F489936
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1094 | 440 | 1059 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300005983|Ga0081540_1012299|Ga0081540_10122993 |
| Length | 175 |
| Sequence | MPFDRITISDCVPVALDPPVETDMSLDLKRQLVSQLVESSRLLRNYIDHRAKTRGTTRAQWIVLFRLREQEGLSQVDLADVLELQPISLVRLLDRLVEHGLLERRQDPKDRRANRLFLTDRGRQLVDDLDSLRDAIATDVLNDIPDQRIDASLQTLRDIKDRIKSLGEDPDVAVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 4 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 5 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 6 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 7 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 8 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 9 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 10 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 11 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 12 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 13 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 14 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 15 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 16 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 17 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 18 | 2904699407 | |||
| 19 | 2906610324 | |||
| 20 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 21 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 22 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 23 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 24 | 2922425934 | |||
| 25 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 26 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 27 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 28 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 29 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 30 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 31 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 32 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 105 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 106 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 109 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 110 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 143 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 146 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 147 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 214 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 221 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 222 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 231 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 232 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 233 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 234 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 235 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 253 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 255 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 266 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 267 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 268 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 269 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 272 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 273 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 274 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 277 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 278 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 354 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 355 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 356 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 357 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 358 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 359 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 360 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 392 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 394 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 404 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 408 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 409 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 410 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 411 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 412 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 413 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 414 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 415 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 416 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 418 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 420 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 421 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 422 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 423 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 424 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 426 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 427 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 428 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 429 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 430 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 431 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 434 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 435 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 436 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 437 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 438 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 439 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 440 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.52 |
| Metatranscriptomes | 0.55 |
| Isolates | 2.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.22 |
| Nodule | 2.93 |
| Rhizoplane | 5.76 |
| Rhizosphere | 79.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1020340 | 3300000549 | Bacteria | 772 |
| 2 | rootH2_10096848 | 3300003320 | Bacteria | 1993 |
| 3 | rootH1_10097652 | 3300003323 | Bacteria | 2143 |
| 4 | Ga0070658_10024846 | 3300005327 | Bacteria | 4805 |
| 5 | Ga0070658_10095518 | 3300005327 | Bacteria | 2454 |
| 6 | Ga0070658_10149575 | 3300005327 | Bacteria | 1954 |
| 7 | Ga0070676_10084466 | 3300005328 | Bacteria | 1933 |
| 8 | Ga0070683_100008483 | 3300005329 | Bacteria | 8729 |
| 9 | Ga0070683_100736603 | 3300005329 | Bacteria | 944 |
| 10 | Ga0070683_100941533 | 3300005329 | Bacteria | 829 |
| 11 | Ga0070670_100171161 | 3300005331 | Bacteria | 1884 |
| 12 | Ga0068869_100548331 | 3300005334 | Bacteria | 971 |
| 13 | Ga0070680_100011935 | 3300005336 | Bacteria | 6740 |
| 14 | Ga0070680_100030530 | 3300005336 | Bacteria | 4329 |
| 15 | Ga0070680_100096296 | 3300005336 | Bacteria | 2454 |
| 16 | Ga0070680_100098880 | 3300005336 | Bacteria | 2421 |
| 17 | Ga0070680_100205224 | 3300005336 | Bacteria | 1662 |
| 18 | Ga0070682_100034380 | 3300005337 | Bacteria | 3087 |
| 19 | Ga0070682_100065584 | 3300005337 | Bacteria | 2308 |
| 20 | Ga0070682_100356620 | 3300005337 | Bacteria | 1092 |
| 21 | Ga0068868_100014105 | 3300005338 | Bacteria | 5883 |
| 22 | Ga0068868_100020935 | 3300005338 | Bacteria | 4923 |
| 23 | Ga0070660_100004475 | 3300005339 | Bacteria | 9660 |
| 24 | Ga0070660_100201255 | 3300005339 | Bacteria | 1615 |
| 25 | Ga0070660_100314234 | 3300005339 | Bacteria | 1286 |
| 26 | Ga0070660_100392798 | 3300005339 | Bacteria | 1146 |
| 27 | Ga0070660_101502263 | 3300005339 | Bacteria | 573 |
| 28 | Ga0070689_100221844 | 3300005340 | Bacteria | 1551 |
| 29 | Ga0070691_10127901 | 3300005341 | Bacteria | 1285 |
| 30 | Ga0070691_10236878 | 3300005341 | Bacteria | 974 |
| 31 | Ga0070687_100465680 | 3300005343 | Bacteria | 844 |
| 32 | Ga0070661_100504410 | 3300005344 | Bacteria | 969 |
| 33 | Ga0070661_100584991 | 3300005344 | Bacteria | 901 |
| 34 | Ga0070661_101108480 | 3300005344 | Bacteria | 660 |
| 35 | Ga0070692_10479303 | 3300005345 | Bacteria | 802 |
| 36 | Ga0070675_101043782 | 3300005354 | Bacteria | 751 |
| 37 | Ga0070671_100371807 | 3300005355 | Bacteria | 1221 |
| 38 | Ga0070673_100043176 | 3300005364 | Bacteria | 3482 |
| 39 | Ga0070673_101400834 | 3300005364 | Bacteria | 658 |
| 40 | Ga0070659_100059496 | 3300005366 | Bacteria | 3017 |
| 41 | Ga0070659_100070327 | 3300005366 | Bacteria | 2780 |
| 42 | Ga0070659_100146550 | 3300005366 | Bacteria | 1924 |
| 43 | Ga0070667_100164177 | 3300005367 | Bacteria | 1958 |
| 44 | Ga0070667_101599645 | 3300005367 | Bacteria | 612 |
| 45 | Ga0070709_10001966 | 3300005434 | Bacteria | 11200 |
| 46 | Ga0070709_10123740 | 3300005434 | Bacteria | 1757 |
| 47 | Ga0070709_10159933 | 3300005434 | Bacteria | 1565 |
| 48 | Ga0070709_10188557 | 3300005434 | Bacteria | 1453 |
| 49 | Ga0070709_10319028 | 3300005434 | Bacteria | 1140 |
| 50 | Ga0070709_10416553 | 3300005434 | Bacteria | 1006 |
| 51 | Ga0070714_100004035 | 3300005435 | Bacteria | 11037 |
| 52 | Ga0070714_100141278 | 3300005435 | Bacteria | 2162 |
| 53 | Ga0070714_100170471 | 3300005435 | Bacteria | 1975 |
| 54 | Ga0070713_100002369 | 3300005436 | Bacteria | 12291 |
| 55 | Ga0070713_100004315 | 3300005436 | Bacteria | 9531 |
| 56 | Ga0070713_100008716 | 3300005436 | Bacteria | 7214 |
| 57 | Ga0070713_100099099 | 3300005436 | Bacteria | 2521 |
| 58 | Ga0070713_100126864 | 3300005436 | Bacteria | 2246 |
| 59 | Ga0070713_100255959 | 3300005436 | Bacteria | 1599 |
| 60 | Ga0070713_100295578 | 3300005436 | Bacteria | 1490 |
| 61 | Ga0070713_100351263 | 3300005436 | Bacteria | 1368 |
| 62 | Ga0070713_100366951 | 3300005436 | Bacteria | 1339 |
| 63 | Ga0070713_100814741 | 3300005436 | Bacteria | 895 |
| 64 | Ga0070713_100847184 | 3300005436 | Bacteria | 878 |
| 65 | Ga0070710_10000567 | 3300005437 | Bacteria | 17537 |
| 66 | Ga0070710_10039600 | 3300005437 | Bacteria | 2594 |
| 67 | Ga0070710_10055501 | 3300005437 | Bacteria | 2239 |
| 68 | Ga0070710_10116312 | 3300005437 | Bacteria | 1612 |
| 69 | Ga0070710_10175357 | 3300005437 | Bacteria | 1339 |
| 70 | Ga0070710_10641649 | 3300005437 | Bacteria | 743 |
| 71 | Ga0070711_100003229 | 3300005439 | Bacteria | 9465 |
| 72 | Ga0070711_100004091 | 3300005439 | Bacteria | 8578 |
| 73 | Ga0070711_100019383 | 3300005439 | Bacteria | 4363 |
| 74 | Ga0070711_100024479 | 3300005439 | Bacteria | 3938 |
| 75 | Ga0070694_100527569 | 3300005444 | Bacteria | 943 |
| 76 | Ga0070694_100801545 | 3300005444 | Bacteria | 772 |
| 77 | Ga0070708_100129226 | 3300005445 | Bacteria | 2337 |
| 78 | Ga0070663_100028079 | 3300005455 | Bacteria | 3826 |
| 79 | Ga0070663_100047389 | 3300005455 | Bacteria | 3044 |
| 80 | Ga0070663_100240136 | 3300005455 | Bacteria | 1430 |
| 81 | Ga0070663_100289021 | 3300005455 | Bacteria | 1309 |
| 82 | Ga0070663_100368589 | 3300005455 | Bacteria | 1167 |
| 83 | Ga0070678_100185071 | 3300005456 | Bacteria | 1708 |
| 84 | Ga0070678_100228337 | 3300005456 | Bacteria | 1550 |
| 85 | Ga0070662_100101270 | 3300005457 | Bacteria | 2180 |
| 86 | Ga0070662_100745308 | 3300005457 | Bacteria | 830 |
| 87 | Ga0070681_10005095 | 3300005458 | Bacteria | 12678 |
| 88 | Ga0070681_10006707 | 3300005458 | Bacteria | 11204 |
| 89 | Ga0070681_10085129 | 3300005458 | Bacteria | 3114 |
| 90 | Ga0070681_10328629 | 3300005458 | Bacteria | 1438 |
| 91 | Ga0070681_10726322 | 3300005458 | Bacteria | 909 |
| 92 | Ga0070681_11745969 | 3300005458 | Bacteria | 549 |
| 93 | Ga0070706_100304014 | 3300005467 | Bacteria | 1488 |
| 94 | Ga0070706_100400523 | 3300005467 | Bacteria | 1278 |
| 95 | Ga0070698_100074338 | 3300005471 | Bacteria | 3404 |
| 96 | Ga0070698_100220198 | 3300005471 | Bacteria | 1832 |
| 97 | Ga0070698_100326992 | 3300005471 | Bacteria | 1464 |
| 98 | Ga0070698_101693166 | 3300005471 | Bacteria | 585 |
| 99 | Ga0070679_100037795 | 3300005530 | Bacteria | 4797 |
| 100 | Ga0070679_100055759 | 3300005530 | Bacteria | 3936 |
| 101 | Ga0070679_100094267 | 3300005530 | Bacteria | 2980 |
| 102 | Ga0070679_100111091 | 3300005530 | Bacteria | 2727 |
| 103 | Ga0070679_100595170 | 3300005530 | Bacteria | 1049 |
| 104 | Ga0070679_100772411 | 3300005530 | Bacteria | 904 |
| 105 | Ga0070679_101045829 | 3300005530 | Bacteria | 761 |
| 106 | Ga0070684_100002527 | 3300005535 | Bacteria | 13495 |
| 107 | Ga0070684_100051408 | 3300005535 | Bacteria | 3580 |
| 108 | Ga0070684_100148173 | 3300005535 | Bacteria | 2125 |
| 109 | Ga0070684_100296017 | 3300005535 | Bacteria | 1484 |
| 110 | Ga0068853_100012545 | 3300005539 | Bacteria | 6894 |
| 111 | Ga0068853_100092352 | 3300005539 | Bacteria | 2663 |
| 112 | Ga0068853_100234150 | 3300005539 | Bacteria | 1681 |
| 113 | Ga0068853_100380670 | 3300005539 | Bacteria | 1318 |
| 114 | Ga0068853_100629957 | 3300005539 | Bacteria | 1020 |
| 115 | Ga0068853_101261304 | 3300005539 | Bacteria | 714 |
| 116 | Ga0070672_100477049 | 3300005543 | Bacteria | 1077 |
| 117 | Ga0070695_100551589 | 3300005545 | Bacteria | 898 |
| 118 | Ga0070693_100275530 | 3300005547 | Bacteria | 1125 |
| 119 | Ga0070693_100295747 | 3300005547 | Bacteria | 1089 |
| 120 | Ga0070665_100021649 | 3300005548 | Bacteria | 6465 |
| 121 | Ga0070665_100106979 | 3300005548 | Bacteria | 2799 |
| 122 | Ga0070665_100124068 | 3300005548 | Bacteria | 2584 |
| 123 | Ga0070665_100301910 | 3300005548 | Bacteria | 1604 |
| 124 | Ga0068855_100034077 | 3300005563 | Bacteria | 6075 |
| 125 | Ga0068855_100336071 | 3300005563 | Bacteria | 1666 |
| 126 | Ga0068855_100364411 | 3300005563 | Bacteria | 1590 |
| 127 | Ga0068855_100747051 | 3300005563 | Bacteria | 1043 |
| 128 | Ga0068855_101860781 | 3300005563 | Unclassified | 610 |
| 129 | Ga0070664_100150017 | 3300005564 | Bacteria | 2058 |
| 130 | Ga0070664_100394887 | 3300005564 | Bacteria | 1264 |
| 131 | Ga0070664_101195936 | 3300005564 | Bacteria | 717 |
| 132 | Ga0068857_100025397 | 3300005577 | Bacteria | 5217 |
| 133 | Ga0068857_100223663 | 3300005577 | Bacteria | 1720 |
| 134 | Ga0068857_100494946 | 3300005577 | Bacteria | 1147 |
| 135 | Ga0068854_100397014 | 3300005578 | Bacteria | 1140 |
| 136 | Ga0068854_100409245 | 3300005578 | Bacteria | 1124 |
| 137 | Ga0068854_100444079 | 3300005578 | Bacteria | 1082 |
| 138 | Ga0068856_100000020 | 3300005614 | Bacteria | 146775 |
| 139 | Ga0068856_100011174 | 3300005614 | Bacteria | 8717 |
| 140 | Ga0068856_100040177 | 3300005614 | Bacteria | 4594 |
| 141 | Ga0068856_100188037 | 3300005614 | Bacteria | 2079 |
| 142 | Ga0068856_100932901 | 3300005614 | Bacteria | 887 |
| 143 | Ga0070702_100128310 | 3300005615 | Bacteria | 1598 |
| 144 | Ga0070702_100482888 | 3300005615 | Bacteria | 906 |
| 145 | Ga0068852_100061971 | 3300005616 | Bacteria | 3251 |
| 146 | Ga0068852_100071443 | 3300005616 | Bacteria | 3048 |
| 147 | Ga0068852_100214457 | 3300005616 | Bacteria | 1828 |
| 148 | Ga0068852_100945521 | 3300005616 | Bacteria | 880 |
| 149 | Ga0068864_100112090 | 3300005618 | Bacteria | 2431 |
| 150 | Ga0068864_100149203 | 3300005618 | Bacteria | 2116 |
| 151 | Ga0068864_100303283 | 3300005618 | Bacteria | 1496 |
| 152 | Ga0068864_100386226 | 3300005618 | Bacteria | 1328 |
| 153 | Ga0068861_100042275 | 3300005719 | Bacteria | 3415 |
| 154 | Ga0068851_10001206 | 3300005834 | Bacteria | 11224 |
| 155 | Ga0068851_10853706 | 3300005834 | Bacteria | 568 |
| 156 | Ga0068870_10039043 | 3300005840 | Bacteria | 2455 |
| 157 | Ga0068863_100412187 | 3300005841 | Bacteria | 1323 |
| 158 | Ga0068858_100042777 | 3300005842 | Bacteria | 4200 |
| 159 | Ga0068858_100224211 | 3300005842 | Bacteria | 1781 |
| 160 | Ga0068858_100419664 | 3300005842 | Bacteria | 1287 |
| 161 | Ga0068858_100980137 | 3300005842 | Bacteria | 828 |
| 162 | Ga0068860_100124121 | 3300005843 | Bacteria | 2475 |
| 163 | Ga0068860_101088991 | 3300005843 | Bacteria | 818 |
| 164 | Ga0068862_100053763 | 3300005844 | Bacteria | 3447 |
| 165 | Ga0081455_10252274 | 3300005937 | Bacteria | 1290 |
| 166 | Ga0081540_1012299 | 3300005983 | Bacteria | 5648 |
| 167 | Ga0081540_1026137 | 3300005983 | Bacteria | 3340 |
| 168 | Ga0081540_1142344 | 3300005983 | Bacteria | 960 |
| 169 | Ga0070717_10002140 | 3300006028 | Bacteria | 13847 |
| 170 | Ga0070717_10005547 | 3300006028 | Bacteria | 9205 |
| 171 | Ga0070717_10022680 | 3300006028 | Bacteria | 4964 |
| 172 | Ga0070717_10255564 | 3300006028 | Bacteria | 1549 |
| 173 | Ga0070717_10278877 | 3300006028 | Bacteria | 1482 |
| 174 | Ga0070717_10459558 | 3300006028 | Bacteria | 1148 |
| 175 | Ga0075365_10082143 | 3300006038 | Bacteria | 2184 |
| 176 | Ga0075365_10082825 | 3300006038 | Bacteria | 2176 |
| 177 | Ga0075368_10056630 | 3300006042 | Bacteria | 1564 |
| 178 | Ga0075363_100050059 | 3300006048 | Bacteria | 2226 |
| 179 | Ga0075364_10136674 | 3300006051 | Bacteria | 1647 |
| 180 | Ga0070715_10001480 | 3300006163 | Bacteria | 6839 |
| 181 | Ga0070715_10094023 | 3300006163 | Bacteria | 1385 |
| 182 | Ga0070715_10293906 | 3300006163 | Bacteria | 866 |
| 183 | Ga0070716_100050844 | 3300006173 | Bacteria | 2354 |
| 184 | Ga0070716_100059369 | 3300006173 | Bacteria | 2205 |
| 185 | Ga0070716_100089790 | 3300006173 | Bacteria | 1857 |
| 186 | Ga0070716_100124803 | 3300006173 | Bacteria | 1618 |
| 187 | Ga0070716_100125300 | 3300006173 | Bacteria | 1615 |
| 188 | Ga0070716_100214089 | 3300006173 | Bacteria | 1290 |
| 189 | Ga0070716_100352250 | 3300006173 | Bacteria | 1042 |
| 190 | Ga0070716_100526190 | 3300006173 | Bacteria | 877 |
| 191 | Ga0070712_100021818 | 3300006175 | Bacteria | 4212 |
| 192 | Ga0070712_100055365 | 3300006175 | Bacteria | 2778 |
| 193 | Ga0070712_100065329 | 3300006175 | Bacteria | 2582 |
| 194 | Ga0070712_100237660 | 3300006175 | Bacteria | 1450 |
| 195 | Ga0070712_100386456 | 3300006175 | Bacteria | 1153 |
| 196 | Ga0070712_100491597 | 3300006175 | Bacteria | 1027 |
| 197 | Ga0070712_100795788 | 3300006175 | Bacteria | 811 |
| 198 | Ga0075367_10038655 | 3300006178 | Bacteria | 2779 |
| 199 | Ga0075367_10157989 | 3300006178 | Bacteria | 1409 |
| 200 | Ga0075366_10029987 | 3300006195 | Bacteria | 3196 |
| 201 | Ga0075366_10046408 | 3300006195 | Bacteria | 2574 |
| 202 | Ga0075366_10799967 | 3300006195 | Bacteria | 586 |
| 203 | Ga0097621_100582349 | 3300006237 | Bacteria | 1021 |
| 204 | Ga0075370_10024128 | 3300006353 | Bacteria | 3356 |
| 205 | Ga0075370_10074510 | 3300006353 | Bacteria | 1945 |
| 206 | Ga0075370_10149586 | 3300006353 | Bacteria | 1368 |
| 207 | Ga0068871_100065852 | 3300006358 | Bacteria | 2969 |
| 208 | Ga0068871_102131530 | 3300006358 | Bacteria | 534 |
| 209 | Ga0075434_100019249 | 3300006871 | Bacteria | 6604 |
| 210 | Ga0075434_100071223 | 3300006871 | Bacteria | 3468 |
| 211 | Ga0068865_100059487 | 3300006881 | Bacteria | 2672 |
| 212 | Ga0099825_1037663 | 3300006941 | Bacteria | 1585 |
| 213 | Ga0099824_1004403 | 3300006942 | Bacteria | 20285 |
| 214 | Ga0099822_1010345 | 3300006943 | Bacteria | 11581 |
| 215 | Ga0075435_100072236 | 3300007076 | Bacteria | 2819 |
| 216 | Ga0075435_100185678 | 3300007076 | Bacteria | 1758 |
| 217 | Ga0099794_10044069 | 3300007265 | Bacteria | 2131 |
| 218 | Ga0099794_10049659 | 3300007265 | Bacteria | 2016 |
| 219 | Ga0099794_10128070 | 3300007265 | Bacteria | 1281 |
| 220 | Ga0099794_10238940 | 3300007265 | Bacteria | 935 |
| 221 | Ga0099795_10028392 | 3300007788 | Bacteria | 1902 |
| 222 | Ga0099795_10056583 | 3300007788 | Bacteria | 1443 |
| 223 | Ga0099795_10082883 | 3300007788 | Bacteria | 1230 |
| 224 | Ga0105250_10113993 | 3300009092 | Bacteria | 1108 |
| 225 | Ga0105240_10011430 | 3300009093 | Bacteria | 12366 |
| 226 | Ga0105240_10033677 | 3300009093 | Bacteria | 6615 |
| 227 | Ga0105240_10041672 | 3300009093 | Bacteria | 5857 |
| 228 | Ga0105240_10174546 | 3300009093 | Bacteria | 2542 |
| 229 | Ga0105240_10434589 | 3300009093 | Bacteria | 1472 |
| 230 | Ga0105240_10435270 | 3300009093 | Bacteria | 1471 |
| 231 | Ga0105240_10723193 | 3300009093 | Bacteria | 1085 |
| 232 | Ga0105240_11621063 | 3300009093 | Bacteria | 677 |
| 233 | Ga0111539_10520252 | 3300009094 | Bacteria | 1386 |
| 234 | Ga0111539_12259434 | 3300009094 | Bacteria | 631 |
| 235 | Ga0105245_10010375 | 3300009098 | Bacteria | 8114 |
| 236 | Ga0105245_10041649 | 3300009098 | Bacteria | 4094 |
| 237 | Ga0105247_10024997 | 3300009101 | Bacteria | 3602 |
| 238 | Ga0105247_10052319 | 3300009101 | Bacteria | 2517 |
| 239 | Ga0105243_10953299 | 3300009148 | Bacteria | 857 |
| 240 | Ga0105241_10008992 | 3300009174 | Bacteria | 7346 |
| 241 | Ga0105241_10098436 | 3300009174 | Bacteria | 2321 |
| 242 | Ga0105241_10292561 | 3300009174 | Bacteria | 1395 |
| 243 | Ga0105242_10139312 | 3300009176 | Bacteria | 2103 |
| 244 | Ga0105248_10007295 | 3300009177 | Bacteria | 12130 |
| 245 | Ga0105248_10322149 | 3300009177 | Bacteria | 1741 |
| 246 | Ga0105248_10439338 | 3300009177 | Bacteria | 1470 |
| 247 | Ga0105248_10511467 | 3300009177 | Bacteria | 1354 |
| 248 | Ga0105237_10020611 | 3300009545 | Bacteria | 6793 |
| 249 | Ga0105237_10090787 | 3300009545 | Bacteria | 3044 |
| 250 | Ga0105237_10107427 | 3300009545 | Bacteria | 2783 |
| 251 | Ga0105237_10160216 | 3300009545 | Bacteria | 2248 |
| 252 | Ga0105237_10317087 | 3300009545 | Bacteria | 1562 |
| 253 | Ga0105237_10342056 | 3300009545 | Bacteria | 1500 |
| 254 | Ga0105237_10357241 | 3300009545 | Bacteria | 1465 |
| 255 | Ga0105237_10864703 | 3300009545 | Bacteria | 911 |
| 256 | Ga0105237_11127656 | 3300009545 | Bacteria | 791 |
| 257 | Ga0105237_11152515 | 3300009545 | Bacteria | 782 |
| 258 | Ga0105238_10002484 | 3300009551 | Bacteria | 18460 |
| 259 | Ga0105238_10010951 | 3300009551 | Bacteria | 9119 |
| 260 | Ga0105238_10080278 | 3300009551 | Bacteria | 3252 |
| 261 | Ga0105238_10125769 | 3300009551 | Bacteria | 2542 |
| 262 | Ga0105238_10132782 | 3300009551 | Bacteria | 2468 |
| 263 | Ga0105238_10167854 | 3300009551 | Bacteria | 2171 |
| 264 | Ga0105238_10192295 | 3300009551 | Bacteria | 2016 |
| 265 | Ga0105238_10301821 | 3300009551 | Bacteria | 1585 |
| 266 | Ga0105238_10498867 | 3300009551 | Bacteria | 1218 |
| 267 | Ga0105238_10619763 | 3300009551 | Bacteria | 1091 |
| 268 | Ga0105249_10283975 | 3300009553 | Bacteria | 1654 |
| 269 | Ga0099796_10012129 | 3300010159 | Bacteria | 2424 |
| 270 | Ga0099796_10023786 | 3300010159 | Bacteria | 1917 |
| 271 | Ga0099796_10057068 | 3300010159 | Bacteria | 1372 |
| 272 | Ga0105239_10046757 | 3300010375 | Bacteria | 4743 |
| 273 | Ga0105239_10053947 | 3300010375 | Bacteria | 4408 |
| 274 | Ga0105239_10069461 | 3300010375 | Bacteria | 3871 |
| 275 | Ga0105239_10150170 | 3300010375 | Bacteria | 2600 |
| 276 | Ga0105239_10215960 | 3300010375 | Bacteria | 2150 |
| 277 | Ga0105239_10400524 | 3300010375 | Bacteria | 1553 |
| 278 | Ga0105239_10473487 | 3300010375 | Bacteria | 1422 |
| 279 | Ga0105239_10521800 | 3300010375 | Bacteria | 1351 |
| 280 | Ga0105239_12028928 | 3300010375 | Bacteria | 668 |
| 281 | Ga0105246_10004587 | 3300011119 | Bacteria | 8412 |
| 282 | Ga0105246_10038703 | 3300011119 | Bacteria | 3208 |
| 283 | Ga0105246_10052688 | 3300011119 | Bacteria | 2797 |
| 284 | Ga0105246_10283331 | 3300011119 | Bacteria | 1330 |
| 285 | Ga0157373_10095005 | 3300013100 | Bacteria | 2098 |
| 286 | Ga0157371_10064333 | 3300013102 | Bacteria | 2599 |
| 287 | Ga0157370_10012436 | 3300013104 | Bacteria | 8824 |
| 288 | Ga0157370_10026797 | 3300013104 | Bacteria | 5686 |
| 289 | Ga0157370_10032211 | 3300013104 | Bacteria | 5120 |
| 290 | Ga0157370_10210884 | 3300013104 | Bacteria | 1800 |
| 291 | Ga0157370_10360975 | 3300013104 | Bacteria | 1339 |
| 292 | Ga0157369_10005811 | 3300013105 | Bacteria | 14344 |
| 293 | Ga0157369_10018574 | 3300013105 | Bacteria | 7794 |
| 294 | Ga0157369_10025441 | 3300013105 | Bacteria | 6573 |
| 295 | Ga0157369_10109029 | 3300013105 | Bacteria | 2944 |
| 296 | Ga0157369_10214507 | 3300013105 | Bacteria | 2016 |
| 297 | Ga0157369_10290556 | 3300013105 | Bacteria | 1702 |
| 298 | Ga0157369_11289808 | 3300013105 | Bacteria | 744 |
| 299 | Ga0157374_10007971 | 3300013296 | Bacteria | 9048 |
| 300 | Ga0157374_10025510 | 3300013296 | Bacteria | 5308 |
| 301 | Ga0157374_10073117 | 3300013296 | Bacteria | 3236 |
| 302 | Ga0157374_10497389 | 3300013296 | Bacteria | 1223 |
| 303 | Ga0157378_10077118 | 3300013297 | Bacteria | 3004 |
| 304 | Ga0163162_10110844 | 3300013306 | Bacteria | 2841 |
| 305 | Ga0163162_10139362 | 3300013306 | Bacteria | 2538 |
| 306 | Ga0163162_10294129 | 3300013306 | Bacteria | 1755 |
| 307 | Ga0163162_11131291 | 3300013306 | Bacteria | 888 |
| 308 | Ga0163162_11431088 | 3300013306 | Bacteria | 787 |
| 309 | Ga0163162_11514511 | 3300013306 | Bacteria | 764 |
| 310 | Ga0157372_10045854 | 3300013307 | Bacteria | 4851 |
| 311 | Ga0157372_10059405 | 3300013307 | Bacteria | 4276 |
| 312 | Ga0157372_10258661 | 3300013307 | Bacteria | 2021 |
| 313 | Ga0157372_10785701 | 3300013307 | Bacteria | 1106 |
| 314 | Ga0157372_10864100 | 3300013307 | Bacteria | 1050 |
| 315 | Ga0157372_11712331 | 3300013307 | Unclassified | 723 |
| 316 | Ga0157375_10009619 | 3300013308 | Bacteria | 8494 |
| 317 | Ga0157375_10420774 | 3300013308 | Bacteria | 1502 |
| 318 | Ga0163163_10046523 | 3300014325 | Bacteria | 4262 |
| 319 | Ga0163163_10060622 | 3300014325 | Bacteria | 3747 |
| 320 | Ga0157380_10116271 | 3300014326 | Bacteria | 2257 |
| 321 | Ga0157377_10075301 | 3300014745 | Bacteria | 1960 |
| 322 | Ga0157377_10303368 | 3300014745 | Bacteria | 1055 |
| 323 | Ga0157379_10039979 | 3300014968 | Bacteria | 4185 |
| 324 | Ga0157379_10261564 | 3300014968 | Bacteria | 1572 |
| 325 | Ga0157379_10450416 | 3300014968 | Bacteria | 1188 |
| 326 | Ga0157376_10048036 | 3300014969 | Bacteria | 3527 |
| 327 | Ga0157376_10272345 | 3300014969 | Bacteria | 1591 |
| 328 | Ga0163161_10395348 | 3300017792 | Bacteria | 1107 |
| 329 | Ga0206353_10729202 | 3300020082 | Bacteria | 661 |
| 330 | Ga0154015_1684958 | 3300020610 | Bacteria | 1106 |
| 331 | Ga0213873_10016491 | 3300021358 | Bacteria | 1671 |
| 332 | Ga0213872_10077681 | 3300021361 | Bacteria | 1492 |
| 333 | Ga0213876_10048362 | 3300021384 | Bacteria | 2247 |
| 334 | Ga0213876_10100808 | 3300021384 | Bacteria | 1531 |
| 335 | Ga0213875_10069571 | 3300021388 | Bacteria | 1644 |
| 336 | Ga0213871_10024691 | 3300021441 | Bacteria | 1524 |
| 337 | Ga0224712_10160059 | 3300022467 | Bacteria | 1003 |
| 338 | Ga0209677_103424 | 3300025253 | Bacteria | 5171 |
| 339 | Ga0209148_1007368 | 3300025254 | Bacteria | 2293 |
| 340 | Ga0209233_1003510 | 3300025261 | Bacteria | 5511 |
| 341 | Ga0209233_1004457 | 3300025261 | Bacteria | 4759 |
| 342 | Ga0209455_1004847 | 3300025272 | Bacteria | 4291 |
| 343 | Ga0209455_1011161 | 3300025272 | Bacteria | 2230 |
| 344 | Ga0209758_1003593 | 3300025297 | Bacteria | 13872 |
| 345 | Ga0207656_10001137 | 3300025321 | Bacteria | 8748 |
| 346 | Ga0207692_10055141 | 3300025898 | Bacteria | 2033 |
| 347 | Ga0207692_10083372 | 3300025898 | Bacteria | 1715 |
| 348 | Ga0207692_10121321 | 3300025898 | Bacteria | 1464 |
| 349 | Ga0207692_10194240 | 3300025898 | Bacteria | 1190 |
| 350 | Ga0207692_10240782 | 3300025898 | Bacteria | 1080 |
| 351 | Ga0207692_10511720 | 3300025898 | Bacteria | 763 |
| 352 | Ga0207710_10026452 | 3300025900 | Bacteria | 2508 |
| 353 | Ga0207710_10227818 | 3300025900 | Bacteria | 927 |
| 354 | Ga0207688_10021898 | 3300025901 | Bacteria | 3495 |
| 355 | Ga0207688_10037540 | 3300025901 | Bacteria | 2687 |
| 356 | Ga0207647_10043784 | 3300025904 | Bacteria | 2799 |
| 357 | Ga0207647_10135717 | 3300025904 | Bacteria | 1444 |
| 358 | Ga0207647_10141574 | 3300025904 | Bacteria | 1409 |
| 359 | Ga0207647_10235786 | 3300025904 | Bacteria | 1052 |
| 360 | Ga0207685_10088570 | 3300025905 | Bacteria | 1298 |
| 361 | Ga0207685_10212952 | 3300025905 | Bacteria | 915 |
| 362 | Ga0207685_10310783 | 3300025905 | Bacteria | 783 |
| 363 | Ga0207699_10002259 | 3300025906 | Bacteria | 9092 |
| 364 | Ga0207699_10003128 | 3300025906 | Bacteria | 7862 |
| 365 | Ga0207699_10007908 | 3300025906 | Bacteria | 5218 |
| 366 | Ga0207699_10017498 | 3300025906 | Bacteria | 3775 |
| 367 | Ga0207699_10205233 | 3300025906 | Bacteria | 1338 |
| 368 | Ga0207699_10347888 | 3300025906 | Bacteria | 1046 |
| 369 | Ga0207699_10901810 | 3300025906 | Bacteria | 652 |
| 370 | Ga0207705_10080181 | 3300025909 | Bacteria | 2378 |
| 371 | Ga0207705_10096802 | 3300025909 | Bacteria | 2167 |
| 372 | Ga0207705_10136991 | 3300025909 | Bacteria | 1826 |
| 373 | Ga0207705_10470212 | 3300025909 | Bacteria | 976 |
| 374 | Ga0207684_10017435 | 3300025910 | Bacteria | 6160 |
| 375 | Ga0207684_10289773 | 3300025910 | Bacteria | 1412 |
| 376 | Ga0207684_10612818 | 3300025910 | Bacteria | 929 |
| 377 | Ga0207684_11274979 | 3300025910 | Bacteria | 606 |
| 378 | Ga0207654_10015391 | 3300025911 | Bacteria | 3970 |
| 379 | Ga0207654_10493473 | 3300025911 | Bacteria | 864 |
| 380 | Ga0207707_10000359 | 3300025912 | Bacteria | 47942 |
| 381 | Ga0207707_10010747 | 3300025912 | Bacteria | 7954 |
| 382 | Ga0207707_10030608 | 3300025912 | Bacteria | 4709 |
| 383 | Ga0207707_10112286 | 3300025912 | Bacteria | 2382 |
| 384 | Ga0207707_10427986 | 3300025912 | Bacteria | 1134 |
| 385 | Ga0207707_10669275 | 3300025912 | Bacteria | 874 |
| 386 | Ga0207695_10015120 | 3300025913 | Bacteria | 9105 |
| 387 | Ga0207695_10042841 | 3300025913 | Bacteria | 4829 |
| 388 | Ga0207695_10096157 | 3300025913 | Bacteria | 2964 |
| 389 | Ga0207695_10996786 | 3300025913 | Bacteria | 717 |
| 390 | Ga0207695_11225365 | 3300025913 | Bacteria | 631 |
| 391 | Ga0207671_10065375 | 3300025914 | Bacteria | 2705 |
| 392 | Ga0207671_10242009 | 3300025914 | Bacteria | 1417 |
| 393 | Ga0207671_10272611 | 3300025914 | Bacteria | 1333 |
| 394 | Ga0207671_10746561 | 3300025914 | Bacteria | 777 |
| 395 | Ga0207671_11028289 | 3300025914 | Bacteria | 649 |
| 396 | Ga0207693_10000581 | 3300025915 | Bacteria | 32715 |
| 397 | Ga0207693_10003453 | 3300025915 | Bacteria | 13483 |
| 398 | Ga0207693_10009635 | 3300025915 | Bacteria | 7866 |
| 399 | Ga0207693_10111900 | 3300025915 | Bacteria | 2141 |
| 400 | Ga0207693_10253283 | 3300025915 | Bacteria | 1381 |
| 401 | Ga0207693_10270756 | 3300025915 | Bacteria | 1331 |
| 402 | Ga0207663_10000084 | 3300025916 | Bacteria | 44454 |
| 403 | Ga0207663_10008412 | 3300025916 | Bacteria | 5392 |
| 404 | Ga0207663_10054543 | 3300025916 | Bacteria | 2503 |
| 405 | Ga0207663_10137659 | 3300025916 | Bacteria | 1697 |
| 406 | Ga0207660_10008448 | 3300025917 | Bacteria | 6659 |
| 407 | Ga0207660_10022333 | 3300025917 | Bacteria | 4263 |
| 408 | Ga0207660_10045743 | 3300025917 | Bacteria | 3085 |
| 409 | Ga0207660_10056652 | 3300025917 | Bacteria | 2805 |
| 410 | Ga0207660_10094596 | 3300025917 | Bacteria | 2221 |
| 411 | Ga0207660_10229577 | 3300025917 | Bacteria | 1459 |
| 412 | Ga0207660_10608780 | 3300025917 | Bacteria | 890 |
| 413 | Ga0207660_10645139 | 3300025917 | Bacteria | 863 |
| 414 | Ga0207657_10007612 | 3300025919 | Bacteria | 11085 |
| 415 | Ga0207657_10050134 | 3300025919 | Bacteria | 3634 |
| 416 | Ga0207649_10088873 | 3300025920 | Bacteria | 2018 |
| 417 | Ga0207649_10631680 | 3300025920 | Bacteria | 826 |
| 418 | Ga0207649_10926056 | 3300025920 | Bacteria | 684 |
| 419 | Ga0207652_10001857 | 3300025921 | Bacteria | 18344 |
| 420 | Ga0207652_10018612 | 3300025921 | Bacteria | 5698 |
| 421 | Ga0207652_10222393 | 3300025921 | Bacteria | 1701 |
| 422 | Ga0207652_10612405 | 3300025921 | Bacteria | 976 |
| 423 | Ga0207652_10864530 | 3300025921 | Bacteria | 800 |
| 424 | Ga0207652_11072876 | 3300025921 | Bacteria | 705 |
| 425 | Ga0207652_11161666 | 3300025921 | Bacteria | 673 |
| 426 | Ga0207694_10008673 | 3300025924 | Bacteria | 7674 |
| 427 | Ga0207694_10050805 | 3300025924 | Bacteria | 3213 |
| 428 | Ga0207694_10297841 | 3300025924 | Bacteria | 1327 |
| 429 | Ga0207694_10306093 | 3300025924 | Bacteria | 1309 |
| 430 | Ga0207694_10539356 | 3300025924 | Bacteria | 979 |
| 431 | Ga0207694_10555686 | 3300025924 | Bacteria | 964 |
| 432 | Ga0207687_10061184 | 3300025927 | Bacteria | 2658 |
| 433 | Ga0207687_10399768 | 3300025927 | Bacteria | 1130 |
| 434 | Ga0207700_10002181 | 3300025928 | Bacteria | 11224 |
| 435 | Ga0207700_10002410 | 3300025928 | Bacteria | 10739 |
| 436 | Ga0207700_10011068 | 3300025928 | Bacteria | 5735 |
| 437 | Ga0207700_10102508 | 3300025928 | Bacteria | 2286 |
| 438 | Ga0207700_10321622 | 3300025928 | Bacteria | 1341 |
| 439 | Ga0207700_10422071 | 3300025928 | Bacteria | 1172 |
| 440 | Ga0207700_11274261 | 3300025928 | Bacteria | 655 |
| 441 | Ga0207664_10033743 | 3300025929 | Bacteria | 3936 |
| 442 | Ga0207664_10446567 | 3300025929 | Bacteria | 1154 |
| 443 | Ga0207664_10776847 | 3300025929 | Bacteria | 862 |
| 444 | Ga0207644_10211660 | 3300025931 | Bacteria | 1533 |
| 445 | Ga0207644_10414897 | 3300025931 | Bacteria | 1102 |
| 446 | Ga0207644_10915142 | 3300025931 | Bacteria | 735 |
| 447 | Ga0207690_10165092 | 3300025932 | Bacteria | 1654 |
| 448 | Ga0207690_10186365 | 3300025932 | Bacteria | 1566 |
| 449 | Ga0207690_10535873 | 3300025932 | Bacteria | 950 |
| 450 | Ga0207706_10071983 | 3300025933 | Bacteria | 3041 |
| 451 | Ga0207686_10418701 | 3300025934 | Bacteria | 1024 |
| 452 | Ga0207709_10191202 | 3300025935 | Bacteria | 1454 |
| 453 | Ga0207704_10492411 | 3300025938 | Bacteria | 986 |
| 454 | Ga0207665_10001451 | 3300025939 | Bacteria | 15944 |
| 455 | Ga0207665_10019859 | 3300025939 | Bacteria | 4415 |
| 456 | Ga0207665_10021271 | 3300025939 | Bacteria | 4265 |
| 457 | Ga0207665_10254343 | 3300025939 | Bacteria | 1299 |
| 458 | Ga0207711_10045435 | 3300025941 | Bacteria | 3753 |
| 459 | Ga0207689_10030221 | 3300025942 | Bacteria | 4515 |
| 460 | Ga0207661_10001574 | 3300025944 | Bacteria | 15528 |
| 461 | Ga0207661_10045131 | 3300025944 | Bacteria | 3486 |
| 462 | Ga0207661_10787835 | 3300025944 | Bacteria | 875 |
| 463 | Ga0207679_10256663 | 3300025945 | Bacteria | 1489 |
| 464 | Ga0207679_10434123 | 3300025945 | Bacteria | 1162 |
| 465 | Ga0207679_10570800 | 3300025945 | Bacteria | 1017 |
| 466 | Ga0207667_10011919 | 3300025949 | Bacteria | 10067 |
| 467 | Ga0207667_10107180 | 3300025949 | Bacteria | 2882 |
| 468 | Ga0207667_10291724 | 3300025949 | Bacteria | 1666 |
| 469 | Ga0207667_10380094 | 3300025949 | Bacteria | 1439 |
| 470 | Ga0207667_10936257 | 3300025949 | Bacteria | 856 |
| 471 | Ga0207651_10085394 | 3300025960 | Bacteria | 2290 |
| 472 | Ga0207712_10360888 | 3300025961 | Bacteria | 1210 |
| 473 | Ga0207640_10569046 | 3300025981 | Bacteria | 955 |
| 474 | Ga0207640_11252382 | 3300025981 | Bacteria | 661 |
| 475 | Ga0207658_11469893 | 3300025986 | Bacteria | 623 |
| 476 | Ga0207677_10017270 | 3300026023 | Bacteria | 4297 |
| 477 | Ga0207677_10620284 | 3300026023 | Bacteria | 951 |
| 478 | Ga0207703_10152408 | 3300026035 | Bacteria | 2017 |
| 479 | Ga0207703_11449680 | 3300026035 | Bacteria | 660 |
| 480 | Ga0207639_10075879 | 3300026041 | Bacteria | 2645 |
| 481 | Ga0207639_10082509 | 3300026041 | Bacteria | 2548 |
| 482 | Ga0207639_10127196 | 3300026041 | Bacteria | 2103 |
| 483 | Ga0207639_10221216 | 3300026041 | Bacteria | 1635 |
| 484 | Ga0207639_10465652 | 3300026041 | Bacteria | 1150 |
| 485 | Ga0207639_10551835 | 3300026041 | Bacteria | 1058 |
| 486 | Ga0207678_10013512 | 3300026067 | Bacteria | 7169 |
| 487 | Ga0207678_10021128 | 3300026067 | Bacteria | 5705 |
| 488 | Ga0207678_10057693 | 3300026067 | Bacteria | 3341 |
| 489 | Ga0207678_10073418 | 3300026067 | Bacteria | 2931 |
| 490 | Ga0207678_10460350 | 3300026067 | Bacteria | 1106 |
| 491 | Ga0207678_10877321 | 3300026067 | Bacteria | 793 |
| 492 | Ga0207678_11134638 | 3300026067 | Bacteria | 692 |
| 493 | Ga0207702_10000126 | 3300026078 | Bacteria | 90550 |
| 494 | Ga0207702_10025939 | 3300026078 | Bacteria | 4866 |
| 495 | Ga0207702_10103752 | 3300026078 | Bacteria | 2515 |
| 496 | Ga0207702_10139175 | 3300026078 | Bacteria | 2194 |
| 497 | Ga0207702_10740032 | 3300026078 | Bacteria | 970 |
| 498 | Ga0207676_10126359 | 3300026095 | Bacteria | 2166 |
| 499 | Ga0207676_10137279 | 3300026095 | Bacteria | 2088 |
| 500 | Ga0207676_10336260 | 3300026095 | Bacteria | 1391 |
| 501 | Ga0207676_11022194 | 3300026095 | Bacteria | 815 |
| 502 | Ga0207674_10047527 | 3300026116 | Bacteria | 4398 |
| 503 | Ga0207674_11577883 | 3300026116 | Bacteria | 625 |
| 504 | Ga0207675_100053776 | 3300026118 | Bacteria | 3756 |
| 505 | Ga0207683_10027970 | 3300026121 | Bacteria | 4873 |
| 506 | Ga0207683_10098624 | 3300026121 | Bacteria | 2607 |
| 507 | Ga0207683_10222039 | 3300026121 | Bacteria | 1722 |
| 508 | Ga0207698_10016536 | 3300026142 | Bacteria | 4976 |
| 509 | Ga0207698_10115167 | 3300026142 | Bacteria | 2263 |
| 510 | Ga0207698_10378503 | 3300026142 | Bacteria | 1346 |
| 511 | Ga0207698_10512444 | 3300026142 | Bacteria | 1169 |
| 512 | Ga0207698_11083948 | 3300026142 | Bacteria | 813 |
| 513 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 514 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 515 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 516 | Ga0209179_1029993 | 3300027512 | Bacteria | 1110 |
| 517 | Ga0209813_10016059 | 3300027866 | Bacteria | 2038 |
| 518 | Ga0209813_10046909 | 3300027866 | Bacteria | 1336 |
| 519 | Ga0268266_10044743 | 3300028379 | Bacteria | 3784 |
| 520 | Ga0268266_10068095 | 3300028379 | Bacteria | 3082 |
| 521 | Ga0268266_10233579 | 3300028379 | Bacteria | 1694 |
| 522 | Ga0268264_10026839 | 3300028381 | Bacteria | 4705 |
| 523 | Ga0265337_1065525 | 3300028556 | Bacteria | 1002 |
| 524 | Ga0265319_1023466 | 3300028563 | Bacteria | 2236 |
| 525 | Ga0265334_10001652 | 3300028573 | Bacteria | 10680 |
| 526 | Ga0265323_10001443 | 3300028653 | Bacteria | 11682 |
| 527 | Ga0265322_10039901 | 3300028654 | Bacteria | 1336 |
| 528 | Ga0265336_10000335 | 3300028666 | Bacteria | 31241 |
| 529 | Ga0265338_10000321 | 3300028800 | Bacteria | 87046 |
| 530 | Ga0265324_10015723 | 3300029957 | Bacteria | 2779 |
| 531 | Ga0265763_1002214 | 3300030763 | Bacteria | 1473 |
| 532 | Ga0265330_10057434 | 3300031235 | Bacteria | 1697 |
| 533 | Ga0265330_10116879 | 3300031235 | Bacteria | 1137 |
| 534 | Ga0265332_10040278 | 3300031238 | Bacteria | 2023 |
| 535 | Ga0265332_10043920 | 3300031238 | Bacteria | 1928 |
| 536 | Ga0265328_10039897 | 3300031239 | Bacteria | 1731 |
| 537 | Ga0265325_10002843 | 3300031241 | Bacteria | 11545 |
| 538 | Ga0265340_10125235 | 3300031247 | Bacteria | 1181 |
| 539 | Ga0265339_10009656 | 3300031249 | Bacteria | 6042 |
| 540 | Ga0265339_10137109 | 3300031249 | Bacteria | 1247 |
| 541 | Ga0265331_10094541 | 3300031250 | Bacteria | 1380 |
| 542 | Ga0265331_10185792 | 3300031250 | Bacteria | 938 |
| 543 | Ga0265331_10234461 | 3300031250 | Bacteria | 824 |
| 544 | Ga0265316_10357857 | 3300031344 | Bacteria | 1056 |
| 545 | Ga0265316_10373207 | 3300031344 | Bacteria | 1030 |
| 546 | Ga0265313_10220810 | 3300031595 | Bacteria | 782 |
| 547 | Ga0307508_10180419 | 3300031616 | Bacteria | 1714 |
| 548 | Ga0265314_10058323 | 3300031711 | Bacteria | 2646 |
| 549 | Ga0265314_10412105 | 3300031711 | Bacteria | 728 |
| 550 | Ga0265342_10015861 | 3300031712 | Bacteria | 4941 |
| 551 | Ga0265342_10028907 | 3300031712 | Bacteria | 3447 |
| 552 | Ga0265342_10035732 | 3300031712 | Bacteria | 3039 |
| 553 | Ga0265342_10413998 | 3300031712 | Bacteria | 695 |
| 554 | Ga0307411_10257060 | 3300032005 | Bacteria | 1377 |
| 555 | Ga0307510_10159803 | 3300033180 | Bacteria | 1852 |
| 556 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 557 | Ga0316215_1001093 | 3300033544 | Bacteria | 2632 |
| 558 | Ga0373926_0078379 | 3300035083 | Bacteria | 1219 |
| 559 | Ga0373934_0018616 | 3300035086 | Bacteria | 2658 |
| 560 | Ga0373934_0026167 | 3300035086 | Bacteria | 2263 |
| 561 | Ga0373944_0035380 | 3300035089 | Bacteria | 1522 |
| 562 | Ga0373951_0252775 | 3300035091 | Bacteria | 530 |
| 563 | Ga0373923_0013083 | 3300035111 | Bacteria | 3085 |
| 564 | Ga0373923_0037693 | 3300035111 | Bacteria | 1979 |
| 565 | Ga0373923_0113651 | 3300035111 | Bacteria | 1204 |
| 566 | Ga0373936_0020273 | 3300035113 | Bacteria | 2582 |
| 567 | Ga0373936_0094888 | 3300035113 | Bacteria | 1254 |
| 568 | Ga0373936_0237573 | 3300035113 | Bacteria | 812 |
| 569 | Ga0373945_0053527 | 3300035116 | Bacteria | 1490 |
| 570 | Ga0373953_0005987 | 3300035117 | Bacteria | 3982 |
| 571 | Ga0373953_0010843 | 3300035117 | Bacteria | 3183 |
| 572 | Ga0373954_0077813 | 3300035118 | Bacteria | 1582 |
| 573 | Ga0373954_0135759 | 3300035118 | Bacteria | 1199 |
| 574 | Ga0373954_0168732 | 3300035118 | Bacteria | 1071 |
| 575 | Ga0373956_0012101 | 3300035119 | Bacteria | 3569 |
| 576 | Ga0373956_0036736 | 3300035119 | Bacteria | 2163 |
| 577 | Ga0373957_0002003 | 3300035120 | Bacteria | 5692 |
| 578 | Ga0373957_0099043 | 3300035120 | Bacteria | 1165 |
| 579 | Ga0373957_0316845 | 3300035120 | Bacteria | 663 |
| 580 | Ga0373957_0340537 | 3300035120 | Bacteria | 639 |
| 581 | Ga0373943_0047895 | 3300035170 | Bacteria | 2092 |
| 582 | Ga0373943_0121655 | 3300035170 | Bacteria | 1387 |
| 583 | Ga0373943_0163581 | 3300035170 | Bacteria | 1213 |
| 584 | Ga0373946_0000984 | 3300035171 | Bacteria | 9775 |
| 585 | Ga0373946_0207549 | 3300035171 | Bacteria | 941 |
| 586 | Ga0373946_0216540 | 3300035171 | Bacteria | 923 |
| 587 | Ga0373955_0002892 | 3300035172 | Bacteria | 7530 |
| 588 | Ga0373955_0021151 | 3300035172 | Bacteria | 3279 |
| 589 | Ga0373955_0067026 | 3300035172 | Bacteria | 1997 |
| 590 | Ga0373955_0177046 | 3300035172 | Bacteria | 1264 |
| 591 | Ga0373924_0006496 | 3300035410 | Bacteria | 4190 |
| 592 | Ga0373924_0034130 | 3300035410 | Bacteria | 2058 |
| 593 | Ga0373935_0000769 | 3300035692 | Bacteria | 17055 |
| 594 | Ga0373935_0134841 | 3300035692 | Bacteria | 1662 |
| 595 | Ga0373935_0199476 | 3300035692 | Bacteria | 1382 |
| 596 | Ga0373935_0523742 | 3300035692 | Bacteria | 862 |
| 597 | Ga0373935_0701895 | 3300035692 | Bacteria | 744 |
| 598 | Ga0373927_0002152 | 3300035695 | Bacteria | 14490 |
| 599 | Ga0373927_0006718 | 3300035695 | Bacteria | 7829 |
| 600 | Ga0373927_0069075 | 3300035695 | Bacteria | 2286 |
| 601 | Ga0373927_0076271 | 3300035695 | Bacteria | 2171 |
| 602 | Ga0373933_0003725 | 3300035724 | Bacteria | 8427 |
| 603 | Ga0373933_0012105 | 3300035724 | Bacteria | 4763 |
| 604 | Ga0373933_0024995 | 3300035724 | Bacteria | 3422 |
| 605 | Ga0373933_0110694 | 3300035724 | Bacteria | 1713 |
| 606 | Ga0373947_0002495 | 3300035725 | Bacteria | 11059 |
| 607 | Ga0373947_0013965 | 3300035725 | Bacteria | 4603 |
| 608 | Ga0373947_0058241 | 3300035725 | Bacteria | 2341 |
| 609 | Ga0373947_0452871 | 3300035725 | Bacteria | 869 |
| 610 | Ga0373937_0044375 | 3300036401 | Bacteria | 4060 |
| 611 | Ga0373937_0059943 | 3300036401 | Bacteria | 3498 |
| 612 | Ga0373937_0080055 | 3300036401 | Bacteria | 3020 |
| 613 | Ga0373937_0082618 | 3300036401 | Bacteria | 2972 |
| 614 | Ga0373937_0120382 | 3300036401 | Bacteria | 2446 |
| 615 | Ga0373937_0335947 | 3300036401 | Bacteria | 1430 |
| 616 | Ga0373937_0800747 | 3300036401 | Bacteria | 890 |
| 617 | Ga0373937_0856007 | 3300036401 | Bacteria | 857 |
| 618 | Ga0373937_0890770 | 3300036401 | Bacteria | 839 |
| 619 | Ga0372808_032717 | 3300036459 | Bacteria | 745 |
| 620 | Ga0372808_049697 | 3300036459 | Bacteria | 600 |
| 621 | Ga0373925_0014642 | 3300037068 | Bacteria | 5666 |
| 622 | Ga0373925_0017659 | 3300037068 | Bacteria | 5177 |
| 623 | Ga0373925_0055417 | 3300037068 | Bacteria | 2968 |
| 624 | Ga0373925_0086872 | 3300037068 | Bacteria | 2387 |
| 625 | Ga0373925_0555204 | 3300037068 | Bacteria | 945 |
| 626 | Ga0395899_0096351 | 3300037312 | Bacteria | 2139 |
| 627 | Ga0395899_0482062 | 3300037312 | Bacteria | 807 |
| 628 | Ga0395900_0036594 | 3300037418 | Bacteria | 5060 |
| 629 | Ga0395900_0264443 | 3300037418 | Bacteria | 1717 |
| 630 | Ga0395900_0281373 | 3300037418 | Bacteria | 1655 |
| 631 | Ga0395900_1214395 | 3300037418 | Bacteria | 669 |
| 632 | Ga0395898_0183739 | 3300037466 | Bacteria | 1998 |
| 633 | Ga0395898_0656312 | 3300037466 | Bacteria | 991 |
| 634 | Ga0395905_0345101 | 3300037471 | Bacteria | 1380 |
| 635 | Ga0395905_0737023 | 3300037471 | Bacteria | 888 |
| 636 | Ga0436364_1238755 | 3300037853 | Bacteria | 753 |
| 637 | Ga0436364_1440766 | 3300037853 | Bacteria | 6579 |
| 638 | Ga0395901_0102630 | 3300038443 | Bacteria | 3002 |
| 639 | Ga0395901_0302042 | 3300038443 | Bacteria | 1659 |
| 640 | Ga0395901_0419125 | 3300038443 | Bacteria | 1373 |
| 641 | Ga0395901_0920692 | 3300038443 | Bacteria | 855 |
| 642 | Ga0395901_1317682 | 3300038443 | Bacteria | 683 |
| 643 | Ga0436365_0055150 | 3300039437 | Bacteria | 2567 |
| 644 | Ga0436365_0154445 | 3300039437 | Bacteria | 696 |
| 645 | Ga0436365_0274379 | 3300039437 | Bacteria | 583 |
| 646 | Ga0436365_0278773 | 3300039437 | Bacteria | 2566 |
| 647 | Ga0436365_1321630 | 3300039437 | Bacteria | 1503 |
| 648 | Ga0436365_1533174 | 3300039437 | Bacteria | 1485 |
| 649 | Ga0436365_1596305 | 3300039437 | Bacteria | 1698 |
| 650 | Ga0436365_1698216 | 3300039437 | Bacteria | 1190 |
| 651 | Ga0436360_0359314 | 3300039438 | Bacteria | 873 |
| 652 | Ga0436360_0858327 | 3300039438 | Bacteria | 3331 |
| 653 | Ga0436361_0402608 | 3300039447 | Bacteria | 4986 |
| 654 | Ga0436361_0499397 | 3300039447 | Bacteria | 571 |
| 655 | Ga0436361_1046855 | 3300039447 | Bacteria | 2558 |
| 656 | Ga0436361_1055508 | 3300039447 | Bacteria | 1139 |
| 657 | Ga0436363_1424999 | 3300039450 | Bacteria | 11027 |
| 658 | Ga0436363_1654142 | 3300039450 | Bacteria | 1203 |
| 659 | Ga0436362_1037639 | 3300039453 | Bacteria | 1622 |
| 660 | Ga0451853_1110420 | 3300041512 | Bacteria | 1116 |
| 661 | Ga0439448_0197900 | 3300042005 | Bacteria | 704 |
| 662 | Ga0466969_0316039 | 3300044656 | Bacteria | 707 |
| 663 | Ga0466969_0354856 | 3300044656 | Bacteria | 664 |
| 664 | Ga0466966_0040049 | 3300044684 | Bacteria | 3016 |
| 665 | Ga0466966_0142565 | 3300044684 | Bacteria | 1464 |
| 666 | Ga0466966_0183123 | 3300044684 | Bacteria | 1271 |
| 667 | Ga0466961_0400694 | 3300044693 | Bacteria | 833 |
| 668 | Ga0466963_0052524 | 3300044694 | Bacteria | 2705 |
| 669 | Ga0466963_0254548 | 3300044694 | Bacteria | 1232 |
| 670 | Ga0466963_1117532 | 3300044694 | Bacteria | 554 |
| 671 | Ga0466964_0186039 | 3300044706 | Bacteria | 988 |
| 672 | Ga0466968_0479476 | 3300044735 | Bacteria | 618 |
| 673 | Ga0466957_0096028 | 3300044842 | Bacteria | 1862 |
| 674 | Ga0466957_0736790 | 3300044842 | Bacteria | 697 |
| 675 | Ga0466959_0075500 | 3300045049 | Bacteria | 2435 |
| 676 | Ga0466959_0079916 | 3300045049 | Bacteria | 2358 |
| 677 | Ga0466959_0213534 | 3300045049 | Bacteria | 1340 |
| 678 | Ga0466959_0216292 | 3300045049 | Bacteria | 1330 |
| 679 | Ga0466967_0132208 | 3300045976 | Bacteria | 2318 |
| 680 | Ga0466967_0150124 | 3300045976 | Bacteria | 2177 |
| 681 | Ga0466967_0151199 | 3300045976 | Bacteria | 2170 |
| 682 | Ga0466967_0228449 | 3300045976 | Bacteria | 1771 |
| 683 | Ga0495592_0021600 | 3300046454 | Bacteria | 4896 |
| 684 | Ga0495592_0029228 | 3300046454 | Bacteria | 4174 |
| 685 | Ga0495592_0031028 | 3300046454 | Bacteria | 4041 |
| 686 | Ga0495592_0182524 | 3300046454 | Bacteria | 1428 |
| 687 | Ga0495603_0000191 | 3300046455 | Bacteria | 32052 |
| 688 | Ga0495603_0027330 | 3300046455 | Bacteria | 3445 |
| 689 | Ga0495590_0207442 | 3300046457 | Bacteria | 721 |
| 690 | Ga0495629_0000500 | 3300046459 | Bacteria | 32861 |
| 691 | Ga0495629_0324696 | 3300046459 | Bacteria | 1052 |
| 692 | Ga0495629_0372715 | 3300046459 | Bacteria | 972 |
| 693 | Ga0495638_0048758 | 3300046460 | Bacteria | 2650 |
| 694 | Ga0495641_0001436 | 3300046461 | Bacteria | 20225 |
| 695 | Ga0495641_0458131 | 3300046461 | Bacteria | 580 |
| 696 | Ga0495651_0124135 | 3300046462 | Bacteria | 1892 |
| 697 | Ga0495651_0143760 | 3300046462 | Bacteria | 1726 |
| 698 | Ga0495651_0273396 | 3300046462 | Bacteria | 1145 |
| 699 | Ga0495653_0003914 | 3300046463 | Bacteria | 12039 |
| 700 | Ga0495653_0036033 | 3300046463 | Bacteria | 3900 |
| 701 | Ga0495580_0003014 | 3300046472 | Bacteria | 14436 |
| 702 | Ga0495580_0025302 | 3300046472 | Bacteria | 4339 |
| 703 | Ga0495580_0165342 | 3300046472 | Bacteria | 1530 |
| 704 | Ga0495582_0000251 | 3300046473 | Bacteria | 29816 |
| 705 | Ga0495639_0000077 | 3300046475 | Bacteria | 46394 |
| 706 | Ga0495639_0266462 | 3300046475 | Bacteria | 849 |
| 707 | Ga0495664_0052529 | 3300046477 | Bacteria | 2422 |
| 708 | Ga0495664_0055406 | 3300046477 | Bacteria | 2359 |
| 709 | Ga0495664_0066459 | 3300046477 | Bacteria | 2150 |
| 710 | Ga0495664_0070146 | 3300046477 | Bacteria | 2092 |
| 711 | Ga0495664_0106235 | 3300046477 | Bacteria | 1693 |
| 712 | Ga0495664_0220896 | 3300046477 | Bacteria | 1147 |
| 713 | Ga0495664_0244929 | 3300046477 | Bacteria | 1084 |
| 714 | Ga0495594_0000938 | 3300046499 | Bacteria | 15112 |
| 715 | Ga0495594_0537971 | 3300046499 | Bacteria | 663 |
| 716 | Ga0495596_0251580 | 3300046500 | Bacteria | 686 |
| 717 | Ga0495606_0089210 | 3300046507 | Bacteria | 1900 |
| 718 | Ga0495606_0198576 | 3300046507 | Bacteria | 1145 |
| 719 | Ga0495608_0009143 | 3300046511 | Bacteria | 6926 |
| 720 | Ga0495608_0224479 | 3300046511 | Bacteria | 1177 |
| 721 | Ga0495610_0067508 | 3300046512 | Bacteria | 1680 |
| 722 | Ga0495616_0094447 | 3300046513 | Bacteria | 1411 |
| 723 | Ga0495618_0020218 | 3300046514 | Bacteria | 4100 |
| 724 | Ga0495618_0154405 | 3300046514 | Bacteria | 1465 |
| 725 | Ga0495618_0420867 | 3300046514 | Bacteria | 814 |
| 726 | Ga0495628_0030315 | 3300046516 | Bacteria | 4380 |
| 727 | Ga0495628_0228204 | 3300046516 | Bacteria | 1396 |
| 728 | Ga0495628_0416196 | 3300046516 | Bacteria | 980 |
| 729 | Ga0495630_0332361 | 3300046517 | Bacteria | 1162 |
| 730 | Ga0495631_0185392 | 3300046518 | Bacteria | 891 |
| 731 | Ga0495648_0006022 | 3300046524 | Bacteria | 9959 |
| 732 | Ga0495648_0242594 | 3300046524 | Bacteria | 875 |
| 733 | Ga0495666_0039136 | 3300046526 | Bacteria | 2303 |
| 734 | Ga0495652_0003535 | 3300046529 | Bacteria | 15358 |
| 735 | Ga0495652_0061438 | 3300046529 | Bacteria | 3171 |
| 736 | Ga0495652_0699938 | 3300046529 | Bacteria | 682 |
| 737 | Ga0495652_0888203 | 3300046529 | Bacteria | 588 |
| 738 | Ga0495665_0000363 | 3300046531 | Bacteria | 22896 |
| 739 | Ga0495640_0008340 | 3300046533 | Bacteria | 8125 |
| 740 | Ga0495640_0018138 | 3300046533 | Bacteria | 5229 |
| 741 | Ga0495587_0048810 | 3300046536 | Bacteria | 2506 |
| 742 | Ga0495645_0018802 | 3300046543 | Bacteria | 4970 |
| 743 | Ga0495645_0128339 | 3300046543 | Bacteria | 1780 |
| 744 | Ga0495622_0016899 | 3300046557 | Bacteria | 3396 |
| 745 | Ga0495622_0191992 | 3300046557 | Bacteria | 912 |
| 746 | Ga0495667_0007037 | 3300046559 | Bacteria | 7634 |
| 747 | Ga0495667_0012558 | 3300046559 | Bacteria | 5744 |
| 748 | Ga0495667_0050074 | 3300046559 | Bacteria | 2757 |
| 749 | Ga0495667_0218115 | 3300046559 | Bacteria | 1218 |
| 750 | Ga0495668_0123906 | 3300046616 | Bacteria | 1414 |
| 751 | Ga0495634_0000440 | 3300046642 | Bacteria | 41444 |
| 752 | Ga0495634_0006578 | 3300046642 | Bacteria | 8814 |
| 753 | Ga0495634_0014949 | 3300046642 | Bacteria | 5581 |
| 754 | Ga0495634_0039133 | 3300046642 | Bacteria | 3230 |
| 755 | Ga0495625_0098496 | 3300046660 | Bacteria | 2011 |
| 756 | Ga0495635_0000425 | 3300046663 | Bacteria | 26748 |
| 757 | Ga0495635_0036763 | 3300046663 | Bacteria | 3392 |
| 758 | Ga0495635_0092525 | 3300046663 | Bacteria | 2067 |
| 759 | Ga0495635_0177840 | 3300046663 | Bacteria | 1446 |
| 760 | Ga0495588_0001638 | 3300046674 | Bacteria | 9590 |
| 761 | Ga0495588_0498649 | 3300046674 | Bacteria | 638 |
| 762 | Ga0495657_0014528 | 3300046675 | Bacteria | 5777 |
| 763 | Ga0495657_0071597 | 3300046675 | Bacteria | 2262 |
| 764 | Ga0495657_0166830 | 3300046675 | Bacteria | 1359 |
| 765 | Ga0495657_0838134 | 3300046675 | Bacteria | 524 |
| 766 | Ga0495599_0040272 | 3300046678 | Bacteria | 2934 |
| 767 | Ga0495599_0151580 | 3300046678 | Bacteria | 1435 |
| 768 | Ga0495599_0236719 | 3300046678 | Bacteria | 1114 |
| 769 | Ga0495623_0045711 | 3300046679 | Bacteria | 2780 |
| 770 | Ga0495623_0384792 | 3300046679 | Bacteria | 758 |
| 771 | Ga0495646_0015975 | 3300046680 | Bacteria | 4765 |
| 772 | Ga0495646_0040856 | 3300046680 | Bacteria | 2853 |
| 773 | Ga0495646_0092645 | 3300046680 | Bacteria | 1742 |
| 774 | Ga0495647_0056223 | 3300046681 | Bacteria | 1542 |
| 775 | Ga0495658_0001987 | 3300046683 | Bacteria | 10418 |
| 776 | Ga0495658_0710326 | 3300046683 | Bacteria | 644 |
| 777 | Ga0495658_0844047 | 3300046683 | Bacteria | 586 |
| 778 | Ga0495669_0024837 | 3300046684 | Bacteria | 2611 |
| 779 | Ga0495613_0011731 | 3300046689 | Bacteria | 6512 |
| 780 | Ga0495613_0074931 | 3300046689 | Bacteria | 2464 |
| 781 | Ga0495624_0000818 | 3300046690 | Bacteria | 24567 |
| 782 | Ga0495671_0051171 | 3300046692 | Bacteria | 2055 |
| 783 | Ga0495600_0017589 | 3300046809 | Bacteria | 4549 |
| 784 | Ga0495600_0032884 | 3300046809 | Bacteria | 3365 |
| 785 | Ga0495600_0376087 | 3300046809 | Bacteria | 887 |
| 786 | Ga0495581_0018715 | 3300047315 | Bacteria | 4022 |
| 787 | Ga0495581_0654914 | 3300047315 | Bacteria | 607 |
| 788 | Ga0495581_0829666 | 3300047315 | Bacteria | 530 |
| 789 | Ga0495604_0017963 | 3300047317 | Bacteria | 5659 |
| 790 | Ga0495604_0049475 | 3300047317 | Bacteria | 3265 |
| 791 | Ga0495604_0145575 | 3300047317 | Bacteria | 1689 |
| 792 | Ga0495604_0239240 | 3300047317 | Bacteria | 1242 |
| 793 | Ga0495604_0626011 | 3300047317 | Bacteria | 688 |
| 794 | Ga0495674_0001342 | 3300047319 | Bacteria | 23999 |
| 795 | Ga0495674_0023164 | 3300047319 | Bacteria | 5724 |
| 796 | Ga0495674_0063294 | 3300047319 | Bacteria | 3218 |
| 797 | Ga0495672_0243279 | 3300047320 | Bacteria | 877 |
| 798 | Ga0495676_0030480 | 3300047321 | Bacteria | 4577 |
| 799 | Ga0495676_0539029 | 3300047321 | Bacteria | 763 |
| 800 | Ga0495680_0029937 | 3300047322 | Bacteria | 4451 |
| 801 | Ga0495680_0061007 | 3300047322 | Bacteria | 2902 |
| 802 | Ga0495680_0316245 | 3300047322 | Bacteria | 1093 |
| 803 | Ga0495683_0251771 | 3300047323 | Bacteria | 775 |
| 804 | Ga0495675_0014718 | 3300047444 | Bacteria | 4944 |
| 805 | Ga0495675_0017501 | 3300047444 | Bacteria | 4542 |
| 806 | Ga0495684_0003601 | 3300047471 | Bacteria | 12078 |
| 807 | Ga0495684_0118183 | 3300047471 | Bacteria | 1998 |
| 808 | Ga0495686_0075373 | 3300047472 | Bacteria | 2069 |
| 809 | Ga0495593_0000192 | 3300047673 | Bacteria | 32140 |
| 810 | Ga0495593_0002191 | 3300047673 | Bacteria | 11688 |
| 811 | Ga0495593_0102081 | 3300047673 | Bacteria | 1470 |
| 812 | Ga0495593_0334920 | 3300047673 | Bacteria | 756 |
| 813 | Ga0495593_0543843 | 3300047673 | Bacteria | 583 |
| 814 | Ga0495602_0065512 | 3300048088 | Bacteria | 3135 |
| 815 | Ga0495602_0108298 | 3300048088 | Bacteria | 2263 |
| 816 | Ga0495602_0203622 | 3300048088 | Bacteria | 1508 |
| 817 | Ga0495602_0218235 | 3300048088 | Bacteria | 1441 |
| 818 | Ga0495602_0225779 | 3300048088 | Bacteria | 1410 |
| 819 | Ga0495602_0315689 | 3300048088 | Bacteria | 1139 |
| 820 | Ga0496100_0090361 | 3300048903 | Bacteria | 2088 |
| 821 | Ga0496100_0227244 | 3300048903 | Bacteria | 1372 |
| 822 | Ga0496101_0006237 | 3300048904 | Bacteria | 7667 |
| 823 | Ga0496101_0288229 | 3300048904 | Bacteria | 1284 |
| 824 | Ga0496101_1110884 | 3300048904 | Bacteria | 620 |
| 825 | Ga0496102_0002444 | 3300048905 | Bacteria | 15846 |
| 826 | Ga0496102_0200887 | 3300048905 | Bacteria | 1879 |
| 827 | Ga0496102_0451242 | 3300048905 | Bacteria | 1206 |
| 828 | Ga0496102_1264076 | 3300048905 | Bacteria | 657 |
| 829 | Ga0496102_1355931 | 3300048905 | Bacteria | 630 |
| 830 | Ga0496103_0103626 | 3300048906 | Bacteria | 1802 |
| 831 | Ga0496103_0423432 | 3300048906 | Bacteria | 855 |
| 832 | Ga0496103_0433860 | 3300048906 | Bacteria | 843 |
| 833 | Ga0496104_0004215 | 3300048907 | Bacteria | 12487 |
| 834 | Ga0496104_0007469 | 3300048907 | Bacteria | 9661 |
| 835 | Ga0496104_0109021 | 3300048907 | Bacteria | 2654 |
| 836 | Ga0496104_0166042 | 3300048907 | Bacteria | 2117 |
| 837 | Ga0496105_0062323 | 3300048908 | Bacteria | 3077 |
| 838 | Ga0496105_0492389 | 3300048908 | Bacteria | 963 |
| 839 | Ga0496106_0031456 | 3300048909 | Bacteria | 3955 |
| 840 | Ga0496106_0043168 | 3300048909 | Bacteria | 3383 |
| 841 | Ga0496106_0125048 | 3300048909 | Bacteria | 2013 |
| 842 | Ga0496106_0301891 | 3300048909 | Bacteria | 1284 |
| 843 | Ga0496107_0004195 | 3300048910 | Bacteria | 9734 |
| 844 | Ga0496107_0006772 | 3300048910 | Bacteria | 7887 |
| 845 | Ga0496107_0090516 | 3300048910 | Bacteria | 2235 |
| 846 | Ga0496108_0000515 | 3300048911 | Bacteria | 30277 |
| 847 | Ga0496108_0008382 | 3300048911 | Bacteria | 8387 |
| 848 | Ga0496108_0067607 | 3300048911 | Bacteria | 3014 |
| 849 | Ga0496108_0082965 | 3300048911 | Bacteria | 2718 |
| 850 | Ga0496108_0085647 | 3300048911 | Bacteria | 2675 |
| 851 | Ga0496109_0010441 | 3300048912 | Bacteria | 7934 |
| 852 | Ga0496109_0016411 | 3300048912 | Bacteria | 6474 |
| 853 | Ga0496109_0205174 | 3300048912 | Bacteria | 1853 |
| 854 | Ga0496110_0005518 | 3300048913 | Bacteria | 9928 |
| 855 | Ga0496110_0006362 | 3300048913 | Bacteria | 9335 |
| 856 | Ga0496110_0119527 | 3300048913 | Bacteria | 2373 |
| 857 | Ga0496111_0020163 | 3300048914 | Bacteria | 4639 |
| 858 | Ga0496111_0054972 | 3300048914 | Bacteria | 2879 |
| 859 | Ga0496111_0065725 | 3300048914 | Bacteria | 2633 |
| 860 | Ga0496111_0220481 | 3300048914 | Bacteria | 1409 |
| 861 | Ga0496111_0358477 | 3300048914 | Bacteria | 1079 |
| 862 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 863 | Ga0496112_0010287 | 3300048915 | Bacteria | 8482 |
| 864 | Ga0496112_0017441 | 3300048915 | Bacteria | 6744 |
| 865 | Ga0496112_0023073 | 3300048915 | Bacteria | 5939 |
| 866 | Ga0496112_0059262 | 3300048915 | Bacteria | 3772 |
| 867 | Ga0496112_0345924 | 3300048915 | Bacteria | 1430 |
| 868 | Ga0496112_0398793 | 3300048915 | Bacteria | 1315 |
| 869 | Ga0496112_0675683 | 3300048915 | Bacteria | 961 |
| 870 | Ga0496113_0039773 | 3300048916 | Bacteria | 3463 |
| 871 | Ga0496113_0049914 | 3300048916 | Bacteria | 3117 |
| 872 | Ga0496113_0199255 | 3300048916 | Bacteria | 1591 |
| 873 | Ga0496113_1277863 | 3300048916 | Bacteria | 571 |
| 874 | Ga0496114_0460979 | 3300048917 | Bacteria | 1125 |
| 875 | Ga0496114_1173754 | 3300048917 | Bacteria | 653 |
| 876 | Ga0496115_0004586 | 3300048918 | Bacteria | 10008 |
| 877 | Ga0496115_0015076 | 3300048918 | Bacteria | 5858 |
| 878 | Ga0496115_0100494 | 3300048918 | Bacteria | 2371 |
| 879 | Ga0496115_0104091 | 3300048918 | Bacteria | 2329 |
| 880 | Ga0496115_0862211 | 3300048918 | Bacteria | 701 |
| 881 | Ga0496115_1268103 | 3300048918 | Bacteria | 550 |
| 882 | Ga0496117_0010921 | 3300048920 | Bacteria | 8185 |
| 883 | Ga0496117_0039914 | 3300048920 | Bacteria | 3459 |
| 884 | Ga0496118_0060403 | 3300048921 | Bacteria | 2815 |
| 885 | Ga0496118_0163414 | 3300048921 | Bacteria | 1372 |
| 886 | Ga0496118_0310191 | 3300048921 | Bacteria | 861 |
| 887 | Ga0496118_0358072 | 3300048921 | Bacteria | 775 |
| 888 | Ga0496119_0061538 | 3300048922 | Bacteria | 2241 |
| 889 | Ga0496119_0163211 | 3300048922 | Bacteria | 1182 |
| 890 | Ga0496121_0006790 | 3300048924 | Bacteria | 14020 |
| 891 | Ga0496121_0011498 | 3300048924 | Bacteria | 9812 |
| 892 | Ga0496121_0026797 | 3300048924 | Bacteria | 5416 |
| 893 | Ga0496121_0042449 | 3300048924 | Bacteria | 3956 |
| 894 | Ga0496121_0159004 | 3300048924 | Bacteria | 1654 |
| 895 | Ga0496121_0402895 | 3300048924 | Bacteria | 895 |
| 896 | Ga0496121_0589008 | 3300048924 | Bacteria | 688 |
| 897 | Ga0496124_0061538 | 3300048927 | Bacteria | 3146 |
| 898 | Ga0496124_0276115 | 3300048927 | Bacteria | 1228 |
| 899 | Ga0496125_0018110 | 3300048928 | Bacteria | 6694 |
| 900 | Ga0496125_0122695 | 3300048928 | Bacteria | 1849 |
| 901 | Ga0496126_0004265 | 3300048929 | Bacteria | 17195 |
| 902 | Ga0496126_0007329 | 3300048929 | Bacteria | 12113 |
| 903 | Ga0496126_0027426 | 3300048929 | Bacteria | 5439 |
| 904 | Ga0496126_0105247 | 3300048929 | Bacteria | 2464 |
| 905 | Ga0496126_0140280 | 3300048929 | Bacteria | 2081 |
| 906 | Ga0496126_0211341 | 3300048929 | Bacteria | 1633 |
| 907 | Ga0496126_0217819 | 3300048929 | Bacteria | 1605 |
| 908 | Ga0496126_0260682 | 3300048929 | Bacteria | 1442 |
| 909 | Ga0496126_0342862 | 3300048929 | Bacteria | 1224 |
| 910 | Ga0496126_0392418 | 3300048929 | Bacteria | 1127 |
| 911 | Ga0496126_0690528 | 3300048929 | Bacteria | 794 |
| 912 | Ga0496126_0832826 | 3300048929 | Bacteria | 705 |
| 913 | Ga0501031_0000268 | 3300049568 | Bacteria | 29430 |
| 914 | Ga0501031_0525600 | 3300049568 | Bacteria | 762 |
| 915 | Ga0501032_0000619 | 3300049569 | Bacteria | 28816 |
| 916 | Ga0501032_0030178 | 3300049569 | Bacteria | 3719 |
| 917 | Ga0501032_0108134 | 3300049569 | Bacteria | 1841 |
| 918 | Ga0501032_0141775 | 3300049569 | Bacteria | 1582 |
| 919 | Ga0501033_0000108 | 3300049570 | Bacteria | 79903 |
| 920 | Ga0501033_0015026 | 3300049570 | Bacteria | 5876 |
| 921 | Ga0501033_0050162 | 3300049570 | Bacteria | 3097 |
| 922 | Ga0501034_0000100 | 3300049571 | Bacteria | 159536 |
| 923 | Ga0501034_0400933 | 3300049571 | Bacteria | 1294 |
| 924 | Ga0501034_0433157 | 3300049571 | Bacteria | 1234 |
| 925 | Ga0501036_0000228 | 3300049572 | Bacteria | 37800 |
| 926 | Ga0501036_0094300 | 3300049572 | Bacteria | 2529 |
| 927 | Ga0501037_0002072 | 3300049573 | Bacteria | 14545 |
| 928 | Ga0501037_0049351 | 3300049573 | Bacteria | 3082 |
| 929 | Ga0501037_0124154 | 3300049573 | Bacteria | 1854 |
| 930 | Ga0501038_0002060 | 3300049574 | Bacteria | 18617 |
| 931 | Ga0501038_0010248 | 3300049574 | Bacteria | 8577 |
| 932 | Ga0501038_0027992 | 3300049574 | Bacteria | 5007 |
| 933 | Ga0501038_1128446 | 3300049574 | Bacteria | 571 |
| 934 | Ga0501039_0001602 | 3300049575 | Bacteria | 16666 |
| 935 | Ga0501039_0022365 | 3300049575 | Bacteria | 4853 |
| 936 | Ga0501039_0102340 | 3300049575 | Bacteria | 2235 |
| 937 | Ga0501040_0122978 | 3300049576 | Bacteria | 1821 |
| 938 | Ga0501043_0000085 | 3300049579 | Bacteria | 83544 |
| 939 | Ga0501043_0021593 | 3300049579 | Bacteria | 5048 |
| 940 | Ga0501043_1087680 | 3300049579 | Bacteria | 565 |
| 941 | Ga0501046_0000426 | 3300049580 | Bacteria | 42186 |
| 942 | Ga0501046_0064242 | 3300049580 | Bacteria | 2866 |
| 943 | Ga0501046_0284157 | 3300049580 | Bacteria | 1211 |
| 944 | Ga0501046_0313454 | 3300049580 | Bacteria | 1144 |
| 945 | Ga0501047_0000221 | 3300049581 | Bacteria | 68563 |
| 946 | Ga0501047_0063342 | 3300049581 | Bacteria | 3567 |
| 947 | Ga0501047_0067526 | 3300049581 | Bacteria | 3445 |
| 948 | Ga0501048_0000621 | 3300049582 | Bacteria | 25292 |
| 949 | Ga0501067_0000384 | 3300049583 | Bacteria | 24036 |
| 950 | Ga0501067_0061848 | 3300049583 | Bacteria | 2072 |
| 951 | Ga0501068_0001789 | 3300049584 | Bacteria | 11428 |
| 952 | Ga0501068_0018947 | 3300049584 | Bacteria | 3989 |
| 953 | Ga0501068_0664659 | 3300049584 | Bacteria | 680 |
| 954 | Ga0501069_0008876 | 3300049585 | Bacteria | 5299 |
| 955 | Ga0501070_0001287 | 3300049586 | Bacteria | 22514 |
| 956 | Ga0501070_0023486 | 3300049586 | Bacteria | 5165 |
| 957 | Ga0501070_0212803 | 3300049586 | Bacteria | 1586 |
| 958 | Ga0501070_0631729 | 3300049586 | Bacteria | 851 |
| 959 | Ga0501070_1346433 | 3300049586 | Bacteria | 544 |
| 960 | Ga0501071_0028472 | 3300049587 | Bacteria | 3939 |
| 961 | Ga0501071_0318381 | 3300049587 | Bacteria | 1181 |
| 962 | Ga0501072_0001233 | 3300049588 | Bacteria | 19088 |
| 963 | Ga0501072_0554217 | 3300049588 | Bacteria | 908 |
| 964 | Ga0501073_0000290 | 3300049589 | Bacteria | 33072 |
| 965 | Ga0501073_0052946 | 3300049589 | Bacteria | 2842 |
| 966 | Ga0501073_0075738 | 3300049589 | Bacteria | 2342 |
| 967 | Ga0501073_0171646 | 3300049589 | Bacteria | 1501 |
| 968 | Ga0501074_0000094 | 3300049590 | Bacteria | 42565 |
| 969 | Ga0501074_0078833 | 3300049590 | Bacteria | 2364 |
| 970 | Ga0501074_0141012 | 3300049590 | Bacteria | 1724 |
| 971 | Ga0501075_0573540 | 3300049591 | Bacteria | 861 |
| 972 | Ga0501076_0230810 | 3300049592 | Bacteria | 1513 |
| 973 | Ga0501077_0138071 | 3300049593 | Bacteria | 1546 |
| 974 | Ga0501079_0023481 | 3300049741 | Bacteria | 4732 |
| 975 | Ga0501079_0175485 | 3300049741 | Bacteria | 1671 |
| 976 | Ga0501080_0007102 | 3300049742 | Bacteria | 10113 |
| 977 | Ga0501080_0076776 | 3300049742 | Bacteria | 3106 |
| 978 | Ga0501080_0145672 | 3300049742 | Bacteria | 2189 |
| 979 | Ga0501083_0000087 | 3300049744 | Bacteria | 62691 |
| 980 | Ga0501083_0235054 | 3300049744 | Bacteria | 1193 |
| 981 | Ga0501035_0000223 | 3300049822 | Bacteria | 67732 |
| 982 | Ga0501035_0029751 | 3300049822 | Bacteria | 4981 |
| 983 | Ga0501035_0057029 | 3300049822 | Bacteria | 3483 |
| 984 | Ga0501035_0099964 | 3300049822 | Bacteria | 2546 |
| 985 | Ga0501044_0000970 | 3300049823 | Bacteria | 34530 |
| 986 | Ga0501044_0009122 | 3300049823 | Bacteria | 10835 |
| 987 | Ga0501044_0036772 | 3300049823 | Bacteria | 5121 |
| 988 | Ga0501044_0069089 | 3300049823 | Bacteria | 3597 |
| 989 | Ga0501044_0159139 | 3300049823 | Bacteria | 2236 |
| 990 | Ga0501045_0023775 | 3300049824 | Bacteria | 4396 |
| 991 | nmdc:mga03683_239499_c1 | 3300050489 | Bacteria | 841 |
| 992 | nmdc:mga03683_52613_c1 | 3300050489 | Bacteria | 1702 |
| 993 | nmdc:mga03n38_3407_c1 | 3300050490 | Bacteria | 5100 |
| 994 | nmdc:mga00v17_260626_c1 | 3300050491 | Bacteria | 1125 |
| 995 | nmdc:mga0k408_179756_c1 | 3300050493 | Bacteria | 1262 |
| 996 | nmdc:mga0k408_42604_c1 | 3300050493 | Bacteria | 2614 |
| 997 | nmdc:mga06z11_118077_c1 | 3300050494 | Bacteria | 1477 |
| 998 | nmdc:mga06z11_276764_c1 | 3300050494 | Bacteria | 994 |
| 999 | nmdc:mga04h51_87348_c1 | 3300050495 | Bacteria | 1117 |
| 1000 | nmdc:mga07m45_108884_c1 | 3300050496 | Bacteria | 1595 |
| 1001 | nmdc:mga07m45_20250_c1 | 3300050496 | Bacteria | 3613 |
| 1002 | nmdc:mga08y16_1698314_c1 | 3300050511 | Bacteria | 587 |
| 1003 | nmdc:mga08y16_721017_c1 | 3300050511 | Bacteria | 995 |
| 1004 | nmdc:mga0n895_10165_c1 | 3300050512 | Bacteria | 8288 |
| 1005 | nmdc:mga0rr50_856087_c1 | 3300050513 | Bacteria | 775 |
| 1006 | nmdc:mga08x19_26638_c2 | 3300050514 | Bacteria | 2966 |
| 1007 | Ga0495601_0018417 | 3300053077 | Bacteria | 4250 |
| 1008 | Ga0495601_0046570 | 3300053077 | Bacteria | 2730 |
| 1009 | Ga0495601_0338930 | 3300053077 | Bacteria | 978 |
| 1010 | Ga0495601_0532884 | 3300053077 | Bacteria | 756 |
| 1011 | Ga0495612_0169193 | 3300053078 | Bacteria | 956 |
| 1012 | Ga0495612_0253191 | 3300053078 | Bacteria | 784 |
| 1013 | Ga0495612_0271034 | 3300053078 | Bacteria | 757 |
| 1014 | Ga0500635_0001711 | 3300053080 | Bacteria | 5319 |
| 1015 | Ga0495655_0051821 | 3300053083 | Bacteria | 1089 |
| 1016 | Ga0495595_0089522 | 3300053084 | Bacteria | 1475 |
| 1017 | Ga0495619_0020769 | 3300053085 | Bacteria | 4187 |
| 1018 | Ga0495619_0129018 | 3300053085 | Bacteria | 1737 |
| 1019 | Ga0495619_0186346 | 3300053085 | Bacteria | 1436 |
| 1020 | Ga0495619_0622733 | 3300053085 | Bacteria | 737 |
| 1021 | Ga0500651_0025571 | 3300053093 | Bacteria | 3704 |
| 1022 | Ga0500554_106627 | 3300053102 | Bacteria | 940 |
| 1023 | Ga0500556_0062377 | 3300053104 | Bacteria | 1375 |
| 1024 | Ga0500556_0380198 | 3300053104 | Bacteria | 544 |
| 1025 | Ga0500562_056287 | 3300053108 | Bacteria | 1054 |
| 1026 | Ga0500572_000537 | 3300053111 | Bacteria | 12870 |
| 1027 | Ga0500595_005319 | 3300053119 | Bacteria | 5636 |
| 1028 | Ga0500595_005513 | 3300053119 | Bacteria | 5519 |
| 1029 | Ga0500595_007491 | 3300053119 | Bacteria | 4528 |
| 1030 | Ga0500595_012739 | 3300053119 | Bacteria | 3240 |
| 1031 | Ga0500595_023493 | 3300053119 | Bacteria | 2166 |
| 1032 | Ga0500608_141344 | 3300053122 | Bacteria | 1067 |
| 1033 | Ga0500642_0056688 | 3300053130 | Bacteria | 1746 |
| 1034 | Ga0500642_0263239 | 3300053130 | Bacteria | 788 |
| 1035 | Ga0500655_046839 | 3300053133 | Bacteria | 856 |
| 1036 | Ga0500658_0027899 | 3300053134 | Bacteria | 2187 |
| 1037 | Ga0500559_0000143 | 3300053136 | Bacteria | 55572 |
| 1038 | Ga0500568_0013681 | 3300053139 | Bacteria | 3690 |
| 1039 | Ga0500568_0020236 | 3300053139 | Bacteria | 2882 |
| 1040 | Ga0500588_0037631 | 3300053146 | Bacteria | 1438 |
| 1041 | Ga0500590_076753 | 3300053148 | Bacteria | 1650 |
| 1042 | Ga0500603_000415 | 3300053150 | Bacteria | 11152 |
| 1043 | Ga0500603_024182 | 3300053150 | Bacteria | 1518 |
| 1044 | Ga0500603_210452 | 3300053150 | Bacteria | 619 |
| 1045 | Ga0500616_0260636 | 3300053153 | Unclassified | 736 |
| 1046 | Ga0500620_137656 | 3300053155 | Bacteria | 854 |
| 1047 | Ga0500636_0063096 | 3300053177 | Bacteria | 2160 |
| 1048 | Ga0500636_0082467 | 3300053177 | Bacteria | 1851 |
| 1049 | Ga0500637_0333145 | 3300053178 | Bacteria | 815 |
| 1050 | Ga0500576_047455 | 3300053725 | Bacteria | 1915 |
| 1051 | Ga0500645_039828 | 3300053730 | Bacteria | 1391 |
| 1052 | Ga0500609_004208 | 3300053731 | Bacteria | 2000 |
| 1053 | Ga0500596_003194 | 3300053735 | Bacteria | 3143 |
| 1054 | Ga0500601_008773 | 3300053737 | Bacteria | 1125 |
| 1055 | Ga0501084_0008032 | 3300054114 | Bacteria | 8689 |
| 1056 | Ga0501082_0000452 | 3300060353 | Bacteria | 36318 |
| 1057 | Ga0501082_0510663 | 3300060353 | Bacteria | 1050 |
| 1058 | Ga0466962_0325437 | 3300061719 | Bacteria | 763 |
| 1059 | Ga0530510_0787506 | 3300061734 | Bacteria | 725 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035111 | Ga0373923_0037693 | Ga0373923_0037693_969_1400 | 143 |
| 2 | 3300035117 | Ga0373953_0010843 | Ga0373953_0010843_1030_1461 | 143 |
| 3 | 3300035118 | Ga0373954_0168732 | Ga0373954_0168732_321_752 | 143 |
| 4 | 3300035119 | Ga0373956_0012101 | Ga0373956_0012101_2056_2487 | 143 |
| 5 | 3300035120 | Ga0373957_0099043 | Ga0373957_0099043_510_941 | 143 |
| 6 | 3300035172 | Ga0373955_0021151 | Ga0373955_0021151_1751_2182 | 143 |
| 7 | 3300035410 | Ga0373924_0034130 | Ga0373924_0034130_822_1253 | 143 |
| 8 | 3300035692 | Ga0373935_0701895 | Ga0373935_0701895_31_462 | 143 |
| 9 | 3300035724 | Ga0373933_0012105 | Ga0373933_0012105_679_1110 | 143 |
| 10 | 3300036401 | Ga0373937_0856007 | Ga0373937_0856007_307_738 | 143 |
| 11 | 3300044735 | Ga0466968_0479476 | Ga0466968_0479476_35_496 | 143 |
| 12 | 3300046454 | Ga0495592_0021600 | Ga0495592_0021600_3871_4302 | 143 |
| 13 | 3300046459 | Ga0495629_0372715 | Ga0495629_0372715_474_905 | 143 |
| 14 | 3300046462 | Ga0495651_0124135 | Ga0495651_0124135_379_810 | 143 |
| 15 | 3300046463 | Ga0495653_0036033 | Ga0495653_0036033_2559_2990 | 143 |
| 16 | 3300046475 | Ga0495639_0266462 | Ga0495639_0266462_304_735 | 143 |
| 17 | 3300046477 | Ga0495664_0070146 | Ga0495664_0070146_732_1163 | 143 |
| 18 | 3300046511 | Ga0495608_0224479 | Ga0495608_0224479_589_1020 | 143 |
| 19 | 3300046514 | Ga0495618_0154405 | Ga0495618_0154405_686_1117 | 143 |
| 20 | 3300046516 | Ga0495628_0030315 | Ga0495628_0030315_1658_2089 | 143 |
| 21 | 3300046529 | Ga0495652_0061438 | Ga0495652_0061438_1774_2205 | 143 |
| 22 | 3300046533 | Ga0495640_0018138 | Ga0495640_0018138_2234_2665 | 143 |
| 23 | 3300046536 | Ga0495587_0048810 | Ga0495587_0048810_1670_2101 | 143 |
| 24 | 3300046559 | Ga0495667_0007037 | Ga0495667_0007037_1889_2320 | 143 |
| 25 | 3300046642 | Ga0495634_0039133 | Ga0495634_0039133_1785_2216 | 143 |
| 26 | 3300046663 | Ga0495635_0177840 | Ga0495635_0177840_337_768 | 143 |
| 27 | 3300046675 | Ga0495657_0014528 | Ga0495657_0014528_3141_3572 | 143 |
| 28 | 3300046678 | Ga0495599_0040272 | Ga0495599_0040272_1711_2142 | 143 |
| 29 | 3300046679 | Ga0495623_0045711 | Ga0495623_0045711_1984_2415 | 143 |
| 30 | 3300046680 | Ga0495646_0092645 | Ga0495646_0092645_961_1392 | 143 |
| 31 | 3300046689 | Ga0495613_0074931 | Ga0495613_0074931_927_1358 | 143 |
| 32 | 3300046809 | Ga0495600_0032884 | Ga0495600_0032884_2073_2504 | 143 |
| 33 | 3300047315 | Ga0495581_0829666 | Ga0495581_0829666_62_493 | 143 |
| 34 | 3300047317 | Ga0495604_0017963 | Ga0495604_0017963_5109_5540 | 143 |
| 35 | 3300047319 | Ga0495674_0023164 | Ga0495674_0023164_4289_4720 | 143 |
| 36 | 3300047322 | Ga0495680_0029937 | Ga0495680_0029937_762_1193 | 143 |
| 37 | 3300047444 | Ga0495675_0014718 | Ga0495675_0014718_834_1265 | 143 |
| 38 | 3300048088 | Ga0495602_0065512 | Ga0495602_0065512_921_1352 | 143 |
| 39 | 3300053077 | Ga0495601_0018417 | Ga0495601_0018417_1670_2101 | 143 |
| 40 | 3300053078 | Ga0495612_0253191 | Ga0495612_0253191_213_644 | 143 |
| 41 | 3300005436 | Ga0070713_100099099 | Ga0070713_1000990993 | 144 |
| 42 | 3300005437 | Ga0070710_10116312 | Ga0070710_101163122 | 144 |
| 43 | 3300005439 | Ga0070711_100004091 | Ga0070711_1000040915 | 144 |
| 44 | 3300006028 | Ga0070717_10255564 | Ga0070717_102555643 | 144 |
| 45 | 3300006173 | Ga0070716_100059369 | Ga0070716_1000593692 | 144 |
| 46 | 3300006175 | Ga0070712_100065329 | Ga0070712_1000653292 | 144 |
| 47 | 3300009093 | Ga0105240_11621063 | Ga0105240_116210631 | 144 |
| 48 | 3300048922 | Ga0496119_0163211 | Ga0496119_0163211_245_739 | 144 |
| 49 | 3300048916 | Ga0496113_1277863 | Ga0496113_1277863_104_556 | 145 |
| 50 | 3300048918 | Ga0496115_1268103 | Ga0496115_1268103_86_538 | 145 |
| 51 | 3300048905 | Ga0496102_1264076 | Ga0496102_1264076_130_591 | 147 |
| 52 | iso_pu_bacteria | 2513237098 | 2513674388 | 148 |
| 53 | iso_pu_bacteria | 2524023210 | 2524470468 | 148 |
| 54 | iso_pu_bacteria | 2885383462 | 2885391054 | 148 |
| 55 | iso_pu_bacteria | 2903768456 | 2903773778 | 148 |
| 56 | iso_pu_bacteria | 8056681323 | 8056688301 | 148 |
| 57 | iso_pu_bacteria | 2508501128 | 2509151641 | 149 |
| 58 | iso_pu_bacteria | 2513237096 | 2513657093 | 149 |
| 59 | iso_pu_bacteria | 2513237137 | 2513855535 | 149 |
| 60 | iso_pu_bacteria | 2513237141 | 2513890187 | 149 |
| 61 | iso_pu_bacteria | 2513237145 | 2513918833 | 149 |
| 62 | iso_pu_bacteria | 2517572143 | 2517892080 | 149 |
| 63 | iso_pu_bacteria | 2524023228 | 2524534164 | 149 |
| 64 | iso_pu_bacteria | 2667528175 | 2671121882 | 149 |
| 65 | iso_pu_bacteria | 2728368998 | 2728753292 | 149 |
| 66 | iso_pu_bacteria | 2791355197 | 2793068835 | 149 |
| 67 | iso_pu_bacteria | 2885374607 | 2885379466 | 149 |
| 68 | iso_pu_bacteria | 2903748898 | 2903753406 | 149 |
| 69 | iso_pu_bacteria | 2904690495 | 2904694854 | 149 |
| 70 | iso_pu_bacteria | 2904699407 | 2904702200 | 149 |
| 71 | iso_pu_bacteria | 2906610324 | 2906617210 | 149 |
| 72 | iso_pu_bacteria | 2906635258 | 2906639270 | 149 |
| 73 | iso_pu_bacteria | 2906660503 | 2906662469 | 149 |
| 74 | iso_pu_bacteria | 2908739725 | 2908742360 | 149 |
| 75 | iso_pu_bacteria | 2908756301 | 2908760004 | 149 |
| 76 | iso_pu_bacteria | 2922425934 | 2922430618 | 149 |
| 77 | iso_pu_bacteria | 2935630451 | 2935631217 | 149 |
| 78 | iso_pu_bacteria | 2941507105 | 2941509958 | 149 |
| 79 | iso_pu_bacteria | 2941515067 | 2941518955 | 149 |
| 80 | iso_pu_bacteria | 2941523033 | 2941525357 | 149 |
| 81 | iso_pu_bacteria | 3005474847 | 3005480529 | 149 |
| 82 | iso_pu_bacteria | 8006933436 | 8006940247 | 149 |
| 83 | iso_pu_bacteria | 8006973647 | 8006980025 | 149 |
| 84 | iso_pu_bacteria | 8019555841 | 8019556230 | 149 |
| 85 | iso_pu_bacteria | 8019565922 | 8019569080 | 149 |
| 86 | iso_pu_bacteria | 8056689827 | 8056692287 | 149 |
| 87 | 3300048918 | Ga0496115_0100494 | Ga0496115_0100494_561_1019 | 151 |
| 88 | 3300003320 | rootH2_10096848 | rootH2_100968482 | 152 |
| 89 | 3300003323 | rootH1_10097652 | rootH1_100976523 | 152 |
| 90 | 3300005329 | Ga0070683_100736603 | Ga0070683_1007366031 | 152 |
| 91 | 3300005336 | Ga0070680_100205224 | Ga0070680_1002052243 | 152 |
| 92 | 3300005339 | Ga0070660_101502263 | Ga0070660_1015022631 | 152 |
| 93 | 3300005366 | Ga0070659_100070327 | Ga0070659_1000703272 | 152 |
| 94 | 3300005436 | Ga0070713_100847184 | Ga0070713_1008471841 | 152 |
| 95 | 3300005455 | Ga0070663_100028079 | Ga0070663_1000280793 | 152 |
| 96 | 3300005471 | Ga0070698_101693166 | Ga0070698_1016931661 | 152 |
| 97 | 3300005530 | Ga0070679_100595170 | Ga0070679_1005951701 | 152 |
| 98 | 3300005563 | Ga0068855_100336071 | Ga0068855_1003360713 | 152 |
| 99 | 3300005577 | Ga0068857_100223663 | Ga0068857_1002236631 | 152 |
| 100 | 3300005578 | Ga0068854_100409245 | Ga0068854_1004092452 | 152 |
| 101 | 3300005614 | Ga0068856_100000020 | Ga0068856_10000002092 | 152 |
| 102 | 3300005614 | Ga0068856_100011174 | Ga0068856_1000111747 | 152 |
| 103 | 3300005616 | Ga0068852_100061971 | Ga0068852_1000619713 | 152 |
| 104 | 3300005983 | Ga0081540_1012299 | Ga0081540_10122993 | 152 |
| 105 | 3300009093 | Ga0105240_10435270 | Ga0105240_104352702 | 152 |
| 106 | 3300009093 | Ga0105240_10723193 | Ga0105240_107231931 | 152 |
| 107 | 3300009545 | Ga0105237_10160216 | Ga0105237_101602163 | 152 |
| 108 | 3300013105 | Ga0157369_10214507 | Ga0157369_102145072 | 152 |
| 109 | 3300013105 | Ga0157369_10290556 | Ga0157369_102905562 | 152 |
| 110 | 3300013307 | Ga0157372_10864100 | Ga0157372_108641002 | 152 |
| 111 | 3300014968 | Ga0157379_10450416 | Ga0157379_104504163 | 152 |
| 112 | 3300020610 | Ga0154015_1684958 | Ga0154015_16849582 | 152 |
| 113 | 3300022467 | Ga0224712_10160059 | Ga0224712_101600592 | 152 |
| 114 | 3300025909 | Ga0207705_10470212 | Ga0207705_104702121 | 152 |
| 115 | 3300025913 | Ga0207695_10996786 | Ga0207695_109967861 | 152 |
| 116 | 3300025914 | Ga0207671_10242009 | Ga0207671_102420092 | 152 |
| 117 | 3300025915 | Ga0207693_10009635 | Ga0207693_100096353 | 152 |
| 118 | 3300025917 | Ga0207660_10645139 | Ga0207660_106451391 | 152 |
| 119 | 3300025921 | Ga0207652_10612405 | Ga0207652_106124052 | 152 |
| 120 | 3300025928 | Ga0207700_11274261 | Ga0207700_112742611 | 152 |
| 121 | 3300025929 | Ga0207664_10446567 | Ga0207664_104465672 | 152 |
| 122 | 3300025932 | Ga0207690_10186365 | Ga0207690_101863651 | 152 |
| 123 | 3300025944 | Ga0207661_10787835 | Ga0207661_107878351 | 152 |
| 124 | 3300025949 | Ga0207667_10291724 | Ga0207667_102917243 | 152 |
| 125 | 3300025981 | Ga0207640_11252382 | Ga0207640_112523821 | 152 |
| 126 | 3300026067 | Ga0207678_10013512 | Ga0207678_100135123 | 152 |
| 127 | 3300026078 | Ga0207702_10000126 | Ga0207702_1000012656 | 152 |
| 128 | 3300026078 | Ga0207702_10103752 | Ga0207702_101037522 | 152 |
| 129 | 3300026142 | Ga0207698_10512444 | Ga0207698_105124441 | 152 |
| 130 | 3300031249 | Ga0265339_10009656 | Ga0265339_100096564 | 152 |
| 131 | 3300031711 | Ga0265314_10058323 | Ga0265314_100583232 | 152 |
| 132 | 3300031712 | Ga0265342_10035732 | Ga0265342_100357322 | 152 |
| 133 | 3300037471 | Ga0395905_0345101 | Ga0395905_0345101_736_1194 | 152 |
| 134 | 3300044694 | Ga0466963_0052524 | Ga0466963_0052524_1979_2437 | 152 |
| 135 | 3300044694 | Ga0466963_0254548 | Ga0466963_0254548_134_592 | 152 |
| 136 | 3300045976 | Ga0466967_0151199 | Ga0466967_0151199_407_865 | 152 |
| 137 | 3300045976 | Ga0466967_0228449 | Ga0466967_0228449_25_483 | 152 |
| 138 | 3300046679 | Ga0495623_0384792 | Ga0495623_0384792_210_668 | 152 |
| 139 | 3300048088 | Ga0495602_0203622 | Ga0495602_0203622_252_710 | 152 |
| 140 | 3300048088 | Ga0495602_0315689 | Ga0495602_0315689_526_984 | 152 |
| 141 | 3300048905 | Ga0496102_0451242 | Ga0496102_0451242_20_478 | 152 |
| 142 | 3300048910 | Ga0496107_0004195 | Ga0496107_0004195_914_1372 | 152 |
| 143 | 3300048911 | Ga0496108_0000515 | Ga0496108_0000515_505_963 | 152 |
| 144 | 3300048912 | Ga0496109_0010441 | Ga0496109_0010441_3960_4418 | 152 |
| 145 | 3300048913 | Ga0496110_0005518 | Ga0496110_0005518_7084_7542 | 152 |
| 146 | 3300048914 | Ga0496111_0220481 | Ga0496111_0220481_855_1313 | 152 |
| 147 | 3300048915 | Ga0496112_0345924 | Ga0496112_0345924_66_524 | 152 |
| 148 | 3300048915 | Ga0496112_0675683 | Ga0496112_0675683_136_594 | 152 |
| 149 | 3300048921 | Ga0496118_0060403 | Ga0496118_0060403_2089_2595 | 152 |
| 150 | 3300048922 | Ga0496119_0061538 | Ga0496119_0061538_1084_1590 | 152 |
| 151 | 3300048924 | Ga0496121_0011498 | Ga0496121_0011498_1779_2285 | 152 |
| 152 | 3300048924 | Ga0496121_0159004 | Ga0496121_0159004_756_1214 | 152 |
| 153 | 3300048929 | Ga0496126_0140280 | Ga0496126_0140280_436_894 | 152 |
| 154 | 3300048929 | Ga0496126_0260682 | Ga0496126_0260682_277_735 | 152 |
| 155 | 3300048929 | Ga0496126_0690528 | Ga0496126_0690528_148_606 | 152 |
| 156 | 3300053078 | Ga0495612_0271034 | Ga0495612_0271034_217_675 | 152 |
| 157 | 3300053093 | Ga0500651_0025571 | Ga0500651_0025571_931_1437 | 152 |
| 158 | 3300053130 | Ga0500642_0056688 | Ga0500642_0056688_1167_1673 | 152 |
| 159 | 3300053731 | Ga0500609_004208 | Ga0500609_004208_1173_1679 | 152 |
| 160 | 3300000549 | LJQas_1020340 | LJQas_10203402 | 153 |
| 161 | 3300005327 | Ga0070658_10024846 | Ga0070658_100248464 | 153 |
| 162 | 3300005327 | Ga0070658_10095518 | Ga0070658_100955182 | 153 |
| 163 | 3300005327 | Ga0070658_10149575 | Ga0070658_101495752 | 153 |
| 164 | 3300005328 | Ga0070676_10084466 | Ga0070676_100844662 | 153 |
| 165 | 3300005329 | Ga0070683_100008483 | Ga0070683_1000084834 | 153 |
| 166 | 3300005329 | Ga0070683_100941533 | Ga0070683_1009415331 | 153 |
| 167 | 3300005331 | Ga0070670_100171161 | Ga0070670_1001711612 | 153 |
| 168 | 3300005334 | Ga0068869_100548331 | Ga0068869_1005483311 | 153 |
| 169 | 3300005336 | Ga0070680_100011935 | Ga0070680_1000119355 | 153 |
| 170 | 3300005336 | Ga0070680_100030530 | Ga0070680_1000305303 | 153 |
| 171 | 3300005336 | Ga0070680_100096296 | Ga0070680_1000962962 | 153 |
| 172 | 3300005336 | Ga0070680_100098880 | Ga0070680_1000988801 | 153 |
| 173 | 3300005337 | Ga0070682_100034380 | Ga0070682_1000343803 | 153 |
| 174 | 3300005337 | Ga0070682_100065584 | Ga0070682_1000655842 | 153 |
| 175 | 3300005337 | Ga0070682_100356620 | Ga0070682_1003566201 | 153 |
| 176 | 3300005338 | Ga0068868_100014105 | Ga0068868_1000141052 | 153 |
| 177 | 3300005338 | Ga0068868_100020935 | Ga0068868_1000209353 | 153 |
| 178 | 3300005339 | Ga0070660_100004475 | Ga0070660_1000044754 | 153 |
| 179 | 3300005339 | Ga0070660_100201255 | Ga0070660_1002012552 | 153 |
| 180 | 3300005339 | Ga0070660_100314234 | Ga0070660_1003142341 | 153 |
| 181 | 3300005339 | Ga0070660_100392798 | Ga0070660_1003927982 | 153 |
| 182 | 3300005340 | Ga0070689_100221844 | Ga0070689_1002218442 | 153 |
| 183 | 3300005341 | Ga0070691_10127901 | Ga0070691_101279012 | 153 |
| 184 | 3300005341 | Ga0070691_10236878 | Ga0070691_102368781 | 153 |
| 185 | 3300005343 | Ga0070687_100465680 | Ga0070687_1004656802 | 153 |
| 186 | 3300005344 | Ga0070661_100504410 | Ga0070661_1005044101 | 153 |
| 187 | 3300005344 | Ga0070661_100584991 | Ga0070661_1005849912 | 153 |
| 188 | 3300005344 | Ga0070661_101108480 | Ga0070661_1011084801 | 153 |
| 189 | 3300005345 | Ga0070692_10479303 | Ga0070692_104793031 | 153 |
| 190 | 3300005354 | Ga0070675_101043782 | Ga0070675_1010437821 | 153 |
| 191 | 3300005355 | Ga0070671_100371807 | Ga0070671_1003718072 | 153 |
| 192 | 3300005364 | Ga0070673_100043176 | Ga0070673_1000431762 | 153 |
| 193 | 3300005364 | Ga0070673_101400834 | Ga0070673_1014008341 | 153 |
| 194 | 3300005366 | Ga0070659_100059496 | Ga0070659_1000594964 | 153 |
| 195 | 3300005366 | Ga0070659_100146550 | Ga0070659_1001465501 | 153 |
| 196 | 3300005367 | Ga0070667_100164177 | Ga0070667_1001641773 | 153 |
| 197 | 3300005367 | Ga0070667_101599645 | Ga0070667_1015996451 | 153 |
| 198 | 3300005434 | Ga0070709_10001966 | Ga0070709_100019663 | 153 |
| 199 | 3300005434 | Ga0070709_10123740 | Ga0070709_101237402 | 153 |
| 200 | 3300005434 | Ga0070709_10159933 | Ga0070709_101599332 | 153 |
| 201 | 3300005434 | Ga0070709_10188557 | Ga0070709_101885572 | 153 |
| 202 | 3300005434 | Ga0070709_10319028 | Ga0070709_103190282 | 153 |
| 203 | 3300005434 | Ga0070709_10416553 | Ga0070709_104165532 | 153 |
| 204 | 3300005435 | Ga0070714_100004035 | Ga0070714_1000040357 | 153 |
| 205 | 3300005435 | Ga0070714_100141278 | Ga0070714_1001412782 | 153 |
| 206 | 3300005435 | Ga0070714_100170471 | Ga0070714_1001704713 | 153 |
| 207 | 3300005436 | Ga0070713_100002369 | Ga0070713_10000236910 | 153 |
| 208 | 3300005436 | Ga0070713_100004315 | Ga0070713_1000043157 | 153 |
| 209 | 3300005436 | Ga0070713_100008716 | Ga0070713_1000087163 | 153 |
| 210 | 3300005436 | Ga0070713_100126864 | Ga0070713_1001268641 | 153 |
| 211 | 3300005436 | Ga0070713_100255959 | Ga0070713_1002559592 | 153 |
| 212 | 3300005436 | Ga0070713_100295578 | Ga0070713_1002955782 | 153 |
| 213 | 3300005436 | Ga0070713_100351263 | Ga0070713_1003512633 | 153 |
| 214 | 3300005436 | Ga0070713_100366951 | Ga0070713_1003669511 | 153 |
| 215 | 3300005436 | Ga0070713_100814741 | Ga0070713_1008147411 | 153 |
| 216 | 3300005437 | Ga0070710_10000567 | Ga0070710_100005672 | 153 |
| 217 | 3300005437 | Ga0070710_10039600 | Ga0070710_100396001 | 153 |
| 218 | 3300005437 | Ga0070710_10055501 | Ga0070710_100555012 | 153 |
| 219 | 3300005437 | Ga0070710_10175357 | Ga0070710_101753572 | 153 |
| 220 | 3300005437 | Ga0070710_10641649 | Ga0070710_106416492 | 153 |
| 221 | 3300005439 | Ga0070711_100003229 | Ga0070711_1000032294 | 153 |
| 222 | 3300005439 | Ga0070711_100019383 | Ga0070711_1000193833 | 153 |
| 223 | 3300005439 | Ga0070711_100024479 | Ga0070711_1000244793 | 153 |
| 224 | 3300005444 | Ga0070694_100527569 | Ga0070694_1005275692 | 153 |
| 225 | 3300005444 | Ga0070694_100801545 | Ga0070694_1008015451 | 153 |
| 226 | 3300005445 | Ga0070708_100129226 | Ga0070708_1001292262 | 153 |
| 227 | 3300005455 | Ga0070663_100047389 | Ga0070663_1000473893 | 153 |
| 228 | 3300005455 | Ga0070663_100240136 | Ga0070663_1002401363 | 153 |
| 229 | 3300005455 | Ga0070663_100289021 | Ga0070663_1002890212 | 153 |
| 230 | 3300005455 | Ga0070663_100368589 | Ga0070663_1003685891 | 153 |
| 231 | 3300005456 | Ga0070678_100185071 | Ga0070678_1001850713 | 153 |
| 232 | 3300005456 | Ga0070678_100228337 | Ga0070678_1002283372 | 153 |
| 233 | 3300005457 | Ga0070662_100101270 | Ga0070662_1001012702 | 153 |
| 234 | 3300005457 | Ga0070662_100745308 | Ga0070662_1007453081 | 153 |
| 235 | 3300005458 | Ga0070681_10005095 | Ga0070681_100050954 | 153 |
| 236 | 3300005458 | Ga0070681_10006707 | Ga0070681_1000670710 | 153 |
| 237 | 3300005458 | Ga0070681_10085129 | Ga0070681_100851293 | 153 |
| 238 | 3300005458 | Ga0070681_10328629 | Ga0070681_103286292 | 153 |
| 239 | 3300005458 | Ga0070681_10726322 | Ga0070681_107263221 | 153 |
| 240 | 3300005458 | Ga0070681_11745969 | Ga0070681_117459691 | 153 |
| 241 | 3300005467 | Ga0070706_100304014 | Ga0070706_1003040142 | 153 |
| 242 | 3300005467 | Ga0070706_100400523 | Ga0070706_1004005232 | 153 |
| 243 | 3300005471 | Ga0070698_100074338 | Ga0070698_1000743383 | 153 |
| 244 | 3300005471 | Ga0070698_100220198 | Ga0070698_1002201982 | 153 |
| 245 | 3300005471 | Ga0070698_100326992 | Ga0070698_1003269922 | 153 |
| 246 | 3300005530 | Ga0070679_100037795 | Ga0070679_1000377954 | 153 |
| 247 | 3300005530 | Ga0070679_100055759 | Ga0070679_1000557593 | 153 |
| 248 | 3300005530 | Ga0070679_100094267 | Ga0070679_1000942674 | 153 |
| 249 | 3300005530 | Ga0070679_100111091 | Ga0070679_1001110912 | 153 |
| 250 | 3300005530 | Ga0070679_100772411 | Ga0070679_1007724112 | 153 |
| 251 | 3300005530 | Ga0070679_101045829 | Ga0070679_1010458291 | 153 |
| 252 | 3300005535 | Ga0070684_100002527 | Ga0070684_1000025274 | 153 |
| 253 | 3300005535 | Ga0070684_100051408 | Ga0070684_1000514083 | 153 |
| 254 | 3300005535 | Ga0070684_100148173 | Ga0070684_1001481732 | 153 |
| 255 | 3300005535 | Ga0070684_100296017 | Ga0070684_1002960171 | 153 |
| 256 | 3300005539 | Ga0068853_100012545 | Ga0068853_1000125453 | 153 |
| 257 | 3300005539 | Ga0068853_100092352 | Ga0068853_1000923522 | 153 |
| 258 | 3300005539 | Ga0068853_100234150 | Ga0068853_1002341502 | 153 |
| 259 | 3300005539 | Ga0068853_100380670 | Ga0068853_1003806702 | 153 |
| 260 | 3300005539 | Ga0068853_100629957 | Ga0068853_1006299572 | 153 |
| 261 | 3300005539 | Ga0068853_101261304 | Ga0068853_1012613042 | 153 |
| 262 | 3300005543 | Ga0070672_100477049 | Ga0070672_1004770492 | 153 |
| 263 | 3300005545 | Ga0070695_100551589 | Ga0070695_1005515892 | 153 |
| 264 | 3300005547 | Ga0070693_100275530 | Ga0070693_1002755302 | 153 |
| 265 | 3300005547 | Ga0070693_100295747 | Ga0070693_1002957472 | 153 |
| 266 | 3300005548 | Ga0070665_100021649 | Ga0070665_1000216495 | 153 |
| 267 | 3300005548 | Ga0070665_100106979 | Ga0070665_1001069792 | 153 |
| 268 | 3300005548 | Ga0070665_100124068 | Ga0070665_1001240682 | 153 |
| 269 | 3300005548 | Ga0070665_100301910 | Ga0070665_1003019101 | 153 |
| 270 | 3300005563 | Ga0068855_100034077 | Ga0068855_1000340775 | 153 |
| 271 | 3300005563 | Ga0068855_100364411 | Ga0068855_1003644111 | 153 |
| 272 | 3300005563 | Ga0068855_100747051 | Ga0068855_1007470512 | 153 |
| 273 | 3300005563 | Ga0068855_101860781 | Ga0068855_1018607811 | 153 |
| 274 | 3300005564 | Ga0070664_100150017 | Ga0070664_1001500172 | 153 |
| 275 | 3300005564 | Ga0070664_100394887 | Ga0070664_1003948871 | 153 |
| 276 | 3300005564 | Ga0070664_101195936 | Ga0070664_1011959361 | 153 |
| 277 | 3300005577 | Ga0068857_100025397 | Ga0068857_1000253973 | 153 |
| 278 | 3300005577 | Ga0068857_100494946 | Ga0068857_1004949462 | 153 |
| 279 | 3300005578 | Ga0068854_100397014 | Ga0068854_1003970142 | 153 |
| 280 | 3300005578 | Ga0068854_100444079 | Ga0068854_1004440791 | 153 |
| 281 | 3300005614 | Ga0068856_100040177 | Ga0068856_1000401772 | 153 |
| 282 | 3300005614 | Ga0068856_100188037 | Ga0068856_1001880373 | 153 |
| 283 | 3300005614 | Ga0068856_100932901 | Ga0068856_1009329011 | 153 |
| 284 | 3300005615 | Ga0070702_100128310 | Ga0070702_1001283101 | 153 |
| 285 | 3300005615 | Ga0070702_100482888 | Ga0070702_1004828882 | 153 |
| 286 | 3300005616 | Ga0068852_100071443 | Ga0068852_1000714433 | 153 |
| 287 | 3300005616 | Ga0068852_100214457 | Ga0068852_1002144572 | 153 |
| 288 | 3300005616 | Ga0068852_100945521 | Ga0068852_1009455212 | 153 |
| 289 | 3300005618 | Ga0068864_100112090 | Ga0068864_1001120901 | 153 |
| 290 | 3300005618 | Ga0068864_100149203 | Ga0068864_1001492032 | 153 |
| 291 | 3300005618 | Ga0068864_100303283 | Ga0068864_1003032834 | 153 |
| 292 | 3300005618 | Ga0068864_100386226 | Ga0068864_1003862262 | 153 |
| 293 | 3300005719 | Ga0068861_100042275 | Ga0068861_1000422752 | 153 |
| 294 | 3300005834 | Ga0068851_10001206 | Ga0068851_100012065 | 153 |
| 295 | 3300005834 | Ga0068851_10853706 | Ga0068851_108537061 | 153 |
| 296 | 3300005840 | Ga0068870_10039043 | Ga0068870_100390433 | 153 |
| 297 | 3300005841 | Ga0068863_100412187 | Ga0068863_1004121872 | 153 |
| 298 | 3300005842 | Ga0068858_100042777 | Ga0068858_1000427773 | 153 |
| 299 | 3300005842 | Ga0068858_100224211 | Ga0068858_1002242111 | 153 |
| 300 | 3300005842 | Ga0068858_100419664 | Ga0068858_1004196642 | 153 |
| 301 | 3300005842 | Ga0068858_100980137 | Ga0068858_1009801372 | 153 |
| 302 | 3300005843 | Ga0068860_100124121 | Ga0068860_1001241213 | 153 |
| 303 | 3300005843 | Ga0068860_101088991 | Ga0068860_1010889912 | 153 |
| 304 | 3300005844 | Ga0068862_100053763 | Ga0068862_1000537633 | 153 |
| 305 | 3300005937 | Ga0081455_10252274 | Ga0081455_102522742 | 153 |
| 306 | 3300005983 | Ga0081540_1026137 | Ga0081540_10261374 | 153 |
| 307 | 3300005983 | Ga0081540_1142344 | Ga0081540_11423442 | 153 |
| 308 | 3300006028 | Ga0070717_10002140 | Ga0070717_1000214010 | 153 |
| 309 | 3300006028 | Ga0070717_10005547 | Ga0070717_100055473 | 153 |
| 310 | 3300006028 | Ga0070717_10022680 | Ga0070717_100226803 | 153 |
| 311 | 3300006028 | Ga0070717_10278877 | Ga0070717_102788772 | 153 |
| 312 | 3300006028 | Ga0070717_10459558 | Ga0070717_104595582 | 153 |
| 313 | 3300006038 | Ga0075365_10082143 | Ga0075365_100821432 | 153 |
| 314 | 3300006038 | Ga0075365_10082825 | Ga0075365_100828252 | 153 |
| 315 | 3300006042 | Ga0075368_10056630 | Ga0075368_100566304 | 153 |
| 316 | 3300006048 | Ga0075363_100050059 | Ga0075363_1000500592 | 153 |
| 317 | 3300006051 | Ga0075364_10136674 | Ga0075364_101366742 | 153 |
| 318 | 3300006163 | Ga0070715_10001480 | Ga0070715_100014808 | 153 |
| 319 | 3300006163 | Ga0070715_10094023 | Ga0070715_100940232 | 153 |
| 320 | 3300006163 | Ga0070715_10293906 | Ga0070715_102939061 | 153 |
| 321 | 3300006173 | Ga0070716_100050844 | Ga0070716_1000508443 | 153 |
| 322 | 3300006173 | Ga0070716_100089790 | Ga0070716_1000897903 | 153 |
| 323 | 3300006173 | Ga0070716_100124803 | Ga0070716_1001248031 | 153 |
| 324 | 3300006173 | Ga0070716_100125300 | Ga0070716_1001253002 | 153 |
| 325 | 3300006173 | Ga0070716_100214089 | Ga0070716_1002140892 | 153 |
| 326 | 3300006173 | Ga0070716_100352250 | Ga0070716_1003522501 | 153 |
| 327 | 3300006173 | Ga0070716_100526190 | Ga0070716_1005261901 | 153 |
| 328 | 3300006175 | Ga0070712_100021818 | Ga0070712_1000218182 | 153 |
| 329 | 3300006175 | Ga0070712_100055365 | Ga0070712_1000553653 | 153 |
| 330 | 3300006175 | Ga0070712_100237660 | Ga0070712_1002376602 | 153 |
| 331 | 3300006175 | Ga0070712_100386456 | Ga0070712_1003864562 | 153 |
| 332 | 3300006175 | Ga0070712_100491597 | Ga0070712_1004915972 | 153 |
| 333 | 3300006175 | Ga0070712_100795788 | Ga0070712_1007957883 | 153 |
| 334 | 3300006178 | Ga0075367_10038655 | Ga0075367_100386553 | 153 |
| 335 | 3300006178 | Ga0075367_10157989 | Ga0075367_101579892 | 153 |
| 336 | 3300006195 | Ga0075366_10029987 | Ga0075366_100299872 | 153 |
| 337 | 3300006195 | Ga0075366_10046408 | Ga0075366_100464083 | 153 |
| 338 | 3300006195 | Ga0075366_10799967 | Ga0075366_107999671 | 153 |
| 339 | 3300006237 | Ga0097621_100582349 | Ga0097621_1005823492 | 153 |
| 340 | 3300006353 | Ga0075370_10024128 | Ga0075370_100241283 | 153 |
| 341 | 3300006353 | Ga0075370_10074510 | Ga0075370_100745101 | 153 |
| 342 | 3300006353 | Ga0075370_10149586 | Ga0075370_101495862 | 153 |
| 343 | 3300006358 | Ga0068871_100065852 | Ga0068871_1000658523 | 153 |
| 344 | 3300006358 | Ga0068871_102131530 | Ga0068871_1021315301 | 153 |
| 345 | 3300006871 | Ga0075434_100019249 | Ga0075434_1000192498 | 153 |
| 346 | 3300006871 | Ga0075434_100071223 | Ga0075434_1000712231 | 153 |
| 347 | 3300006881 | Ga0068865_100059487 | Ga0068865_1000594872 | 153 |
| 348 | 3300006941 | Ga0099825_1037663 | Ga0099825_10376632 | 153 |
| 349 | 3300006942 | Ga0099824_1004403 | Ga0099824_100440314 | 153 |
| 350 | 3300006943 | Ga0099822_1010345 | Ga0099822_10103453 | 153 |
| 351 | 3300007076 | Ga0075435_100072236 | Ga0075435_1000722362 | 153 |
| 352 | 3300007076 | Ga0075435_100185678 | Ga0075435_1001856782 | 153 |
| 353 | 3300007265 | Ga0099794_10044069 | Ga0099794_100440692 | 153 |
| 354 | 3300007265 | Ga0099794_10049659 | Ga0099794_100496592 | 153 |
| 355 | 3300007265 | Ga0099794_10128070 | Ga0099794_101280702 | 153 |
| 356 | 3300007265 | Ga0099794_10238940 | Ga0099794_102389402 | 153 |
| 357 | 3300007788 | Ga0099795_10028392 | Ga0099795_100283921 | 153 |
| 358 | 3300007788 | Ga0099795_10056583 | Ga0099795_100565831 | 153 |
| 359 | 3300007788 | Ga0099795_10082883 | Ga0099795_100828832 | 153 |
| 360 | 3300009092 | Ga0105250_10113993 | Ga0105250_101139931 | 153 |
| 361 | 3300009093 | Ga0105240_10011430 | Ga0105240_100114303 | 153 |
| 362 | 3300009093 | Ga0105240_10033677 | Ga0105240_100336773 | 153 |
| 363 | 3300009093 | Ga0105240_10041672 | Ga0105240_100416723 | 153 |
| 364 | 3300009093 | Ga0105240_10174546 | Ga0105240_101745463 | 153 |
| 365 | 3300009093 | Ga0105240_10434589 | Ga0105240_104345891 | 153 |
| 366 | 3300009094 | Ga0111539_10520252 | Ga0111539_105202523 | 153 |
| 367 | 3300009094 | Ga0111539_12259434 | Ga0111539_122594341 | 153 |
| 368 | 3300009098 | Ga0105245_10010375 | Ga0105245_100103752 | 153 |
| 369 | 3300009098 | Ga0105245_10041649 | Ga0105245_100416493 | 153 |
| 370 | 3300009101 | Ga0105247_10024997 | Ga0105247_100249971 | 153 |
| 371 | 3300009101 | Ga0105247_10052319 | Ga0105247_100523193 | 153 |
| 372 | 3300009148 | Ga0105243_10953299 | Ga0105243_109532992 | 153 |
| 373 | 3300009174 | Ga0105241_10008992 | Ga0105241_100089923 | 153 |
| 374 | 3300009174 | Ga0105241_10098436 | Ga0105241_100984362 | 153 |
| 375 | 3300009174 | Ga0105241_10292561 | Ga0105241_102925612 | 153 |
| 376 | 3300009176 | Ga0105242_10139312 | Ga0105242_101393122 | 153 |
| 377 | 3300009177 | Ga0105248_10007295 | Ga0105248_100072957 | 153 |
| 378 | 3300009177 | Ga0105248_10322149 | Ga0105248_103221491 | 153 |
| 379 | 3300009177 | Ga0105248_10439338 | Ga0105248_104393382 | 153 |
| 380 | 3300009177 | Ga0105248_10511467 | Ga0105248_105114671 | 153 |
| 381 | 3300009545 | Ga0105237_10020611 | Ga0105237_100206112 | 153 |
| 382 | 3300009545 | Ga0105237_10090787 | Ga0105237_100907871 | 153 |
| 383 | 3300009545 | Ga0105237_10107427 | Ga0105237_101074272 | 153 |
| 384 | 3300009545 | Ga0105237_10317087 | Ga0105237_103170872 | 153 |
| 385 | 3300009545 | Ga0105237_10342056 | Ga0105237_103420562 | 153 |
| 386 | 3300009545 | Ga0105237_10357241 | Ga0105237_103572412 | 153 |
| 387 | 3300009545 | Ga0105237_10864703 | Ga0105237_108647032 | 153 |
| 388 | 3300009545 | Ga0105237_11127656 | Ga0105237_111276561 | 153 |
| 389 | 3300009545 | Ga0105237_11152515 | Ga0105237_111525151 | 153 |
| 390 | 3300009551 | Ga0105238_10002484 | Ga0105238_100024845 | 153 |
| 391 | 3300009551 | Ga0105238_10010951 | Ga0105238_100109513 | 153 |
| 392 | 3300009551 | Ga0105238_10080278 | Ga0105238_100802783 | 153 |
| 393 | 3300009551 | Ga0105238_10125769 | Ga0105238_101257693 | 153 |
| 394 | 3300009551 | Ga0105238_10132782 | Ga0105238_101327822 | 153 |
| 395 | 3300009551 | Ga0105238_10167854 | Ga0105238_101678542 | 153 |
| 396 | 3300009551 | Ga0105238_10192295 | Ga0105238_101922952 | 153 |
| 397 | 3300009551 | Ga0105238_10301821 | Ga0105238_103018212 | 153 |
| 398 | 3300009551 | Ga0105238_10498867 | Ga0105238_104988672 | 153 |
| 399 | 3300009551 | Ga0105238_10619763 | Ga0105238_106197632 | 153 |
| 400 | 3300009553 | Ga0105249_10283975 | Ga0105249_102839751 | 153 |
| 401 | 3300010159 | Ga0099796_10012129 | Ga0099796_100121293 | 153 |
| 402 | 3300010159 | Ga0099796_10023786 | Ga0099796_100237863 | 153 |
| 403 | 3300010159 | Ga0099796_10057068 | Ga0099796_100570683 | 153 |
| 404 | 3300010375 | Ga0105239_10046757 | Ga0105239_100467573 | 153 |
| 405 | 3300010375 | Ga0105239_10053947 | Ga0105239_100539472 | 153 |
| 406 | 3300010375 | Ga0105239_10069461 | Ga0105239_100694612 | 153 |
| 407 | 3300010375 | Ga0105239_10150170 | Ga0105239_101501702 | 153 |
| 408 | 3300010375 | Ga0105239_10215960 | Ga0105239_102159602 | 153 |
| 409 | 3300010375 | Ga0105239_10400524 | Ga0105239_104005242 | 153 |
| 410 | 3300010375 | Ga0105239_10473487 | Ga0105239_104734872 | 153 |
| 411 | 3300010375 | Ga0105239_10521800 | Ga0105239_105218003 | 153 |
| 412 | 3300010375 | Ga0105239_12028928 | Ga0105239_120289281 | 153 |
| 413 | 3300011119 | Ga0105246_10004587 | Ga0105246_100045877 | 153 |
| 414 | 3300011119 | Ga0105246_10038703 | Ga0105246_100387033 | 153 |
| 415 | 3300011119 | Ga0105246_10052688 | Ga0105246_100526883 | 153 |
| 416 | 3300011119 | Ga0105246_10283331 | Ga0105246_102833312 | 153 |
| 417 | 3300013100 | Ga0157373_10095005 | Ga0157373_100950052 | 153 |
| 418 | 3300013102 | Ga0157371_10064333 | Ga0157371_100643333 | 153 |
| 419 | 3300013104 | Ga0157370_10012436 | Ga0157370_100124362 | 153 |
| 420 | 3300013104 | Ga0157370_10026797 | Ga0157370_100267973 | 153 |
| 421 | 3300013104 | Ga0157370_10032211 | Ga0157370_100322113 | 153 |
| 422 | 3300013104 | Ga0157370_10210884 | Ga0157370_102108842 | 153 |
| 423 | 3300013104 | Ga0157370_10360975 | Ga0157370_103609752 | 153 |
| 424 | 3300013105 | Ga0157369_10005811 | Ga0157369_100058115 | 153 |
| 425 | 3300013105 | Ga0157369_10018574 | Ga0157369_100185745 | 153 |
| 426 | 3300013105 | Ga0157369_10025441 | Ga0157369_100254412 | 153 |
| 427 | 3300013105 | Ga0157369_10109029 | Ga0157369_101090293 | 153 |
| 428 | 3300013105 | Ga0157369_11289808 | Ga0157369_112898081 | 153 |
| 429 | 3300013296 | Ga0157374_10007971 | Ga0157374_100079716 | 153 |
| 430 | 3300013296 | Ga0157374_10025510 | Ga0157374_100255103 | 153 |
| 431 | 3300013296 | Ga0157374_10073117 | Ga0157374_100731173 | 153 |
| 432 | 3300013296 | Ga0157374_10497389 | Ga0157374_104973892 | 153 |
| 433 | 3300013297 | Ga0157378_10077118 | Ga0157378_100771183 | 153 |
| 434 | 3300013306 | Ga0163162_10110844 | Ga0163162_101108442 | 153 |
| 435 | 3300013306 | Ga0163162_10139362 | Ga0163162_101393622 | 153 |
| 436 | 3300013306 | Ga0163162_10294129 | Ga0163162_102941292 | 153 |
| 437 | 3300013306 | Ga0163162_11131291 | Ga0163162_111312912 | 153 |
| 438 | 3300013306 | Ga0163162_11431088 | Ga0163162_114310881 | 153 |
| 439 | 3300013306 | Ga0163162_11514511 | Ga0163162_115145111 | 153 |
| 440 | 3300013307 | Ga0157372_10045854 | Ga0157372_100458541 | 153 |
| 441 | 3300013307 | Ga0157372_10059405 | Ga0157372_100594053 | 153 |
| 442 | 3300013307 | Ga0157372_10258661 | Ga0157372_102586612 | 153 |
| 443 | 3300013307 | Ga0157372_10785701 | Ga0157372_107857012 | 153 |
| 444 | 3300013307 | Ga0157372_11712331 | Ga0157372_117123311 | 153 |
| 445 | 3300013308 | Ga0157375_10009619 | Ga0157375_100096193 | 153 |
| 446 | 3300013308 | Ga0157375_10420774 | Ga0157375_104207741 | 153 |
| 447 | 3300014325 | Ga0163163_10046523 | Ga0163163_100465234 | 153 |
| 448 | 3300014325 | Ga0163163_10060622 | Ga0163163_100606225 | 153 |
| 449 | 3300014326 | Ga0157380_10116271 | Ga0157380_101162713 | 153 |
| 450 | 3300014745 | Ga0157377_10075301 | Ga0157377_100753012 | 153 |
| 451 | 3300014745 | Ga0157377_10303368 | Ga0157377_103033682 | 153 |
| 452 | 3300014968 | Ga0157379_10039979 | Ga0157379_100399793 | 153 |
| 453 | 3300014968 | Ga0157379_10261564 | Ga0157379_102615642 | 153 |
| 454 | 3300014969 | Ga0157376_10048036 | Ga0157376_100480363 | 153 |
| 455 | 3300014969 | Ga0157376_10272345 | Ga0157376_102723452 | 153 |
| 456 | 3300017792 | Ga0163161_10395348 | Ga0163161_103953481 | 153 |
| 457 | 3300020082 | Ga0206353_10729202 | Ga0206353_107292021 | 153 |
| 458 | 3300021358 | Ga0213873_10016491 | Ga0213873_100164912 | 153 |
| 459 | 3300021361 | Ga0213872_10077681 | Ga0213872_100776812 | 153 |
| 460 | 3300021384 | Ga0213876_10048362 | Ga0213876_100483622 | 153 |
| 461 | 3300021384 | Ga0213876_10100808 | Ga0213876_101008082 | 153 |
| 462 | 3300021388 | Ga0213875_10069571 | Ga0213875_100695712 | 153 |
| 463 | 3300021441 | Ga0213871_10024691 | Ga0213871_100246912 | 153 |
| 464 | 3300025253 | Ga0209677_103424 | Ga0209677_1034244 | 153 |
| 465 | 3300025254 | Ga0209148_1007368 | Ga0209148_10073683 | 153 |
| 466 | 3300025261 | Ga0209233_1003510 | Ga0209233_10035105 | 153 |
| 467 | 3300025261 | Ga0209233_1004457 | Ga0209233_10044573 | 153 |
| 468 | 3300025272 | Ga0209455_1004847 | Ga0209455_10048472 | 153 |
| 469 | 3300025272 | Ga0209455_1011161 | Ga0209455_10111612 | 153 |
| 470 | 3300025297 | Ga0209758_1003593 | Ga0209758_10035938 | 153 |
| 471 | 3300025321 | Ga0207656_10001137 | Ga0207656_100011375 | 153 |
| 472 | 3300025898 | Ga0207692_10055141 | Ga0207692_100551412 | 153 |
| 473 | 3300025898 | Ga0207692_10083372 | Ga0207692_100833722 | 153 |
| 474 | 3300025898 | Ga0207692_10121321 | Ga0207692_101213212 | 153 |
| 475 | 3300025898 | Ga0207692_10194240 | Ga0207692_101942402 | 153 |
| 476 | 3300025898 | Ga0207692_10240782 | Ga0207692_102407821 | 153 |
| 477 | 3300025898 | Ga0207692_10511720 | Ga0207692_105117201 | 153 |
| 478 | 3300025900 | Ga0207710_10026452 | Ga0207710_100264522 | 153 |
| 479 | 3300025900 | Ga0207710_10227818 | Ga0207710_102278181 | 153 |
| 480 | 3300025901 | Ga0207688_10021898 | Ga0207688_100218983 | 153 |
| 481 | 3300025901 | Ga0207688_10037540 | Ga0207688_100375402 | 153 |
| 482 | 3300025904 | Ga0207647_10043784 | Ga0207647_100437843 | 153 |
| 483 | 3300025904 | Ga0207647_10135717 | Ga0207647_101357172 | 153 |
| 484 | 3300025904 | Ga0207647_10141574 | Ga0207647_101415743 | 153 |
| 485 | 3300025904 | Ga0207647_10235786 | Ga0207647_102357862 | 153 |
| 486 | 3300025905 | Ga0207685_10088570 | Ga0207685_100885701 | 153 |
| 487 | 3300025905 | Ga0207685_10212952 | Ga0207685_102129522 | 153 |
| 488 | 3300025905 | Ga0207685_10310783 | Ga0207685_103107831 | 153 |
| 489 | 3300025906 | Ga0207699_10002259 | Ga0207699_100022595 | 153 |
| 490 | 3300025906 | Ga0207699_10003128 | Ga0207699_100031289 | 153 |
| 491 | 3300025906 | Ga0207699_10007908 | Ga0207699_100079084 | 153 |
| 492 | 3300025906 | Ga0207699_10017498 | Ga0207699_100174983 | 153 |
| 493 | 3300025906 | Ga0207699_10205233 | Ga0207699_102052332 | 153 |
| 494 | 3300025906 | Ga0207699_10347888 | Ga0207699_103478882 | 153 |
| 495 | 3300025906 | Ga0207699_10901810 | Ga0207699_109018101 | 153 |
| 496 | 3300025909 | Ga0207705_10080181 | Ga0207705_100801813 | 153 |
| 497 | 3300025909 | Ga0207705_10096802 | Ga0207705_100968021 | 153 |
| 498 | 3300025909 | Ga0207705_10136991 | Ga0207705_101369912 | 153 |
| 499 | 3300025910 | Ga0207684_10017435 | Ga0207684_100174353 | 153 |
| 500 | 3300025910 | Ga0207684_10289773 | Ga0207684_102897732 | 153 |
| 501 | 3300025910 | Ga0207684_10612818 | Ga0207684_106128181 | 153 |
| 502 | 3300025910 | Ga0207684_11274979 | Ga0207684_112749791 | 153 |
| 503 | 3300025911 | Ga0207654_10015391 | Ga0207654_100153913 | 153 |
| 504 | 3300025911 | Ga0207654_10493473 | Ga0207654_104934732 | 153 |
| 505 | 3300025912 | Ga0207707_10000359 | Ga0207707_1000035924 | 153 |
| 506 | 3300025912 | Ga0207707_10010747 | Ga0207707_100107472 | 153 |
| 507 | 3300025912 | Ga0207707_10030608 | Ga0207707_100306085 | 153 |
| 508 | 3300025912 | Ga0207707_10112286 | Ga0207707_101122863 | 153 |
| 509 | 3300025912 | Ga0207707_10427986 | Ga0207707_104279862 | 153 |
| 510 | 3300025912 | Ga0207707_10669275 | Ga0207707_106692751 | 153 |
| 511 | 3300025913 | Ga0207695_10015120 | Ga0207695_100151206 | 153 |
| 512 | 3300025913 | Ga0207695_10042841 | Ga0207695_100428413 | 153 |
| 513 | 3300025913 | Ga0207695_10096157 | Ga0207695_100961573 | 153 |
| 514 | 3300025913 | Ga0207695_11225365 | Ga0207695_112253651 | 153 |
| 515 | 3300025914 | Ga0207671_10065375 | Ga0207671_100653752 | 153 |
| 516 | 3300025914 | Ga0207671_10272611 | Ga0207671_102726112 | 153 |
| 517 | 3300025914 | Ga0207671_10746561 | Ga0207671_107465611 | 153 |
| 518 | 3300025914 | Ga0207671_11028289 | Ga0207671_110282891 | 153 |
| 519 | 3300025915 | Ga0207693_10000581 | Ga0207693_1000058120 | 153 |
| 520 | 3300025915 | Ga0207693_10003453 | Ga0207693_100034539 | 153 |
| 521 | 3300025915 | Ga0207693_10111900 | Ga0207693_101119003 | 153 |
| 522 | 3300025915 | Ga0207693_10253283 | Ga0207693_102532832 | 153 |
| 523 | 3300025915 | Ga0207693_10270756 | Ga0207693_102707562 | 153 |
| 524 | 3300025916 | Ga0207663_10000084 | Ga0207663_100000849 | 153 |
| 525 | 3300025916 | Ga0207663_10008412 | Ga0207663_100084123 | 153 |
| 526 | 3300025916 | Ga0207663_10054543 | Ga0207663_100545434 | 153 |
| 527 | 3300025916 | Ga0207663_10137659 | Ga0207663_101376593 | 153 |
| 528 | 3300025917 | Ga0207660_10008448 | Ga0207660_100084482 | 153 |
| 529 | 3300025917 | Ga0207660_10022333 | Ga0207660_100223333 | 153 |
| 530 | 3300025917 | Ga0207660_10045743 | Ga0207660_100457432 | 153 |
| 531 | 3300025917 | Ga0207660_10056652 | Ga0207660_100566522 | 153 |
| 532 | 3300025917 | Ga0207660_10094596 | Ga0207660_100945962 | 153 |
| 533 | 3300025917 | Ga0207660_10229577 | Ga0207660_102295772 | 153 |
| 534 | 3300025917 | Ga0207660_10608780 | Ga0207660_106087801 | 153 |
| 535 | 3300025919 | Ga0207657_10007612 | Ga0207657_100076129 | 153 |
| 536 | 3300025919 | Ga0207657_10050134 | Ga0207657_100501342 | 153 |
| 537 | 3300025920 | Ga0207649_10088873 | Ga0207649_100888733 | 153 |
| 538 | 3300025920 | Ga0207649_10631680 | Ga0207649_106316802 | 153 |
| 539 | 3300025920 | Ga0207649_10926056 | Ga0207649_109260561 | 153 |
| 540 | 3300025921 | Ga0207652_10001857 | Ga0207652_100018575 | 153 |
| 541 | 3300025921 | Ga0207652_10018612 | Ga0207652_100186124 | 153 |
| 542 | 3300025921 | Ga0207652_10222393 | Ga0207652_102223932 | 153 |
| 543 | 3300025921 | Ga0207652_10864530 | Ga0207652_108645301 | 153 |
| 544 | 3300025921 | Ga0207652_11072876 | Ga0207652_110728761 | 153 |
| 545 | 3300025921 | Ga0207652_11161666 | Ga0207652_111616661 | 153 |
| 546 | 3300025924 | Ga0207694_10008673 | Ga0207694_100086734 | 153 |
| 547 | 3300025924 | Ga0207694_10050805 | Ga0207694_100508052 | 153 |
| 548 | 3300025924 | Ga0207694_10297841 | Ga0207694_102978412 | 153 |
| 549 | 3300025924 | Ga0207694_10306093 | Ga0207694_103060932 | 153 |
| 550 | 3300025924 | Ga0207694_10539356 | Ga0207694_105393561 | 153 |
| 551 | 3300025924 | Ga0207694_10555686 | Ga0207694_105556862 | 153 |
| 552 | 3300025927 | Ga0207687_10061184 | Ga0207687_100611842 | 153 |
| 553 | 3300025927 | Ga0207687_10399768 | Ga0207687_103997682 | 153 |
| 554 | 3300025928 | Ga0207700_10002181 | Ga0207700_100021813 | 153 |
| 555 | 3300025928 | Ga0207700_10002410 | Ga0207700_100024106 | 153 |
| 556 | 3300025928 | Ga0207700_10011068 | Ga0207700_100110683 | 153 |
| 557 | 3300025928 | Ga0207700_10102508 | Ga0207700_101025082 | 153 |
| 558 | 3300025928 | Ga0207700_10321622 | Ga0207700_103216222 | 153 |
| 559 | 3300025928 | Ga0207700_10422071 | Ga0207700_104220712 | 153 |
| 560 | 3300025929 | Ga0207664_10033743 | Ga0207664_100337433 | 153 |
| 561 | 3300025929 | Ga0207664_10776847 | Ga0207664_107768472 | 153 |
| 562 | 3300025931 | Ga0207644_10211660 | Ga0207644_102116602 | 153 |
| 563 | 3300025931 | Ga0207644_10414897 | Ga0207644_104148972 | 153 |
| 564 | 3300025931 | Ga0207644_10915142 | Ga0207644_109151421 | 153 |
| 565 | 3300025932 | Ga0207690_10165092 | Ga0207690_101650922 | 153 |
| 566 | 3300025932 | Ga0207690_10535873 | Ga0207690_105358731 | 153 |
| 567 | 3300025933 | Ga0207706_10071983 | Ga0207706_100719833 | 153 |
| 568 | 3300025934 | Ga0207686_10418701 | Ga0207686_104187011 | 153 |
| 569 | 3300025935 | Ga0207709_10191202 | Ga0207709_101912023 | 153 |
| 570 | 3300025938 | Ga0207704_10492411 | Ga0207704_104924111 | 153 |
| 571 | 3300025939 | Ga0207665_10001451 | Ga0207665_1000145110 | 153 |
| 572 | 3300025939 | Ga0207665_10019859 | Ga0207665_100198592 | 153 |
| 573 | 3300025939 | Ga0207665_10021271 | Ga0207665_100212714 | 153 |
| 574 | 3300025939 | Ga0207665_10254343 | Ga0207665_102543432 | 153 |
| 575 | 3300025941 | Ga0207711_10045435 | Ga0207711_100454352 | 153 |
| 576 | 3300025942 | Ga0207689_10030221 | Ga0207689_100302214 | 153 |
| 577 | 3300025944 | Ga0207661_10001574 | Ga0207661_100015748 | 153 |
| 578 | 3300025944 | Ga0207661_10045131 | Ga0207661_100451312 | 153 |
| 579 | 3300025945 | Ga0207679_10256663 | Ga0207679_102566631 | 153 |
| 580 | 3300025945 | Ga0207679_10434123 | Ga0207679_104341231 | 153 |
| 581 | 3300025945 | Ga0207679_10570800 | Ga0207679_105708002 | 153 |
| 582 | 3300025949 | Ga0207667_10011919 | Ga0207667_100119197 | 153 |
| 583 | 3300025949 | Ga0207667_10107180 | Ga0207667_101071802 | 153 |
| 584 | 3300025949 | Ga0207667_10380094 | Ga0207667_103800941 | 153 |
| 585 | 3300025949 | Ga0207667_10936257 | Ga0207667_109362571 | 153 |
| 586 | 3300025960 | Ga0207651_10085394 | Ga0207651_100853942 | 153 |
| 587 | 3300025961 | Ga0207712_10360888 | Ga0207712_103608882 | 153 |
| 588 | 3300025981 | Ga0207640_10569046 | Ga0207640_105690461 | 153 |
| 589 | 3300025986 | Ga0207658_11469893 | Ga0207658_114698931 | 153 |
| 590 | 3300026023 | Ga0207677_10017270 | Ga0207677_100172702 | 153 |
| 591 | 3300026023 | Ga0207677_10620284 | Ga0207677_106202842 | 153 |
| 592 | 3300026035 | Ga0207703_10152408 | Ga0207703_101524082 | 153 |
| 593 | 3300026035 | Ga0207703_11449680 | Ga0207703_114496802 | 153 |
| 594 | 3300026041 | Ga0207639_10075879 | Ga0207639_100758792 | 153 |
| 595 | 3300026041 | Ga0207639_10082509 | Ga0207639_100825092 | 153 |
| 596 | 3300026041 | Ga0207639_10127196 | Ga0207639_101271963 | 153 |
| 597 | 3300026041 | Ga0207639_10221216 | Ga0207639_102212162 | 153 |
| 598 | 3300026041 | Ga0207639_10465652 | Ga0207639_104656522 | 153 |
| 599 | 3300026041 | Ga0207639_10551835 | Ga0207639_105518351 | 153 |
| 600 | 3300026067 | Ga0207678_10021128 | Ga0207678_100211283 | 153 |
| 601 | 3300026067 | Ga0207678_10057693 | Ga0207678_100576932 | 153 |
| 602 | 3300026067 | Ga0207678_10073418 | Ga0207678_100734182 | 153 |
| 603 | 3300026067 | Ga0207678_10460350 | Ga0207678_104603502 | 153 |
| 604 | 3300026067 | Ga0207678_10877321 | Ga0207678_108773211 | 153 |
| 605 | 3300026067 | Ga0207678_11134638 | Ga0207678_111346381 | 153 |
| 606 | 3300026078 | Ga0207702_10025939 | Ga0207702_100259391 | 153 |
| 607 | 3300026078 | Ga0207702_10139175 | Ga0207702_101391753 | 153 |
| 608 | 3300026078 | Ga0207702_10740032 | Ga0207702_107400322 | 153 |
| 609 | 3300026095 | Ga0207676_10126359 | Ga0207676_101263593 | 153 |
| 610 | 3300026095 | Ga0207676_10137279 | Ga0207676_101372793 | 153 |
| 611 | 3300026095 | Ga0207676_10336260 | Ga0207676_103362602 | 153 |
| 612 | 3300026095 | Ga0207676_11022194 | Ga0207676_110221941 | 153 |
| 613 | 3300026116 | Ga0207674_10047527 | Ga0207674_100475272 | 153 |
| 614 | 3300026116 | Ga0207674_11577883 | Ga0207674_115778831 | 153 |
| 615 | 3300026118 | Ga0207675_100053776 | Ga0207675_1000537763 | 153 |
| 616 | 3300026121 | Ga0207683_10027970 | Ga0207683_100279703 | 153 |
| 617 | 3300026121 | Ga0207683_10098624 | Ga0207683_100986243 | 153 |
| 618 | 3300026121 | Ga0207683_10222039 | Ga0207683_102220392 | 153 |
| 619 | 3300026142 | Ga0207698_10016536 | Ga0207698_100165361 | 153 |
| 620 | 3300026142 | Ga0207698_10115167 | Ga0207698_101151671 | 153 |
| 621 | 3300026142 | Ga0207698_10378503 | Ga0207698_103785032 | 153 |
| 622 | 3300026142 | Ga0207698_11083948 | Ga0207698_110839482 | 153 |
| 623 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001231 | 153 |
| 624 | 3300027361 | Ga0209489_100001 | Ga0209489_100001231 | 153 |
| 625 | 3300027363 | Ga0209700_100001 | Ga0209700_100001231 | 153 |
| 626 | 3300027512 | Ga0209179_1029993 | Ga0209179_10299932 | 153 |
| 627 | 3300027866 | Ga0209813_10016059 | Ga0209813_100160592 | 153 |
| 628 | 3300027866 | Ga0209813_10046909 | Ga0209813_100469091 | 153 |
| 629 | 3300028379 | Ga0268266_10044743 | Ga0268266_100447433 | 153 |
| 630 | 3300028379 | Ga0268266_10068095 | Ga0268266_100680953 | 153 |
| 631 | 3300028379 | Ga0268266_10233579 | Ga0268266_102335791 | 153 |
| 632 | 3300028381 | Ga0268264_10026839 | Ga0268264_100268393 | 153 |
| 633 | 3300028556 | Ga0265337_1065525 | Ga0265337_10655251 | 153 |
| 634 | 3300028563 | Ga0265319_1023466 | Ga0265319_10234661 | 153 |
| 635 | 3300028573 | Ga0265334_10001652 | Ga0265334_100016523 | 153 |
| 636 | 3300028653 | Ga0265323_10001443 | Ga0265323_1000144313 | 153 |
| 637 | 3300028654 | Ga0265322_10039901 | Ga0265322_100399012 | 153 |
| 638 | 3300028666 | Ga0265336_10000335 | Ga0265336_1000033512 | 153 |
| 639 | 3300028800 | Ga0265338_10000321 | Ga0265338_1000032126 | 153 |
| 640 | 3300029957 | Ga0265324_10015723 | Ga0265324_100157233 | 153 |
| 641 | 3300030763 | Ga0265763_1002214 | Ga0265763_10022142 | 153 |
| 642 | 3300031235 | Ga0265330_10057434 | Ga0265330_100574342 | 153 |
| 643 | 3300031235 | Ga0265330_10116879 | Ga0265330_101168792 | 153 |
| 644 | 3300031238 | Ga0265332_10040278 | Ga0265332_100402782 | 153 |
| 645 | 3300031238 | Ga0265332_10043920 | Ga0265332_100439201 | 153 |
| 646 | 3300031239 | Ga0265328_10039897 | Ga0265328_100398972 | 153 |
| 647 | 3300031241 | Ga0265325_10002843 | Ga0265325_100028434 | 153 |
| 648 | 3300031247 | Ga0265340_10125235 | Ga0265340_101252352 | 153 |
| 649 | 3300031249 | Ga0265339_10137109 | Ga0265339_101371092 | 153 |
| 650 | 3300031250 | Ga0265331_10094541 | Ga0265331_100945411 | 153 |
| 651 | 3300031250 | Ga0265331_10185792 | Ga0265331_101857922 | 153 |
| 652 | 3300031250 | Ga0265331_10234461 | Ga0265331_102344612 | 153 |
| 653 | 3300031344 | Ga0265316_10357857 | Ga0265316_103578571 | 153 |
| 654 | 3300031344 | Ga0265316_10373207 | Ga0265316_103732072 | 153 |
| 655 | 3300031595 | Ga0265313_10220810 | Ga0265313_102208101 | 153 |
| 656 | 3300031616 | Ga0307508_10180419 | Ga0307508_101804193 | 153 |
| 657 | 3300031711 | Ga0265314_10412105 | Ga0265314_104121051 | 153 |
| 658 | 3300031712 | Ga0265342_10015861 | Ga0265342_100158615 | 153 |
| 659 | 3300031712 | Ga0265342_10028907 | Ga0265342_100289072 | 153 |
| 660 | 3300031712 | Ga0265342_10413998 | Ga0265342_104139981 | 153 |
| 661 | 3300032005 | Ga0307411_10257060 | Ga0307411_102570602 | 153 |
| 662 | 3300033180 | Ga0307510_10159803 | Ga0307510_101598031 | 153 |
| 663 | 3300033442 | Ga0315911_1000006 | Ga0315911_1000006337 | 153 |
| 664 | 3300033544 | Ga0316215_1001093 | Ga0316215_10010931 | 153 |
| 665 | 3300035083 | Ga0373926_0078379 | Ga0373926_0078379_454_918 | 153 |
| 666 | 3300035086 | Ga0373934_0018616 | Ga0373934_0018616_647_1108 | 153 |
| 667 | 3300035086 | Ga0373934_0026167 | Ga0373934_0026167_1242_1706 | 153 |
| 668 | 3300035089 | Ga0373944_0035380 | Ga0373944_0035380_183_647 | 153 |
| 669 | 3300035091 | Ga0373951_0252775 | Ga0373951_0252775_20_481 | 153 |
| 670 | 3300035111 | Ga0373923_0013083 | Ga0373923_0013083_2326_2787 | 153 |
| 671 | 3300035111 | Ga0373923_0113651 | Ga0373923_0113651_46_507 | 153 |
| 672 | 3300035113 | Ga0373936_0020273 | Ga0373936_0020273_667_1128 | 153 |
| 673 | 3300035113 | Ga0373936_0094888 | Ga0373936_0094888_239_700 | 153 |
| 674 | 3300035113 | Ga0373936_0237573 | Ga0373936_0237573_271_732 | 153 |
| 675 | 3300035116 | Ga0373945_0053527 | Ga0373945_0053527_192_653 | 153 |
| 676 | 3300035117 | Ga0373953_0005987 | Ga0373953_0005987_1362_1823 | 153 |
| 677 | 3300035118 | Ga0373954_0077813 | Ga0373954_0077813_656_1117 | 153 |
| 678 | 3300035118 | Ga0373954_0135759 | Ga0373954_0135759_677_1138 | 153 |
| 679 | 3300035119 | Ga0373956_0036736 | Ga0373956_0036736_125_589 | 153 |
| 680 | 3300035120 | Ga0373957_0002003 | Ga0373957_0002003_1687_2148 | 153 |
| 681 | 3300035120 | Ga0373957_0316845 | Ga0373957_0316845_105_566 | 153 |
| 682 | 3300035120 | Ga0373957_0340537 | Ga0373957_0340537_125_589 | 153 |
| 683 | 3300035170 | Ga0373943_0047895 | Ga0373943_0047895_612_1073 | 153 |
| 684 | 3300035170 | Ga0373943_0121655 | Ga0373943_0121655_405_869 | 153 |
| 685 | 3300035170 | Ga0373943_0163581 | Ga0373943_0163581_671_1132 | 153 |
| 686 | 3300035171 | Ga0373946_0000984 | Ga0373946_0000984_3842_4303 | 153 |
| 687 | 3300035171 | Ga0373946_0207549 | Ga0373946_0207549_303_767 | 153 |
| 688 | 3300035171 | Ga0373946_0216540 | Ga0373946_0216540_331_792 | 153 |
| 689 | 3300035172 | Ga0373955_0002892 | Ga0373955_0002892_3436_3897 | 153 |
| 690 | 3300035172 | Ga0373955_0067026 | Ga0373955_0067026_1446_1907 | 153 |
| 691 | 3300035172 | Ga0373955_0177046 | Ga0373955_0177046_247_708 | 153 |
| 692 | 3300035410 | Ga0373924_0006496 | Ga0373924_0006496_1767_2228 | 153 |
| 693 | 3300035692 | Ga0373935_0000769 | Ga0373935_0000769_2911_3372 | 153 |
| 694 | 3300035692 | Ga0373935_0134841 | Ga0373935_0134841_596_1060 | 153 |
| 695 | 3300035692 | Ga0373935_0199476 | Ga0373935_0199476_518_979 | 153 |
| 696 | 3300035692 | Ga0373935_0523742 | Ga0373935_0523742_314_775 | 153 |
| 697 | 3300035695 | Ga0373927_0002152 | Ga0373927_0002152_463_924 | 153 |
| 698 | 3300035695 | Ga0373927_0006718 | Ga0373927_0006718_947_1408 | 153 |
| 699 | 3300035695 | Ga0373927_0069075 | Ga0373927_0069075_1339_1803 | 153 |
| 700 | 3300035695 | Ga0373927_0076271 | Ga0373927_0076271_1043_1504 | 153 |
| 701 | 3300035724 | Ga0373933_0003725 | Ga0373933_0003725_7124_7585 | 153 |
| 702 | 3300035724 | Ga0373933_0024995 | Ga0373933_0024995_361_822 | 153 |
| 703 | 3300035724 | Ga0373933_0110694 | Ga0373933_0110694_892_1353 | 153 |
| 704 | 3300035725 | Ga0373947_0002495 | Ga0373947_0002495_4211_4672 | 153 |
| 705 | 3300035725 | Ga0373947_0013965 | Ga0373947_0013965_1983_2444 | 153 |
| 706 | 3300035725 | Ga0373947_0058241 | Ga0373947_0058241_433_894 | 153 |
| 707 | 3300035725 | Ga0373947_0452871 | Ga0373947_0452871_118_582 | 153 |
| 708 | 3300036401 | Ga0373937_0044375 | Ga0373937_0044375_241_702 | 153 |
| 709 | 3300036401 | Ga0373937_0059943 | Ga0373937_0059943_81_542 | 153 |
| 710 | 3300036401 | Ga0373937_0080055 | Ga0373937_0080055_2408_2869 | 153 |
| 711 | 3300036401 | Ga0373937_0082618 | Ga0373937_0082618_491_952 | 153 |
| 712 | 3300036401 | Ga0373937_0120382 | Ga0373937_0120382_1287_1748 | 153 |
| 713 | 3300036401 | Ga0373937_0335947 | Ga0373937_0335947_277_741 | 153 |
| 714 | 3300036401 | Ga0373937_0800747 | Ga0373937_0800747_393_854 | 153 |
| 715 | 3300036401 | Ga0373937_0890770 | Ga0373937_0890770_145_606 | 153 |
| 716 | 3300036459 | Ga0372808_032717 | Ga0372808_032717_168_629 | 153 |
| 717 | 3300036459 | Ga0372808_049697 | Ga0372808_049697_63_524 | 153 |
| 718 | 3300037068 | Ga0373925_0014642 | Ga0373925_0014642_2625_3086 | 153 |
| 719 | 3300037068 | Ga0373925_0017659 | Ga0373925_0017659_4333_4797 | 153 |
| 720 | 3300037068 | Ga0373925_0055417 | Ga0373925_0055417_1917_2378 | 153 |
| 721 | 3300037068 | Ga0373925_0086872 | Ga0373925_0086872_365_826 | 153 |
| 722 | 3300037068 | Ga0373925_0555204 | Ga0373925_0555204_409_870 | 153 |
| 723 | 3300037312 | Ga0395899_0096351 | Ga0395899_0096351_487_990 | 153 |
| 724 | 3300037312 | Ga0395899_0482062 | Ga0395899_0482062_311_772 | 153 |
| 725 | 3300037418 | Ga0395900_0036594 | Ga0395900_0036594_3042_3503 | 153 |
| 726 | 3300037418 | Ga0395900_0264443 | Ga0395900_0264443_491_970 | 153 |
| 727 | 3300037418 | Ga0395900_0281373 | Ga0395900_0281373_306_767 | 153 |
| 728 | 3300037418 | Ga0395900_1214395 | Ga0395900_1214395_158_631 | 153 |
| 729 | 3300037466 | Ga0395898_0183739 | Ga0395898_0183739_42_515 | 153 |
| 730 | 3300037466 | Ga0395898_0656312 | Ga0395898_0656312_330_833 | 153 |
| 731 | 3300037471 | Ga0395905_0737023 | Ga0395905_0737023_306_767 | 153 |
| 732 | 3300037853 | Ga0436364_1238755 | Ga0436364_1238755_249_722 | 153 |
| 733 | 3300037853 | Ga0436364_1440766 | Ga0436364_1440766_3629_4090 | 153 |
| 734 | 3300038443 | Ga0395901_0102630 | Ga0395901_0102630_763_1224 | 153 |
| 735 | 3300038443 | Ga0395901_0302042 | Ga0395901_0302042_340_843 | 153 |
| 736 | 3300038443 | Ga0395901_0419125 | Ga0395901_0419125_789_1268 | 153 |
| 737 | 3300038443 | Ga0395901_0920692 | Ga0395901_0920692_349_810 | 153 |
| 738 | 3300038443 | Ga0395901_1317682 | Ga0395901_1317682_19_480 | 153 |
| 739 | 3300039437 | Ga0436365_0055150 | Ga0436365_0055150_829_1290 | 153 |
| 740 | 3300039437 | Ga0436365_0154445 | Ga0436365_0154445_114_575 | 153 |
| 741 | 3300039437 | Ga0436365_0274379 | Ga0436365_0274379_37_498 | 153 |
| 742 | 3300039437 | Ga0436365_0278773 | Ga0436365_0278773_401_874 | 153 |
| 743 | 3300039437 | Ga0436365_1321630 | Ga0436365_1321630_781_1242 | 153 |
| 744 | 3300039437 | Ga0436365_1533174 | Ga0436365_1533174_671_1132 | 153 |
| 745 | 3300039437 | Ga0436365_1596305 | Ga0436365_1596305_411_896 | 153 |
| 746 | 3300039437 | Ga0436365_1698216 | Ga0436365_1698216_202_663 | 153 |
| 747 | 3300039438 | Ga0436360_0359314 | Ga0436360_0359314_74_535 | 153 |
| 748 | 3300039438 | Ga0436360_0858327 | Ga0436360_0858327_1849_2310 | 153 |
| 749 | 3300039447 | Ga0436361_0402608 | Ga0436361_0402608_2263_2724 | 153 |
| 750 | 3300039447 | Ga0436361_0499397 | Ga0436361_0499397_71_532 | 153 |
| 751 | 3300039447 | Ga0436361_1046855 | Ga0436361_1046855_1325_1786 | 153 |
| 752 | 3300039447 | Ga0436361_1055508 | Ga0436361_1055508_227_688 | 153 |
| 753 | 3300039450 | Ga0436363_1424999 | Ga0436363_1424999_3845_4309 | 153 |
| 754 | 3300039450 | Ga0436363_1654142 | Ga0436363_1654142_376_837 | 153 |
| 755 | 3300039453 | Ga0436362_1037639 | Ga0436362_1037639_453_914 | 153 |
| 756 | 3300041512 | Ga0451853_1110420 | Ga0451853_1110420_159_620 | 153 |
| 757 | 3300042005 | Ga0439448_0197900 | Ga0439448_0197900_38_499 | 153 |
| 758 | 3300044656 | Ga0466969_0316039 | Ga0466969_0316039_71_532 | 153 |
| 759 | 3300044656 | Ga0466969_0354856 | Ga0466969_0354856_121_582 | 153 |
| 760 | 3300044684 | Ga0466966_0040049 | Ga0466966_0040049_152_613 | 153 |
| 761 | 3300044684 | Ga0466966_0142565 | Ga0466966_0142565_427_888 | 153 |
| 762 | 3300044684 | Ga0466966_0183123 | Ga0466966_0183123_366_827 | 153 |
| 763 | 3300044693 | Ga0466961_0400694 | Ga0466961_0400694_127_588 | 153 |
| 764 | 3300044694 | Ga0466963_1117532 | Ga0466963_1117532_43_504 | 153 |
| 765 | 3300044706 | Ga0466964_0186039 | Ga0466964_0186039_189_653 | 153 |
| 766 | 3300044842 | Ga0466957_0096028 | Ga0466957_0096028_1276_1737 | 153 |
| 767 | 3300044842 | Ga0466957_0736790 | Ga0466957_0736790_211_672 | 153 |
| 768 | 3300045049 | Ga0466959_0075500 | Ga0466959_0075500_884_1345 | 153 |
| 769 | 3300045049 | Ga0466959_0079916 | Ga0466959_0079916_255_716 | 153 |
| 770 | 3300045049 | Ga0466959_0213534 | Ga0466959_0213534_109_570 | 153 |
| 771 | 3300045049 | Ga0466959_0216292 | Ga0466959_0216292_819_1280 | 153 |
| 772 | 3300045976 | Ga0466967_0132208 | Ga0466967_0132208_691_1152 | 153 |
| 773 | 3300045976 | Ga0466967_0150124 | Ga0466967_0150124_1603_2064 | 153 |
| 774 | 3300046454 | Ga0495592_0029228 | Ga0495592_0029228_2899_3360 | 153 |
| 775 | 3300046454 | Ga0495592_0031028 | Ga0495592_0031028_156_617 | 153 |
| 776 | 3300046454 | Ga0495592_0182524 | Ga0495592_0182524_405_869 | 153 |
| 777 | 3300046455 | Ga0495603_0000191 | Ga0495603_0000191_14097_14558 | 153 |
| 778 | 3300046455 | Ga0495603_0027330 | Ga0495603_0027330_2742_3203 | 153 |
| 779 | 3300046457 | Ga0495590_0207442 | Ga0495590_0207442_187_648 | 153 |
| 780 | 3300046459 | Ga0495629_0000500 | Ga0495629_0000500_18976_19437 | 153 |
| 781 | 3300046459 | Ga0495629_0324696 | Ga0495629_0324696_150_641 | 153 |
| 782 | 3300046460 | Ga0495638_0048758 | Ga0495638_0048758_57_518 | 153 |
| 783 | 3300046461 | Ga0495641_0001436 | Ga0495641_0001436_1272_1733 | 153 |
| 784 | 3300046461 | Ga0495641_0458131 | Ga0495641_0458131_69_530 | 153 |
| 785 | 3300046462 | Ga0495651_0143760 | Ga0495651_0143760_81_542 | 153 |
| 786 | 3300046462 | Ga0495651_0273396 | Ga0495651_0273396_202_663 | 153 |
| 787 | 3300046463 | Ga0495653_0003914 | Ga0495653_0003914_7349_7810 | 153 |
| 788 | 3300046472 | Ga0495580_0003014 | Ga0495580_0003014_13327_13788 | 153 |
| 789 | 3300046472 | Ga0495580_0025302 | Ga0495580_0025302_1846_2307 | 153 |
| 790 | 3300046472 | Ga0495580_0165342 | Ga0495580_0165342_355_819 | 153 |
| 791 | 3300046473 | Ga0495582_0000251 | Ga0495582_0000251_19925_20386 | 153 |
| 792 | 3300046475 | Ga0495639_0000077 | Ga0495639_0000077_14374_14835 | 153 |
| 793 | 3300046477 | Ga0495664_0052529 | Ga0495664_0052529_1586_2047 | 153 |
| 794 | 3300046477 | Ga0495664_0055406 | Ga0495664_0055406_288_749 | 153 |
| 795 | 3300046477 | Ga0495664_0066459 | Ga0495664_0066459_124_588 | 153 |
| 796 | 3300046477 | Ga0495664_0106235 | Ga0495664_0106235_203_664 | 153 |
| 797 | 3300046477 | Ga0495664_0220896 | Ga0495664_0220896_228_689 | 153 |
| 798 | 3300046477 | Ga0495664_0244929 | Ga0495664_0244929_605_1066 | 153 |
| 799 | 3300046499 | Ga0495594_0000938 | Ga0495594_0000938_566_1027 | 153 |
| 800 | 3300046499 | Ga0495594_0537971 | Ga0495594_0537971_19_483 | 153 |
| 801 | 3300046500 | Ga0495596_0251580 | Ga0495596_0251580_19_510 | 153 |
| 802 | 3300046507 | Ga0495606_0089210 | Ga0495606_0089210_1425_1886 | 153 |
| 803 | 3300046507 | Ga0495606_0198576 | Ga0495606_0198576_169_660 | 153 |
| 804 | 3300046511 | Ga0495608_0009143 | Ga0495608_0009143_3309_3770 | 153 |
| 805 | 3300046512 | Ga0495610_0067508 | Ga0495610_0067508_920_1381 | 153 |
| 806 | 3300046513 | Ga0495616_0094447 | Ga0495616_0094447_230_691 | 153 |
| 807 | 3300046514 | Ga0495618_0020218 | Ga0495618_0020218_3622_4086 | 153 |
| 808 | 3300046514 | Ga0495618_0420867 | Ga0495618_0420867_160_621 | 153 |
| 809 | 3300046516 | Ga0495628_0228204 | Ga0495628_0228204_115_576 | 153 |
| 810 | 3300046516 | Ga0495628_0416196 | Ga0495628_0416196_134_595 | 153 |
| 811 | 3300046517 | Ga0495630_0332361 | Ga0495630_0332361_656_1120 | 153 |
| 812 | 3300046518 | Ga0495631_0185392 | Ga0495631_0185392_338_799 | 153 |
| 813 | 3300046524 | Ga0495648_0006022 | Ga0495648_0006022_9216_9677 | 153 |
| 814 | 3300046524 | Ga0495648_0242594 | Ga0495648_0242594_20_496 | 153 |
| 815 | 3300046526 | Ga0495666_0039136 | Ga0495666_0039136_1023_1484 | 153 |
| 816 | 3300046529 | Ga0495652_0003535 | Ga0495652_0003535_1478_1939 | 153 |
| 817 | 3300046529 | Ga0495652_0699938 | Ga0495652_0699938_22_483 | 153 |
| 818 | 3300046529 | Ga0495652_0888203 | Ga0495652_0888203_70_531 | 153 |
| 819 | 3300046531 | Ga0495665_0000363 | Ga0495665_0000363_3653_4114 | 153 |
| 820 | 3300046533 | Ga0495640_0008340 | Ga0495640_0008340_1269_1730 | 153 |
| 821 | 3300046543 | Ga0495645_0018802 | Ga0495645_0018802_4095_4556 | 153 |
| 822 | 3300046543 | Ga0495645_0128339 | Ga0495645_0128339_819_1280 | 153 |
| 823 | 3300046557 | Ga0495622_0016899 | Ga0495622_0016899_1465_1926 | 153 |
| 824 | 3300046557 | Ga0495622_0191992 | Ga0495622_0191992_190_651 | 153 |
| 825 | 3300046559 | Ga0495667_0012558 | Ga0495667_0012558_1626_2087 | 153 |
| 826 | 3300046559 | Ga0495667_0050074 | Ga0495667_0050074_564_1025 | 153 |
| 827 | 3300046559 | Ga0495667_0218115 | Ga0495667_0218115_287_748 | 153 |
| 828 | 3300046616 | Ga0495668_0123906 | Ga0495668_0123906_504_965 | 153 |
| 829 | 3300046642 | Ga0495634_0000440 | Ga0495634_0000440_34483_34944 | 153 |
| 830 | 3300046642 | Ga0495634_0006578 | Ga0495634_0006578_1837_2298 | 153 |
| 831 | 3300046642 | Ga0495634_0014949 | Ga0495634_0014949_198_662 | 153 |
| 832 | 3300046660 | Ga0495625_0098496 | Ga0495625_0098496_1527_1988 | 153 |
| 833 | 3300046663 | Ga0495635_0000425 | Ga0495635_0000425_13601_14062 | 153 |
| 834 | 3300046663 | Ga0495635_0036763 | Ga0495635_0036763_867_1331 | 153 |
| 835 | 3300046663 | Ga0495635_0092525 | Ga0495635_0092525_260_721 | 153 |
| 836 | 3300046674 | Ga0495588_0001638 | Ga0495588_0001638_3203_3664 | 153 |
| 837 | 3300046674 | Ga0495588_0498649 | Ga0495588_0498649_44_508 | 153 |
| 838 | 3300046675 | Ga0495657_0071597 | Ga0495657_0071597_361_822 | 153 |
| 839 | 3300046675 | Ga0495657_0166830 | Ga0495657_0166830_811_1272 | 153 |
| 840 | 3300046675 | Ga0495657_0838134 | Ga0495657_0838134_48_509 | 153 |
| 841 | 3300046678 | Ga0495599_0151580 | Ga0495599_0151580_836_1297 | 153 |
| 842 | 3300046678 | Ga0495599_0236719 | Ga0495599_0236719_587_1051 | 153 |
| 843 | 3300046680 | Ga0495646_0015975 | Ga0495646_0015975_1903_2364 | 153 |
| 844 | 3300046680 | Ga0495646_0040856 | Ga0495646_0040856_470_931 | 153 |
| 845 | 3300046681 | Ga0495647_0056223 | Ga0495647_0056223_143_604 | 153 |
| 846 | 3300046683 | Ga0495658_0001987 | Ga0495658_0001987_2911_3372 | 153 |
| 847 | 3300046683 | Ga0495658_0710326 | Ga0495658_0710326_123_584 | 153 |
| 848 | 3300046683 | Ga0495658_0844047 | Ga0495658_0844047_66_527 | 153 |
| 849 | 3300046684 | Ga0495669_0024837 | Ga0495669_0024837_1928_2389 | 153 |
| 850 | 3300046689 | Ga0495613_0011731 | Ga0495613_0011731_2911_3372 | 153 |
| 851 | 3300046690 | Ga0495624_0000818 | Ga0495624_0000818_10232_10693 | 153 |
| 852 | 3300046692 | Ga0495671_0051171 | Ga0495671_0051171_866_1327 | 153 |
| 853 | 3300046809 | Ga0495600_0017589 | Ga0495600_0017589_2068_2529 | 153 |
| 854 | 3300046809 | Ga0495600_0376087 | Ga0495600_0376087_21_482 | 153 |
| 855 | 3300047315 | Ga0495581_0018715 | Ga0495581_0018715_493_957 | 153 |
| 856 | 3300047315 | Ga0495581_0654914 | Ga0495581_0654914_122_583 | 153 |
| 857 | 3300047317 | Ga0495604_0049475 | Ga0495604_0049475_519_980 | 153 |
| 858 | 3300047317 | Ga0495604_0145575 | Ga0495604_0145575_125_586 | 153 |
| 859 | 3300047317 | Ga0495604_0239240 | Ga0495604_0239240_175_636 | 153 |
| 860 | 3300047317 | Ga0495604_0626011 | Ga0495604_0626011_103_564 | 153 |
| 861 | 3300047319 | Ga0495674_0001342 | Ga0495674_0001342_8445_8906 | 153 |
| 862 | 3300047319 | Ga0495674_0063294 | Ga0495674_0063294_155_616 | 153 |
| 863 | 3300047320 | Ga0495672_0243279 | Ga0495672_0243279_274_735 | 153 |
| 864 | 3300047321 | Ga0495676_0030480 | Ga0495676_0030480_3186_3647 | 153 |
| 865 | 3300047321 | Ga0495676_0539029 | Ga0495676_0539029_129_590 | 153 |
| 866 | 3300047322 | Ga0495680_0061007 | Ga0495680_0061007_2249_2710 | 153 |
| 867 | 3300047322 | Ga0495680_0316245 | Ga0495680_0316245_502_963 | 153 |
| 868 | 3300047323 | Ga0495683_0251771 | Ga0495683_0251771_21_482 | 153 |
| 869 | 3300047444 | Ga0495675_0017501 | Ga0495675_0017501_2604_3065 | 153 |
| 870 | 3300047471 | Ga0495684_0003601 | Ga0495684_0003601_6350_6811 | 153 |
| 871 | 3300047471 | Ga0495684_0118183 | Ga0495684_0118183_1020_1481 | 153 |
| 872 | 3300047472 | Ga0495686_0075373 | Ga0495686_0075373_729_1190 | 153 |
| 873 | 3300047673 | Ga0495593_0000192 | Ga0495593_0000192_17355_17816 | 153 |
| 874 | 3300047673 | Ga0495593_0002191 | Ga0495593_0002191_3769_4230 | 153 |
| 875 | 3300047673 | Ga0495593_0102081 | Ga0495593_0102081_610_1074 | 153 |
| 876 | 3300047673 | Ga0495593_0334920 | Ga0495593_0334920_84_545 | 153 |
| 877 | 3300047673 | Ga0495593_0543843 | Ga0495593_0543843_61_552 | 153 |
| 878 | 3300048088 | Ga0495602_0108298 | Ga0495602_0108298_133_594 | 153 |
| 879 | 3300048088 | Ga0495602_0218235 | Ga0495602_0218235_787_1248 | 153 |
| 880 | 3300048088 | Ga0495602_0225779 | Ga0495602_0225779_797_1258 | 153 |
| 881 | 3300048903 | Ga0496100_0090361 | Ga0496100_0090361_1153_1614 | 153 |
| 882 | 3300048903 | Ga0496100_0227244 | Ga0496100_0227244_455_916 | 153 |
| 883 | 3300048904 | Ga0496101_0006237 | Ga0496101_0006237_6475_6966 | 153 |
| 884 | 3300048904 | Ga0496101_0288229 | Ga0496101_0288229_248_724 | 153 |
| 885 | 3300048904 | Ga0496101_1110884 | Ga0496101_1110884_101_562 | 153 |
| 886 | 3300048905 | Ga0496102_0002444 | Ga0496102_0002444_6570_7061 | 153 |
| 887 | 3300048905 | Ga0496102_0200887 | Ga0496102_0200887_1224_1685 | 153 |
| 888 | 3300048905 | Ga0496102_1355931 | Ga0496102_1355931_16_477 | 153 |
| 889 | 3300048906 | Ga0496103_0103626 | Ga0496103_0103626_71_562 | 153 |
| 890 | 3300048906 | Ga0496103_0423432 | Ga0496103_0423432_107_568 | 153 |
| 891 | 3300048906 | Ga0496103_0433860 | Ga0496103_0433860_43_504 | 153 |
| 892 | 3300048907 | Ga0496104_0004215 | Ga0496104_0004215_8560_9051 | 153 |
| 893 | 3300048907 | Ga0496104_0007469 | Ga0496104_0007469_7317_7778 | 153 |
| 894 | 3300048907 | Ga0496104_0109021 | Ga0496104_0109021_1488_1949 | 153 |
| 895 | 3300048907 | Ga0496104_0166042 | Ga0496104_0166042_108_584 | 153 |
| 896 | 3300048908 | Ga0496105_0062323 | Ga0496105_0062323_1590_2081 | 153 |
| 897 | 3300048908 | Ga0496105_0492389 | Ga0496105_0492389_429_890 | 153 |
| 898 | 3300048909 | Ga0496106_0031456 | Ga0496106_0031456_1486_1977 | 153 |
| 899 | 3300048909 | Ga0496106_0043168 | Ga0496106_0043168_1837_2298 | 153 |
| 900 | 3300048909 | Ga0496106_0125048 | Ga0496106_0125048_1359_1820 | 153 |
| 901 | 3300048909 | Ga0496106_0301891 | Ga0496106_0301891_693_1154 | 153 |
| 902 | 3300048910 | Ga0496107_0006772 | Ga0496107_0006772_2465_2956 | 153 |
| 903 | 3300048910 | Ga0496107_0090516 | Ga0496107_0090516_757_1218 | 153 |
| 904 | 3300048911 | Ga0496108_0008382 | Ga0496108_0008382_354_845 | 153 |
| 905 | 3300048911 | Ga0496108_0067607 | Ga0496108_0067607_2462_2923 | 153 |
| 906 | 3300048911 | Ga0496108_0082965 | Ga0496108_0082965_1338_1799 | 153 |
| 907 | 3300048911 | Ga0496108_0085647 | Ga0496108_0085647_1231_1692 | 153 |
| 908 | 3300048912 | Ga0496109_0016411 | Ga0496109_0016411_4741_5232 | 153 |
| 909 | 3300048912 | Ga0496109_0205174 | Ga0496109_0205174_845_1309 | 153 |
| 910 | 3300048913 | Ga0496110_0006362 | Ga0496110_0006362_5833_6324 | 153 |
| 911 | 3300048913 | Ga0496110_0119527 | Ga0496110_0119527_1795_2256 | 153 |
| 912 | 3300048914 | Ga0496111_0020163 | Ga0496111_0020163_311_775 | 153 |
| 913 | 3300048914 | Ga0496111_0054972 | Ga0496111_0054972_341_832 | 153 |
| 914 | 3300048914 | Ga0496111_0065725 | Ga0496111_0065725_1464_1925 | 153 |
| 915 | 3300048914 | Ga0496111_0358477 | Ga0496111_0358477_438_899 | 153 |
| 916 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_342189_342650 | 153 |
| 917 | 3300048915 | Ga0496112_0010287 | Ga0496112_0010287_517_978 | 153 |
| 918 | 3300048915 | Ga0496112_0017441 | Ga0496112_0017441_4363_4824 | 153 |
| 919 | 3300048915 | Ga0496112_0023073 | Ga0496112_0023073_1911_2372 | 153 |
| 920 | 3300048915 | Ga0496112_0059262 | Ga0496112_0059262_2574_3035 | 153 |
| 921 | 3300048915 | Ga0496112_0398793 | Ga0496112_0398793_16_507 | 153 |
| 922 | 3300048916 | Ga0496113_0039773 | Ga0496113_0039773_1489_1950 | 153 |
| 923 | 3300048916 | Ga0496113_0049914 | Ga0496113_0049914_1242_1733 | 153 |
| 924 | 3300048916 | Ga0496113_0199255 | Ga0496113_0199255_474_935 | 153 |
| 925 | 3300048917 | Ga0496114_0460979 | Ga0496114_0460979_501_962 | 153 |
| 926 | 3300048917 | Ga0496114_1173754 | Ga0496114_1173754_19_510 | 153 |
| 927 | 3300048918 | Ga0496115_0004586 | Ga0496115_0004586_7921_8412 | 153 |
| 928 | 3300048918 | Ga0496115_0015076 | Ga0496115_0015076_4689_5150 | 153 |
| 929 | 3300048918 | Ga0496115_0104091 | Ga0496115_0104091_818_1279 | 153 |
| 930 | 3300048918 | Ga0496115_0862211 | Ga0496115_0862211_97_558 | 153 |
| 931 | 3300048920 | Ga0496117_0010921 | Ga0496117_0010921_2734_3195 | 153 |
| 932 | 3300048920 | Ga0496117_0039914 | Ga0496117_0039914_156_617 | 153 |
| 933 | 3300048921 | Ga0496118_0163414 | Ga0496118_0163414_806_1267 | 153 |
| 934 | 3300048921 | Ga0496118_0310191 | Ga0496118_0310191_101_562 | 153 |
| 935 | 3300048921 | Ga0496118_0358072 | Ga0496118_0358072_85_546 | 153 |
| 936 | 3300048924 | Ga0496121_0006790 | Ga0496121_0006790_3760_4242 | 153 |
| 937 | 3300048924 | Ga0496121_0026797 | Ga0496121_0026797_917_1378 | 153 |
| 938 | 3300048924 | Ga0496121_0042449 | Ga0496121_0042449_1299_1760 | 153 |
| 939 | 3300048924 | Ga0496121_0402895 | Ga0496121_0402895_418_879 | 153 |
| 940 | 3300048924 | Ga0496121_0589008 | Ga0496121_0589008_50_511 | 153 |
| 941 | 3300048927 | Ga0496124_0061538 | Ga0496124_0061538_1707_2168 | 153 |
| 942 | 3300048927 | Ga0496124_0276115 | Ga0496124_0276115_466_927 | 153 |
| 943 | 3300048928 | Ga0496125_0018110 | Ga0496125_0018110_5967_6428 | 153 |
| 944 | 3300048928 | Ga0496125_0122695 | Ga0496125_0122695_551_1012 | 153 |
| 945 | 3300048929 | Ga0496126_0004265 | Ga0496126_0004265_10458_10919 | 153 |
| 946 | 3300048929 | Ga0496126_0007329 | Ga0496126_0007329_7366_7827 | 153 |
| 947 | 3300048929 | Ga0496126_0027426 | Ga0496126_0027426_3753_4214 | 153 |
| 948 | 3300048929 | Ga0496126_0105247 | Ga0496126_0105247_295_756 | 153 |
| 949 | 3300048929 | Ga0496126_0211341 | Ga0496126_0211341_499_960 | 153 |
| 950 | 3300048929 | Ga0496126_0217819 | Ga0496126_0217819_915_1376 | 153 |
| 951 | 3300048929 | Ga0496126_0342862 | Ga0496126_0342862_676_1137 | 153 |
| 952 | 3300048929 | Ga0496126_0392418 | Ga0496126_0392418_477_938 | 153 |
| 953 | 3300048929 | Ga0496126_0832826 | Ga0496126_0832826_188_664 | 153 |
| 954 | 3300049568 | Ga0501031_0000268 | Ga0501031_0000268_25477_25938 | 153 |
| 955 | 3300049568 | Ga0501031_0525600 | Ga0501031_0525600_42_518 | 153 |
| 956 | 3300049569 | Ga0501032_0000619 | Ga0501032_0000619_360_821 | 153 |
| 957 | 3300049569 | Ga0501032_0030178 | Ga0501032_0030178_22_498 | 153 |
| 958 | 3300049569 | Ga0501032_0108134 | Ga0501032_0108134_889_1365 | 153 |
| 959 | 3300049569 | Ga0501032_0141775 | Ga0501032_0141775_528_1004 | 153 |
| 960 | 3300049570 | Ga0501033_0000108 | Ga0501033_0000108_12660_13121 | 153 |
| 961 | 3300049570 | Ga0501033_0015026 | Ga0501033_0015026_1135_1611 | 153 |
| 962 | 3300049570 | Ga0501033_0050162 | Ga0501033_0050162_1235_1711 | 153 |
| 963 | 3300049571 | Ga0501034_0000100 | Ga0501034_0000100_109727_110188 | 153 |
| 964 | 3300049571 | Ga0501034_0400933 | Ga0501034_0400933_24_500 | 153 |
| 965 | 3300049571 | Ga0501034_0433157 | Ga0501034_0433157_249_725 | 153 |
| 966 | 3300049572 | Ga0501036_0000228 | Ga0501036_0000228_13356_13817 | 153 |
| 967 | 3300049572 | Ga0501036_0094300 | Ga0501036_0094300_1744_2220 | 153 |
| 968 | 3300049573 | Ga0501037_0002072 | Ga0501037_0002072_8308_8769 | 153 |
| 969 | 3300049573 | Ga0501037_0049351 | Ga0501037_0049351_2239_2715 | 153 |
| 970 | 3300049573 | Ga0501037_0124154 | Ga0501037_0124154_1134_1610 | 153 |
| 971 | 3300049574 | Ga0501038_0002060 | Ga0501038_0002060_2661_3137 | 153 |
| 972 | 3300049574 | Ga0501038_0010248 | Ga0501038_0010248_7757_8218 | 153 |
| 973 | 3300049574 | Ga0501038_0027992 | Ga0501038_0027992_78_554 | 153 |
| 974 | 3300049574 | Ga0501038_1128446 | Ga0501038_1128446_18_494 | 153 |
| 975 | 3300049575 | Ga0501039_0001602 | Ga0501039_0001602_2263_2724 | 153 |
| 976 | 3300049575 | Ga0501039_0022365 | Ga0501039_0022365_3266_3742 | 153 |
| 977 | 3300049575 | Ga0501039_0102340 | Ga0501039_0102340_1425_1901 | 153 |
| 978 | 3300049576 | Ga0501040_0122978 | Ga0501040_0122978_1304_1780 | 153 |
| 979 | 3300049579 | Ga0501043_0000085 | Ga0501043_0000085_66148_66609 | 153 |
| 980 | 3300049579 | Ga0501043_0021593 | Ga0501043_0021593_1804_2280 | 153 |
| 981 | 3300049579 | Ga0501043_1087680 | Ga0501043_1087680_72_548 | 153 |
| 982 | 3300049580 | Ga0501046_0000426 | Ga0501046_0000426_13897_14358 | 153 |
| 983 | 3300049580 | Ga0501046_0064242 | Ga0501046_0064242_1098_1559 | 153 |
| 984 | 3300049580 | Ga0501046_0284157 | Ga0501046_0284157_75_551 | 153 |
| 985 | 3300049580 | Ga0501046_0313454 | Ga0501046_0313454_189_665 | 153 |
| 986 | 3300049581 | Ga0501047_0000221 | Ga0501047_0000221_54288_54749 | 153 |
| 987 | 3300049581 | Ga0501047_0063342 | Ga0501047_0063342_329_790 | 153 |
| 988 | 3300049581 | Ga0501047_0067526 | Ga0501047_0067526_2952_3428 | 153 |
| 989 | 3300049582 | Ga0501048_0000621 | Ga0501048_0000621_13116_13577 | 153 |
| 990 | 3300049583 | Ga0501067_0000384 | Ga0501067_0000384_22791_23252 | 153 |
| 991 | 3300049583 | Ga0501067_0061848 | Ga0501067_0061848_178_654 | 153 |
| 992 | 3300049584 | Ga0501068_0001789 | Ga0501068_0001789_6215_6676 | 153 |
| 993 | 3300049584 | Ga0501068_0018947 | Ga0501068_0018947_356_832 | 153 |
| 994 | 3300049584 | Ga0501068_0664659 | Ga0501068_0664659_178_654 | 153 |
| 995 | 3300049585 | Ga0501069_0008876 | Ga0501069_0008876_1775_2236 | 153 |
| 996 | 3300049586 | Ga0501070_0001287 | Ga0501070_0001287_10897_11358 | 153 |
| 997 | 3300049586 | Ga0501070_0023486 | Ga0501070_0023486_3657_4118 | 153 |
| 998 | 3300049586 | Ga0501070_0212803 | Ga0501070_0212803_663_1139 | 153 |
| 999 | 3300049586 | Ga0501070_0631729 | Ga0501070_0631729_301_777 | 153 |
| 1000 | 3300049586 | Ga0501070_1346433 | Ga0501070_1346433_27_506 | 153 |
| 1001 | 3300049587 | Ga0501071_0028472 | Ga0501071_0028472_1552_2013 | 153 |
| 1002 | 3300049587 | Ga0501071_0318381 | Ga0501071_0318381_629_1105 | 153 |
| 1003 | 3300049588 | Ga0501072_0001233 | Ga0501072_0001233_16359_16820 | 153 |
| 1004 | 3300049588 | Ga0501072_0554217 | Ga0501072_0554217_93_569 | 153 |
| 1005 | 3300049589 | Ga0501073_0000290 | Ga0501073_0000290_2869_3330 | 153 |
| 1006 | 3300049589 | Ga0501073_0052946 | Ga0501073_0052946_218_679 | 153 |
| 1007 | 3300049589 | Ga0501073_0075738 | Ga0501073_0075738_1337_1813 | 153 |
| 1008 | 3300049589 | Ga0501073_0171646 | Ga0501073_0171646_420_896 | 153 |
| 1009 | 3300049590 | Ga0501074_0000094 | Ga0501074_0000094_16514_16975 | 153 |
| 1010 | 3300049590 | Ga0501074_0078833 | Ga0501074_0078833_292_768 | 153 |
| 1011 | 3300049590 | Ga0501074_0141012 | Ga0501074_0141012_45_506 | 153 |
| 1012 | 3300049591 | Ga0501075_0573540 | Ga0501075_0573540_352_828 | 153 |
| 1013 | 3300049592 | Ga0501076_0230810 | Ga0501076_0230810_541_1017 | 153 |
| 1014 | 3300049593 | Ga0501077_0138071 | Ga0501077_0138071_635_1111 | 153 |
| 1015 | 3300049741 | Ga0501079_0023481 | Ga0501079_0023481_487_948 | 153 |
| 1016 | 3300049741 | Ga0501079_0175485 | Ga0501079_0175485_465_941 | 153 |
| 1017 | 3300049742 | Ga0501080_0007102 | Ga0501080_0007102_8499_8960 | 153 |
| 1018 | 3300049742 | Ga0501080_0076776 | Ga0501080_0076776_1733_2209 | 153 |
| 1019 | 3300049742 | Ga0501080_0145672 | Ga0501080_0145672_93_569 | 153 |
| 1020 | 3300049744 | Ga0501083_0000087 | Ga0501083_0000087_59529_59990 | 153 |
| 1021 | 3300049744 | Ga0501083_0235054 | Ga0501083_0235054_660_1136 | 153 |
| 1022 | 3300049822 | Ga0501035_0000223 | Ga0501035_0000223_60078_60539 | 153 |
| 1023 | 3300049822 | Ga0501035_0029751 | Ga0501035_0029751_3119_3598 | 153 |
| 1024 | 3300049822 | Ga0501035_0057029 | Ga0501035_0057029_1874_2350 | 153 |
| 1025 | 3300049822 | Ga0501035_0099964 | Ga0501035_0099964_2049_2525 | 153 |
| 1026 | 3300049823 | Ga0501044_0000970 | Ga0501044_0000970_15356_15817 | 153 |
| 1027 | 3300049823 | Ga0501044_0009122 | Ga0501044_0009122_6117_6593 | 153 |
| 1028 | 3300049823 | Ga0501044_0036772 | Ga0501044_0036772_1281_1742 | 153 |
| 1029 | 3300049823 | Ga0501044_0069089 | Ga0501044_0069089_2155_2637 | 153 |
| 1030 | 3300049823 | Ga0501044_0159139 | Ga0501044_0159139_336_812 | 153 |
| 1031 | 3300049824 | Ga0501045_0023775 | Ga0501045_0023775_3522_3998 | 153 |
| 1032 | 3300050489 | nmdc:mga03683_239499_c1 | nmdc:mga03683_239499_c1_169_630 | 153 |
| 1033 | 3300050489 | nmdc:mga03683_52613_c1 | nmdc:mga03683_52613_c1_381_857 | 153 |
| 1034 | 3300050490 | nmdc:mga03n38_3407_c1 | nmdc:mga03n38_3407_c1_3965_4441 | 153 |
| 1035 | 3300050491 | nmdc:mga00v17_260626_c1 | nmdc:mga00v17_260626_c1_40_501 | 153 |
| 1036 | 3300050493 | nmdc:mga0k408_179756_c1 | nmdc:mga0k408_179756_c1_724_1185 | 153 |
| 1037 | 3300050493 | nmdc:mga0k408_42604_c1 | nmdc:mga0k408_42604_c1_102_578 | 153 |
| 1038 | 3300050494 | nmdc:mga06z11_118077_c1 | nmdc:mga06z11_118077_c1_531_1007 | 153 |
| 1039 | 3300050494 | nmdc:mga06z11_276764_c1 | nmdc:mga06z11_276764_c1_101_562 | 153 |
| 1040 | 3300050495 | nmdc:mga04h51_87348_c1 | nmdc:mga04h51_87348_c1_93_554 | 153 |
| 1041 | 3300050496 | nmdc:mga07m45_108884_c1 | nmdc:mga07m45_108884_c1_1042_1503 | 153 |
| 1042 | 3300050496 | nmdc:mga07m45_20250_c1 | nmdc:mga07m45_20250_c1_13_489 | 153 |
| 1043 | 3300050511 | nmdc:mga08y16_1698314_c1 | nmdc:mga08y16_1698314_c1_94_570 | 153 |
| 1044 | 3300050511 | nmdc:mga08y16_721017_c1 | nmdc:mga08y16_721017_c1_29_490 | 153 |
| 1045 | 3300050512 | nmdc:mga0n895_10165_c1 | nmdc:mga0n895_10165_c1_7106_7567 | 153 |
| 1046 | 3300050513 | nmdc:mga0rr50_856087_c1 | nmdc:mga0rr50_856087_c1_87_548 | 153 |
| 1047 | 3300050514 | nmdc:mga08x19_26638_c2 | nmdc:mga08x19_26638_c2_111_572 | 153 |
| 1048 | 3300053077 | Ga0495601_0046570 | Ga0495601_0046570_2249_2710 | 153 |
| 1049 | 3300053077 | Ga0495601_0338930 | Ga0495601_0338930_69_530 | 153 |
| 1050 | 3300053077 | Ga0495601_0532884 | Ga0495601_0532884_139_600 | 153 |
| 1051 | 3300053078 | Ga0495612_0169193 | Ga0495612_0169193_195_656 | 153 |
| 1052 | 3300053080 | Ga0500635_0001711 | Ga0500635_0001711_2466_2927 | 153 |
| 1053 | 3300053083 | Ga0495655_0051821 | Ga0495655_0051821_154_645 | 153 |
| 1054 | 3300053084 | Ga0495595_0089522 | Ga0495595_0089522_451_912 | 153 |
| 1055 | 3300053085 | Ga0495619_0020769 | Ga0495619_0020769_1478_1939 | 153 |
| 1056 | 3300053085 | Ga0495619_0129018 | Ga0495619_0129018_1209_1670 | 153 |
| 1057 | 3300053085 | Ga0495619_0186346 | Ga0495619_0186346_945_1406 | 153 |
| 1058 | 3300053085 | Ga0495619_0622733 | Ga0495619_0622733_49_510 | 153 |
| 1059 | 3300053102 | Ga0500554_106627 | Ga0500554_106627_155_616 | 153 |
| 1060 | 3300053104 | Ga0500556_0062377 | Ga0500556_0062377_317_820 | 153 |
| 1061 | 3300053104 | Ga0500556_0380198 | Ga0500556_0380198_40_516 | 153 |
| 1062 | 3300053108 | Ga0500562_056287 | Ga0500562_056287_102_563 | 153 |
| 1063 | 3300053111 | Ga0500572_000537 | Ga0500572_000537_3611_4117 | 153 |
| 1064 | 3300053119 | Ga0500595_005319 | Ga0500595_005319_353_829 | 153 |
| 1065 | 3300053119 | Ga0500595_005513 | Ga0500595_005513_4010_4513 | 153 |
| 1066 | 3300053119 | Ga0500595_007491 | Ga0500595_007491_2728_3204 | 153 |
| 1067 | 3300053119 | Ga0500595_012739 | Ga0500595_012739_2029_2490 | 153 |
| 1068 | 3300053119 | Ga0500595_023493 | Ga0500595_023493_800_1276 | 153 |
| 1069 | 3300053122 | Ga0500608_141344 | Ga0500608_141344_370_876 | 153 |
| 1070 | 3300053130 | Ga0500642_0263239 | Ga0500642_0263239_64_525 | 153 |
| 1071 | 3300053133 | Ga0500655_046839 | Ga0500655_046839_15_476 | 153 |
| 1072 | 3300053134 | Ga0500658_0027899 | Ga0500658_0027899_292_753 | 153 |
| 1073 | 3300053136 | Ga0500559_0000143 | Ga0500559_0000143_10522_11028 | 153 |
| 1074 | 3300053139 | Ga0500568_0013681 | Ga0500568_0013681_2860_3363 | 153 |
| 1075 | 3300053139 | Ga0500568_0020236 | Ga0500568_0020236_1579_2055 | 153 |
| 1076 | 3300053146 | Ga0500588_0037631 | Ga0500588_0037631_584_1060 | 153 |
| 1077 | 3300053148 | Ga0500590_076753 | Ga0500590_076753_550_1011 | 153 |
| 1078 | 3300053150 | Ga0500603_000415 | Ga0500603_000415_7941_8402 | 153 |
| 1079 | 3300053150 | Ga0500603_024182 | Ga0500603_024182_689_1150 | 153 |
| 1080 | 3300053150 | Ga0500603_210452 | Ga0500603_210452_112_573 | 153 |
| 1081 | 3300053153 | Ga0500616_0260636 | Ga0500616_0260636_112_615 | 153 |
| 1082 | 3300053155 | Ga0500620_137656 | Ga0500620_137656_174_650 | 153 |
| 1083 | 3300053177 | Ga0500636_0063096 | Ga0500636_0063096_31_492 | 153 |
| 1084 | 3300053177 | Ga0500636_0082467 | Ga0500636_0082467_272_733 | 153 |
| 1085 | 3300053178 | Ga0500637_0333145 | Ga0500637_0333145_295_756 | 153 |
| 1086 | 3300053725 | Ga0500576_047455 | Ga0500576_047455_482_988 | 153 |
| 1087 | 3300053730 | Ga0500645_039828 | Ga0500645_039828_73_534 | 153 |
| 1088 | 3300053735 | Ga0500596_003194 | Ga0500596_003194_208_714 | 153 |
| 1089 | 3300053737 | Ga0500601_008773 | Ga0500601_008773_216_677 | 153 |
| 1090 | 3300054114 | Ga0501084_0008032 | Ga0501084_0008032_7741_8202 | 153 |
| 1091 | 3300060353 | Ga0501082_0000452 | Ga0501082_0000452_35310_35771 | 153 |
| 1092 | 3300060353 | Ga0501082_0510663 | Ga0501082_0510663_330_806 | 153 |
| 1093 | 3300061719 | Ga0466962_0325437 | Ga0466962_0325437_86_547 | 153 |
| 1094 | 3300061734 | Ga0530510_0787506 | Ga0530510_0787506_74_550 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5duk-assembly1.cif.gz_A | n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 | 0.957 | 36 | 86 |
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.9545 | 40 | 95 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9482 | 36 | 96 |
| 4kmf-assembly1.cif.gz_A-2 | crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna | 0.942 | 40 | 96 |
| 5duk-assembly1.cif.gz_B | n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 | 0.9351 | 36 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4awxB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9545 | 40 | 95 | 1.10.10.10 |
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9511 | 36 | 97 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9482 | 36 | 96 | 1.10.10.10 |
| 1s3jB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9474 | 33 | 96 | 1.10.10.10 |
| af_A0A368UHH6_2_74_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9467 | 43 | 77 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D4NER3-F1-model_v4 | MarR family transcriptional regulator | 0.9792 | 9 | 140 |
GO:0003677
GO:0003700 |
| AF-A0A4R3Y2Y2-F1-model_v4 | DNA-binding MarR family transcriptional regulator | 0.969 | 9 | 136 |
GO:0003677
GO:0003700 |
| AF-A0A7X7XU90-F1-model_v4 | MarR family transcriptional regulator | 0.9663 | 5 | 142 |
GO:0003677
GO:0003700 |
| AF-A0A166D5M6-F1-model_v4 | Transcriptional regulator HosA | 0.9643 | 9 | 145 |
GO:0003677
GO:0003700 |
| AF-A0A2S4M9V9-F1-model_v4 | MarR family transcriptional regulator | 0.964 | 5 | 147 |
GO:0003700
GO:0006950 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar