653_0016762 | 3300046463 | Bacteria | 5962 |
| 823 | Ga0495653_0345006 | 3300046463 | Bacteria | 959 |
| 824 | Ga0495653_0613886 | 3300046463 | Unclassified | 667 |
| 825 | Ga0495650_0016153 | 3300046471 | Bacteria | 3794 |
| 826 | Ga0495580_0028947 | 3300046472 | Bacteria | 4024 |
| 827 | Ga0495639_0017448 | 3300046475 | Bacteria | 3118 |
| 828 | Ga0495639_0521745 | 3300046475 | Bacteria | 607 |
| 829 | Ga0495662_0005382 | 3300046476 | Bacteria | 6408 |
| 830 | Ga0495664_0008766 | 3300046477 | Bacteria | 5649 |
| 831 | Ga0495664_0049870 | 3300046477 | Bacteria | 2485 |
| 832 | Ga0495664_0075798 | 3300046477 | Bacteria | 2012 |
| 833 | Ga0495664_0322152 | 3300046477 | Bacteria | 932 |
| 834 | Ga0495664_0359818 | 3300046477 | Bacteria | 876 |
| 835 | Ga0495664_0380495 | 3300046477 | Bacteria | 848 |
| 836 | Ga0495664_0586851 | 3300046477 | Unclassified | 663 |
| 837 | Ga0495664_0650425 | 3300046477 | Bacteria | 625 |
| 838 | Ga0495583_0143019 | 3300046506 | Bacteria | 995 |
| 839 | Ga0495608_0000028 | 3300046511 | Bacteria | 151829 |
| 840 | Ga0495608_0012419 | 3300046511 | Bacteria | 5912 |
| 841 | Ga0495608_0017771 | 3300046511 | Bacteria | 4917 |
| 842 | Ga0495608_0295359 | 3300046511 | Bacteria | 1004 |
| 843 | Ga0495618_0025694 | 3300046514 | Bacteria | 3657 |
| 844 | Ga0495618_0178415 | 3300046514 | Bacteria | 1350 |
| 845 | Ga0495628_0001918 | 3300046516 | Bacteria | 18867 |
| 846 | Ga0495628_0006885 | 3300046516 | Bacteria | 9880 |
| 847 | Ga0495628_0026832 | 3300046516 | Bacteria | 4689 |
| 848 | Ga0495628_0103939 | 3300046516 | Bacteria | 2190 |
| 849 | Ga0495628_0237842 | 3300046516 | Bacteria | 1363 |
| 850 | Ga0495628_0496787 | 3300046516 | Bacteria | 881 |
| 851 | Ga0495630_0006388 | 3300046517 | Bacteria | 8381 |
| 852 | Ga0495630_0102218 | 3300046517 | Bacteria | 2168 |
| 853 | Ga0495630_0520624 | 3300046517 | Unclassified | 912 |
| 854 | Ga0495630_0664209 | 3300046517 | Bacteria | 798 |
| 855 | Ga0495632_0001505 | 3300046519 | Bacteria | 19261 |
| 856 | Ga0495637_0216222 | 3300046520 | Bacteria | 699 |
| 857 | Ga0495666_0002010 | 3300046526 | Bacteria | 10047 |
| 858 | Ga0495666_0009785 | 3300046526 | Bacteria | 4791 |
| 859 | Ga0495652_0000031 | 3300046529 | Bacteria | 151765 |
| 860 | Ga0495652_0103665 | 3300046529 | Bacteria | 2302 |
| 861 | Ga0495652_0309847 | 3300046529 | Bacteria | 1144 |
| 862 | Ga0495652_0446218 | 3300046529 | Bacteria | 906 |
| 863 | Ga0495665_0015478 | 3300046531 | Bacteria | 4107 |
| 864 | Ga0495665_0548606 | 3300046531 | Bacteria | 580 |
| 865 | Ga0495640_0019201 | 3300046533 | Bacteria | 5049 |
| 866 | Ga0495640_0041400 | 3300046533 | Bacteria | 3219 |
| 867 | Ga0495640_0071341 | 3300046533 | Bacteria | 2331 |
| 868 | Ga0495640_0200721 | 3300046533 | Bacteria | 1264 |
| 869 | Ga0495640_0325527 | 3300046533 | Bacteria | 951 |
| 870 | Ga0495586_0005073 | 3300046535 | Bacteria | 7046 |
| 871 | Ga0495586_0667811 | 3300046535 | Bacteria | 600 |
| 872 | Ga0495587_0000023 | 3300046536 | Bacteria | 151763 |
| 873 | Ga0495587_0016275 | 3300046536 | Bacteria | 4628 |
| 874 | Ga0495587_0058223 | 3300046536 | Bacteria | 2270 |
| 875 | Ga0495645_0011765 | 3300046543 | Bacteria | 6163 |
| 876 | Ga0495645_0077699 | 3300046543 | Bacteria | 2386 |
| 877 | Ga0495645_0187043 | 3300046543 | Bacteria | 1414 |
| 878 | Ga0495645_0348635 | 3300046543 | Bacteria | 954 |
| 879 | Ga0495645_0415880 | 3300046543 | Bacteria | 854 |
| 880 | Ga0495645_0465015 | 3300046543 | Bacteria | 796 |
| 881 | Ga0495645_0581349 | 3300046543 | Bacteria | 691 |
| 882 | Ga0495645_0960812 | 3300046543 | Bacteria | 504 |
| 883 | Ga0495667_0000373 | 3300046559 | Bacteria | 28432 |
| 884 | Ga0495667_0000913 | 3300046559 | Bacteria | 19089 |
| 885 | Ga0495667_0026848 | 3300046559 | Bacteria | 3879 |
| 886 | Ga0495667_0214846 | 3300046559 | Bacteria | 1228 |
| 887 | Ga0495667_0835981 | 3300046559 | Bacteria | 567 |
| 888 | Ga0495668_0548487 | 3300046616 | Bacteria | 638 |
| 889 | Ga0495634_0060857 | 3300046642 | Bacteria | 2511 |
| 890 | Ga0495634_0883196 | 3300046642 | Bacteria | 506 |
| 891 | Ga0495635_0013180 | 3300046663 | Bacteria | 5787 |
| 892 | Ga0495635_0048120 | 3300046663 | Bacteria | 2939 |
| 893 | Ga0495635_0097633 | 3300046663 | Bacteria | 2008 |
| 894 | Ga0495635_0194617 | 3300046663 | Bacteria | 1376 |
| 895 | Ga0495635_0202400 | 3300046663 | Bacteria | 1346 |
| 896 | Ga0495635_0359002 | 3300046663 | Bacteria | 971 |
| 897 | Ga0495588_0356262 | 3300046674 | Bacteria | 769 |
| 898 | Ga0495657_0000022 | 3300046675 | Bacteria | 151837 |
| 899 | Ga0495657_0044444 | 3300046675 | Bacteria | 3021 |
| 900 | Ga0495657_0354777 | 3300046675 | Bacteria | 867 |
| 901 | Ga0495657_0401404 | 3300046675 | Bacteria | 806 |
| 902 | Ga0495599_0000174 | 3300046678 | Bacteria | 42332 |
| 903 | Ga0495599_0016524 | 3300046678 | Bacteria | 4582 |
| 904 | Ga0495599_0025442 | 3300046678 | Bacteria | 3705 |
| 905 | Ga0495599_0058597 | 3300046678 | Bacteria | 2409 |
| 906 | Ga0495599_0069003 | 3300046678 | Bacteria | 2207 |
| 907 | Ga0495623_0011541 | 3300046679 | Bacteria | 5718 |
| 908 | Ga0495623_0075512 | 3300046679 | Bacteria | 2092 |
| 909 | Ga0495623_0311102 | 3300046679 | Bacteria | 868 |
| 910 | Ga0495646_0013004 | 3300046680 | Bacteria | 5292 |
| 911 | Ga0495646_0025270 | 3300046680 | Bacteria | 3736 |
| 912 | Ga0495646_0040869 | 3300046680 | Bacteria | 2853 |
| 913 | Ga0495646_0212791 | 3300046680 | Bacteria | 1048 |
| 914 | Ga0495646_0405261 | 3300046680 | Bacteria | 708 |
| 915 | Ga0495647_0051074 | 3300046681 | Unclassified | 1606 |
| 916 | Ga0495647_0355221 | 3300046681 | Bacteria | 667 |
| 917 | Ga0495658_0010354 | 3300046683 | Bacteria | 4664 |
| 918 | Ga0495658_1015596 | 3300046683 | Bacteria | 529 |
| 919 | Ga0495613_0077197 | 3300046689 | Bacteria | 2423 |
| 920 | Ga0495613_0271754 | 3300046689 | Bacteria | 1179 |
| 921 | Ga0495624_0905725 | 3300046690 | Bacteria | 519 |
| 922 | Ga0495600_0011341 | 3300046809 | Bacteria | 5553 |
| 923 | Ga0495600_0049830 | 3300046809 | Bacteria | 2732 |
| 924 | Ga0495600_0501315 | 3300046809 | Bacteria | 746 |
| 925 | Ga0495600_0749741 | 3300046809 | Bacteria | 584 |
| 926 | Ga0495581_0326247 | 3300047315 | Bacteria | 897 |
| 927 | Ga0495581_0553724 | 3300047315 | Unclassified | 667 |
| 928 | Ga0495604_0000022 | 3300047317 | Bacteria | 151744 |
| 929 | Ga0495604_0000132 | 3300047317 | Bacteria | 63177 |
| 930 | Ga0495604_0009677 | 3300047317 | Bacteria | 7620 |
| 931 | Ga0495604_0118825 | 3300047317 | Bacteria | 1916 |
| 932 | Ga0495604_0772212 | 3300047317 | Bacteria | 607 |
| 933 | Ga0495674_0004392 | 3300047319 | Bacteria | 13556 |
| 934 | Ga0495674_0012867 | 3300047319 | Bacteria | 7880 |
| 935 | Ga0495674_0022817 | 3300047319 | Bacteria | 5768 |
| 936 | Ga0495674_0085661 | 3300047319 | Bacteria | 2699 |
| 937 | Ga0495674_0480681 | 3300047319 | Bacteria | 995 |
| 938 | Ga0495676_0061477 | 3300047321 | Bacteria | 2938 |
| 939 | Ga0495676_0260381 | 3300047321 | Bacteria | 1180 |
| 940 | Ga0495676_0303493 | 3300047321 | Bacteria | 1076 |
| 941 | Ga0495680_0001555 | 3300047322 | Bacteria | 24556 |
| 942 | Ga0495680_0039799 | 3300047322 | Bacteria | 3747 |
| 943 | Ga0495680_0054859 | 3300047322 | Bacteria | 3093 |
| 944 | Ga0495680_0309366 | 3300047322 | Bacteria | 1108 |
| 945 | Ga0495675_0001285 | 3300047444 | Bacteria | 15206 |
| 946 | Ga0495675_0086137 | 3300047444 | Bacteria | 1975 |
| 947 | Ga0495675_0086933 | 3300047444 | Bacteria | 1964 |
| 948 | Ga0495675_0226830 | 3300047444 | Bacteria | 1128 |
| 949 | Ga0495675_0279794 | 3300047444 | Bacteria | 995 |
| 950 | Ga0495684_0010588 | 3300047471 | Bacteria | 7127 |
| 951 | Ga0495684_0153870 | 3300047471 | Bacteria | 1718 |
| 952 | Ga0495593_0197128 | 3300047673 | Bacteria | 1012 |
| 953 | Ga0495593_0651527 | 3300047673 | Bacteria | 529 |
| 954 | Ga0495602_0000169 | 3300048088 | Bacteria | 60858 |
| 955 | Ga0495602_0031701 | 3300048088 | Bacteria | 4992 |
| 956 | Ga0495602_0135570 | 3300048088 | Bacteria | 1956 |
| 957 | Ga0495602_0688943 | 3300048088 | Bacteria | 694 |
| 958 | Ga0496100_0404680 | 3300048903 | Bacteria | 1040 |
| 959 | Ga0496100_1181794 | 3300048903 | Bacteria | 603 |
| 960 | Ga0496102_0135235 | 3300048905 | Bacteria | 2310 |
| 961 | Ga0496104_0075454 | 3300048907 | Bacteria | 3210 |
| 962 | Ga0496104_0800194 | 3300048907 | Bacteria | 849 |
| 963 | Ga0496105_0108894 | 3300048908 | Bacteria | 2287 |
| 964 | Ga0496105_0267328 | 3300048908 | Bacteria | 1382 |
| 965 | Ga0496105_1004003 | 3300048908 | Bacteria | 624 |
| 966 | Ga0496106_0381372 | 3300048909 | Bacteria | 1133 |
| 967 | Ga0496106_0443450 | 3300048909 | Bacteria | 1043 |
| 968 | Ga0496106_1183642 | 3300048909 | Bacteria | 597 |
| 969 | Ga0496108_0075084 | 3300048911 | Bacteria | 2855 |
| 970 | Ga0496108_0300554 | 3300048911 | Bacteria | 1398 |
| 971 | Ga0496108_0586784 | 3300048911 | Bacteria | 971 |
| 972 | Ga0496109_0081888 | 3300048912 | Bacteria | 2974 |
| 973 | Ga0496112_0094243 | 3300048915 | Bacteria | 2964 |
| 974 | Ga0496112_0541407 | 3300048915 | Bacteria | 1098 |
| 975 | Ga0496112_0638487 | 3300048915 | Bacteria | 995 |
| 976 | Ga0496112_1039101 | 3300048915 | Bacteria | 738 |
| 977 | Ga0496113_0048622 | 3300048916 | Bacteria | 3156 |
| 978 | Ga0496113_0393100 | 3300048916 | Bacteria | 1113 |
| 979 | Ga0496114_0193978 | 3300048917 | Bacteria | 1778 |
| 980 | Ga0496114_0894470 | 3300048917 | Unclassified | 769 |
| 981 | Ga0496114_1243382 | 3300048917 | Bacteria | 631 |
| 982 | Ga0496114_1562689 | 3300048917 | Bacteria | 548 |
| 983 | Ga0496115_0131802 | 3300048918 | Bacteria | 2060 |
| 984 | Ga0501033_0876018 | 3300049570 | Bacteria | 604 |
| 985 | Ga0501036_0137951 | 3300049572 | Bacteria | 2058 |
| 986 | Ga0501039_0030630 | 3300049575 | Bacteria | 4149 |
| 987 | Ga0501040_0065530 | 3300049576 | Bacteria | 2502 |
| 988 | Ga0501041_0045336 | 3300049577 | Bacteria | 2673 |
| 989 | Ga0501042_0017499 | 3300049578 | Bacteria | 4943 |
| 990 | Ga0501042_0037006 | 3300049578 | Bacteria | 3463 |
| 991 | Ga0501048_0242172 | 3300049582 | Bacteria | 1280 |
| 992 | Ga0501067_0000471 | 3300049583 | Bacteria | 21958 |
| 993 | Ga0501067_0399902 | 3300049583 | Bacteria | 766 |
| 994 | Ga0501068_0000400 | 3300049584 | Bacteria | 21980 |
| 995 | Ga0501069_0001363 | 3300049585 | Bacteria | 11987 |
| 996 | Ga0501071_0482249 | 3300049587 | Bacteria | 950 |
| 997 | Ga0501072_0057835 | 3300049588 | Bacteria | 3056 |
| 998 | Ga0501074_0722138 | 3300049590 | Bacteria | 703 |
| 999 | Ga0501075_0187350 | 3300049591 | Bacteria | 1578 |
| 1000 | Ga0501076_0989178 | 3300049592 | Bacteria | 693 |
| 1001 | Ga0501079_0454986 | 3300049741 | Bacteria | 1005 |
| 1002 | Ga0501081_0550352 | 3300049743 | Bacteria | 862 |
| 1003 | Ga0501081_0696577 | 3300049743 | Bacteria | 763 |
| 1004 | Ga0501044_0241222 | 3300049823 | Bacteria | 1751 |
| 1005 | Ga0501044_0378082 | 3300049823 | Bacteria | 1332 |
| 1006 | Ga0501045_0010962 | 3300049824 | Bacteria | 6349 |
| 1007 | nmdc:mga03n38_764603_c1 | 3300050490 | Bacteria | 560 |
| 1008 | nmdc:mga03n38_914024_c1 | 3300050490 | Unclassified | 516 |
| 1009 | nmdc:mga00v17_145660_c1 | 3300050491 | Bacteria | 1520 |
| 1010 | nmdc:mga00v17_60460_c1 | 3300050491 | Bacteria | 2327 |
| 1011 | nmdc:mga00v17_813616_c1 | 3300050491 | Bacteria | 595 |
| 1012 | nmdc:mga0yw44_1022012_c1 | 3300050492 | Unclassified | 559 |
| 1013 | nmdc:mga0yw44_389588_c1 | 3300050492 | Bacteria | 941 |
| 1014 | nmdc:mga0k408_148398_c1 | 3300050493 | Bacteria | 1396 |
| 1015 | nmdc:mga0k408_58177_c1 | 3300050493 | Bacteria | 2245 |
| 1016 | nmdc:mga0k408_65654_c1 | 3300050493 | Bacteria | 2113 |
| 1017 | nmdc:mga06z11_175692_c1 | 3300050494 | Bacteria | 1232 |
| 1018 | nmdc:mga06z11_293452_c1 | 3300050494 | Bacteria | 965 |
| 1019 | nmdc:mga07m45_116862_c1 | 3300050496 | Bacteria | 1539 |
| 1020 | nmdc:mga07m45_65691_c1 | 3300050496 | Bacteria | 2060 |
| 1021 | nmdc:mga05p37_488298_c1 | 3300050507 | Bacteria | 1416 |
| 1022 | nmdc:mga05p37_8079_c1 | 3300050507 | Bacteria | 12433 |
| 1023 | nmdc:mga08y16_121804_c1 | 3300050511 | Bacteria | 2714 |
| 1024 | nmdc:mga08y16_175621_c1 | 3300050511 | Bacteria | 2224 |
| 1025 | nmdc:mga0n895_1050625_c1 | 3300050512 | Bacteria | 794 |
| 1026 | nmdc:mga0n895_1517643_c1 | 3300050512 | Bacteria | 636 |
| 1027 | nmdc:mga0n895_3349_c1 | 3300050512 | Bacteria | 12885 |
| 1028 | nmdc:mga0n895_40777_c1 | 3300050512 | Bacteria | 4511 |
| 1029 | nmdc:mga0n895_447392_c1 | 3300050512 | Bacteria | 1305 |
| 1030 | nmdc:mga0n895_690106_c1 | 3300050512 | Bacteria | 1018 |
| 1031 | nmdc:mga0rr50_162087_c1 | 3300050513 | Bacteria | 1816 |
| 1032 | nmdc:mga0rr50_4906_c1 | 3300050513 | Bacteria | 7916 |
| 1033 | nmdc:mga0rr50_746027_c1 | 3300050513 | Bacteria | 836 |
| 1034 | nmdc:mga08x19_1330458_c1 | 3300050514 | Bacteria | 509 |
| 1035 | nmdc:mga08x19_536741_c1 | 3300050514 | Bacteria | 827 |
| 1036 | nmdc:mga08x19_704531_c1 | 3300050514 | Bacteria | 717 |
| 1037 | nmdc:mga08x19_896287_c1 | 3300050514 | Bacteria | 630 |
| 1038 | nmdc:mga0a205_203326_c1 | 3300050515 | Bacteria | 1871 |
| 1039 | nmdc:mga0a205_919529_c1 | 3300050515 | Bacteria | 722 |
| 1040 | nmdc:mga0sz30_198803_c1 | 3300050516 | Unclassified | 890 |
| 1041 | Ga0495601_0046684 | 3300053077 | Bacteria | 2726 |
| 1042 | Ga0495601_0059285 | 3300053077 | Bacteria | 2427 |
| 1043 | Ga0495601_0060951 | 3300053077 | Bacteria | 2395 |
| 1044 | Ga0495601_0086273 | 3300053077 | Bacteria | 2017 |
| 1045 | Ga0495601_0997819 | 3300053077 | Bacteria | 526 |
| 1046 | Ga0495612_0023863 | 3300053078 | Bacteria | 2456 |
| 1047 | Ga0495612_0057263 | 3300053078 | Bacteria | 1609 |
| 1048 | Ga0500635_0000007 | 3300053080 | Bacteria | 169379 |
| 1049 | Ga0500635_0433326 | 3300053080 | Bacteria | 521 |
| 1050 | Ga0495655_0001829 | 3300053083 | Bacteria | 3314 |
| 1051 | Ga0495595_0003146 | 3300053084 | Bacteria | 6541 |
| 1052 | Ga0495595_0182804 | 3300053084 | Bacteria | 1040 |
| 1053 | Ga0495595_0186417 | 3300053084 | Bacteria | 1030 |
| 1054 | Ga0495595_0291387 | 3300053084 | Bacteria | 820 |
| 1055 | Ga0495595_0487289 | 3300053084 | Bacteria | 628 |
| 1056 | Ga0495619_0055053 | 3300053085 | Bacteria | 2634 |
| 1057 | Ga0495619_0190723 | 3300053085 | Bacteria | 1418 |
| 1058 | Ga0495619_0363951 | 3300053085 | Bacteria | 1000 |
| 1059 | Ga0495619_0749394 | 3300053085 | Bacteria | 662 |
| 1060 | Ga0500578_0000213 | 3300053086 | Bacteria | 71211 |
| 1061 | Ga0500644_0023657 | 3300053088 | Bacteria | 1868 |
| 1062 | Ga0500646_0138572 | 3300053090 | Bacteria | 796 |
| 1063 | Ga0500651_0107982 | 3300053093 | Bacteria | 1700 |
| 1064 | Ga0500650_0193225 | 3300053098 | Bacteria | 929 |
| 1065 | Ga0500572_081457 | 3300053111 | Bacteria | 1015 |
| 1066 | Ga0500628_013690 | 3300053129 | Bacteria | 1519 |
| 1067 | Ga0500642_0002873 | 3300053130 | Bacteria | 5120 |
| 1068 | Ga0500652_000430 | 3300053131 | Bacteria | 14948 |
| 1069 | Ga0500655_011150 | 3300053133 | Bacteria | 1627 |
| 1070 | Ga0500658_0361323 | 3300053134 | Bacteria | 666 |
| 1071 | Ga0500559_0023824 | 3300053136 | Bacteria | 2600 |
| 1072 | Ga0500559_0042432 | 3300053136 | Bacteria | 1984 |
| 1073 | Ga0500564_029657 | 3300053138 | Bacteria | 2521 |
| 1074 | Ga0500568_0009296 | 3300053139 | Bacteria | 4681 |
| 1075 | Ga0500577_0006261 | 3300053142 | Bacteria | 3269 |
| 1076 | Ga0500579_058777 | 3300053143 | Bacteria | 2298 |
| 1077 | Ga0500604_0013805 | 3300053151 | Bacteria | 2192 |
| 1078 | Ga0500604_0024587 | 3300053151 | Bacteria | 1725 |
| 1079 | Ga0500604_0205690 | 3300053151 | Bacteria | 677 |
| 1080 | Ga0500622_0000631 | 3300053156 | Bacteria | 31645 |
| 1081 | Ga0500622_0154784 | 3300053156 | Bacteria | 1080 |
| 1082 | Ga0500570_201134 | 3300053724 | Bacteria | 604 |
| 1083 | Ga0500601_007612 | 3300053737 | Bacteria | 1202 |
| 1084 | Ga0501084_0305761 | 3300054114 | Bacteria | 1343 |
| 1085 | Ga0501084_1737224 | 3300054114 | Bacteria | 521 |
| 1086 | Ga0501082_1123901 | 3300060353 | Bacteria | 687 |
| 1087 | Ga0466962_0008558 | 3300061719 | Bacteria | 4904 |
| 1088 | Ga0466962_0059868 | 3300061719 | Bacteria | 1818 |
| 1089 | Ga0466962_0655581 | 3300061719 | Bacteria | 537 |
| 1090 | Ga0530510_0006186 | 3300061734 | Bacteria | 8321 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041459 | Ga0451800_1538363 | Ga0451800_1538363_272_463 | 62 |
| 2 | 3300044706 | Ga0466964_0018940 | Ga0466964_0018940_2078_2311 | 64 |
| 3 | 3300044765 | Ga0466970_0135627 | Ga0466970_0135627_689_922 | 64 |
| 4 | 3300044842 | Ga0466957_0525647 | Ga0466957_0525647_487_720 | 64 |
| 5 | 3300044719 | Ga0466971_0686630 | Ga0466971_0686630_166_396 | 68 |
| 6 | 3300044765 | Ga0466970_0170935 | Ga0466970_0170935_815_1045 | 68 |
| 7 | 3300044901 | Ga0466960_0557122 | Ga0466960_0557122_169_399 | 68 |
| 8 | 3300044693 | Ga0466961_0164634 | Ga0466961_0164634_1126_1359 | 70 |
| 9 | 3300061719 | Ga0466962_0655581 | Ga0466962_0655581_285_518 | 70 |
| 10 | iso_pu_bacteria | 2585428057 | 2587724890 | 72 |
| 11 | iso_pu_bacteria | 2585428058 | 2587736704 | 72 |
| 12 | iso_pu_bacteria | 2588253510 | 2588295315 | 72 |
| 13 | iso_pu_bacteria | 2643221592 | 2643970186 | 72 |
| 14 | iso_pu_bacteria | 2643221625 | 2644142416 | 72 |
| 15 | iso_pu_bacteria | 2643221648 | 2644275118 | 72 |
| 16 | 3300005330 | Ga0070690_101141857 | Ga0070690_1011418572 | 73 |
| 17 | 3300005355 | Ga0070671_101841547 | Ga0070671_1018415472 | 73 |
| 18 | 3300005356 | Ga0070674_102180306 | Ga0070674_1021803061 | 73 |
| 19 | 3300005440 | Ga0070705_100608479 | Ga0070705_1006084792 | 73 |
| 20 | 3300005549 | Ga0070704_101868437 | Ga0070704_1018684372 | 73 |
| 21 | 3300005843 | Ga0068860_101068251 | Ga0068860_1010682512 | 73 |
| 22 | 3300006038 | Ga0075365_11041903 | Ga0075365_110419032 | 73 |
| 23 | 3300006358 | Ga0068871_101284369 | Ga0068871_1012843692 | 73 |
| 24 | 3300009098 | Ga0105245_10095768 | Ga0105245_100957682 | 73 |
| 25 | 3300009148 | Ga0105243_10475141 | Ga0105243_104751412 | 73 |
| 26 | 3300009148 | Ga0105243_11986279 | Ga0105243_119862791 | 73 |
| 27 | 3300009176 | Ga0105242_12282082 | Ga0105242_122820822 | 73 |
| 28 | 3300009545 | Ga0105237_11588062 | Ga0105237_115880622 | 73 |
| 29 | 3300009553 | Ga0105249_11427000 | Ga0105249_114270002 | 73 |
| 30 | 3300013297 | Ga0157378_11248540 | Ga0157378_112485402 | 73 |
| 31 | 3300013306 | Ga0163162_11183552 | Ga0163162_111835522 | 73 |
| 32 | 3300014326 | Ga0157380_12153166 | Ga0157380_121531662 | 73 |
| 33 | 3300014968 | Ga0157379_10138447 | Ga0157379_101384471 | 73 |
| 34 | 3300025918 | Ga0207662_10219689 | Ga0207662_102196892 | 73 |
| 35 | 3300025934 | Ga0207686_10627461 | Ga0207686_106274612 | 73 |
| 36 | 3300025935 | Ga0207709_11434122 | Ga0207709_114341222 | 73 |
| 37 | 3300025942 | Ga0207689_11343711 | Ga0207689_113437112 | 73 |
| 38 | 3300025961 | Ga0207712_11750157 | Ga0207712_117501572 | 73 |
| 39 | 3300025972 | Ga0207668_11557321 | Ga0207668_115573211 | 73 |
| 40 | 3300026088 | Ga0207641_12273826 | Ga0207641_122738262 | 73 |
| 41 | 3300026095 | Ga0207676_11315795 | Ga0207676_113157952 | 73 |
| 42 | 3300026118 | Ga0207675_101165500 | Ga0207675_1011655002 | 73 |
| 43 | 3300028558 | Ga0265326_10131536 | Ga0265326_101315362 | 73 |
| 44 | 3300028563 | Ga0265319_1063116 | Ga0265319_10631162 | 73 |
| 45 | 3300028800 | Ga0265338_10000241 | Ga0265338_1000024138 | 73 |
| 46 | 3300028800 | Ga0265338_10150506 | Ga0265338_101505062 | 73 |
| 47 | 3300031240 | Ga0265320_10455223 | Ga0265320_104552231 | 73 |
| 48 | 3300031241 | Ga0265325_10007889 | Ga0265325_100078892 | 73 |
| 49 | 3300031247 | Ga0265340_10226992 | Ga0265340_102269922 | 73 |
| 50 | 3300031247 | Ga0265340_10228124 | Ga0265340_102281241 | 73 |
| 51 | 3300031249 | Ga0265339_10000865 | Ga0265339_1000086514 | 73 |
| 52 | 3300031249 | Ga0265339_10532045 | Ga0265339_105320452 | 73 |
| 53 | 3300031344 | Ga0265316_10071814 | Ga0265316_100718142 | 73 |
| 54 | 3300031595 | Ga0265313_10005615 | Ga0265313_100056157 | 73 |
| 55 | 3300031711 | Ga0265314_10136451 | Ga0265314_101364512 | 73 |
| 56 | 3300031712 | Ga0265342_10369636 | Ga0265342_103696361 | 73 |
| 57 | 3300044683 | Ga0466965_0799980 | Ga0466965_0799980_283_510 | 73 |
| 58 | 3300046463 | Ga0495653_0613886 | Ga0495653_0613886_411_635 | 73 |
| 59 | 3300046511 | Ga0495608_0295359 | Ga0495608_0295359_320_544 | 73 |
| 60 | 3300046517 | Ga0495630_0520624 | Ga0495630_0520624_437_661 | 73 |
| 61 | 3300047321 | Ga0495676_0061477 | Ga0495676_0061477_1874_2104 | 73 |
| 62 | 3300047322 | Ga0495680_0309366 | Ga0495680_0309366_472_696 | 73 |
| 63 | 3300048915 | Ga0496112_0541407 | Ga0496112_0541407_851_1075 | 73 |
| 64 | 3300048915 | Ga0496112_0638487 | Ga0496112_0638487_220_444 | 73 |
| 65 | 3300048917 | Ga0496114_1562689 | Ga0496114_1562689_26_250 | 73 |
| 66 | 3300050492 | nmdc:mga0yw44_1022012_c1 | nmdc:mga0yw44_1022012_c1_145_369 | 73 |
| 67 | 3300005343 | Ga0070687_100487859 | Ga0070687_1004878592 | 74 |
| 68 | 3300005367 | Ga0070667_100844611 | Ga0070667_1008446112 | 74 |
| 69 | 3300005456 | Ga0070678_101049153 | Ga0070678_1010491532 | 74 |
| 70 | 3300005843 | Ga0068860_102684187 | Ga0068860_1026841872 | 74 |
| 71 | 3300006038 | Ga0075365_10107068 | Ga0075365_101070682 | 74 |
| 72 | 3300006038 | Ga0075365_10752618 | Ga0075365_107526182 | 74 |
| 73 | 3300006178 | Ga0075367_10433180 | Ga0075367_104331802 | 74 |
| 74 | 3300009094 | Ga0111539_10208014 | Ga0111539_102080142 | 74 |
| 75 | 3300009094 | Ga0111539_12363162 | Ga0111539_123631622 | 74 |
| 76 | 3300009553 | Ga0105249_10816655 | Ga0105249_108166552 | 74 |
| 77 | 3300014325 | Ga0163163_13055106 | Ga0163163_130551062 | 74 |
| 78 | 3300014326 | Ga0157380_10406487 | Ga0157380_104064872 | 74 |
| 79 | 3300014745 | Ga0157377_10870037 | Ga0157377_108700371 | 74 |
| 80 | 3300026067 | Ga0207678_11189586 | Ga0207678_111895862 | 74 |
| 81 | 3300026075 | Ga0207708_10975471 | Ga0207708_109754711 | 74 |
| 82 | 3300027907 | Ga0207428_11290146 | Ga0207428_112901461 | 74 |
| 83 | 3300031824 | Ga0307413_10094713 | Ga0307413_100947131 | 74 |
| 84 | 3300031852 | Ga0307410_10690565 | Ga0307410_106905652 | 74 |
| 85 | 3300031852 | Ga0307410_11271563 | Ga0307410_112715631 | 74 |
| 86 | 3300031901 | Ga0307406_10251448 | Ga0307406_102514482 | 74 |
| 87 | 3300032002 | Ga0307416_100551137 | Ga0307416_1005511372 | 74 |
| 88 | 3300032126 | Ga0307415_100897852 | Ga0307415_1008978522 | 74 |
| 89 | 3300041443 | Ga0451789_0299630 | Ga0451789_0299630_29_259 | 74 |
| 90 | 3300041451 | Ga0451791_1359482 | Ga0451791_1359482_520_747 | 74 |
| 91 | 3300041452 | Ga0451793_0217027 | Ga0451793_0217027_237_464 | 74 |
| 92 | 3300041509 | Ga0451843_0771240 | Ga0451843_0771240_229_456 | 74 |
| 93 | 3300041512 | Ga0451853_1343160 | Ga0451853_1343160_37_264 | 74 |
| 94 | 3300044706 | Ga0466964_0521994 | Ga0466964_0521994_178_408 | 74 |
| 95 | 3300044842 | Ga0466957_0741379 | Ga0466957_0741379_237_467 | 74 |
| 96 | 3300044901 | Ga0466960_0127649 | Ga0466960_0127649_806_1036 | 74 |
| 97 | 3300045976 | Ga0466967_0021296 | Ga0466967_0021296_51_281 | 74 |
| 98 | 3300046477 | Ga0495664_0650425 | Ga0495664_0650425_327_557 | 74 |
| 99 | 3300046543 | Ga0495645_0960812 | Ga0495645_0960812_65_295 | 74 |
| 100 | 3300046663 | Ga0495635_0194617 | Ga0495635_0194617_509_739 | 74 |
| 101 | 3300048917 | Ga0496114_0193978 | Ga0496114_0193978_741_971 | 74 |
| 102 | 3300049570 | Ga0501033_0876018 | Ga0501033_0876018_92_316 | 74 |
| 103 | 3300049572 | Ga0501036_0137951 | Ga0501036_0137951_362_586 | 74 |
| 104 | 3300049575 | Ga0501039_0030630 | Ga0501039_0030630_2083_2307 | 74 |
| 105 | 3300049576 | Ga0501040_0065530 | Ga0501040_0065530_232_456 | 74 |
| 106 | 3300049577 | Ga0501041_0045336 | Ga0501041_0045336_2239_2463 | 74 |
| 107 | 3300049578 | Ga0501042_0037006 | Ga0501042_0037006_3049_3273 | 74 |
| 108 | 3300049582 | Ga0501048_0242172 | Ga0501048_0242172_145_369 | 74 |
| 109 | 3300049587 | Ga0501071_0482249 | Ga0501071_0482249_533_757 | 74 |
| 110 | 3300049588 | Ga0501072_0057835 | Ga0501072_0057835_361_585 | 74 |
| 111 | 3300049590 | Ga0501074_0722138 | Ga0501074_0722138_231_455 | 74 |
| 112 | 3300049591 | Ga0501075_0187350 | Ga0501075_0187350_526_750 | 74 |
| 113 | 3300049592 | Ga0501076_0989178 | Ga0501076_0989178_152_376 | 74 |
| 114 | 3300049741 | Ga0501079_0454986 | Ga0501079_0454986_636_860 | 74 |
| 115 | 3300049743 | Ga0501081_0550352 | Ga0501081_0550352_470_694 | 74 |
| 116 | 3300049824 | Ga0501045_0010962 | Ga0501045_0010962_4947_5171 | 74 |
| 117 | 3300050490 | nmdc:mga03n38_764603_c1 | nmdc:mga03n38_764603_c1_143_373 | 74 |
| 118 | 3300050494 | nmdc:mga06z11_293452_c1 | nmdc:mga06z11_293452_c1_453_680 | 74 |
| 119 | 3300050511 | nmdc:mga08y16_175621_c1 | nmdc:mga08y16_175621_c1_1743_1967 | 74 |
| 120 | 3300053077 | Ga0495601_0046684 | Ga0495601_0046684_2192_2422 | 74 |
| 121 | 3300054114 | Ga0501084_0305761 | Ga0501084_0305761_691_915 | 74 |
| 122 | 3300060353 | Ga0501082_1123901 | Ga0501082_1123901_380_604 | 74 |
| 123 | 3300005335 | Ga0070666_10554206 | Ga0070666_105542062 | 75 |
| 124 | 3300005356 | Ga0070674_101404058 | Ga0070674_1014040582 | 75 |
| 125 | 3300005543 | Ga0070672_100314468 | Ga0070672_1003144682 | 75 |
| 126 | 3300006871 | Ga0075434_101208056 | Ga0075434_1012080562 | 75 |
| 127 | 3300009177 | Ga0105248_10428825 | Ga0105248_104288252 | 75 |
| 128 | 3300025923 | Ga0207681_11589750 | Ga0207681_115897501 | 75 |
| 129 | 3300025940 | Ga0207691_10448022 | Ga0207691_104480222 | 75 |
| 130 | 3300025986 | Ga0207658_10820107 | Ga0207658_108201072 | 75 |
| 131 | 3300026089 | Ga0207648_11438087 | Ga0207648_114380871 | 75 |
| 132 | 3300027665 | Ga0209983_1142946 | Ga0209983_11429462 | 75 |
| 133 | 3300028381 | Ga0268264_10305891 | Ga0268264_103058914 | 75 |
| 134 | 3300028381 | Ga0268264_11239226 | Ga0268264_112392262 | 75 |
| 135 | 3300031824 | Ga0307413_11366499 | Ga0307413_113664992 | 75 |
| 136 | 3300050490 | nmdc:mga03n38_914024_c1 | nmdc:mga03n38_914024_c1_151_390 | 75 |
| 137 | 3300002705 | JGI25156J39149_1000441 | JGI25156J39149_100044117 | 76 |
| 138 | 3300002738 | JGI25154J39366_1001707 | JGI25154J39366_10017075 | 76 |
| 139 | 3300002741 | JGI25157J39369_1000029 | JGI25157J39369_1000029118 | 76 |
| 140 | 3300003215 | JGI25153J46596_10001226 | JGI25153J46596_1000122611 | 76 |
| 141 | 3300003316 | rootH1_10004301 | rootH1_100043012 | 76 |
| 142 | 3300003316 | rootH1_10005893 | rootH1_100058932 | 76 |
| 143 | 3300003316 | rootH1_10013444 | rootH1_100134444 | 76 |
| 144 | 3300003322 | rootL2_10339283 | rootL2_103392832 | 76 |
| 145 | 3300003323 | rootH1_10027097 | rootH1_100270973 | 76 |
| 146 | 3300003323 | rootH1_10087369 | rootH1_100873692 | 76 |
| 147 | 3300003323 | rootH1_10170894 | rootH1_101708943 | 76 |
| 148 | 3300003752 | Ga0055539_1000310 | Ga0055539_100031014 | 76 |
| 149 | 3300003752 | Ga0055539_1000600 | Ga0055539_10006007 | 76 |
| 150 | 3300003756 | Ga0055533_1000010 | Ga0055533_1000010387 | 76 |
| 151 | 3300003759 | Ga0055525_1001518 | Ga0055525_10015183 | 76 |
| 152 | 3300003790 | Ga0055528_1068003 | Ga0055528_10680031 | 76 |
| 153 | 3300003791 | Ga0055530_10074810 | Ga0055530_100748101 | 76 |
| 154 | 3300003792 | Ga0055540_1030422 | Ga0055540_10304222 | 76 |
| 155 | 3300003794 | Ga0055531_10001045 | Ga0055531_1000104510 | 76 |
| 156 | 3300005262 | Ga0065165_1012529 | Ga0065165_10125293 | 76 |
| 157 | 3300005293 | Ga0065715_10766672 | Ga0065715_107666722 | 76 |
| 158 | 3300005327 | Ga0070658_10108531 | Ga0070658_101085311 | 76 |
| 159 | 3300005327 | Ga0070658_10385524 | Ga0070658_103855242 | 76 |
| 160 | 3300005327 | Ga0070658_10441595 | Ga0070658_104415952 | 76 |
| 161 | 3300005328 | Ga0070676_10008789 | Ga0070676_100087895 | 76 |
| 162 | 3300005328 | Ga0070676_10018572 | Ga0070676_100185721 | 76 |
| 163 | 3300005328 | Ga0070676_10937356 | Ga0070676_109373561 | 76 |
| 164 | 3300005331 | Ga0070670_100040204 | Ga0070670_1000402042 | 76 |
| 165 | 3300005331 | Ga0070670_100635295 | Ga0070670_1006352952 | 76 |
| 166 | 3300005334 | Ga0068869_100051754 | Ga0068869_1000517544 | 76 |
| 167 | 3300005334 | Ga0068869_100212462 | Ga0068869_1002124623 | 76 |
| 168 | 3300005334 | Ga0068869_100983923 | Ga0068869_1009839232 | 76 |
| 169 | 3300005335 | Ga0070666_10412331 | Ga0070666_104123311 | 76 |
| 170 | 3300005336 | Ga0070680_100391522 | Ga0070680_1003915223 | 76 |
| 171 | 3300005337 | Ga0070682_101421735 | Ga0070682_1014217351 | 76 |
| 172 | 3300005338 | Ga0068868_100114538 | Ga0068868_1001145385 | 76 |
| 173 | 3300005338 | Ga0068868_101238843 | Ga0068868_1012388432 | 76 |
| 174 | 3300005339 | Ga0070660_100681414 | Ga0070660_1006814141 | 76 |
| 175 | 3300005339 | Ga0070660_101202257 | Ga0070660_1012022571 | 76 |
| 176 | 3300005339 | Ga0070660_101266582 | Ga0070660_1012665821 | 76 |
| 177 | 3300005340 | Ga0070689_100861541 | Ga0070689_1008615412 | 76 |
| 178 | 3300005343 | Ga0070687_100946310 | Ga0070687_1009463101 | 76 |
| 179 | 3300005344 | Ga0070661_100876160 | Ga0070661_1008761603 | 76 |
| 180 | 3300005344 | Ga0070661_101045492 | Ga0070661_1010454922 | 76 |
| 181 | 3300005347 | Ga0070668_100085107 | Ga0070668_1000851072 | 76 |
| 182 | 3300005353 | Ga0070669_100769414 | Ga0070669_1007694142 | 76 |
| 183 | 3300005353 | Ga0070669_100981446 | Ga0070669_1009814462 | 76 |
| 184 | 3300005353 | Ga0070669_101108097 | Ga0070669_1011080972 | 76 |
| 185 | 3300005354 | Ga0070675_100006299 | Ga0070675_1000062996 | 76 |
| 186 | 3300005355 | Ga0070671_100013087 | Ga0070671_1000130872 | 76 |
| 187 | 3300005355 | Ga0070671_100015588 | Ga0070671_10001558810 | 76 |
| 188 | 3300005355 | Ga0070671_100229098 | Ga0070671_1002290983 | 76 |
| 189 | 3300005356 | Ga0070674_100275680 | Ga0070674_1002756801 | 76 |
| 190 | 3300005364 | Ga0070673_100053065 | Ga0070673_1000530655 | 76 |
| 191 | 3300005364 | Ga0070673_100904123 | Ga0070673_1009041232 | 76 |
| 192 | 3300005365 | Ga0070688_100077300 | Ga0070688_1000773004 | 76 |
| 193 | 3300005365 | Ga0070688_100116360 | Ga0070688_1001163604 | 76 |
| 194 | 3300005366 | Ga0070659_100250401 | Ga0070659_1002504011 | 76 |
| 195 | 3300005366 | Ga0070659_100263450 | Ga0070659_1002634503 | 76 |
| 196 | 3300005366 | Ga0070659_101221801 | Ga0070659_1012218012 | 76 |
| 197 | 3300005367 | Ga0070667_100322274 | Ga0070667_1003222741 | 76 |
| 198 | 3300005367 | Ga0070667_100856409 | Ga0070667_1008564091 | 76 |
| 199 | 3300005367 | Ga0070667_101652783 | Ga0070667_1016527832 | 76 |
| 200 | 3300005406 | Ga0070703_10555755 | Ga0070703_105557552 | 76 |
| 201 | 3300005441 | Ga0070700_100102740 | Ga0070700_1001027403 | 76 |
| 202 | 3300005455 | Ga0070663_101708127 | Ga0070663_1017081271 | 76 |
| 203 | 3300005456 | Ga0070678_100193945 | Ga0070678_1001939454 | 76 |
| 204 | 3300005456 | Ga0070678_100515575 | Ga0070678_1005155751 | 76 |
| 205 | 3300005457 | Ga0070662_100189176 | Ga0070662_1001891761 | 76 |
| 206 | 3300005459 | Ga0068867_100005302 | Ga0068867_10000530211 | 76 |
| 207 | 3300005459 | Ga0068867_100007136 | Ga0068867_1000071363 | 76 |
| 208 | 3300005459 | Ga0068867_100312774 | Ga0068867_1003127742 | 76 |
| 209 | 3300005459 | Ga0068867_100478789 | Ga0068867_1004787892 | 76 |
| 210 | 3300005459 | Ga0068867_101686593 | Ga0068867_1016865931 | 76 |
| 211 | 3300005466 | Ga0070685_10080895 | Ga0070685_100808952 | 76 |
| 212 | 3300005466 | Ga0070685_11044380 | Ga0070685_110443801 | 76 |
| 213 | 3300005535 | Ga0070684_101887998 | Ga0070684_1018879981 | 76 |
| 214 | 3300005539 | Ga0068853_100051167 | Ga0068853_1000511673 | 76 |
| 215 | 3300005543 | Ga0070672_100032455 | Ga0070672_1000324551 | 76 |
| 216 | 3300005543 | Ga0070672_100152541 | Ga0070672_1001525413 | 76 |
| 217 | 3300005547 | Ga0070693_101165555 | Ga0070693_1011655552 | 76 |
| 218 | 3300005548 | Ga0070665_100000098 | Ga0070665_10000009885 | 76 |
| 219 | 3300005548 | Ga0070665_101204944 | Ga0070665_1012049442 | 76 |
| 220 | 3300005563 | Ga0068855_100030535 | Ga0068855_1000305354 | 76 |
| 221 | 3300005563 | Ga0068855_100299317 | Ga0068855_1002993172 | 76 |
| 222 | 3300005563 | Ga0068855_100360939 | Ga0068855_1003609392 | 76 |
| 223 | 3300005563 | Ga0068855_101170619 | Ga0068855_1011706193 | 76 |
| 224 | 3300005564 | Ga0070664_101345284 | Ga0070664_1013452841 | 76 |
| 225 | 3300005577 | Ga0068857_100002542 | Ga0068857_1000025427 | 76 |
| 226 | 3300005577 | Ga0068857_100486677 | Ga0068857_1004866771 | 76 |
| 227 | 3300005578 | Ga0068854_100074461 | Ga0068854_1000744613 | 76 |
| 228 | 3300005578 | Ga0068854_100076760 | Ga0068854_1000767602 | 76 |
| 229 | 3300005578 | Ga0068854_100290993 | Ga0068854_1002909932 | 76 |
| 230 | 3300005614 | Ga0068856_100003174 | Ga0068856_1000031743 | 76 |
| 231 | 3300005615 | Ga0070702_101206654 | Ga0070702_1012066541 | 76 |
| 232 | 3300005616 | Ga0068852_100198830 | Ga0068852_1001988303 | 76 |
| 233 | 3300005616 | Ga0068852_100556722 | Ga0068852_1005567222 | 76 |
| 234 | 3300005617 | Ga0068859_100715138 | Ga0068859_1007151382 | 76 |
| 235 | 3300005618 | Ga0068864_100344319 | Ga0068864_1003443193 | 76 |
| 236 | 3300005718 | Ga0068866_10020806 | Ga0068866_100208062 | 76 |
| 237 | 3300005718 | Ga0068866_10383014 | Ga0068866_103830142 | 76 |
| 238 | 3300005719 | Ga0068861_100000224 | Ga0068861_1000002244 | 76 |
| 239 | 3300005834 | Ga0068851_10218130 | Ga0068851_102181302 | 76 |
| 240 | 3300005834 | Ga0068851_10967389 | Ga0068851_109673891 | 76 |
| 241 | 3300005840 | Ga0068870_10116133 | Ga0068870_101161334 | 76 |
| 242 | 3300005841 | Ga0068863_100371788 | Ga0068863_1003717882 | 76 |
| 243 | 3300005841 | Ga0068863_101249438 | Ga0068863_1012494381 | 76 |
| 244 | 3300005842 | Ga0068858_100377146 | Ga0068858_1003771462 | 76 |
| 245 | 3300005842 | Ga0068858_101746546 | Ga0068858_1017465462 | 76 |
| 246 | 3300005843 | Ga0068860_100055985 | Ga0068860_1000559853 | 76 |
| 247 | 3300005843 | Ga0068860_100422789 | Ga0068860_1004227892 | 76 |
| 248 | 3300005844 | Ga0068862_100027091 | Ga0068862_1000270915 | 76 |
| 249 | 3300006038 | Ga0075365_10150910 | Ga0075365_101509102 | 76 |
| 250 | 3300006051 | Ga0075364_10336764 | Ga0075364_103367642 | 76 |
| 251 | 3300006173 | Ga0070716_100362870 | Ga0070716_1003628702 | 76 |
| 252 | 3300006177 | Ga0075362_10159300 | Ga0075362_101593001 | 76 |
| 253 | 3300006177 | Ga0075362_10731284 | Ga0075362_107312841 | 76 |
| 254 | 3300006178 | Ga0075367_10032057 | Ga0075367_100320573 | 76 |
| 255 | 3300006186 | Ga0075369_10377597 | Ga0075369_103775972 | 76 |
| 256 | 3300006195 | Ga0075366_10003201 | Ga0075366_100032019 | 76 |
| 257 | 3300006195 | Ga0075366_10150430 | Ga0075366_101504302 | 76 |
| 258 | 3300006195 | Ga0075366_10157670 | Ga0075366_101576702 | 76 |
| 259 | 3300006195 | Ga0075366_10431793 | Ga0075366_104317931 | 76 |
| 260 | 3300006353 | Ga0075370_10118338 | Ga0075370_101183382 | 76 |
| 261 | 3300006353 | Ga0075370_10944159 | Ga0075370_109441592 | 76 |
| 262 | 3300006358 | Ga0068871_100841120 | Ga0068871_1008411201 | 76 |
| 263 | 3300006358 | Ga0068871_101704466 | Ga0068871_1017044662 | 76 |
| 264 | 3300006871 | Ga0075434_100028670 | Ga0075434_1000286705 | 76 |
| 265 | 3300006881 | Ga0068865_100018985 | Ga0068865_1000189854 | 76 |
| 266 | 3300006881 | Ga0068865_100557594 | Ga0068865_1005575942 | 76 |
| 267 | 3300006931 | Ga0097620_100715238 | Ga0097620_1007152382 | 76 |
| 268 | 3300009093 | Ga0105240_10051215 | Ga0105240_100512153 | 76 |
| 269 | 3300009098 | Ga0105245_10372145 | Ga0105245_103721453 | 76 |
| 270 | 3300009098 | Ga0105245_10410317 | Ga0105245_104103172 | 76 |
| 271 | 3300009098 | Ga0105245_12335318 | Ga0105245_123353182 | 76 |
| 272 | 3300009148 | Ga0105243_10075868 | Ga0105243_100758682 | 76 |
| 273 | 3300009148 | Ga0105243_10101618 | Ga0105243_101016182 | 76 |
| 274 | 3300009148 | Ga0105243_10213881 | Ga0105243_102138811 | 76 |
| 275 | 3300009148 | Ga0105243_10833584 | Ga0105243_108335841 | 76 |
| 276 | 3300009174 | Ga0105241_10024859 | Ga0105241_100248591 | 76 |
| 277 | 3300009174 | Ga0105241_12171437 | Ga0105241_121714372 | 76 |
| 278 | 3300009174 | Ga0105241_12417635 | Ga0105241_124176351 | 76 |
| 279 | 3300009176 | Ga0105242_10163736 | Ga0105242_101637362 | 76 |
| 280 | 3300009177 | Ga0105248_10273784 | Ga0105248_102737842 | 76 |
| 281 | 3300009545 | Ga0105237_10112238 | Ga0105237_101122382 | 76 |
| 282 | 3300009545 | Ga0105237_11592427 | Ga0105237_115924271 | 76 |
| 283 | 3300009545 | Ga0105237_11767370 | Ga0105237_117673701 | 76 |
| 284 | 3300009551 | Ga0105238_10234083 | Ga0105238_102340831 | 76 |
| 285 | 3300009551 | Ga0105238_10407160 | Ga0105238_104071602 | 76 |
| 286 | 3300009553 | Ga0105249_10658774 | Ga0105249_106587742 | 76 |
| 287 | 3300009553 | Ga0105249_12965765 | Ga0105249_129657652 | 76 |
| 288 | 3300010375 | Ga0105239_10029727 | Ga0105239_100297273 | 76 |
| 289 | 3300013105 | Ga0157369_10057405 | Ga0157369_100574053 | 76 |
| 290 | 3300013296 | Ga0157374_10690326 | Ga0157374_106903263 | 76 |
| 291 | 3300013297 | Ga0157378_10095544 | Ga0157378_100955445 | 76 |
| 292 | 3300013297 | Ga0157378_11500267 | Ga0157378_115002672 | 76 |
| 293 | 3300013306 | Ga0163162_10193851 | Ga0163162_101938514 | 76 |
| 294 | 3300013306 | Ga0163162_12180957 | Ga0163162_121809572 | 76 |
| 295 | 3300013307 | Ga0157372_10239661 | Ga0157372_102396613 | 76 |
| 296 | 3300013308 | Ga0157375_10059822 | Ga0157375_100598224 | 76 |
| 297 | 3300013308 | Ga0157375_10361661 | Ga0157375_103616614 | 76 |
| 298 | 3300013308 | Ga0157375_10555136 | Ga0157375_105551362 | 76 |
| 299 | 3300013308 | Ga0157375_13337343 | Ga0157375_133373432 | 76 |
| 300 | 3300014325 | Ga0163163_11152370 | Ga0163163_111523701 | 76 |
| 301 | 3300014326 | Ga0157380_10194223 | Ga0157380_101942232 | 76 |
| 302 | 3300014968 | Ga0157379_10054457 | Ga0157379_100544573 | 76 |
| 303 | 3300014969 | Ga0157376_10190417 | Ga0157376_101904172 | 76 |
| 304 | 3300015262 | Ga0182007_10405209 | Ga0182007_104052092 | 76 |
| 305 | 3300017792 | Ga0163161_10177384 | Ga0163161_101773843 | 76 |
| 306 | 3300020070 | Ga0206356_11133492 | Ga0206356_111334921 | 76 |
| 307 | 3300020070 | Ga0206356_11249086 | Ga0206356_112490862 | 76 |
| 308 | 3300020081 | Ga0206354_10736402 | Ga0206354_107364021 | 76 |
| 309 | 3300020082 | Ga0206353_11840564 | Ga0206353_118405641 | 76 |
| 310 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031721 | 76 |
| 311 | 3300025230 | Ga0209563_100049 | Ga0209563_100049183 | 76 |
| 312 | 3300025242 | Ga0209258_100700 | Ga0209258_10070015 | 76 |
| 313 | 3300025246 | Ga0209646_1000257 | Ga0209646_100025735 | 76 |
| 314 | 3300025250 | Ga0209026_1000054 | Ga0209026_100005469 | 76 |
| 315 | 3300025253 | Ga0209677_100050 | Ga0209677_100050140 | 76 |
| 316 | 3300025253 | Ga0209677_100316 | Ga0209677_10031611 | 76 |
| 317 | 3300025256 | Ga0209759_1000043 | Ga0209759_1000043158 | 76 |
| 318 | 3300025256 | Ga0209759_1001086 | Ga0209759_100108614 | 76 |
| 319 | 3300025256 | Ga0209759_1007372 | Ga0209759_10073722 | 76 |
| 320 | 3300025258 | Ga0209129_1031800 | Ga0209129_10318002 | 76 |
| 321 | 3300025273 | Ga0209673_1028349 | Ga0209673_10283492 | 76 |
| 322 | 3300025273 | Ga0209673_1042339 | Ga0209673_10423392 | 76 |
| 323 | 3300025297 | Ga0209758_1000146 | Ga0209758_100014646 | 76 |
| 324 | 3300025298 | Ga0209050_1000303 | Ga0209050_100030371 | 76 |
| 325 | 3300025303 | Ga0209051_1000823 | Ga0209051_100082324 | 76 |
| 326 | 3300025303 | Ga0209051_1026928 | Ga0209051_10269282 | 76 |
| 327 | 3300025304 | Ga0209257_1000161 | Ga0209257_1000161158 | 76 |
| 328 | 3300025893 | Ga0207682_10460464 | Ga0207682_104604641 | 76 |
| 329 | 3300025899 | Ga0207642_10026857 | Ga0207642_100268572 | 76 |
| 330 | 3300025903 | Ga0207680_10358678 | Ga0207680_103586782 | 76 |
| 331 | 3300025907 | Ga0207645_10009049 | Ga0207645_100090496 | 76 |
| 332 | 3300025907 | Ga0207645_10034740 | Ga0207645_100347401 | 76 |
| 333 | 3300025907 | Ga0207645_10038721 | Ga0207645_100387212 | 76 |
| 334 | 3300025908 | Ga0207643_10220592 | Ga0207643_102205922 | 76 |
| 335 | 3300025909 | Ga0207705_10116513 | Ga0207705_101165134 | 76 |
| 336 | 3300025911 | Ga0207654_10131981 | Ga0207654_101319813 | 76 |
| 337 | 3300025911 | Ga0207654_10434129 | Ga0207654_104341293 | 76 |
| 338 | 3300025913 | Ga0207695_10067716 | Ga0207695_100677163 | 76 |
| 339 | 3300025914 | Ga0207671_10162329 | Ga0207671_101623292 | 76 |
| 340 | 3300025914 | Ga0207671_10771495 | Ga0207671_107714951 | 76 |
| 341 | 3300025919 | Ga0207657_10066537 | Ga0207657_100665375 | 76 |
| 342 | 3300025919 | Ga0207657_10374209 | Ga0207657_103742093 | 76 |
| 343 | 3300025919 | Ga0207657_10613542 | Ga0207657_106135422 | 76 |
| 344 | 3300025919 | Ga0207657_11488214 | Ga0207657_114882142 | 76 |
| 345 | 3300025920 | Ga0207649_10447022 | Ga0207649_104470222 | 76 |
| 346 | 3300025923 | Ga0207681_10063600 | Ga0207681_100636003 | 76 |
| 347 | 3300025923 | Ga0207681_10595533 | Ga0207681_105955332 | 76 |
| 348 | 3300025924 | Ga0207694_10187951 | Ga0207694_101879511 | 76 |
| 349 | 3300025924 | Ga0207694_11382103 | Ga0207694_113821032 | 76 |
| 350 | 3300025925 | Ga0207650_10021982 | Ga0207650_100219825 | 76 |
| 351 | 3300025925 | Ga0207650_10353222 | Ga0207650_103532222 | 76 |
| 352 | 3300025926 | Ga0207659_10025362 | Ga0207659_100253625 | 76 |
| 353 | 3300025927 | Ga0207687_10134285 | Ga0207687_101342854 | 76 |
| 354 | 3300025931 | Ga0207644_10015616 | Ga0207644_100156165 | 76 |
| 355 | 3300025931 | Ga0207644_10043701 | Ga0207644_100437013 | 76 |
| 356 | 3300025932 | Ga0207690_10191708 | Ga0207690_101917082 | 76 |
| 357 | 3300025932 | Ga0207690_10650980 | Ga0207690_106509801 | 76 |
| 358 | 3300025932 | Ga0207690_10942145 | Ga0207690_109421452 | 76 |
| 359 | 3300025933 | Ga0207706_10385356 | Ga0207706_103853562 | 76 |
| 360 | 3300025934 | Ga0207686_10161057 | Ga0207686_101610572 | 76 |
| 361 | 3300025935 | Ga0207709_10105761 | Ga0207709_101057612 | 76 |
| 362 | 3300025935 | Ga0207709_10161557 | Ga0207709_101615572 | 76 |
| 363 | 3300025935 | Ga0207709_10610664 | Ga0207709_106106641 | 76 |
| 364 | 3300025936 | Ga0207670_10555076 | Ga0207670_105550762 | 76 |
| 365 | 3300025937 | Ga0207669_10340291 | Ga0207669_103402913 | 76 |
| 366 | 3300025938 | Ga0207704_10017341 | Ga0207704_100173413 | 76 |
| 367 | 3300025938 | Ga0207704_10860502 | Ga0207704_108605022 | 76 |
| 368 | 3300025940 | Ga0207691_10025458 | Ga0207691_100254581 | 76 |
| 369 | 3300025940 | Ga0207691_10104170 | Ga0207691_101041702 | 76 |
| 370 | 3300025941 | Ga0207711_10094784 | Ga0207711_100947842 | 76 |
| 371 | 3300025942 | Ga0207689_10058653 | Ga0207689_100586532 | 76 |
| 372 | 3300025942 | Ga0207689_10178707 | Ga0207689_101787073 | 76 |
| 373 | 3300025945 | Ga0207679_10546889 | Ga0207679_105468893 | 76 |
| 374 | 3300025949 | Ga0207667_10047907 | Ga0207667_100479075 | 76 |
| 375 | 3300025949 | Ga0207667_10998014 | Ga0207667_109980142 | 76 |
| 376 | 3300025960 | Ga0207651_10016983 | Ga0207651_100169832 | 76 |
| 377 | 3300025960 | Ga0207651_10158756 | Ga0207651_101587563 | 76 |
| 378 | 3300025961 | Ga0207712_10394822 | Ga0207712_103948222 | 76 |
| 379 | 3300025972 | Ga0207668_10068417 | Ga0207668_100684173 | 76 |
| 380 | 3300025981 | Ga0207640_10025835 | Ga0207640_100258353 | 76 |
| 381 | 3300025981 | Ga0207640_10106473 | Ga0207640_101064732 | 76 |
| 382 | 3300025986 | Ga0207658_10275315 | Ga0207658_102753151 | 76 |
| 383 | 3300025986 | Ga0207658_11460340 | Ga0207658_114603401 | 76 |
| 384 | 3300026023 | Ga0207677_10072659 | Ga0207677_100726592 | 76 |
| 385 | 3300026023 | Ga0207677_11217122 | Ga0207677_112171221 | 76 |
| 386 | 3300026035 | Ga0207703_10066634 | Ga0207703_100666342 | 76 |
| 387 | 3300026041 | Ga0207639_10062586 | Ga0207639_100625863 | 76 |
| 388 | 3300026067 | Ga0207678_10415264 | Ga0207678_104152642 | 76 |
| 389 | 3300026067 | Ga0207678_11059552 | Ga0207678_110595522 | 76 |
| 390 | 3300026075 | Ga0207708_10025564 | Ga0207708_100255644 | 76 |
| 391 | 3300026078 | Ga0207702_10011854 | Ga0207702_100118541 | 76 |
| 392 | 3300026088 | Ga0207641_10579289 | Ga0207641_105792892 | 76 |
| 393 | 3300026088 | Ga0207641_11248355 | Ga0207641_112483551 | 76 |
| 394 | 3300026089 | Ga0207648_10000182 | Ga0207648_1000018228 | 76 |
| 395 | 3300026089 | Ga0207648_10008440 | Ga0207648_100084407 | 76 |
| 396 | 3300026089 | Ga0207648_10117852 | Ga0207648_101178523 | 76 |
| 397 | 3300026089 | Ga0207648_10857061 | Ga0207648_108570612 | 76 |
| 398 | 3300026089 | Ga0207648_11279528 | Ga0207648_112795282 | 76 |
| 399 | 3300026089 | Ga0207648_12052192 | Ga0207648_120521921 | 76 |
| 400 | 3300026116 | Ga0207674_10021066 | Ga0207674_100210663 | 76 |
| 401 | 3300026116 | Ga0207674_10090703 | Ga0207674_100907032 | 76 |
| 402 | 3300026116 | Ga0207674_11102786 | Ga0207674_111027861 | 76 |
| 403 | 3300026118 | Ga0207675_100000551 | Ga0207675_1000005517 | 76 |
| 404 | 3300026118 | Ga0207675_101717799 | Ga0207675_1017177991 | 76 |
| 405 | 3300026142 | Ga0207698_10120685 | Ga0207698_101206854 | 76 |
| 406 | 3300026142 | Ga0207698_10439739 | Ga0207698_104397392 | 76 |
| 407 | 3300026142 | Ga0207698_11351819 | Ga0207698_113518192 | 76 |
| 408 | 3300026142 | Ga0207698_12643693 | Ga0207698_126436932 | 76 |
| 409 | 3300028379 | Ga0268266_10000644 | Ga0268266_100006448 | 76 |
| 410 | 3300028379 | Ga0268266_11607450 | Ga0268266_116074502 | 76 |
| 411 | 3300028380 | Ga0268265_10042088 | Ga0268265_100420882 | 76 |
| 412 | 3300028381 | Ga0268264_10058416 | Ga0268264_100584163 | 76 |
| 413 | 3300028381 | Ga0268264_10658548 | Ga0268264_106585482 | 76 |
| 414 | 3300028666 | Ga0265336_10000006 | Ga0265336_10000006183 | 76 |
| 415 | 3300028786 | Ga0307517_10194526 | Ga0307517_101945262 | 76 |
| 416 | 3300029957 | Ga0265324_10026123 | Ga0265324_100261232 | 76 |
| 417 | 3300031456 | Ga0307513_10612822 | Ga0307513_106128222 | 76 |
| 418 | 3300031548 | Ga0307408_100522269 | Ga0307408_1005222692 | 76 |
| 419 | 3300031548 | Ga0307408_100529214 | Ga0307408_1005292142 | 76 |
| 420 | 3300031548 | Ga0307408_102436969 | Ga0307408_1024369692 | 76 |
| 421 | 3300031616 | Ga0307508_10524372 | Ga0307508_105243722 | 76 |
| 422 | 3300031711 | Ga0265314_10072472 | Ga0265314_100724722 | 76 |
| 423 | 3300031712 | Ga0265342_10035270 | Ga0265342_100352703 | 76 |
| 424 | 3300031730 | Ga0307516_10001515 | Ga0307516_1000151513 | 76 |
| 425 | 3300031824 | Ga0307413_10290959 | Ga0307413_102909593 | 76 |
| 426 | 3300031824 | Ga0307413_11919791 | Ga0307413_119197912 | 76 |
| 427 | 3300031852 | Ga0307410_10151032 | Ga0307410_101510322 | 76 |
| 428 | 3300031852 | Ga0307410_11509947 | Ga0307410_115099471 | 76 |
| 429 | 3300031852 | Ga0307410_11611444 | Ga0307410_116114441 | 76 |
| 430 | 3300031901 | Ga0307406_10793760 | Ga0307406_107937601 | 76 |
| 431 | 3300031903 | Ga0307407_10050043 | Ga0307407_100500433 | 76 |
| 432 | 3300031903 | Ga0307407_11135320 | Ga0307407_111353202 | 76 |
| 433 | 3300031911 | Ga0307412_10390078 | Ga0307412_103900782 | 76 |
| 434 | 3300031995 | Ga0307409_100573146 | Ga0307409_1005731462 | 76 |
| 435 | 3300031995 | Ga0307409_100968328 | Ga0307409_1009683282 | 76 |
| 436 | 3300032004 | Ga0307414_10785528 | Ga0307414_107855282 | 76 |
| 437 | 3300032004 | Ga0307414_11764175 | Ga0307414_117641752 | 76 |
| 438 | 3300032005 | Ga0307411_10666634 | Ga0307411_106666341 | 76 |
| 439 | 3300032126 | Ga0307415_100153449 | Ga0307415_1001534493 | 76 |
| 440 | 3300032126 | Ga0307415_100246982 | Ga0307415_1002469822 | 76 |
| 441 | 3300033180 | Ga0307510_10427231 | Ga0307510_104272311 | 76 |
| 442 | 3300033180 | Ga0307510_10660083 | Ga0307510_106600831 | 76 |
| 443 | 3300035114 | Ga0373939_0037436 | Ga0373939_0037436_49_282 | 76 |
| 444 | 3300035171 | Ga0373946_0203683 | Ga0373946_0203683_358_591 | 76 |
| 445 | 3300035172 | Ga0373955_0387236 | Ga0373955_0387236_455_688 | 76 |
| 446 | 3300035692 | Ga0373935_1022043 | Ga0373935_1022043_110_391 | 76 |
| 447 | 3300035695 | Ga0373927_0039628 | Ga0373927_0039628_1938_2171 | 76 |
| 448 | 3300035725 | Ga0373947_0165078 | Ga0373947_0165078_272_505 | 76 |
| 449 | 3300036401 | Ga0373937_0489486 | Ga0373937_0489486_624_857 | 76 |
| 450 | 3300037068 | Ga0373925_0005477 | Ga0373925_0005477_6272_6505 | 76 |
| 451 | 3300037068 | Ga0373925_0006470 | Ga0373925_0006470_8253_8534 | 76 |
| 452 | 3300037068 | Ga0373925_1241001 | Ga0373925_1241001_300_533 | 76 |
| 453 | 3300037312 | Ga0395899_0005714 | Ga0395899_0005714_8620_8853 | 76 |
| 454 | 3300037312 | Ga0395899_0407825 | Ga0395899_0407825_415_648 | 76 |
| 455 | 3300037312 | Ga0395899_0570113 | Ga0395899_0570113_429_662 | 76 |
| 456 | 3300037418 | Ga0395900_0010158 | Ga0395900_0010158_2405_2638 | 76 |
| 457 | 3300037466 | Ga0395898_0003690 | Ga0395898_0003690_14578_14811 | 76 |
| 458 | 3300037471 | Ga0395905_0002683 | Ga0395905_0002683_9350_9583 | 76 |
| 459 | 3300038443 | Ga0395901_0002847 | Ga0395901_0002847_4164_4397 | 76 |
| 460 | 3300038443 | Ga0395901_0015358 | Ga0395901_0015358_356_589 | 76 |
| 461 | 3300041443 | Ga0451789_0416861 | Ga0451789_0416861_1140_1373 | 76 |
| 462 | 3300041451 | Ga0451791_1281330 | Ga0451791_1281330_352_585 | 76 |
| 463 | 3300041452 | Ga0451793_0793246 | Ga0451793_0793246_1791_2024 | 76 |
| 464 | 3300041452 | Ga0451793_1643730 | Ga0451793_1643730_325_558 | 76 |
| 465 | 3300041456 | Ga0451795_0536464 | Ga0451795_0536464_425_658 | 76 |
| 466 | 3300041458 | Ga0451798_0508301 | Ga0451798_0508301_580_813 | 76 |
| 467 | 3300041459 | Ga0451800_0155813 | Ga0451800_0155813_38_271 | 76 |
| 468 | 3300041459 | Ga0451800_1416307 | Ga0451800_1416307_131_403 | 76 |
| 469 | 3300041486 | Ga0451807_0123301 | Ga0451807_0123301_26_259 | 76 |
| 470 | 3300041486 | Ga0451807_1650466 | Ga0451807_1650466_352_585 | 76 |
| 471 | 3300041491 | Ga0451833_0170977 | Ga0451833_0170977_17_250 | 76 |
| 472 | 3300041492 | Ga0451835_0127159 | Ga0451835_0127159_231_464 | 76 |
| 473 | 3300041512 | Ga0451853_0387231 | Ga0451853_0387231_301_534 | 76 |
| 474 | 3300041512 | Ga0451853_1209586 | Ga0451853_1209586_318_551 | 76 |
| 475 | 3300042128 | Ga0450897_030162 | Ga0450897_030162_212_445 | 76 |
| 476 | 3300042439 | Ga0439464_0103278 | Ga0439464_0103278_612_857 | 76 |
| 477 | 3300044656 | Ga0466969_0005025 | Ga0466969_0005025_4546_4779 | 76 |
| 478 | 3300044656 | Ga0466969_0282293 | Ga0466969_0282293_357_590 | 76 |
| 479 | 3300044683 | Ga0466965_0752234 | Ga0466965_0752234_312_545 | 76 |
| 480 | 3300044684 | Ga0466966_0005905 | Ga0466966_0005905_6031_6264 | 76 |
| 481 | 3300044684 | Ga0466966_0915987 | Ga0466966_0915987_184_417 | 76 |
| 482 | 3300044684 | Ga0466966_0926611 | Ga0466966_0926611_138_371 | 76 |
| 483 | 3300044693 | Ga0466961_0010761 | Ga0466961_0010761_3040_3273 | 76 |
| 484 | 3300044693 | Ga0466961_0273286 | Ga0466961_0273286_409_642 | 76 |
| 485 | 3300044693 | Ga0466961_0532126 | Ga0466961_0532126_51_284 | 76 |
| 486 | 3300044694 | Ga0466963_0117485 | Ga0466963_0117485_1154_1387 | 76 |
| 487 | 3300044694 | Ga0466963_1094914 | Ga0466963_1094914_10_243 | 76 |
| 488 | 3300044706 | Ga0466964_0007682 | Ga0466964_0007682_406_639 | 76 |
| 489 | 3300044706 | Ga0466964_0793189 | Ga0466964_0793189_75_308 | 76 |
| 490 | 3300044719 | Ga0466971_0164387 | Ga0466971_0164387_758_991 | 76 |
| 491 | 3300044719 | Ga0466971_0208355 | Ga0466971_0208355_270_503 | 76 |
| 492 | 3300044765 | Ga0466970_0121409 | Ga0466970_0121409_1106_1339 | 76 |
| 493 | 3300044765 | Ga0466970_0142614 | Ga0466970_0142614_612_845 | 76 |
| 494 | 3300044842 | Ga0466957_0010494 | Ga0466957_0010494_3310_3543 | 76 |
| 495 | 3300044842 | Ga0466957_0060210 | Ga0466957_0060210_1562_1795 | 76 |
| 496 | 3300044842 | Ga0466957_0214085 | Ga0466957_0214085_223_456 | 76 |
| 497 | 3300044842 | Ga0466957_0337254 | Ga0466957_0337254_580_813 | 76 |
| 498 | 3300044901 | Ga0466960_0107436 | Ga0466960_0107436_103_336 | 76 |
| 499 | 3300045049 | Ga0466959_0188232 | Ga0466959_0188232_550_783 | 76 |
| 500 | 3300045049 | Ga0466959_0317928 | Ga0466959_0317928_688_921 | 76 |
| 501 | 3300045049 | Ga0466959_0320834 | Ga0466959_0320834_463_696 | 76 |
| 502 | 3300045049 | Ga0466959_0606724 | Ga0466959_0606724_378_611 | 76 |
| 503 | 3300045049 | Ga0466959_0945674 | Ga0466959_0945674_274_507 | 76 |
| 504 | 3300045836 | Ga0466958_0033247 | Ga0466958_0033247_874_1107 | 76 |
| 505 | 3300045836 | Ga0466958_0176904 | Ga0466958_0176904_1046_1279 | 76 |
| 506 | 3300045836 | Ga0466958_0728616 | Ga0466958_0728616_146_379 | 76 |
| 507 | 3300045976 | Ga0466967_0135714 | Ga0466967_0135714_1675_1908 | 76 |
| 508 | 3300045976 | Ga0466967_0483308 | Ga0466967_0483308_29_262 | 76 |
| 509 | 3300045976 | Ga0466967_0684263 | Ga0466967_0684263_556_789 | 76 |
| 510 | 3300045976 | Ga0466967_0887005 | Ga0466967_0887005_209_442 | 76 |
| 511 | 3300045976 | Ga0466967_1773452 | Ga0466967_1773452_143_376 | 76 |
| 512 | 3300046455 | Ga0495603_0175429 | Ga0495603_0175429_830_1075 | 76 |
| 513 | 3300046471 | Ga0495650_0016153 | Ga0495650_0016153_1733_1966 | 76 |
| 514 | 3300046475 | Ga0495639_0017448 | Ga0495639_0017448_175_456 | 76 |
| 515 | 3300046519 | Ga0495632_0001505 | Ga0495632_0001505_13727_13960 | 76 |
| 516 | 3300046520 | Ga0495637_0216222 | Ga0495637_0216222_448_681 | 76 |
| 517 | 3300046526 | Ga0495666_0009785 | Ga0495666_0009785_101_382 | 76 |
| 518 | 3300046535 | Ga0495586_0005073 | Ga0495586_0005073_4097_4378 | 76 |
| 519 | 3300046535 | Ga0495586_0667811 | Ga0495586_0667811_156_389 | 76 |
| 520 | 3300046543 | Ga0495645_0465015 | Ga0495645_0465015_146_379 | 76 |
| 521 | 3300046616 | Ga0495668_0548487 | Ga0495668_0548487_308_541 | 76 |
| 522 | 3300046681 | Ga0495647_0051074 | Ga0495647_0051074_1260_1541 | 76 |
| 523 | 3300046681 | Ga0495647_0355221 | Ga0495647_0355221_266_499 | 76 |
| 524 | 3300046683 | Ga0495658_0010354 | Ga0495658_0010354_3823_4056 | 76 |
| 525 | 3300046683 | Ga0495658_1015596 | Ga0495658_1015596_227_460 | 76 |
| 526 | 3300046689 | Ga0495613_0271754 | Ga0495613_0271754_83_364 | 76 |
| 527 | 3300047315 | Ga0495581_0553724 | Ga0495581_0553724_232_513 | 76 |
| 528 | 3300048908 | Ga0496105_0267328 | Ga0496105_0267328_1127_1360 | 76 |
| 529 | 3300048908 | Ga0496105_1004003 | Ga0496105_1004003_108_341 | 76 |
| 530 | 3300048909 | Ga0496106_0381372 | Ga0496106_0381372_126_359 | 76 |
| 531 | 3300048911 | Ga0496108_0586784 | Ga0496108_0586784_559_792 | 76 |
| 532 | 3300048915 | Ga0496112_1039101 | Ga0496112_1039101_178_411 | 76 |
| 533 | 3300048916 | Ga0496113_0393100 | Ga0496113_0393100_765_998 | 76 |
| 534 | 3300048917 | Ga0496114_0894470 | Ga0496114_0894470_493_738 | 76 |
| 535 | 3300048917 | Ga0496114_1243382 | Ga0496114_1243382_312_545 | 76 |
| 536 | 3300049823 | Ga0501044_0378082 | Ga0501044_0378082_898_1131 | 76 |
| 537 | 3300050491 | nmdc:mga00v17_813616_c1 | nmdc:mga00v17_813616_c1_94_327 | 76 |
| 538 | 3300050493 | nmdc:mga0k408_148398_c1 | nmdc:mga0k408_148398_c1_1055_1288 | 76 |
| 539 | 3300050493 | nmdc:mga0k408_58177_c1 | nmdc:mga0k408_58177_c1_566_799 | 76 |
| 540 | 3300050493 | nmdc:mga0k408_65654_c1 | nmdc:mga0k408_65654_c1_1698_1931 | 76 |
| 541 | 3300050494 | nmdc:mga06z11_175692_c1 | nmdc:mga06z11_175692_c1_413_646 | 76 |
| 542 | 3300050496 | nmdc:mga07m45_116862_c1 | nmdc:mga07m45_116862_c1_943_1176 | 76 |
| 543 | 3300050496 | nmdc:mga07m45_65691_c1 | nmdc:mga07m45_65691_c1_624_857 | 76 |
| 544 | 3300050512 | nmdc:mga0n895_40777_c1 | nmdc:mga0n895_40777_c1_447_680 | 76 |
| 545 | 3300050516 | nmdc:mga0sz30_198803_c1 | nmdc:mga0sz30_198803_c1_320_553 | 76 |
| 546 | 3300053080 | Ga0500635_0000007 | Ga0500635_0000007_102049_102282 | 76 |
| 547 | 3300053080 | Ga0500635_0433326 | Ga0500635_0433326_112_345 | 76 |
| 548 | 3300053084 | Ga0495595_0487289 | Ga0495595_0487289_134_367 | 76 |
| 549 | 3300053086 | Ga0500578_0000213 | Ga0500578_0000213_50140_50373 | 76 |
| 550 | 3300053088 | Ga0500644_0023657 | Ga0500644_0023657_184_417 | 76 |
| 551 | 3300053090 | Ga0500646_0138572 | Ga0500646_0138572_84_317 | 76 |
| 552 | 3300053093 | Ga0500651_0107982 | Ga0500651_0107982_69_302 | 76 |
| 553 | 3300053098 | Ga0500650_0193225 | Ga0500650_0193225_231_464 | 76 |
| 554 | 3300053129 | Ga0500628_013690 | Ga0500628_013690_248_481 | 76 |
| 555 | 3300053130 | Ga0500642_0002873 | Ga0500642_0002873_1286_1519 | 76 |
| 556 | 3300053131 | Ga0500652_000430 | Ga0500652_000430_4954_5187 | 76 |
| 557 | 3300053133 | Ga0500655_011150 | Ga0500655_011150_274_507 | 76 |
| 558 | 3300053134 | Ga0500658_0361323 | Ga0500658_0361323_177_410 | 76 |
| 559 | 3300053136 | Ga0500559_0042432 | Ga0500559_0042432_1529_1762 | 76 |
| 560 | 3300053138 | Ga0500564_029657 | Ga0500564_029657_137_370 | 76 |
| 561 | 3300053139 | Ga0500568_0009296 | Ga0500568_0009296_3273_3506 | 76 |
| 562 | 3300053142 | Ga0500577_0006261 | Ga0500577_0006261_1998_2231 | 76 |
| 563 | 3300053143 | Ga0500579_058777 | Ga0500579_058777_1643_1876 | 76 |
| 564 | 3300053151 | Ga0500604_0013805 | Ga0500604_0013805_1628_1861 | 76 |
| 565 | 3300053151 | Ga0500604_0024587 | Ga0500604_0024587_1180_1413 | 76 |
| 566 | 3300053151 | Ga0500604_0205690 | Ga0500604_0205690_80_313 | 76 |
| 567 | 3300053156 | Ga0500622_0000631 | Ga0500622_0000631_24248_24481 | 76 |
| 568 | 3300053156 | Ga0500622_0154784 | Ga0500622_0154784_497_730 | 76 |
| 569 | 3300053724 | Ga0500570_201134 | Ga0500570_201134_141_374 | 76 |
| 570 | 3300061719 | Ga0466962_0008558 | Ga0466962_0008558_4187_4420 | 76 |
| 571 | 3300061719 | Ga0466962_0059868 | Ga0466962_0059868_677_910 | 76 |
| 572 | iso_pu_bacteria | 8055066027 | 8055067178 | 76 |
| 573 | 3300009147 | Ga0114129_10328013 | Ga0114129_103280133 | 77 |
| 574 | 3300050507 | nmdc:mga05p37_488298_c1 | nmdc:mga05p37_488298_c1_182_421 | 77 |
| 575 | 3300005355 | Ga0070671_100066906 | Ga0070671_1000669063 | 78 |
| 576 | 3300005445 | Ga0070708_101321288 | Ga0070708_1013212881 | 78 |
| 577 | 3300005471 | Ga0070698_101049384 | Ga0070698_1010493841 | 78 |
| 578 | 3300005842 | Ga0068858_100454063 | Ga0068858_1004540632 | 78 |
| 579 | 3300005843 | Ga0068860_100736075 | Ga0068860_1007360752 | 78 |
| 580 | 3300006028 | Ga0070717_10945342 | Ga0070717_109453421 | 78 |
| 581 | 3300009177 | Ga0105248_13097283 | Ga0105248_130972831 | 78 |
| 582 | 3300014325 | Ga0163163_10894919 | Ga0163163_108949193 | 78 |
| 583 | 3300025931 | Ga0207644_10109398 | Ga0207644_101093983 | 78 |
| 584 | 3300028379 | Ga0268266_11203417 | Ga0268266_112034172 | 78 |
| 585 | 3300028381 | Ga0268264_11029452 | Ga0268264_110294522 | 78 |
| 586 | 3300028800 | Ga0265338_10245479 | Ga0265338_102454792 | 78 |
| 587 | 3300048903 | Ga0496100_1181794 | Ga0496100_1181794_91_330 | 78 |
| 588 | 3300048907 | Ga0496104_0800194 | Ga0496104_0800194_248_487 | 78 |
| 589 | 3300053111 | Ga0500572_081457 | Ga0500572_081457_653_895 | 78 |
| 590 | 3300053737 | Ga0500601_007612 | Ga0500601_007612_754_996 | 78 |
| 591 | 3300005338 | Ga0068868_101031307 | Ga0068868_1010313072 | 79 |
| 592 | 3300005341 | Ga0070691_10866205 | Ga0070691_108662052 | 79 |
| 593 | 3300005355 | Ga0070671_101188361 | Ga0070671_1011883612 | 79 |
| 594 | 3300005539 | Ga0068853_102261951 | Ga0068853_1022619512 | 79 |
| 595 | 3300005843 | Ga0068860_100053262 | Ga0068860_1000532625 | 79 |
| 596 | 3300005843 | Ga0068860_101669347 | Ga0068860_1016693472 | 79 |
| 597 | 3300005844 | Ga0068862_100014364 | Ga0068862_1000143644 | 79 |
| 598 | 3300005981 | Ga0081538_10287076 | Ga0081538_102870762 | 79 |
| 599 | 3300006175 | Ga0070712_101747539 | Ga0070712_1017475392 | 79 |
| 600 | 3300009101 | Ga0105247_11623143 | Ga0105247_116231431 | 79 |
| 601 | 3300009553 | Ga0105249_10029368 | Ga0105249_100293681 | 79 |
| 602 | 3300013306 | Ga0163162_12591010 | Ga0163162_125910101 | 79 |
| 603 | 3300025915 | Ga0207693_11299139 | Ga0207693_112991391 | 79 |
| 604 | 3300025961 | Ga0207712_10009351 | Ga0207712_100093515 | 79 |
| 605 | 3300025972 | Ga0207668_11668200 | Ga0207668_116682002 | 79 |
| 606 | 3300026118 | Ga0207675_100363056 | Ga0207675_1003630563 | 79 |
| 607 | 3300028379 | Ga0268266_11785159 | Ga0268266_117851592 | 79 |
| 608 | 3300028381 | Ga0268264_10077247 | Ga0268264_100772473 | 79 |
| 609 | 3300028381 | Ga0268264_11250068 | Ga0268264_112500682 | 79 |
| 610 | 3300031548 | Ga0307408_100863869 | Ga0307408_1008638692 | 79 |
| 611 | 3300031852 | Ga0307410_10219114 | Ga0307410_102191143 | 79 |
| 612 | 3300031901 | Ga0307406_10691846 | Ga0307406_106918462 | 79 |
| 613 | 3300031903 | Ga0307407_10052488 | Ga0307407_100524883 | 79 |
| 614 | 3300032002 | Ga0307416_100298750 | Ga0307416_1002987503 | 79 |
| 615 | 3300032004 | Ga0307414_11255002 | Ga0307414_112550022 | 79 |
| 616 | 3300032005 | Ga0307411_11268801 | Ga0307411_112688011 | 79 |
| 617 | 3300032005 | Ga0307411_11677681 | Ga0307411_116776812 | 79 |
| 618 | 3300035692 | Ga0373935_0190152 | Ga0373935_0190152_489_731 | 79 |
| 619 | 3300037312 | Ga0395899_0015928 | Ga0395899_0015928_3449_3691 | 79 |
| 620 | 3300037418 | Ga0395900_0041112 | Ga0395900_0041112_3937_4179 | 79 |
| 621 | 3300037466 | Ga0395898_0008906 | Ga0395898_0008906_7075_7317 | 79 |
| 622 | 3300037466 | Ga0395898_0420890 | Ga0395898_0420890_907_1149 | 79 |
| 623 | 3300037471 | Ga0395905_0037201 | Ga0395905_0037201_2134_2376 | 79 |
| 624 | 3300038443 | Ga0395901_0083145 | Ga0395901_0083145_2223_2465 | 79 |
| 625 | 3300038443 | Ga0395901_0507636 | Ga0395901_0507636_242_484 | 79 |
| 626 | 3300038443 | Ga0395901_0570984 | Ga0395901_0570984_856_1098 | 79 |
| 627 | 3300039450 | Ga0436363_0433468 | Ga0436363_0433468_574_816 | 79 |
| 628 | 3300044684 | Ga0466966_0009417 | Ga0466966_0009417_2088_2333 | 79 |
| 629 | 3300046454 | Ga0495592_0476749 | Ga0495592_0476749_69_311 | 79 |
| 630 | 3300046477 | Ga0495664_0586851 | Ga0495664_0586851_129_371 | 79 |
| 631 | 3300046533 | Ga0495640_0200721 | Ga0495640_0200721_748_990 | 79 |
| 632 | 3300046663 | Ga0495635_0359002 | Ga0495635_0359002_127_369 | 79 |
| 633 | 3300047319 | Ga0495674_0085661 | Ga0495674_0085661_1151_1393 | 79 |
| 634 | 3300048905 | Ga0496102_0135235 | Ga0496102_0135235_1996_2238 | 79 |
| 635 | 3300048909 | Ga0496106_1183642 | Ga0496106_1183642_284_526 | 79 |
| 636 | 3300049583 | Ga0501067_0000471 | Ga0501067_0000471_13579_13821 | 79 |
| 637 | 3300049584 | Ga0501068_0000400 | Ga0501068_0000400_4237_4479 | 79 |
| 638 | 3300049585 | Ga0501069_0001363 | Ga0501069_0001363_68_310 | 79 |
| 639 | 3300049743 | Ga0501081_0696577 | Ga0501081_0696577_387_629 | 79 |
| 640 | 3300053077 | Ga0495601_0086273 | Ga0495601_0086273_939_1181 | 79 |
| 641 | 3300053078 | Ga0495612_0057263 | Ga0495612_0057263_614_856 | 79 |
| 642 | 3300053083 | Ga0495655_0001829 | Ga0495655_0001829_2478_2720 | 79 |
| 643 | 3300053084 | Ga0495595_0291387 | Ga0495595_0291387_463_705 | 79 |
| 644 | 3300053085 | Ga0495619_0363951 | Ga0495619_0363951_670_912 | 79 |
| 645 | 3300054114 | Ga0501084_1737224 | Ga0501084_1737224_169_411 | 79 |
| 646 | 3300061734 | Ga0530510_0006186 | Ga0530510_0006186_265_507 | 79 |
| 647 | 3300001989 | JGI24739J22299_10007711 | JGI24739J22299_100077114 | 80 |
| 648 | 3300001990 | JGI24737J22298_10006112 | JGI24737J22298_100061122 | 80 |
| 649 | 3300005327 | Ga0070658_10001118 | Ga0070658_1000111815 | 80 |
| 650 | 3300005329 | Ga0070683_100128063 | Ga0070683_1001280632 | 80 |
| 651 | 3300005329 | Ga0070683_102292911 | Ga0070683_1022929111 | 80 |
| 652 | 3300005338 | Ga0068868_101322194 | Ga0068868_1013221942 | 80 |
| 653 | 3300005338 | Ga0068868_101918070 | Ga0068868_1019180701 | 80 |
| 654 | 3300005341 | Ga0070691_10100826 | Ga0070691_101008263 | 80 |
| 655 | 3300005341 | Ga0070691_11087739 | Ga0070691_110877391 | 80 |
| 656 | 3300005367 | Ga0070667_100150804 | Ga0070667_1001508042 | 80 |
| 657 | 3300005434 | Ga0070709_10041876 | Ga0070709_100418762 | 80 |
| 658 | 3300005434 | Ga0070709_10100876 | Ga0070709_101008763 | 80 |
| 659 | 3300005434 | Ga0070709_10131650 | Ga0070709_101316502 | 80 |
| 660 | 3300005435 | Ga0070714_100078197 | Ga0070714_1000781973 | 80 |
| 661 | 3300005435 | Ga0070714_100142587 | Ga0070714_1001425873 | 80 |
| 662 | 3300005435 | Ga0070714_100195186 | Ga0070714_1001951862 | 80 |
| 663 | 3300005435 | Ga0070714_101114212 | Ga0070714_1011142121 | 80 |
| 664 | 3300005436 | Ga0070713_100042266 | Ga0070713_1000422662 | 80 |
| 665 | 3300005436 | Ga0070713_100058351 | Ga0070713_1000583512 | 80 |
| 666 | 3300005436 | Ga0070713_100395700 | Ga0070713_1003957002 | 80 |
| 667 | 3300005436 | Ga0070713_100968809 | Ga0070713_1009688092 | 80 |
| 668 | 3300005437 | Ga0070710_10008149 | Ga0070710_100081492 | 80 |
| 669 | 3300005437 | Ga0070710_10068524 | Ga0070710_100685243 | 80 |
| 670 | 3300005437 | Ga0070710_10234782 | Ga0070710_102347822 | 80 |
| 671 | 3300005437 | Ga0070710_10406824 | Ga0070710_104068241 | 80 |
| 672 | 3300005439 | Ga0070711_100032103 | Ga0070711_1000321032 | 80 |
| 673 | 3300005439 | Ga0070711_100071894 | Ga0070711_1000718943 | 80 |
| 674 | 3300005439 | Ga0070711_100446528 | Ga0070711_1004465281 | 80 |
| 675 | 3300005439 | Ga0070711_101176717 | Ga0070711_1011767172 | 80 |
| 676 | 3300005439 | Ga0070711_101267664 | Ga0070711_1012676642 | 80 |
| 677 | 3300005445 | Ga0070708_100015319 | Ga0070708_1000153193 | 80 |
| 678 | 3300005445 | Ga0070708_100171208 | Ga0070708_1001712082 | 80 |
| 679 | 3300005445 | Ga0070708_100365147 | Ga0070708_1003651472 | 80 |
| 680 | 3300005445 | Ga0070708_100408118 | Ga0070708_1004081182 | 80 |
| 681 | 3300005445 | Ga0070708_101090363 | Ga0070708_1010903631 | 80 |
| 682 | 3300005455 | Ga0070663_100924907 | Ga0070663_1009249072 | 80 |
| 683 | 3300005458 | Ga0070681_11106185 | Ga0070681_111061851 | 80 |
| 684 | 3300005458 | Ga0070681_12030703 | Ga0070681_120307031 | 80 |
| 685 | 3300005467 | Ga0070706_100002179 | Ga0070706_10000217915 | 80 |
| 686 | 3300005467 | Ga0070706_100006593 | Ga0070706_1000065932 | 80 |
| 687 | 3300005467 | Ga0070706_100026080 | Ga0070706_1000260804 | 80 |
| 688 | 3300005467 | Ga0070706_100084698 | Ga0070706_1000846983 | 80 |
| 689 | 3300005467 | Ga0070706_100094365 | Ga0070706_1000943655 | 80 |
| 690 | 3300005467 | Ga0070706_100100824 | Ga0070706_1001008243 | 80 |
| 691 | 3300005467 | Ga0070706_100215065 | Ga0070706_1002150652 | 80 |
| 692 | 3300005468 | Ga0070707_100000181 | Ga0070707_10000018141 | 80 |
| 693 | 3300005468 | Ga0070707_100021236 | Ga0070707_1000212363 | 80 |
| 694 | 3300005468 | Ga0070707_100034951 | Ga0070707_1000349515 | 80 |
| 695 | 3300005468 | Ga0070707_100041325 | Ga0070707_1000413254 | 80 |
| 696 | 3300005468 | Ga0070707_100073713 | Ga0070707_1000737132 | 80 |
| 697 | 3300005468 | Ga0070707_100272643 | Ga0070707_1002726432 | 80 |
| 698 | 3300005468 | Ga0070707_100299894 | Ga0070707_1002998943 | 80 |
| 699 | 3300005468 | Ga0070707_100449540 | Ga0070707_1004495402 | 80 |
| 700 | 3300005471 | Ga0070698_100000823 | Ga0070698_10000082325 | 80 |
| 701 | 3300005471 | Ga0070698_100032848 | Ga0070698_1000328482 | 80 |
| 702 | 3300005471 | Ga0070698_100039524 | Ga0070698_1000395247 | 80 |
| 703 | 3300005471 | Ga0070698_100062232 | Ga0070698_1000622322 | 80 |
| 704 | 3300005471 | Ga0070698_100069878 | Ga0070698_1000698783 | 80 |
| 705 | 3300005471 | Ga0070698_101347771 | Ga0070698_1013477712 | 80 |
| 706 | 3300005471 | Ga0070698_101513069 | Ga0070698_1015130692 | 80 |
| 707 | 3300005518 | Ga0070699_100196129 | Ga0070699_1001961291 | 80 |
| 708 | 3300005518 | Ga0070699_100420997 | Ga0070699_1004209972 | 80 |
| 709 | 3300005518 | Ga0070699_100477398 | Ga0070699_1004773981 | 80 |
| 710 | 3300005530 | Ga0070679_100342572 | Ga0070679_1003425721 | 80 |
| 711 | 3300005530 | Ga0070679_101150447 | Ga0070679_1011504472 | 80 |
| 712 | 3300005539 | Ga0068853_100142950 | Ga0068853_1001429501 | 80 |
| 713 | 3300005545 | Ga0070695_101016895 | Ga0070695_1010168951 | 80 |
| 714 | 3300005548 | Ga0070665_100383965 | Ga0070665_1003839653 | 80 |
| 715 | 3300005563 | Ga0068855_101182450 | Ga0068855_1011824502 | 80 |
| 716 | 3300005577 | Ga0068857_100141255 | Ga0068857_1001412553 | 80 |
| 717 | 3300005614 | Ga0068856_100160421 | Ga0068856_1001604212 | 80 |
| 718 | 3300005617 | Ga0068859_100608831 | Ga0068859_1006088312 | 80 |
| 719 | 3300005719 | Ga0068861_100216964 | Ga0068861_1002169642 | 80 |
| 720 | 3300005937 | Ga0081455_10117093 | Ga0081455_101170933 | 80 |
| 721 | 3300005937 | Ga0081455_10837403 | Ga0081455_108374032 | 80 |
| 722 | 3300006028 | Ga0070717_10003520 | Ga0070717_100035208 | 80 |
| 723 | 3300006028 | Ga0070717_10056983 | Ga0070717_100569833 | 80 |
| 724 | 3300006028 | Ga0070717_10114234 | Ga0070717_101142342 | 80 |
| 725 | 3300006028 | Ga0070717_10164230 | Ga0070717_101642302 | 80 |
| 726 | 3300006028 | Ga0070717_10209095 | Ga0070717_102090952 | 80 |
| 727 | 3300006028 | Ga0070717_10482504 | Ga0070717_104825041 | 80 |
| 728 | 3300006051 | Ga0075364_10175284 | Ga0075364_101752843 | 80 |
| 729 | 3300006058 | Ga0075432_10332979 | Ga0075432_103329791 | 80 |
| 730 | 3300006163 | Ga0070715_10000176 | Ga0070715_100001768 | 80 |
| 731 | 3300006163 | Ga0070715_10031319 | Ga0070715_100313192 | 80 |
| 732 | 3300006173 | Ga0070716_100008911 | Ga0070716_1000089112 | 80 |
| 733 | 3300006173 | Ga0070716_100036121 | Ga0070716_1000361211 | 80 |
| 734 | 3300006175 | Ga0070712_100018221 | Ga0070712_1000182212 | 80 |
| 735 | 3300006175 | Ga0070712_100062788 | Ga0070712_1000627882 | 80 |
| 736 | 3300006175 | Ga0070712_100629266 | Ga0070712_1006292662 | 80 |
| 737 | 3300006175 | Ga0070712_100636151 | Ga0070712_1006361512 | 80 |
| 738 | 3300006175 | Ga0070712_100677919 | Ga0070712_1006779191 | 80 |
| 739 | 3300006237 | Ga0097621_101191406 | Ga0097621_1011914062 | 80 |
| 740 | 3300006844 | Ga0075428_100045905 | Ga0075428_1000459052 | 80 |
| 741 | 3300006852 | Ga0075433_10339717 | Ga0075433_103397172 | 80 |
| 742 | 3300006852 | Ga0075433_10804141 | Ga0075433_108041411 | 80 |
| 743 | 3300006871 | Ga0075434_100678140 | Ga0075434_1006781402 | 80 |
| 744 | 3300006871 | Ga0075434_101123829 | Ga0075434_1011238292 | 80 |
| 745 | 3300006871 | Ga0075434_102272759 | Ga0075434_1022727591 | 80 |
| 746 | 3300006914 | Ga0075436_100254164 | Ga0075436_1002541642 | 80 |
| 747 | 3300006914 | Ga0075436_100703571 | Ga0075436_1007035712 | 80 |
| 748 | 3300006931 | Ga0097620_100608775 | Ga0097620_1006087752 | 80 |
| 749 | 3300007076 | Ga0075435_100148711 | Ga0075435_1001487113 | 80 |
| 750 | 3300007076 | Ga0075435_100498732 | Ga0075435_1004987322 | 80 |
| 751 | 3300007076 | Ga0075435_101520899 | Ga0075435_1015208992 | 80 |
| 752 | 3300007265 | Ga0099794_10030975 | Ga0099794_100309752 | 80 |
| 753 | 3300009094 | Ga0111539_10252618 | Ga0111539_102526182 | 80 |
| 754 | 3300009094 | Ga0111539_10946339 | Ga0111539_109463392 | 80 |
| 755 | 3300009094 | Ga0111539_12314771 | Ga0111539_123147712 | 80 |
| 756 | 3300009101 | Ga0105247_11164917 | Ga0105247_111649172 | 80 |
| 757 | 3300009147 | Ga0114129_10006236 | Ga0114129_100062363 | 80 |
| 758 | 3300009147 | Ga0114129_10504407 | Ga0114129_105044072 | 80 |
| 759 | 3300009148 | Ga0105243_12413153 | Ga0105243_124131531 | 80 |
| 760 | 3300009177 | Ga0105248_11720954 | Ga0105248_117209542 | 80 |
| 761 | 3300010375 | Ga0105239_11080390 | Ga0105239_110803902 | 80 |
| 762 | 3300011119 | Ga0105246_10043217 | Ga0105246_100432173 | 80 |
| 763 | 3300011119 | Ga0105246_10245213 | Ga0105246_102452133 | 80 |
| 764 | 3300013105 | Ga0157369_11323755 | Ga0157369_113237551 | 80 |
| 765 | 3300013105 | Ga0157369_11705469 | Ga0157369_117054691 | 80 |
| 766 | 3300013306 | Ga0163162_13197703 | Ga0163162_131977031 | 80 |
| 767 | 3300013307 | Ga0157372_10208871 | Ga0157372_102088713 | 80 |
| 768 | 3300013307 | Ga0157372_11908803 | Ga0157372_119088031 | 80 |
| 769 | 3300013308 | Ga0157375_11154994 | Ga0157375_111549942 | 80 |
| 770 | 3300020075 | Ga0206349_1895358 | Ga0206349_18953581 | 80 |
| 771 | 3300020080 | Ga0206350_10821574 | Ga0206350_108215741 | 80 |
| 772 | 3300020081 | Ga0206354_10029914 | Ga0206354_100299142 | 80 |
| 773 | 3300020081 | Ga0206354_10133078 | Ga0206354_101330781 | 80 |
| 774 | 3300020082 | Ga0206353_10114996 | Ga0206353_101149962 | 80 |
| 775 | 3300020082 | Ga0206353_11094267 | Ga0206353_110942672 | 80 |
| 776 | 3300020610 | Ga0154015_1051813 | Ga0154015_10518132 | 80 |
| 777 | 3300021377 | Ga0213874_10167468 | Ga0213874_101674681 | 80 |
| 778 | 3300021377 | Ga0213874_10261085 | Ga0213874_102610852 | 80 |
| 779 | 3300021388 | Ga0213875_10000250 | Ga0213875_1000025035 | 80 |
| 780 | 3300021388 | Ga0213875_10002024 | Ga0213875_100020248 | 80 |
| 781 | 3300021388 | Ga0213875_10137605 | Ga0213875_101376052 | 80 |
| 782 | 3300021388 | Ga0213875_10312986 | Ga0213875_103129862 | 80 |
| 783 | 3300022467 | Ga0224712_10299958 | Ga0224712_102999581 | 80 |
| 784 | 3300024225 | Ga0224572_1010763 | Ga0224572_10107633 | 80 |
| 785 | 3300024225 | Ga0224572_1028651 | Ga0224572_10286512 | 80 |
| 786 | 3300025885 | Ga0207653_10130289 | Ga0207653_101302891 | 80 |
| 787 | 3300025898 | Ga0207692_10003218 | Ga0207692_100032187 | 80 |
| 788 | 3300025898 | Ga0207692_10011020 | Ga0207692_100110202 | 80 |
| 789 | 3300025898 | Ga0207692_10063073 | Ga0207692_100630732 | 80 |
| 790 | 3300025898 | Ga0207692_10108524 | Ga0207692_101085242 | 80 |
| 791 | 3300025898 | Ga0207692_10494689 | Ga0207692_104946891 | 80 |
| 792 | 3300025904 | Ga0207647_10011526 | Ga0207647_100115263 | 80 |
| 793 | 3300025905 | Ga0207685_10022260 | Ga0207685_100222602 | 80 |
| 794 | 3300025905 | Ga0207685_10053473 | Ga0207685_100534732 | 80 |
| 795 | 3300025905 | Ga0207685_10211536 | Ga0207685_102115362 | 80 |
| 796 | 3300025906 | Ga0207699_10004354 | Ga0207699_100043543 | 80 |
| 797 | 3300025906 | Ga0207699_10006055 | Ga0207699_100060556 | 80 |
| 798 | 3300025906 | Ga0207699_10034155 | Ga0207699_100341553 | 80 |
| 799 | 3300025906 | Ga0207699_10259178 | Ga0207699_102591782 | 80 |
| 800 | 3300025909 | Ga0207705_10000251 | Ga0207705_100002518 | 80 |
| 801 | 3300025910 | Ga0207684_10001290 | Ga0207684_100012903 | 80 |
| 802 | 3300025910 | Ga0207684_10001319 | Ga0207684_1000131912 | 80 |
| 803 | 3300025910 | Ga0207684_10004232 | Ga0207684_100042324 | 80 |
| 804 | 3300025910 | Ga0207684_10113089 | Ga0207684_101130893 | 80 |
| 805 | 3300025910 | Ga0207684_10148325 | Ga0207684_101483251 | 80 |
| 806 | 3300025910 | Ga0207684_10487563 | Ga0207684_104875632 | 80 |
| 807 | 3300025910 | Ga0207684_10533858 | Ga0207684_105338582 | 80 |
| 808 | 3300025915 | Ga0207693_10008315 | Ga0207693_100083156 | 80 |
| 809 | 3300025915 | Ga0207693_10036042 | Ga0207693_100360425 | 80 |
| 810 | 3300025915 | Ga0207693_10083441 | Ga0207693_100834412 | 80 |
| 811 | 3300025916 | Ga0207663_10004647 | Ga0207663_100046473 | 80 |
| 812 | 3300025916 | Ga0207663_10038404 | Ga0207663_100384041 | 80 |
| 813 | 3300025916 | Ga0207663_11016512 | Ga0207663_110165122 | 80 |
| 814 | 3300025922 | Ga0207646_10000690 | Ga0207646_1000069025 | 80 |
| 815 | 3300025922 | Ga0207646_10001669 | Ga0207646_1000166920 | 80 |
| 816 | 3300025922 | Ga0207646_10015118 | Ga0207646_100151184 | 80 |
| 817 | 3300025922 | Ga0207646_10077937 | Ga0207646_100779372 | 80 |
| 818 | 3300025922 | Ga0207646_10082304 | Ga0207646_100823043 | 80 |
| 819 | 3300025922 | Ga0207646_10189946 | Ga0207646_101899462 | 80 |
| 820 | 3300025922 | Ga0207646_10305638 | Ga0207646_103056383 | 80 |
| 821 | 3300025922 | Ga0207646_10474438 | Ga0207646_104744381 | 80 |
| 822 | 3300025922 | Ga0207646_10666003 | Ga0207646_106660032 | 80 |
| 823 | 3300025928 | Ga0207700_10007201 | Ga0207700_100072013 | 80 |
| 824 | 3300025928 | Ga0207700_10029880 | Ga0207700_100298805 | 80 |
| 825 | 3300025928 | Ga0207700_10055685 | Ga0207700_100556852 | 80 |
| 826 | 3300025928 | Ga0207700_10113240 | Ga0207700_101132402 | 80 |
| 827 | 3300025928 | Ga0207700_10493236 | Ga0207700_104932362 | 80 |
| 828 | 3300025929 | Ga0207664_10000650 | Ga0207664_100006503 | 80 |
| 829 | 3300025929 | Ga0207664_10004546 | Ga0207664_100045463 | 80 |
| 830 | 3300025929 | Ga0207664_10004907 | Ga0207664_100049073 | 80 |
| 831 | 3300025929 | Ga0207664_10215369 | Ga0207664_102153691 | 80 |
| 832 | 3300025939 | Ga0207665_10002376 | Ga0207665_1000237615 | 80 |
| 833 | 3300025939 | Ga0207665_10011702 | Ga0207665_100117027 | 80 |
| 834 | 3300025939 | Ga0207665_10059382 | Ga0207665_100593823 | 80 |
| 835 | 3300025944 | Ga0207661_10048992 | Ga0207661_100489923 | 80 |
| 836 | 3300025949 | Ga0207667_10760691 | Ga0207667_107606912 | 80 |
| 837 | 3300025986 | Ga0207658_10591418 | Ga0207658_105914181 | 80 |
| 838 | 3300026023 | Ga0207677_11785345 | Ga0207677_117853451 | 80 |
| 839 | 3300026078 | Ga0207702_10480004 | Ga0207702_104800042 | 80 |
| 840 | 3300026116 | Ga0207674_10251700 | Ga0207674_102517004 | 80 |
| 841 | 3300026118 | Ga0207675_100303940 | Ga0207675_1003039402 | 80 |
| 842 | 3300027671 | Ga0209588_1033098 | Ga0209588_10330982 | 80 |
| 843 | 3300027907 | Ga0207428_10878981 | Ga0207428_108789812 | 80 |
| 844 | 3300028379 | Ga0268266_10773250 | Ga0268266_107732502 | 80 |
| 845 | 3300028800 | Ga0265338_10003796 | Ga0265338_100037962 | 80 |
| 846 | 3300030522 | Ga0307512_10108540 | Ga0307512_101085402 | 80 |
| 847 | 3300031456 | Ga0307513_10555678 | Ga0307513_105556781 | 80 |
| 848 | 3300032002 | Ga0307416_100578564 | Ga0307416_1005785642 | 80 |
| 849 | 3300032126 | Ga0307415_100323594 | Ga0307415_1003235943 | 80 |
| 850 | 3300035083 | Ga0373926_0014236 | Ga0373926_0014236_1147_1392 | 80 |
| 851 | 3300035083 | Ga0373926_0101926 | Ga0373926_0101926_606_851 | 80 |
| 852 | 3300035086 | Ga0373934_0000188 | Ga0373934_0000188_2531_2776 | 80 |
| 853 | 3300035086 | Ga0373934_0414235 | Ga0373934_0414235_178_423 | 80 |
| 854 | 3300035111 | Ga0373923_0029014 | Ga0373923_0029014_1153_1398 | 80 |
| 855 | 3300035111 | Ga0373923_0270273 | Ga0373923_0270273_496_741 | 80 |
| 856 | 3300035113 | Ga0373936_0115734 | Ga0373936_0115734_331_576 | 80 |
| 857 | 3300035113 | Ga0373936_0349941 | Ga0373936_0349941_134_379 | 80 |
| 858 | 3300035113 | Ga0373936_0584871 | Ga0373936_0584871_76_321 | 80 |
| 859 | 3300035114 | Ga0373939_0323733 | Ga0373939_0323733_121_366 | 80 |
| 860 | 3300035117 | Ga0373953_0002097 | Ga0373953_0002097_3068_3313 | 80 |
| 861 | 3300035117 | Ga0373953_0018644 | Ga0373953_0018644_915_1160 | 80 |
| 862 | 3300035118 | Ga0373954_0017630 | Ga0373954_0017630_736_981 | 80 |
| 863 | 3300035119 | Ga0373956_0000657 | Ga0373956_0000657_2081_2326 | 80 |
| 864 | 3300035119 | Ga0373956_0012255 | Ga0373956_0012255_2352_2597 | 80 |
| 865 | 3300035119 | Ga0373956_0108788 | Ga0373956_0108788_805_1050 | 80 |
| 866 | 3300035120 | Ga0373957_0000118 | Ga0373957_0000118_8685_8930 | 80 |
| 867 | 3300035120 | Ga0373957_0057697 | Ga0373957_0057697_857_1102 | 80 |
| 868 | 3300035120 | Ga0373957_0103361 | Ga0373957_0103361_766_1011 | 80 |
| 869 | 3300035171 | Ga0373946_0044684 | Ga0373946_0044684_1529_1774 | 80 |
| 870 | 3300035172 | Ga0373955_0000007 | Ga0373955_0000007_79083_79328 | 80 |
| 871 | 3300035172 | Ga0373955_0068377 | Ga0373955_0068377_886_1131 | 80 |
| 872 | 3300035242 | Ga0373962_0177377 | Ga0373962_0177377_364_609 | 80 |
| 873 | 3300035410 | Ga0373924_0001424 | Ga0373924_0001424_4180_4425 | 80 |
| 874 | 3300035410 | Ga0373924_0102183 | Ga0373924_0102183_354_599 | 80 |
| 875 | 3300035691 | Ga0373931_0438520 | Ga0373931_0438520_393_638 | 80 |
| 876 | 3300035691 | Ga0373931_0876909 | Ga0373931_0876909_22_267 | 80 |
| 877 | 3300035692 | Ga0373935_0004922 | Ga0373935_0004922_4756_5001 | 80 |
| 878 | 3300035692 | Ga0373935_0125630 | Ga0373935_0125630_1416_1661 | 80 |
| 879 | 3300035692 | Ga0373935_0239570 | Ga0373935_0239570_144_389 | 80 |
| 880 | 3300035692 | Ga0373935_0356892 | Ga0373935_0356892_751_996 | 80 |
| 881 | 3300035692 | Ga0373935_0377617 | Ga0373935_0377617_520_765 | 80 |
| 882 | 3300035692 | Ga0373935_0718997 | Ga0373935_0718997_78_323 | 80 |
| 883 | 3300035695 | Ga0373927_0020243 | Ga0373927_0020243_2313_2558 | 80 |
| 884 | 3300035695 | Ga0373927_1177463 | Ga0373927_1177463_101_346 | 80 |
| 885 | 3300035724 | Ga0373933_0000002 | Ga0373933_0000002_142925_143170 | 80 |
| 886 | 3300035724 | Ga0373933_0155018 | Ga0373933_0155018_398_643 | 80 |
| 887 | 3300035724 | Ga0373933_0277686 | Ga0373933_0277686_579_824 | 80 |
| 888 | 3300035725 | Ga0373947_0000737 | Ga0373947_0000737_11521_11766 | 80 |
| 889 | 3300035725 | Ga0373947_0388373 | Ga0373947_0388373_638_883 | 80 |
| 890 | 3300035725 | Ga0373947_1113014 | Ga0373947_1113014_142_387 | 80 |
| 891 | 3300036401 | Ga0373937_0000014 | Ga0373937_0000014_8616_8861 | 80 |
| 892 | 3300036401 | Ga0373937_0028627 | Ga0373937_0028627_546_791 | 80 |
| 893 | 3300036401 | Ga0373937_0030802 | Ga0373937_0030802_4261_4506 | 80 |
| 894 | 3300036401 | Ga0373937_0086326 | Ga0373937_0086326_1752_1997 | 80 |
| 895 | 3300036401 | Ga0373937_0361545 | Ga0373937_0361545_564_809 | 80 |
| 896 | 3300036401 | Ga0373937_1022848 | Ga0373937_1022848_332_577 | 80 |
| 897 | 3300036459 | Ga0372808_006996 | Ga0372808_006996_242_487 | 80 |
| 898 | 3300037068 | Ga0373925_0001809 | Ga0373925_0001809_13659_13904 | 80 |
| 899 | 3300037068 | Ga0373925_0113270 | Ga0373925_0113270_1662_1907 | 80 |
| 900 | 3300037068 | Ga0373925_0201269 | Ga0373925_0201269_559_804 | 80 |
| 901 | 3300037312 | Ga0395899_0454772 | Ga0395899_0454772_125_373 | 80 |
| 902 | 3300037418 | Ga0395900_0021811 | Ga0395900_0021811_866_1114 | 80 |
| 903 | 3300037466 | Ga0395898_0217991 | Ga0395898_0217991_569_817 | 80 |
| 904 | 3300037853 | Ga0436364_0111682 | Ga0436364_0111682_486_731 | 80 |
| 905 | 3300037853 | Ga0436364_0287407 | Ga0436364_0287407_94002_94247 | 80 |
| 906 | 3300037853 | Ga0436364_1192698 | Ga0436364_1192698_505_750 | 80 |
| 907 | 3300037853 | Ga0436364_1489807 | Ga0436364_1489807_7484_7729 | 80 |
| 908 | 3300038443 | Ga0395901_0019313 | Ga0395901_0019313_6188_6436 | 80 |
| 909 | 3300038996 | Ga0242420_126987 | Ga0242420_126987_124_369 | 80 |
| 910 | 3300039437 | Ga0436365_0909018 | Ga0436365_0909018_143_388 | 80 |
| 911 | 3300039450 | Ga0436363_0236204 | Ga0436363_0236204_360_605 | 80 |
| 912 | 3300039450 | Ga0436363_0689210 | Ga0436363_0689210_83_328 | 80 |
| 913 | 3300039450 | Ga0436363_1449032 | Ga0436363_1449032_332_577 | 80 |
| 914 | 3300041451 | Ga0451791_0719694 | Ga0451791_0719694_124_372 | 80 |
| 915 | 3300041452 | Ga0451793_0625656 | Ga0451793_0625656_195_443 | 80 |
| 916 | 3300044694 | Ga0466963_0005874 | Ga0466963_0005874_6493_6738 | 80 |
| 917 | 3300044842 | Ga0466957_0153559 | Ga0466957_0153559_45_290 | 80 |
| 918 | 3300045836 | Ga0466958_0253648 | Ga0466958_0253648_163_408 | 80 |
| 919 | 3300045976 | Ga0466967_0134170 | Ga0466967_0134170_1876_2121 | 80 |
| 920 | 3300046454 | Ga0495592_0000077 | Ga0495592_0000077_76977_77222 | 80 |
| 921 | 3300046454 | Ga0495592_0004580 | Ga0495592_0004580_7444_7689 | 80 |
| 922 | 3300046454 | Ga0495592_0145851 | Ga0495592_0145851_1028_1273 | 80 |
| 923 | 3300046454 | Ga0495592_0308285 | Ga0495592_0308285_671_916 | 80 |
| 924 | 3300046454 | Ga0495592_0372834 | Ga0495592_0372834_535_780 | 80 |
| 925 | 3300046454 | Ga0495592_0535168 | Ga0495592_0535168_67_312 | 80 |
| 926 | 3300046461 | Ga0495641_0498407 | Ga0495641_0498407_229_474 | 80 |
| 927 | 3300046462 | Ga0495651_0000019 | Ga0495651_0000019_8616_8861 | 80 |
| 928 | 3300046462 | Ga0495651_0045029 | Ga0495651_0045029_2409_2654 | 80 |
| 929 | 3300046462 | Ga0495651_0054910 | Ga0495651_0054910_1051_1296 | 80 |
| 930 | 3300046462 | Ga0495651_0083155 | Ga0495651_0083155_225_470 | 80 |
| 931 | 3300046462 | Ga0495651_0602431 | Ga0495651_0602431_44_289 | 80 |
| 932 | 3300046463 | Ga0495653_0001268 | Ga0495653_0001268_10679_10924 | 80 |
| 933 | 3300046463 | Ga0495653_0016762 | Ga0495653_0016762_3947_4192 | 80 |
| 934 | 3300046463 | Ga0495653_0345006 | Ga0495653_0345006_129_374 | 80 |
| 935 | 3300046472 | Ga0495580_0028947 | Ga0495580_0028947_53_298 | 80 |
| 936 | 3300046475 | Ga0495639_0521745 | Ga0495639_0521745_192_437 | 80 |
| 937 | 3300046476 | Ga0495662_0005382 | Ga0495662_0005382_6097_6342 | 80 |
| 938 | 3300046477 | Ga0495664_0008766 | Ga0495664_0008766_4704_4949 | 80 |
| 939 | 3300046477 | Ga0495664_0049870 | Ga0495664_0049870_729_974 | 80 |
| 940 | 3300046477 | Ga0495664_0075798 | Ga0495664_0075798_295_540 | 80 |
| 941 | 3300046477 | Ga0495664_0322152 | Ga0495664_0322152_643_888 | 80 |
| 942 | 3300046477 | Ga0495664_0359818 | Ga0495664_0359818_84_329 | 80 |
| 943 | 3300046477 | Ga0495664_0380495 | Ga0495664_0380495_514_759 | 80 |
| 944 | 3300046506 | Ga0495583_0143019 | Ga0495583_0143019_308_553 | 80 |
| 945 | 3300046511 | Ga0495608_0000028 | Ga0495608_0000028_142917_143162 | 80 |
| 946 | 3300046511 | Ga0495608_0012419 | Ga0495608_0012419_5456_5701 | 80 |
| 947 | 3300046511 | Ga0495608_0017771 | Ga0495608_0017771_4129_4374 | 80 |
| 948 | 3300046514 | Ga0495618_0025694 | Ga0495618_0025694_1355_1600 | 80 |
| 949 | 3300046514 | Ga0495618_0178415 | Ga0495618_0178415_611_856 | 80 |
| 950 | 3300046516 | Ga0495628_0001918 | Ga0495628_0001918_8393_8638 | 80 |
| 951 | 3300046516 | Ga0495628_0006885 | Ga0495628_0006885_9432_9677 | 80 |
| 952 | 3300046516 | Ga0495628_0026832 | Ga0495628_0026832_769_1014 | 80 |
| 953 | 3300046516 | Ga0495628_0103939 | Ga0495628_0103939_1298_1543 | 80 |
| 954 | 3300046516 | Ga0495628_0237842 | Ga0495628_0237842_274_519 | 80 |
| 955 | 3300046516 | Ga0495628_0496787 | Ga0495628_0496787_217_462 | 80 |
| 956 | 3300046517 | Ga0495630_0006388 | Ga0495630_0006388_6134_6379 | 80 |
| 957 | 3300046517 | Ga0495630_0102218 | Ga0495630_0102218_1186_1431 | 80 |
| 958 | 3300046517 | Ga0495630_0664209 | Ga0495630_0664209_259_504 | 80 |
| 959 | 3300046526 | Ga0495666_0002010 | Ga0495666_0002010_7962_8207 | 80 |
| 960 | 3300046529 | Ga0495652_0000031 | Ga0495652_0000031_142905_143150 | 80 |
| 961 | 3300046529 | Ga0495652_0103665 | Ga0495652_0103665_259_504 | 80 |
| 962 | 3300046529 | Ga0495652_0309847 | Ga0495652_0309847_533_778 | 80 |
| 963 | 3300046529 | Ga0495652_0446218 | Ga0495652_0446218_392_637 | 80 |
| 964 | 3300046531 | Ga0495665_0015478 | Ga0495665_0015478_3776_4021 | 80 |
| 965 | 3300046531 | Ga0495665_0548606 | Ga0495665_0548606_113_358 | 80 |
| 966 | 3300046533 | Ga0495640_0019201 | Ga0495640_0019201_1968_2213 | 80 |
| 967 | 3300046533 | Ga0495640_0041400 | Ga0495640_0041400_2939_3184 | 80 |
| 968 | 3300046533 | Ga0495640_0071341 | Ga0495640_0071341_973_1218 | 80 |
| 969 | 3300046533 | Ga0495640_0325527 | Ga0495640_0325527_480_725 | 80 |
| 970 | 3300046536 | Ga0495587_0000023 | Ga0495587_0000023_8594_8839 | 80 |
| 971 | 3300046536 | Ga0495587_0016275 | Ga0495587_0016275_204_449 | 80 |
| 972 | 3300046536 | Ga0495587_0058223 | Ga0495587_0058223_998_1243 | 80 |
| 973 | 3300046543 | Ga0495645_0011765 | Ga0495645_0011765_5715_5960 | 80 |
| 974 | 3300046543 | Ga0495645_0077699 | Ga0495645_0077699_1606_1851 | 80 |
| 975 | 3300046543 | Ga0495645_0187043 | Ga0495645_0187043_102_347 | 80 |
| 976 | 3300046543 | Ga0495645_0348635 | Ga0495645_0348635_200_445 | 80 |
| 977 | 3300046543 | Ga0495645_0415880 | Ga0495645_0415880_117_362 | 80 |
| 978 | 3300046543 | Ga0495645_0581349 | Ga0495645_0581349_359_604 | 80 |
| 979 | 3300046559 | Ga0495667_0000373 | Ga0495667_0000373_27012_27257 | 80 |
| 980 | 3300046559 | Ga0495667_0000913 | Ga0495667_0000913_8615_8860 | 80 |
| 981 | 3300046559 | Ga0495667_0026848 | Ga0495667_0026848_2553_2798 | 80 |
| 982 | 3300046559 | Ga0495667_0214846 | Ga0495667_0214846_86_331 | 80 |
| 983 | 3300046559 | Ga0495667_0835981 | Ga0495667_0835981_282_527 | 80 |
| 984 | 3300046642 | Ga0495634_0060857 | Ga0495634_0060857_264_509 | 80 |
| 985 | 3300046642 | Ga0495634_0883196 | Ga0495634_0883196_223_468 | 80 |
| 986 | 3300046663 | Ga0495635_0013180 | Ga0495635_0013180_32_277 | 80 |
| 987 | 3300046663 | Ga0495635_0048120 | Ga0495635_0048120_142_387 | 80 |
| 988 | 3300046663 | Ga0495635_0097633 | Ga0495635_0097633_523_768 | 80 |
| 989 | 3300046663 | Ga0495635_0202400 | Ga0495635_0202400_54_299 | 80 |
| 990 | 3300046674 | Ga0495588_0356262 | Ga0495588_0356262_309_554 | 80 |
| 991 | 3300046675 | Ga0495657_0000022 | Ga0495657_0000022_142925_143170 | 80 |
| 992 | 3300046675 | Ga0495657_0044444 | Ga0495657_0044444_212_457 | 80 |
| 993 | 3300046675 | Ga0495657_0354777 | Ga0495657_0354777_543_788 | 80 |
| 994 | 3300046675 | Ga0495657_0401404 | Ga0495657_0401404_492_737 | 80 |
| 995 | 3300046678 | Ga0495599_0000174 | Ga0495599_0000174_38865_39110 | 80 |
| 996 | 3300046678 | Ga0495599_0016524 | Ga0495599_0016524_922_1167 | 80 |
| 997 | 3300046678 | Ga0495599_0025442 | Ga0495599_0025442_2909_3154 | 80 |
| 998 | 3300046678 | Ga0495599_0058597 | Ga0495599_0058597_1127_1372 | 80 |
| 999 | 3300046678 | Ga0495599_0069003 | Ga0495599_0069003_1873_2118 | 80 |
| 1000 | 3300046679 | Ga0495623_0011541 | Ga0495623_0011541_2894_3139 | 80 |
| 1001 | 3300046679 | Ga0495623_0075512 | Ga0495623_0075512_392_637 | 80 |
| 1002 | 3300046679 | Ga0495623_0311102 | Ga0495623_0311102_428_673 | 80 |
| 1003 | 3300046680 | Ga0495646_0013004 | Ga0495646_0013004_2518_2763 | 80 |
| 1004 | 3300046680 | Ga0495646_0025270 | Ga0495646_0025270_76_321 | 80 |
| 1005 | 3300046680 | Ga0495646_0040869 | Ga0495646_0040869_537_782 | 80 |
| 1006 | 3300046680 | Ga0495646_0212791 | Ga0495646_0212791_560_805 | 80 |
| 1007 | 3300046680 | Ga0495646_0405261 | Ga0495646_0405261_302_547 | 80 |
| 1008 | 3300046689 | Ga0495613_0077197 | Ga0495613_0077197_1909_2154 | 80 |
| 1009 | 3300046690 | Ga0495624_0905725 | Ga0495624_0905725_244_489 | 80 |
| 1010 | 3300046809 | Ga0495600_0011341 | Ga0495600_0011341_844_1089 | 80 |
| 1011 | 3300046809 | Ga0495600_0049830 | Ga0495600_0049830_1629_1874 | 80 |
| 1012 | 3300046809 | Ga0495600_0501315 | Ga0495600_0501315_86_331 | 80 |
| 1013 | 3300046809 | Ga0495600_0749741 | Ga0495600_0749741_264_509 | 80 |
| 1014 | 3300047315 | Ga0495581_0326247 | Ga0495581_0326247_505_750 | 80 |
| 1015 | 3300047317 | Ga0495604_0000022 | Ga0495604_0000022_142884_143129 | 80 |
| 1016 | 3300047317 | Ga0495604_0000132 | Ga0495604_0000132_50125_50370 | 80 |
| 1017 | 3300047317 | Ga0495604_0009677 | Ga0495604_0009677_6156_6401 | 80 |
| 1018 | 3300047317 | Ga0495604_0118825 | Ga0495604_0118825_1223_1468 | 80 |
| 1019 | 3300047317 | Ga0495604_0772212 | Ga0495604_0772212_134_379 | 80 |
| 1020 | 3300047319 | Ga0495674_0004392 | Ga0495674_0004392_2300_2545 | 80 |
| 1021 | 3300047319 | Ga0495674_0012867 | Ga0495674_0012867_6444_6689 | 80 |
| 1022 | 3300047319 | Ga0495674_0022817 | Ga0495674_0022817_4085_4330 | 80 |
| 1023 | 3300047319 | Ga0495674_0480681 | Ga0495674_0480681_125_370 | 80 |
| 1024 | 3300047321 | Ga0495676_0260381 | Ga0495676_0260381_922_1167 | 80 |
| 1025 | 3300047321 | Ga0495676_0303493 | Ga0495676_0303493_558_803 | 80 |
| 1026 | 3300047322 | Ga0495680_0001555 | Ga0495680_0001555_8614_8859 | 80 |
| 1027 | 3300047322 | Ga0495680_0039799 | Ga0495680_0039799_490_735 | 80 |
| 1028 | 3300047322 | Ga0495680_0054859 | Ga0495680_0054859_2064_2309 | 80 |
| 1029 | 3300047444 | Ga0495675_0001285 | Ga0495675_0001285_6346_6591 | 80 |
| 1030 | 3300047444 | Ga0495675_0086137 | Ga0495675_0086137_381_626 | 80 |
| 1031 | 3300047444 | Ga0495675_0086933 | Ga0495675_0086933_264_509 | 80 |
| 1032 | 3300047444 | Ga0495675_0226830 | Ga0495675_0226830_312_557 | 80 |
| 1033 | 3300047444 | Ga0495675_0279794 | Ga0495675_0279794_137_382 | 80 |
| 1034 | 3300047471 | Ga0495684_0010588 | Ga0495684_0010588_6840_7085 | 80 |
| 1035 | 3300047471 | Ga0495684_0153870 | Ga0495684_0153870_392_637 | 80 |
| 1036 | 3300047673 | Ga0495593_0197128 | Ga0495593_0197128_728_973 | 80 |
| 1037 | 3300047673 | Ga0495593_0651527 | Ga0495593_0651527_145_390 | 80 |
| 1038 | 3300048088 | Ga0495602_0000169 | Ga0495602_0000169_8616_8861 | 80 |
| 1039 | 3300048088 | Ga0495602_0031701 | Ga0495602_0031701_4411_4656 | 80 |
| 1040 | 3300048088 | Ga0495602_0135570 | Ga0495602_0135570_1041_1286 | 80 |
| 1041 | 3300048088 | Ga0495602_0688943 | Ga0495602_0688943_398_643 | 80 |
| 1042 | 3300048903 | Ga0496100_0404680 | Ga0496100_0404680_206_451 | 80 |
| 1043 | 3300048907 | Ga0496104_0075454 | Ga0496104_0075454_690_935 | 80 |
| 1044 | 3300048908 | Ga0496105_0108894 | Ga0496105_0108894_84_329 | 80 |
| 1045 | 3300048909 | Ga0496106_0443450 | Ga0496106_0443450_489_734 | 80 |
| 1046 | 3300048911 | Ga0496108_0075084 | Ga0496108_0075084_1518_1763 | 80 |
| 1047 | 3300048911 | Ga0496108_0300554 | Ga0496108_0300554_418_666 | 80 |
| 1048 | 3300048912 | Ga0496109_0081888 | Ga0496109_0081888_2282_2527 | 80 |
| 1049 | 3300048915 | Ga0496112_0094243 | Ga0496112_0094243_2490_2735 | 80 |
| 1050 | 3300048916 | Ga0496113_0048622 | Ga0496113_0048622_1979_2224 | 80 |
| 1051 | 3300048918 | Ga0496115_0131802 | Ga0496115_0131802_121_366 | 80 |
| 1052 | 3300049578 | Ga0501042_0017499 | Ga0501042_0017499_3739_3984 | 80 |
| 1053 | 3300049583 | Ga0501067_0399902 | Ga0501067_0399902_128_373 | 80 |
| 1054 | 3300049823 | Ga0501044_0241222 | Ga0501044_0241222_58_306 | 80 |
| 1055 | 3300050491 | nmdc:mga00v17_145660_c1 | nmdc:mga00v17_145660_c1_369_614 | 80 |
| 1056 | 3300050491 | nmdc:mga00v17_60460_c1 | nmdc:mga00v17_60460_c1_1824_2069 | 80 |
| 1057 | 3300050492 | nmdc:mga0yw44_389588_c1 | nmdc:mga0yw44_389588_c1_275_523 | 80 |
| 1058 | 3300050507 | nmdc:mga05p37_8079_c1 | nmdc:mga05p37_8079_c1_5410_5655 | 80 |
| 1059 | 3300050511 | nmdc:mga08y16_121804_c1 | nmdc:mga08y16_121804_c1_1393_1638 | 80 |
| 1060 | 3300050512 | nmdc:mga0n895_1050625_c1 | nmdc:mga0n895_1050625_c1_369_614 | 80 |
| 1061 | 3300050512 | nmdc:mga0n895_1517643_c1 | nmdc:mga0n895_1517643_c1_257_502 | 80 |
| 1062 | 3300050512 | nmdc:mga0n895_3349_c1 | nmdc:mga0n895_3349_c1_5022_5267 | 80 |
| 1063 | 3300050512 | nmdc:mga0n895_447392_c1 | nmdc:mga0n895_447392_c1_188_433 | 80 |
| 1064 | 3300050512 | nmdc:mga0n895_690106_c1 | nmdc:mga0n895_690106_c1_210_455 | 80 |
| 1065 | 3300050513 | nmdc:mga0rr50_162087_c1 | nmdc:mga0rr50_162087_c1_187_432 | 80 |
| 1066 | 3300050513 | nmdc:mga0rr50_4906_c1 | nmdc:mga0rr50_4906_c1_7383_7628 | 80 |
| 1067 | 3300050513 | nmdc:mga0rr50_746027_c1 | nmdc:mga0rr50_746027_c1_189_434 | 80 |
| 1068 | 3300050514 | nmdc:mga08x19_1330458_c1 | nmdc:mga08x19_1330458_c1_155_400 | 80 |
| 1069 | 3300050514 | nmdc:mga08x19_536741_c1 | nmdc:mga08x19_536741_c1_534_779 | 80 |
| 1070 | 3300050514 | nmdc:mga08x19_704531_c1 | nmdc:mga08x19_704531_c1_63_308 | 80 |
| 1071 | 3300050514 | nmdc:mga08x19_896287_c1 | nmdc:mga08x19_896287_c1_195_440 | 80 |
| 1072 | 3300050515 | nmdc:mga0a205_203326_c1 | nmdc:mga0a205_203326_c1_1144_1389 | 80 |
| 1073 | 3300050515 | nmdc:mga0a205_919529_c1 | nmdc:mga0a205_919529_c1_99_344 | 80 |
| 1074 | 3300053077 | Ga0495601_0059285 | Ga0495601_0059285_2147_2392 | 80 |
| 1075 | 3300053077 | Ga0495601_0060951 | Ga0495601_0060951_499_744 | 80 |
| 1076 | 3300053077 | Ga0495601_0997819 | Ga0495601_0997819_89_334 | 80 |
| 1077 | 3300053078 | Ga0495612_0023863 | Ga0495612_0023863_637_882 | 80 |
| 1078 | 3300053084 | Ga0495595_0003146 | Ga0495595_0003146_2620_2865 | 80 |
| 1079 | 3300053084 | Ga0495595_0182804 | Ga0495595_0182804_80_325 | 80 |
| 1080 | 3300053084 | Ga0495595_0186417 | Ga0495595_0186417_732_977 | 80 |
| 1081 | 3300053085 | Ga0495619_0055053 | Ga0495619_0055053_1644_1889 | 80 |
| 1082 | 3300053085 | Ga0495619_0190723 | Ga0495619_0190723_289_534 | 80 |
| 1083 | 3300053085 | Ga0495619_0749394 | Ga0495619_0749394_81_326 | 80 |
| 1084 | 3300053136 | Ga0500559_0023824 | Ga0500559_0023824_1679_1924 | 80 |
| 1085 | 3300000549 | LJQas_1000976 | LJQas_10009767 | 83 |
| 1086 | 3300000549 | LJQas_1001572 | LJQas_10015723 | 83 |
| 1087 | 3300031548 | Ga0307408_100026964 | Ga0307408_1000269645 | 83 |
| 1088 | 3300031824 | Ga0307413_10021651 | Ga0307413_100216514 | 83 |
| 1089 | 3300031852 | Ga0307410_10014089 | Ga0307410_100140896 | 83 |
| 1090 | 3300031901 | Ga0307406_11705335 | Ga0307406_117053351 | 83 |
| 1091 | 3300031903 | Ga0307407_10276519 | Ga0307407_102765191 | 83 |
| 1092 | 3300031911 | Ga0307412_11967731 | Ga0307412_119677311 | 83 |
| 1093 | 3300031995 | Ga0307409_100039770 | Ga0307409_1000397706 | 83 |
| 1094 | 3300032002 | Ga0307416_100051141 | Ga0307416_1000511414 | 83 |
| 1095 | 3300032004 | Ga0307414_10247405 | Ga0307414_102474051 | 83 |
| 1096 | 3300032126 | Ga0307415_100122561 | Ga0307415_1001225612 | 83 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v6u-assembly1.cif.gz_BW | promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes | 0.8564 | 1 | 64 |
| 8btr-assembly1.cif.gz_Li | giardia ribosome in pre-t hybrid state (d2) | 0.8338 | 1 | 62 |
| 4afl-assembly2.cif.gz_F | the crystal structure of the ing4 dimerization domain reveals the functional organization of the ing family of chromatin binding proteins. | 0.8028 | 3 | 64 |
| 4afl-assembly3.cif.gz_D | the crystal structure of the ing4 dimerization domain reveals the functional organization of the ing family of chromatin binding proteins. | 0.7894 | 4 | 64 |
| 3vpv-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa tsi2 | 0.7872 | 1 | 56 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9HGM9_19_131_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8665 | 32 | 64 | 1.25.40.10 |
| af_O04482_225_309_1.20.58.860 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.866 | 6 | 64 | 1.20.58.860 |
| 1lrzA03 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8331 | 3 | 63 | 1.20.58.90 |
| af_A0A0R0EY02_5_123_1.20.5.4130 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.814 | 3 | 60 | 1.20.5.4130 |
| af_I1JNT6_11_252_3.30.900.20 | Alpha Beta;2-Layer Sandwich;Cell Cycle, Spindle Assembly Checkpoint Protein; Chain A; | 0.8107 | 4 | 56 | 3.30.900.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0B8MZF6-F1-model_v4 | Transcriptional regulator | 0.9127 | 1 | 79 |
GO:0003677
GO:0003700 GO:0009058 GO:0030170 |
| AF-A0A424YL92-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.8984 | 6 | 56 |
GO:0016301
|
| AF-A0A1S9M7U1-F1-model_v4 | DUF2630 domain-containing protein | 0.892 | 1 | 83 |
|
| AF-A0A542QSC6-F1-model_v4 | Zinc-binding alcohol dehydrogenase family protein | 0.88 | 1 | 83 |
|
| AF-A0A212RIA7-F1-model_v4 | Transcriptional regulator, AraC family with amidase-like domain | 0.8767 | 1 | 83 |
GO:0003700
GO:0043565 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar