F489936

General Info

Members Datasets Scaffolds Average Seq Length
1094 440 1059 154

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1012299|Ga0081540_10122993
Length 175
Sequence MPFDRITISDCVPVALDPPVETDMSLDLKRQLVSQLVESSRLLRNYIDHRAKTRGTTRAQWIVLFRLREQEGLSQVDLADVLELQPISLVRLLDRLVEHGLLERRQDPKDRRANRLFLTDRGRQLVDDLDSLRDAIATDVLNDIPDQRIDASLQTLRDIKDRIKSLGEDPDVAVK

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
9 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
10 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
11 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
12 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
13 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
14 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
15 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
16 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
17 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
18 2904699407
19 2906610324
20 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
21 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
22 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
23 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
24 2922425934
25 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
26 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
27 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
28 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
29 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
30 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
105 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
106 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
109 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
143 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
146 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
147 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
151 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
203 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
204 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
205 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
210 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
211 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
212 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
213 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
214 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
217 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
219 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
220 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
221 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
231 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
232 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
233 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
269 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
270 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
271 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
272 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
273 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
274 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
283 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
284 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
285 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
286 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
287 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
295 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
300 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
354 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
355 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
356 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
390 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
391 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
394 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
395 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
399 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
404 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
405 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
408 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
409 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
410 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
411 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
412 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
413 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
414 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
415 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
416 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
417 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
418 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
419 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
420 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
421 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
422 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
423 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
424 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
425 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
426 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
427 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
428 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
429 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
430 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
431 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
432 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
433 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
434 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
435 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
436 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
437 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
438 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
439 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
440 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.52
Metatranscriptomes 0.55
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.22
Nodule 2.93
Rhizoplane 5.76
Rhizosphere 79.34
Stem 0
Stem Tuber 0
Unclassified 5.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1020340 3300000549 Bacteria 772
2 rootH2_10096848 3300003320 Bacteria 1993
3 rootH1_10097652 3300003323 Bacteria 2143
4 Ga0070658_10024846 3300005327 Bacteria 4805
5 Ga0070658_10095518 3300005327 Bacteria 2454
6 Ga0070658_10149575 3300005327 Bacteria 1954
7 Ga0070676_10084466 3300005328 Bacteria 1933
8 Ga0070683_100008483 3300005329 Bacteria 8729
9 Ga0070683_100736603 3300005329 Bacteria 944
10 Ga0070683_100941533 3300005329 Bacteria 829
11 Ga0070670_100171161 3300005331 Bacteria 1884
12 Ga0068869_100548331 3300005334 Bacteria 971
13 Ga0070680_100011935 3300005336 Bacteria 6740
14 Ga0070680_100030530 3300005336 Bacteria 4329
15 Ga0070680_100096296 3300005336 Bacteria 2454
16 Ga0070680_100098880 3300005336 Bacteria 2421
17 Ga0070680_100205224 3300005336 Bacteria 1662
18 Ga0070682_100034380 3300005337 Bacteria 3087
19 Ga0070682_100065584 3300005337 Bacteria 2308
20 Ga0070682_100356620 3300005337 Bacteria 1092
21 Ga0068868_100014105 3300005338 Bacteria 5883
22 Ga0068868_100020935 3300005338 Bacteria 4923
23 Ga0070660_100004475 3300005339 Bacteria 9660
24 Ga0070660_100201255 3300005339 Bacteria 1615
25 Ga0070660_100314234 3300005339 Bacteria 1286
26 Ga0070660_100392798 3300005339 Bacteria 1146
27 Ga0070660_101502263 3300005339 Bacteria 573
28 Ga0070689_100221844 3300005340 Bacteria 1551
29 Ga0070691_10127901 3300005341 Bacteria 1285
30 Ga0070691_10236878 3300005341 Bacteria 974
31 Ga0070687_100465680 3300005343 Bacteria 844
32 Ga0070661_100504410 3300005344 Bacteria 969
33 Ga0070661_100584991 3300005344 Bacteria 901
34 Ga0070661_101108480 3300005344 Bacteria 660
35 Ga0070692_10479303 3300005345 Bacteria 802
36 Ga0070675_101043782 3300005354 Bacteria 751
37 Ga0070671_100371807 3300005355 Bacteria 1221
38 Ga0070673_100043176 3300005364 Bacteria 3482
39 Ga0070673_101400834 3300005364 Bacteria 658
40 Ga0070659_100059496 3300005366 Bacteria 3017
41 Ga0070659_100070327 3300005366 Bacteria 2780
42 Ga0070659_100146550 3300005366 Bacteria 1924
43 Ga0070667_100164177 3300005367 Bacteria 1958
44 Ga0070667_101599645 3300005367 Bacteria 612
45 Ga0070709_10001966 3300005434 Bacteria 11200
46 Ga0070709_10123740 3300005434 Bacteria 1757
47 Ga0070709_10159933 3300005434 Bacteria 1565
48 Ga0070709_10188557 3300005434 Bacteria 1453
49 Ga0070709_10319028 3300005434 Bacteria 1140
50 Ga0070709_10416553 3300005434 Bacteria 1006
51 Ga0070714_100004035 3300005435 Bacteria 11037
52 Ga0070714_100141278 3300005435 Bacteria 2162
53 Ga0070714_100170471 3300005435 Bacteria 1975
54 Ga0070713_100002369 3300005436 Bacteria 12291
55 Ga0070713_100004315 3300005436 Bacteria 9531
56 Ga0070713_100008716 3300005436 Bacteria 7214
57 Ga0070713_100099099 3300005436 Bacteria 2521
58 Ga0070713_100126864 3300005436 Bacteria 2246
59 Ga0070713_100255959 3300005436 Bacteria 1599
60 Ga0070713_100295578 3300005436 Bacteria 1490
61 Ga0070713_100351263 3300005436 Bacteria 1368
62 Ga0070713_100366951 3300005436 Bacteria 1339
63 Ga0070713_100814741 3300005436 Bacteria 895
64 Ga0070713_100847184 3300005436 Bacteria 878
65 Ga0070710_10000567 3300005437 Bacteria 17537
66 Ga0070710_10039600 3300005437 Bacteria 2594
67 Ga0070710_10055501 3300005437 Bacteria 2239
68 Ga0070710_10116312 3300005437 Bacteria 1612
69 Ga0070710_10175357 3300005437 Bacteria 1339
70 Ga0070710_10641649 3300005437 Bacteria 743
71 Ga0070711_100003229 3300005439 Bacteria 9465
72 Ga0070711_100004091 3300005439 Bacteria 8578
73 Ga0070711_100019383 3300005439 Bacteria 4363
74 Ga0070711_100024479 3300005439 Bacteria 3938
75 Ga0070694_100527569 3300005444 Bacteria 943
76 Ga0070694_100801545 3300005444 Bacteria 772
77 Ga0070708_100129226 3300005445 Bacteria 2337
78 Ga0070663_100028079 3300005455 Bacteria 3826
79 Ga0070663_100047389 3300005455 Bacteria 3044
80 Ga0070663_100240136 3300005455 Bacteria 1430
81 Ga0070663_100289021 3300005455 Bacteria 1309
82 Ga0070663_100368589 3300005455 Bacteria 1167
83 Ga0070678_100185071 3300005456 Bacteria 1708
84 Ga0070678_100228337 3300005456 Bacteria 1550
85 Ga0070662_100101270 3300005457 Bacteria 2180
86 Ga0070662_100745308 3300005457 Bacteria 830
87 Ga0070681_10005095 3300005458 Bacteria 12678
88 Ga0070681_10006707 3300005458 Bacteria 11204
89 Ga0070681_10085129 3300005458 Bacteria 3114
90 Ga0070681_10328629 3300005458 Bacteria 1438
91 Ga0070681_10726322 3300005458 Bacteria 909
92 Ga0070681_11745969 3300005458 Bacteria 549
93 Ga0070706_100304014 3300005467 Bacteria 1488
94 Ga0070706_100400523 3300005467 Bacteria 1278
95 Ga0070698_100074338 3300005471 Bacteria 3404
96 Ga0070698_100220198 3300005471 Bacteria 1832
97 Ga0070698_100326992 3300005471 Bacteria 1464
98 Ga0070698_101693166 3300005471 Bacteria 585
99 Ga0070679_100037795 3300005530 Bacteria 4797
100 Ga0070679_100055759 3300005530 Bacteria 3936
101 Ga0070679_100094267 3300005530 Bacteria 2980
102 Ga0070679_100111091 3300005530 Bacteria 2727
103 Ga0070679_100595170 3300005530 Bacteria 1049
104 Ga0070679_100772411 3300005530 Bacteria 904
105 Ga0070679_101045829 3300005530 Bacteria 761
106 Ga0070684_100002527 3300005535 Bacteria 13495
107 Ga0070684_100051408 3300005535 Bacteria 3580
108 Ga0070684_100148173 3300005535 Bacteria 2125
109 Ga0070684_100296017 3300005535 Bacteria 1484
110 Ga0068853_100012545 3300005539 Bacteria 6894
111 Ga0068853_100092352 3300005539 Bacteria 2663
112 Ga0068853_100234150 3300005539 Bacteria 1681
113 Ga0068853_100380670 3300005539 Bacteria 1318
114 Ga0068853_100629957 3300005539 Bacteria 1020
115 Ga0068853_101261304 3300005539 Bacteria 714
116 Ga0070672_100477049 3300005543 Bacteria 1077
117 Ga0070695_100551589 3300005545 Bacteria 898
118 Ga0070693_100275530 3300005547 Bacteria 1125
119 Ga0070693_100295747 3300005547 Bacteria 1089
120 Ga0070665_100021649 3300005548 Bacteria 6465
121 Ga0070665_100106979 3300005548 Bacteria 2799
122 Ga0070665_100124068 3300005548 Bacteria 2584
123 Ga0070665_100301910 3300005548 Bacteria 1604
124 Ga0068855_100034077 3300005563 Bacteria 6075
125 Ga0068855_100336071 3300005563 Bacteria 1666
126 Ga0068855_100364411 3300005563 Bacteria 1590
127 Ga0068855_100747051 3300005563 Bacteria 1043
128 Ga0068855_101860781 3300005563 Unclassified 610
129 Ga0070664_100150017 3300005564 Bacteria 2058
130 Ga0070664_100394887 3300005564 Bacteria 1264
131 Ga0070664_101195936 3300005564 Bacteria 717
132 Ga0068857_100025397 3300005577 Bacteria 5217
133 Ga0068857_100223663 3300005577 Bacteria 1720
134 Ga0068857_100494946 3300005577 Bacteria 1147
135 Ga0068854_100397014 3300005578 Bacteria 1140
136 Ga0068854_100409245 3300005578 Bacteria 1124
137 Ga0068854_100444079 3300005578 Bacteria 1082
138 Ga0068856_100000020 3300005614 Bacteria 146775
139 Ga0068856_100011174 3300005614 Bacteria 8717
140 Ga0068856_100040177 3300005614 Bacteria 4594
141 Ga0068856_100188037 3300005614 Bacteria 2079
142 Ga0068856_100932901 3300005614 Bacteria 887
143 Ga0070702_100128310 3300005615 Bacteria 1598
144 Ga0070702_100482888 3300005615 Bacteria 906
145 Ga0068852_100061971 3300005616 Bacteria 3251
146 Ga0068852_100071443 3300005616 Bacteria 3048
147 Ga0068852_100214457 3300005616 Bacteria 1828
148 Ga0068852_100945521 3300005616 Bacteria 880
149 Ga0068864_100112090 3300005618 Bacteria 2431
150 Ga0068864_100149203 3300005618 Bacteria 2116
151 Ga0068864_100303283 3300005618 Bacteria 1496
152 Ga0068864_100386226 3300005618 Bacteria 1328
153 Ga0068861_100042275 3300005719 Bacteria 3415
154 Ga0068851_10001206 3300005834 Bacteria 11224
155 Ga0068851_10853706 3300005834 Bacteria 568
156 Ga0068870_10039043 3300005840 Bacteria 2455
157 Ga0068863_100412187 3300005841 Bacteria 1323
158 Ga0068858_100042777 3300005842 Bacteria 4200
159 Ga0068858_100224211 3300005842 Bacteria 1781
160 Ga0068858_100419664 3300005842 Bacteria 1287
161 Ga0068858_100980137 3300005842 Bacteria 828
162 Ga0068860_100124121 3300005843 Bacteria 2475
163 Ga0068860_101088991 3300005843 Bacteria 818
164 Ga0068862_100053763 3300005844 Bacteria 3447
165 Ga0081455_10252274 3300005937 Bacteria 1290
166 Ga0081540_1012299 3300005983 Bacteria 5648
167 Ga0081540_1026137 3300005983 Bacteria 3340
168 Ga0081540_1142344 3300005983 Bacteria 960
169 Ga0070717_10002140 3300006028 Bacteria 13847
170 Ga0070717_10005547 3300006028 Bacteria 9205
171 Ga0070717_10022680 3300006028 Bacteria 4964
172 Ga0070717_10255564 3300006028 Bacteria 1549
173 Ga0070717_10278877 3300006028 Bacteria 1482
174 Ga0070717_10459558 3300006028 Bacteria 1148
175 Ga0075365_10082143 3300006038 Bacteria 2184
176 Ga0075365_10082825 3300006038 Bacteria 2176
177 Ga0075368_10056630 3300006042 Bacteria 1564
178 Ga0075363_100050059 3300006048 Bacteria 2226
179 Ga0075364_10136674 3300006051 Bacteria 1647
180 Ga0070715_10001480 3300006163 Bacteria 6839
181 Ga0070715_10094023 3300006163 Bacteria 1385
182 Ga0070715_10293906 3300006163 Bacteria 866
183 Ga0070716_100050844 3300006173 Bacteria 2354
184 Ga0070716_100059369 3300006173 Bacteria 2205
185 Ga0070716_100089790 3300006173 Bacteria 1857
186 Ga0070716_100124803 3300006173 Bacteria 1618
187 Ga0070716_100125300 3300006173 Bacteria 1615
188 Ga0070716_100214089 3300006173 Bacteria 1290
189 Ga0070716_100352250 3300006173 Bacteria 1042
190 Ga0070716_100526190 3300006173 Bacteria 877
191 Ga0070712_100021818 3300006175 Bacteria 4212
192 Ga0070712_100055365 3300006175 Bacteria 2778
193 Ga0070712_100065329 3300006175 Bacteria 2582
194 Ga0070712_100237660 3300006175 Bacteria 1450
195 Ga0070712_100386456 3300006175 Bacteria 1153
196 Ga0070712_100491597 3300006175 Bacteria 1027
197 Ga0070712_100795788 3300006175 Bacteria 811
198 Ga0075367_10038655 3300006178 Bacteria 2779
199 Ga0075367_10157989 3300006178 Bacteria 1409
200 Ga0075366_10029987 3300006195 Bacteria 3196
201 Ga0075366_10046408 3300006195 Bacteria 2574
202 Ga0075366_10799967 3300006195 Bacteria 586
203 Ga0097621_100582349 3300006237 Bacteria 1021
204 Ga0075370_10024128 3300006353 Bacteria 3356
205 Ga0075370_10074510 3300006353 Bacteria 1945
206 Ga0075370_10149586 3300006353 Bacteria 1368
207 Ga0068871_100065852 3300006358 Bacteria 2969
208 Ga0068871_102131530 3300006358 Bacteria 534
209 Ga0075434_100019249 3300006871 Bacteria 6604
210 Ga0075434_100071223 3300006871 Bacteria 3468
211 Ga0068865_100059487 3300006881 Bacteria 2672
212 Ga0099825_1037663 3300006941 Bacteria 1585
213 Ga0099824_1004403 3300006942 Bacteria 20285
214 Ga0099822_1010345 3300006943 Bacteria 11581
215 Ga0075435_100072236 3300007076 Bacteria 2819
216 Ga0075435_100185678 3300007076 Bacteria 1758
217 Ga0099794_10044069 3300007265 Bacteria 2131
218 Ga0099794_10049659 3300007265 Bacteria 2016
219 Ga0099794_10128070 3300007265 Bacteria 1281
220 Ga0099794_10238940 3300007265 Bacteria 935
221 Ga0099795_10028392 3300007788 Bacteria 1902
222 Ga0099795_10056583 3300007788 Bacteria 1443
223 Ga0099795_10082883 3300007788 Bacteria 1230
224 Ga0105250_10113993 3300009092 Bacteria 1108
225 Ga0105240_10011430 3300009093 Bacteria 12366
226 Ga0105240_10033677 3300009093 Bacteria 6615
227 Ga0105240_10041672 3300009093 Bacteria 5857
228 Ga0105240_10174546 3300009093 Bacteria 2542
229 Ga0105240_10434589 3300009093 Bacteria 1472
230 Ga0105240_10435270 3300009093 Bacteria 1471
231 Ga0105240_10723193 3300009093 Bacteria 1085
232 Ga0105240_11621063 3300009093 Bacteria 677
233 Ga0111539_10520252 3300009094 Bacteria 1386
234 Ga0111539_12259434 3300009094 Bacteria 631
235 Ga0105245_10010375 3300009098 Bacteria 8114
236 Ga0105245_10041649 3300009098 Bacteria 4094
237 Ga0105247_10024997 3300009101 Bacteria 3602
238 Ga0105247_10052319 3300009101 Bacteria 2517
239 Ga0105243_10953299 3300009148 Bacteria 857
240 Ga0105241_10008992 3300009174 Bacteria 7346
241 Ga0105241_10098436 3300009174 Bacteria 2321
242 Ga0105241_10292561 3300009174 Bacteria 1395
243 Ga0105242_10139312 3300009176 Bacteria 2103
244 Ga0105248_10007295 3300009177 Bacteria 12130
245 Ga0105248_10322149 3300009177 Bacteria 1741
246 Ga0105248_10439338 3300009177 Bacteria 1470
247 Ga0105248_10511467 3300009177 Bacteria 1354
248 Ga0105237_10020611 3300009545 Bacteria 6793
249 Ga0105237_10090787 3300009545 Bacteria 3044
250 Ga0105237_10107427 3300009545 Bacteria 2783
251 Ga0105237_10160216 3300009545 Bacteria 2248
252 Ga0105237_10317087 3300009545 Bacteria 1562
253 Ga0105237_10342056 3300009545 Bacteria 1500
254 Ga0105237_10357241 3300009545 Bacteria 1465
255 Ga0105237_10864703 3300009545 Bacteria 911
256 Ga0105237_11127656 3300009545 Bacteria 791
257 Ga0105237_11152515 3300009545 Bacteria 782
258 Ga0105238_10002484 3300009551 Bacteria 18460
259 Ga0105238_10010951 3300009551 Bacteria 9119
260 Ga0105238_10080278 3300009551 Bacteria 3252
261 Ga0105238_10125769 3300009551 Bacteria 2542
262 Ga0105238_10132782 3300009551 Bacteria 2468
263 Ga0105238_10167854 3300009551 Bacteria 2171
264 Ga0105238_10192295 3300009551 Bacteria 2016
265 Ga0105238_10301821 3300009551 Bacteria 1585
266 Ga0105238_10498867 3300009551 Bacteria 1218
267 Ga0105238_10619763 3300009551 Bacteria 1091
268 Ga0105249_10283975 3300009553 Bacteria 1654
269 Ga0099796_10012129 3300010159 Bacteria 2424
270 Ga0099796_10023786 3300010159 Bacteria 1917
271 Ga0099796_10057068 3300010159 Bacteria 1372
272 Ga0105239_10046757 3300010375 Bacteria 4743
273 Ga0105239_10053947 3300010375 Bacteria 4408
274 Ga0105239_10069461 3300010375 Bacteria 3871
275 Ga0105239_10150170 3300010375 Bacteria 2600
276 Ga0105239_10215960 3300010375 Bacteria 2150
277 Ga0105239_10400524 3300010375 Bacteria 1553
278 Ga0105239_10473487 3300010375 Bacteria 1422
279 Ga0105239_10521800 3300010375 Bacteria 1351
280 Ga0105239_12028928 3300010375 Bacteria 668
281 Ga0105246_10004587 3300011119 Bacteria 8412
282 Ga0105246_10038703 3300011119 Bacteria 3208
283 Ga0105246_10052688 3300011119 Bacteria 2797
284 Ga0105246_10283331 3300011119 Bacteria 1330
285 Ga0157373_10095005 3300013100 Bacteria 2098
286 Ga0157371_10064333 3300013102 Bacteria 2599
287 Ga0157370_10012436 3300013104 Bacteria 8824
288 Ga0157370_10026797 3300013104 Bacteria 5686
289 Ga0157370_10032211 3300013104 Bacteria 5120
290 Ga0157370_10210884 3300013104 Bacteria 1800
291 Ga0157370_10360975 3300013104 Bacteria 1339
292 Ga0157369_10005811 3300013105 Bacteria 14344
293 Ga0157369_10018574 3300013105 Bacteria 7794
294 Ga0157369_10025441 3300013105 Bacteria 6573
295 Ga0157369_10109029 3300013105 Bacteria 2944
296 Ga0157369_10214507 3300013105 Bacteria 2016
297 Ga0157369_10290556 3300013105 Bacteria 1702
298 Ga0157369_11289808 3300013105 Bacteria 744
299 Ga0157374_10007971 3300013296 Bacteria 9048
300 Ga0157374_10025510 3300013296 Bacteria 5308
301 Ga0157374_10073117 3300013296 Bacteria 3236
302 Ga0157374_10497389 3300013296 Bacteria 1223
303 Ga0157378_10077118 3300013297 Bacteria 3004
304 Ga0163162_10110844 3300013306 Bacteria 2841
305 Ga0163162_10139362 3300013306 Bacteria 2538
306 Ga0163162_10294129 3300013306 Bacteria 1755
307 Ga0163162_11131291 3300013306 Bacteria 888
308 Ga0163162_11431088 3300013306 Bacteria 787
309 Ga0163162_11514511 3300013306 Bacteria 764
310 Ga0157372_10045854 3300013307 Bacteria 4851
311 Ga0157372_10059405 3300013307 Bacteria 4276
312 Ga0157372_10258661 3300013307 Bacteria 2021
313 Ga0157372_10785701 3300013307 Bacteria 1106
314 Ga0157372_10864100 3300013307 Bacteria 1050
315 Ga0157372_11712331 3300013307 Unclassified 723
316 Ga0157375_10009619 3300013308 Bacteria 8494
317 Ga0157375_10420774 3300013308 Bacteria 1502
318 Ga0163163_10046523 3300014325 Bacteria 4262
319 Ga0163163_10060622 3300014325 Bacteria 3747
320 Ga0157380_10116271 3300014326 Bacteria 2257
321 Ga0157377_10075301 3300014745 Bacteria 1960
322 Ga0157377_10303368 3300014745 Bacteria 1055
323 Ga0157379_10039979 3300014968 Bacteria 4185
324 Ga0157379_10261564 3300014968 Bacteria 1572
325 Ga0157379_10450416 3300014968 Bacteria 1188
326 Ga0157376_10048036 3300014969 Bacteria 3527
327 Ga0157376_10272345 3300014969 Bacteria 1591
328 Ga0163161_10395348 3300017792 Bacteria 1107
329 Ga0206353_10729202 3300020082 Bacteria 661
330 Ga0154015_1684958 3300020610 Bacteria 1106
331 Ga0213873_10016491 3300021358 Bacteria 1671
332 Ga0213872_10077681 3300021361 Bacteria 1492
333 Ga0213876_10048362 3300021384 Bacteria 2247
334 Ga0213876_10100808 3300021384 Bacteria 1531
335 Ga0213875_10069571 3300021388 Bacteria 1644
336 Ga0213871_10024691 3300021441 Bacteria 1524
337 Ga0224712_10160059 3300022467 Bacteria 1003
338 Ga0209677_103424 3300025253 Bacteria 5171
339 Ga0209148_1007368 3300025254 Bacteria 2293
340 Ga0209233_1003510 3300025261 Bacteria 5511
341 Ga0209233_1004457 3300025261 Bacteria 4759
342 Ga0209455_1004847 3300025272 Bacteria 4291
343 Ga0209455_1011161 3300025272 Bacteria 2230
344 Ga0209758_1003593 3300025297 Bacteria 13872
345 Ga0207656_10001137 3300025321 Bacteria 8748
346 Ga0207692_10055141 3300025898 Bacteria 2033
347 Ga0207692_10083372 3300025898 Bacteria 1715
348 Ga0207692_10121321 3300025898 Bacteria 1464
349 Ga0207692_10194240 3300025898 Bacteria 1190
350 Ga0207692_10240782 3300025898 Bacteria 1080
351 Ga0207692_10511720 3300025898 Bacteria 763
352 Ga0207710_10026452 3300025900 Bacteria 2508
353 Ga0207710_10227818 3300025900 Bacteria 927
354 Ga0207688_10021898 3300025901 Bacteria 3495
355 Ga0207688_10037540 3300025901 Bacteria 2687
356 Ga0207647_10043784 3300025904 Bacteria 2799
357 Ga0207647_10135717 3300025904 Bacteria 1444
358 Ga0207647_10141574 3300025904 Bacteria 1409
359 Ga0207647_10235786 3300025904 Bacteria 1052
360 Ga0207685_10088570 3300025905 Bacteria 1298
361 Ga0207685_10212952 3300025905 Bacteria 915
362 Ga0207685_10310783 3300025905 Bacteria 783
363 Ga0207699_10002259 3300025906 Bacteria 9092
364 Ga0207699_10003128 3300025906 Bacteria 7862
365 Ga0207699_10007908 3300025906 Bacteria 5218
366 Ga0207699_10017498 3300025906 Bacteria 3775
367 Ga0207699_10205233 3300025906 Bacteria 1338
368 Ga0207699_10347888 3300025906 Bacteria 1046
369 Ga0207699_10901810 3300025906 Bacteria 652
370 Ga0207705_10080181 3300025909 Bacteria 2378
371 Ga0207705_10096802 3300025909 Bacteria 2167
372 Ga0207705_10136991 3300025909 Bacteria 1826
373 Ga0207705_10470212 3300025909 Bacteria 976
374 Ga0207684_10017435 3300025910 Bacteria 6160
375 Ga0207684_10289773 3300025910 Bacteria 1412
376 Ga0207684_10612818 3300025910 Bacteria 929
377 Ga0207684_11274979 3300025910 Bacteria 606
378 Ga0207654_10015391 3300025911 Bacteria 3970
379 Ga0207654_10493473 3300025911 Bacteria 864
380 Ga0207707_10000359 3300025912 Bacteria 47942
381 Ga0207707_10010747 3300025912 Bacteria 7954
382 Ga0207707_10030608 3300025912 Bacteria 4709
383 Ga0207707_10112286 3300025912 Bacteria 2382
384 Ga0207707_10427986 3300025912 Bacteria 1134
385 Ga0207707_10669275 3300025912 Bacteria 874
386 Ga0207695_10015120 3300025913 Bacteria 9105
387 Ga0207695_10042841 3300025913 Bacteria 4829
388 Ga0207695_10096157 3300025913 Bacteria 2964
389 Ga0207695_10996786 3300025913 Bacteria 717
390 Ga0207695_11225365 3300025913 Bacteria 631
391 Ga0207671_10065375 3300025914 Bacteria 2705
392 Ga0207671_10242009 3300025914 Bacteria 1417
393 Ga0207671_10272611 3300025914 Bacteria 1333
394 Ga0207671_10746561 3300025914 Bacteria 777
395 Ga0207671_11028289 3300025914 Bacteria 649
396 Ga0207693_10000581 3300025915 Bacteria 32715
397 Ga0207693_10003453 3300025915 Bacteria 13483
398 Ga0207693_10009635 3300025915 Bacteria 7866
399 Ga0207693_10111900 3300025915 Bacteria 2141
400 Ga0207693_10253283 3300025915 Bacteria 1381
401 Ga0207693_10270756 3300025915 Bacteria 1331
402 Ga0207663_10000084 3300025916 Bacteria 44454
403 Ga0207663_10008412 3300025916 Bacteria 5392
404 Ga0207663_10054543 3300025916 Bacteria 2503
405 Ga0207663_10137659 3300025916 Bacteria 1697
406 Ga0207660_10008448 3300025917 Bacteria 6659
407 Ga0207660_10022333 3300025917 Bacteria 4263
408 Ga0207660_10045743 3300025917 Bacteria 3085
409 Ga0207660_10056652 3300025917 Bacteria 2805
410 Ga0207660_10094596 3300025917 Bacteria 2221
411 Ga0207660_10229577 3300025917 Bacteria 1459
412 Ga0207660_10608780 3300025917 Bacteria 890
413 Ga0207660_10645139 3300025917 Bacteria 863
414 Ga0207657_10007612 3300025919 Bacteria 11085
415 Ga0207657_10050134 3300025919 Bacteria 3634
416 Ga0207649_10088873 3300025920 Bacteria 2018
417 Ga0207649_10631680 3300025920 Bacteria 826
418 Ga0207649_10926056 3300025920 Bacteria 684
419 Ga0207652_10001857 3300025921 Bacteria 18344
420 Ga0207652_10018612 3300025921 Bacteria 5698
421 Ga0207652_10222393 3300025921 Bacteria 1701
422 Ga0207652_10612405 3300025921 Bacteria 976
423 Ga0207652_10864530 3300025921 Bacteria 800
424 Ga0207652_11072876 3300025921 Bacteria 705
425 Ga0207652_11161666 3300025921 Bacteria 673
426 Ga0207694_10008673 3300025924 Bacteria 7674
427 Ga0207694_10050805 3300025924 Bacteria 3213
428 Ga0207694_10297841 3300025924 Bacteria 1327
429 Ga0207694_10306093 3300025924 Bacteria 1309
430 Ga0207694_10539356 3300025924 Bacteria 979
431 Ga0207694_10555686 3300025924 Bacteria 964
432 Ga0207687_10061184 3300025927 Bacteria 2658
433 Ga0207687_10399768 3300025927 Bacteria 1130
434 Ga0207700_10002181 3300025928 Bacteria 11224
435 Ga0207700_10002410 3300025928 Bacteria 10739
436 Ga0207700_10011068 3300025928 Bacteria 5735
437 Ga0207700_10102508 3300025928 Bacteria 2286
438 Ga0207700_10321622 3300025928 Bacteria 1341
439 Ga0207700_10422071 3300025928 Bacteria 1172
440 Ga0207700_11274261 3300025928 Bacteria 655
441 Ga0207664_10033743 3300025929 Bacteria 3936
442 Ga0207664_10446567 3300025929 Bacteria 1154
443 Ga0207664_10776847 3300025929 Bacteria 862
444 Ga0207644_10211660 3300025931 Bacteria 1533
445 Ga0207644_10414897 3300025931 Bacteria 1102
446 Ga0207644_10915142 3300025931 Bacteria 735
447 Ga0207690_10165092 3300025932 Bacteria 1654
448 Ga0207690_10186365 3300025932 Bacteria 1566
449 Ga0207690_10535873 3300025932 Bacteria 950
450 Ga0207706_10071983 3300025933 Bacteria 3041
451 Ga0207686_10418701 3300025934 Bacteria 1024
452 Ga0207709_10191202 3300025935 Bacteria 1454
453 Ga0207704_10492411 3300025938 Bacteria 986
454 Ga0207665_10001451 3300025939 Bacteria 15944
455 Ga0207665_10019859 3300025939 Bacteria 4415
456 Ga0207665_10021271 3300025939 Bacteria 4265
457 Ga0207665_10254343 3300025939 Bacteria 1299
458 Ga0207711_10045435 3300025941 Bacteria 3753
459 Ga0207689_10030221 3300025942 Bacteria 4515
460 Ga0207661_10001574 3300025944 Bacteria 15528
461 Ga0207661_10045131 3300025944 Bacteria 3486
462 Ga0207661_10787835 3300025944 Bacteria 875
463 Ga0207679_10256663 3300025945 Bacteria 1489
464 Ga0207679_10434123 3300025945 Bacteria 1162
465 Ga0207679_10570800 3300025945 Bacteria 1017
466 Ga0207667_10011919 3300025949 Bacteria 10067
467 Ga0207667_10107180 3300025949 Bacteria 2882
468 Ga0207667_10291724 3300025949 Bacteria 1666
469 Ga0207667_10380094 3300025949 Bacteria 1439
470 Ga0207667_10936257 3300025949 Bacteria 856
471 Ga0207651_10085394 3300025960 Bacteria 2290
472 Ga0207712_10360888 3300025961 Bacteria 1210
473 Ga0207640_10569046 3300025981 Bacteria 955
474 Ga0207640_11252382 3300025981 Bacteria 661
475 Ga0207658_11469893 3300025986 Bacteria 623
476 Ga0207677_10017270 3300026023 Bacteria 4297
477 Ga0207677_10620284 3300026023 Bacteria 951
478 Ga0207703_10152408 3300026035 Bacteria 2017
479 Ga0207703_11449680 3300026035 Bacteria 660
480 Ga0207639_10075879 3300026041 Bacteria 2645
481 Ga0207639_10082509 3300026041 Bacteria 2548
482 Ga0207639_10127196 3300026041 Bacteria 2103
483 Ga0207639_10221216 3300026041 Bacteria 1635
484 Ga0207639_10465652 3300026041 Bacteria 1150
485 Ga0207639_10551835 3300026041 Bacteria 1058
486 Ga0207678_10013512 3300026067 Bacteria 7169
487 Ga0207678_10021128 3300026067 Bacteria 5705
488 Ga0207678_10057693 3300026067 Bacteria 3341
489 Ga0207678_10073418 3300026067 Bacteria 2931
490 Ga0207678_10460350 3300026067 Bacteria 1106
491 Ga0207678_10877321 3300026067 Bacteria 793
492 Ga0207678_11134638 3300026067 Bacteria 692
493 Ga0207702_10000126 3300026078 Bacteria 90550
494 Ga0207702_10025939 3300026078 Bacteria 4866
495 Ga0207702_10103752 3300026078 Bacteria 2515
496 Ga0207702_10139175 3300026078 Bacteria 2194
497 Ga0207702_10740032 3300026078 Bacteria 970
498 Ga0207676_10126359 3300026095 Bacteria 2166
499 Ga0207676_10137279 3300026095 Bacteria 2088
500 Ga0207676_10336260 3300026095 Bacteria 1391
501 Ga0207676_11022194 3300026095 Bacteria 815
502 Ga0207674_10047527 3300026116 Bacteria 4398
503 Ga0207674_11577883 3300026116 Bacteria 625
504 Ga0207675_100053776 3300026118 Bacteria 3756
505 Ga0207683_10027970 3300026121 Bacteria 4873
506 Ga0207683_10098624 3300026121 Bacteria 2607
507 Ga0207683_10222039 3300026121 Bacteria 1722
508 Ga0207698_10016536 3300026142 Bacteria 4976
509 Ga0207698_10115167 3300026142 Bacteria 2263
510 Ga0207698_10378503 3300026142 Bacteria 1346
511 Ga0207698_10512444 3300026142 Bacteria 1169
512 Ga0207698_11083948 3300026142 Bacteria 813
513 Ga0209589_1000001 3300027357 Bacteria 794224
514 Ga0209489_100001 3300027361 Bacteria 794224
515 Ga0209700_100001 3300027363 Bacteria 794224
516 Ga0209179_1029993 3300027512 Bacteria 1110
517 Ga0209813_10016059 3300027866 Bacteria 2038
518 Ga0209813_10046909 3300027866 Bacteria 1336
519 Ga0268266_10044743 3300028379 Bacteria 3784
520 Ga0268266_10068095 3300028379 Bacteria 3082
521 Ga0268266_10233579 3300028379 Bacteria 1694
522 Ga0268264_10026839 3300028381 Bacteria 4705
523 Ga0265337_1065525 3300028556 Bacteria 1002
524 Ga0265319_1023466 3300028563 Bacteria 2236
525 Ga0265334_10001652 3300028573 Bacteria 10680
526 Ga0265323_10001443 3300028653 Bacteria 11682
527 Ga0265322_10039901 3300028654 Bacteria 1336
528 Ga0265336_10000335 3300028666 Bacteria 31241
529 Ga0265338_10000321 3300028800 Bacteria 87046
530 Ga0265324_10015723 3300029957 Bacteria 2779
531 Ga0265763_1002214 3300030763 Bacteria 1473
532 Ga0265330_10057434 3300031235 Bacteria 1697
533 Ga0265330_10116879 3300031235 Bacteria 1137
534 Ga0265332_10040278 3300031238 Bacteria 2023
535 Ga0265332_10043920 3300031238 Bacteria 1928
536 Ga0265328_10039897 3300031239 Bacteria 1731
537 Ga0265325_10002843 3300031241 Bacteria 11545
538 Ga0265340_10125235 3300031247 Bacteria 1181
539 Ga0265339_10009656 3300031249 Bacteria 6042
540 Ga0265339_10137109 3300031249 Bacteria 1247
541 Ga0265331_10094541 3300031250 Bacteria 1380
542 Ga0265331_10185792 3300031250 Bacteria 938
543 Ga0265331_10234461 3300031250 Bacteria 824
544 Ga0265316_10357857 3300031344 Bacteria 1056
545 Ga0265316_10373207 3300031344 Bacteria 1030
546 Ga0265313_10220810 3300031595 Bacteria 782
547 Ga0307508_10180419 3300031616 Bacteria 1714
548 Ga0265314_10058323 3300031711 Bacteria 2646
549 Ga0265314_10412105 3300031711 Bacteria 728
550 Ga0265342_10015861 3300031712 Bacteria 4941
551 Ga0265342_10028907 3300031712 Bacteria 3447
552 Ga0265342_10035732 3300031712 Bacteria 3039
553 Ga0265342_10413998 3300031712 Bacteria 695
554 Ga0307411_10257060 3300032005 Bacteria 1377
555 Ga0307510_10159803 3300033180 Bacteria 1852
556 Ga0315911_1000006 3300033442 Bacteria 414563
557 Ga0316215_1001093 3300033544 Bacteria 2632
558 Ga0373926_0078379 3300035083 Bacteria 1219
559 Ga0373934_0018616 3300035086 Bacteria 2658
560 Ga0373934_0026167 3300035086 Bacteria 2263
561 Ga0373944_0035380 3300035089 Bacteria 1522
562 Ga0373951_0252775 3300035091 Bacteria 530
563 Ga0373923_0013083 3300035111 Bacteria 3085
564 Ga0373923_0037693 3300035111 Bacteria 1979
565 Ga0373923_0113651 3300035111 Bacteria 1204
566 Ga0373936_0020273 3300035113 Bacteria 2582
567 Ga0373936_0094888 3300035113 Bacteria 1254
568 Ga0373936_0237573 3300035113 Bacteria 812
569 Ga0373945_0053527 3300035116 Bacteria 1490
570 Ga0373953_0005987 3300035117 Bacteria 3982
571 Ga0373953_0010843 3300035117 Bacteria 3183
572 Ga0373954_0077813 3300035118 Bacteria 1582
573 Ga0373954_0135759 3300035118 Bacteria 1199
574 Ga0373954_0168732 3300035118 Bacteria 1071
575 Ga0373956_0012101 3300035119 Bacteria 3569
576 Ga0373956_0036736 3300035119 Bacteria 2163
577 Ga0373957_0002003 3300035120 Bacteria 5692
578 Ga0373957_0099043 3300035120 Bacteria 1165
579 Ga0373957_0316845 3300035120 Bacteria 663
580 Ga0373957_0340537 3300035120 Bacteria 639
581 Ga0373943_0047895 3300035170 Bacteria 2092
582 Ga0373943_0121655 3300035170 Bacteria 1387
583 Ga0373943_0163581 3300035170 Bacteria 1213
584 Ga0373946_0000984 3300035171 Bacteria 9775
585 Ga0373946_0207549 3300035171 Bacteria 941
586 Ga0373946_0216540 3300035171 Bacteria 923
587 Ga0373955_0002892 3300035172 Bacteria 7530
588 Ga0373955_0021151 3300035172 Bacteria 3279
589 Ga0373955_0067026 3300035172 Bacteria 1997
590 Ga0373955_0177046 3300035172 Bacteria 1264
591 Ga0373924_0006496 3300035410 Bacteria 4190
592 Ga0373924_0034130 3300035410 Bacteria 2058
593 Ga0373935_0000769 3300035692 Bacteria 17055
594 Ga0373935_0134841 3300035692 Bacteria 1662
595 Ga0373935_0199476 3300035692 Bacteria 1382
596 Ga0373935_0523742 3300035692 Bacteria 862
597 Ga0373935_0701895 3300035692 Bacteria 744
598 Ga0373927_0002152 3300035695 Bacteria 14490
599 Ga0373927_0006718 3300035695 Bacteria 7829
600 Ga0373927_0069075 3300035695 Bacteria 2286
601 Ga0373927_0076271 3300035695 Bacteria 2171
602 Ga0373933_0003725 3300035724 Bacteria 8427
603 Ga0373933_0012105 3300035724 Bacteria 4763
604 Ga0373933_0024995 3300035724 Bacteria 3422
605 Ga0373933_0110694 3300035724 Bacteria 1713
606 Ga0373947_0002495 3300035725 Bacteria 11059
607 Ga0373947_0013965 3300035725 Bacteria 4603
608 Ga0373947_0058241 3300035725 Bacteria 2341
609 Ga0373947_0452871 3300035725 Bacteria 869
610 Ga0373937_0044375 3300036401 Bacteria 4060
611 Ga0373937_0059943 3300036401 Bacteria 3498
612 Ga0373937_0080055 3300036401 Bacteria 3020
613 Ga0373937_0082618 3300036401 Bacteria 2972
614 Ga0373937_0120382 3300036401 Bacteria 2446
615 Ga0373937_0335947 3300036401 Bacteria 1430
616 Ga0373937_0800747 3300036401 Bacteria 890
617 Ga0373937_0856007 3300036401 Bacteria 857
618 Ga0373937_0890770 3300036401 Bacteria 839
619 Ga0372808_032717 3300036459 Bacteria 745
620 Ga0372808_049697 3300036459 Bacteria 600
621 Ga0373925_0014642 3300037068 Bacteria 5666
622 Ga0373925_0017659 3300037068 Bacteria 5177
623 Ga0373925_0055417 3300037068 Bacteria 2968
624 Ga0373925_0086872 3300037068 Bacteria 2387
625 Ga0373925_0555204 3300037068 Bacteria 945
626 Ga0395899_0096351 3300037312 Bacteria 2139
627 Ga0395899_0482062 3300037312 Bacteria 807
628 Ga0395900_0036594 3300037418 Bacteria 5060
629 Ga0395900_0264443 3300037418 Bacteria 1717
630 Ga0395900_0281373 3300037418 Bacteria 1655
631 Ga0395900_1214395 3300037418 Bacteria 669
632 Ga0395898_0183739 3300037466 Bacteria 1998
633 Ga0395898_0656312 3300037466 Bacteria 991
634 Ga0395905_0345101 3300037471 Bacteria 1380
635 Ga0395905_0737023 3300037471 Bacteria 888
636 Ga0436364_1238755 3300037853 Bacteria 753
637 Ga0436364_1440766 3300037853 Bacteria 6579
638 Ga0395901_0102630 3300038443 Bacteria 3002
639 Ga0395901_0302042 3300038443 Bacteria 1659
640 Ga0395901_0419125 3300038443 Bacteria 1373
641 Ga0395901_0920692 3300038443 Bacteria 855
642 Ga0395901_1317682 3300038443 Bacteria 683
643 Ga0436365_0055150 3300039437 Bacteria 2567
644 Ga0436365_0154445 3300039437 Bacteria 696
645 Ga0436365_0274379 3300039437 Bacteria 583
646 Ga0436365_0278773 3300039437 Bacteria 2566
647 Ga0436365_1321630 3300039437 Bacteria 1503
648 Ga0436365_1533174 3300039437 Bacteria 1485
649 Ga0436365_1596305 3300039437 Bacteria 1698
650 Ga0436365_1698216 3300039437 Bacteria 1190
651 Ga0436360_0359314 3300039438 Bacteria 873
652 Ga0436360_0858327 3300039438 Bacteria 3331
653 Ga0436361_0402608 3300039447 Bacteria 4986
654 Ga0436361_0499397 3300039447 Bacteria 571
655 Ga0436361_1046855 3300039447 Bacteria 2558
656 Ga0436361_1055508 3300039447 Bacteria 1139
657 Ga0436363_1424999 3300039450 Bacteria 11027
658 Ga0436363_1654142 3300039450 Bacteria 1203
659 Ga0436362_1037639 3300039453 Bacteria 1622
660 Ga0451853_1110420 3300041512 Bacteria 1116
661 Ga0439448_0197900 3300042005 Bacteria 704
662 Ga0466969_0316039 3300044656 Bacteria 707
663 Ga0466969_0354856 3300044656 Bacteria 664
664 Ga0466966_0040049 3300044684 Bacteria 3016
665 Ga0466966_0142565 3300044684 Bacteria 1464
666 Ga0466966_0183123 3300044684 Bacteria 1271
667 Ga0466961_0400694 3300044693 Bacteria 833
668 Ga0466963_0052524 3300044694 Bacteria 2705
669 Ga0466963_0254548 3300044694 Bacteria 1232
670 Ga0466963_1117532 3300044694 Bacteria 554
671 Ga0466964_0186039 3300044706 Bacteria 988
672 Ga0466968_0479476 3300044735 Bacteria 618
673 Ga0466957_0096028 3300044842 Bacteria 1862
674 Ga0466957_0736790 3300044842 Bacteria 697
675 Ga0466959_0075500 3300045049 Bacteria 2435
676 Ga0466959_0079916 3300045049 Bacteria 2358
677 Ga0466959_0213534 3300045049 Bacteria 1340
678 Ga0466959_0216292 3300045049 Bacteria 1330
679 Ga0466967_0132208 3300045976 Bacteria 2318
680 Ga0466967_0150124 3300045976 Bacteria 2177
681 Ga0466967_0151199 3300045976 Bacteria 2170
682 Ga0466967_0228449 3300045976 Bacteria 1771
683 Ga0495592_0021600 3300046454 Bacteria 4896
684 Ga0495592_0029228 3300046454 Bacteria 4174
685 Ga0495592_0031028 3300046454 Bacteria 4041
686 Ga0495592_0182524 3300046454 Bacteria 1428
687 Ga0495603_0000191 3300046455 Bacteria 32052
688 Ga0495603_0027330 3300046455 Bacteria 3445
689 Ga0495590_0207442 3300046457 Bacteria 721
690 Ga0495629_0000500 3300046459 Bacteria 32861
691 Ga0495629_0324696 3300046459 Bacteria 1052
692 Ga0495629_0372715 3300046459 Bacteria 972
693 Ga0495638_0048758 3300046460 Bacteria 2650
694 Ga0495641_0001436 3300046461 Bacteria 20225
695 Ga0495641_0458131 3300046461 Bacteria 580
696 Ga0495651_0124135 3300046462 Bacteria 1892
697 Ga0495651_0143760 3300046462 Bacteria 1726
698 Ga0495651_0273396 3300046462 Bacteria 1145
699 Ga0495653_0003914 3300046463 Bacteria 12039
700 Ga0495653_0036033 3300046463 Bacteria 3900
701 Ga0495580_0003014 3300046472 Bacteria 14436
702 Ga0495580_0025302 3300046472 Bacteria 4339
703 Ga0495580_0165342 3300046472 Bacteria 1530
704 Ga0495582_0000251 3300046473 Bacteria 29816
705 Ga0495639_0000077 3300046475 Bacteria 46394
706 Ga0495639_0266462 3300046475 Bacteria 849
707 Ga0495664_0052529 3300046477 Bacteria 2422
708 Ga0495664_0055406 3300046477 Bacteria 2359
709 Ga0495664_0066459 3300046477 Bacteria 2150
710 Ga0495664_0070146 3300046477 Bacteria 2092
711 Ga0495664_0106235 3300046477 Bacteria 1693
712 Ga0495664_0220896 3300046477 Bacteria 1147
713 Ga0495664_0244929 3300046477 Bacteria 1084
714 Ga0495594_0000938 3300046499 Bacteria 15112
715 Ga0495594_0537971 3300046499 Bacteria 663
716 Ga0495596_0251580 3300046500 Bacteria 686
717 Ga0495606_0089210 3300046507 Bacteria 1900
718 Ga0495606_0198576 3300046507 Bacteria 1145
719 Ga0495608_0009143 3300046511 Bacteria 6926
720 Ga0495608_0224479 3300046511 Bacteria 1177
721 Ga0495610_0067508 3300046512 Bacteria 1680
722 Ga0495616_0094447 3300046513 Bacteria 1411
723 Ga0495618_0020218 3300046514 Bacteria 4100
724 Ga0495618_0154405 3300046514 Bacteria 1465
725 Ga0495618_0420867 3300046514 Bacteria 814
726 Ga0495628_0030315 3300046516 Bacteria 4380
727 Ga0495628_0228204 3300046516 Bacteria 1396
728 Ga0495628_0416196 3300046516 Bacteria 980
729 Ga0495630_0332361 3300046517 Bacteria 1162
730 Ga0495631_0185392 3300046518 Bacteria 891
731 Ga0495648_0006022 3300046524 Bacteria 9959
732 Ga0495648_0242594 3300046524 Bacteria 875
733 Ga0495666_0039136 3300046526 Bacteria 2303
734 Ga0495652_0003535 3300046529 Bacteria 15358
735 Ga0495652_0061438 3300046529 Bacteria 3171
736 Ga0495652_0699938 3300046529 Bacteria 682
737 Ga0495652_0888203 3300046529 Bacteria 588
738 Ga0495665_0000363 3300046531 Bacteria 22896
739 Ga0495640_0008340 3300046533 Bacteria 8125
740 Ga0495640_0018138 3300046533 Bacteria 5229
741 Ga0495587_0048810 3300046536 Bacteria 2506
742 Ga0495645_0018802 3300046543 Bacteria 4970
743 Ga0495645_0128339 3300046543 Bacteria 1780
744 Ga0495622_0016899 3300046557 Bacteria 3396
745 Ga0495622_0191992 3300046557 Bacteria 912
746 Ga0495667_0007037 3300046559 Bacteria 7634
747 Ga0495667_0012558 3300046559 Bacteria 5744
748 Ga0495667_0050074 3300046559 Bacteria 2757
749 Ga0495667_0218115 3300046559 Bacteria 1218
750 Ga0495668_0123906 3300046616 Bacteria 1414
751 Ga0495634_0000440 3300046642 Bacteria 41444
752 Ga0495634_0006578 3300046642 Bacteria 8814
753 Ga0495634_0014949 3300046642 Bacteria 5581
754 Ga0495634_0039133 3300046642 Bacteria 3230
755 Ga0495625_0098496 3300046660 Bacteria 2011
756 Ga0495635_0000425 3300046663 Bacteria 26748
757 Ga0495635_0036763 3300046663 Bacteria 3392
758 Ga0495635_0092525 3300046663 Bacteria 2067
759 Ga0495635_0177840 3300046663 Bacteria 1446
760 Ga0495588_0001638 3300046674 Bacteria 9590
761 Ga0495588_0498649 3300046674 Bacteria 638
762 Ga0495657_0014528 3300046675 Bacteria 5777
763 Ga0495657_0071597 3300046675 Bacteria 2262
764 Ga0495657_0166830 3300046675 Bacteria 1359
765 Ga0495657_0838134 3300046675 Bacteria 524
766 Ga0495599_0040272 3300046678 Bacteria 2934
767 Ga0495599_0151580 3300046678 Bacteria 1435
768 Ga0495599_0236719 3300046678 Bacteria 1114
769 Ga0495623_0045711 3300046679 Bacteria 2780
770 Ga0495623_0384792 3300046679 Bacteria 758
771 Ga0495646_0015975 3300046680 Bacteria 4765
772 Ga0495646_0040856 3300046680 Bacteria 2853
773 Ga0495646_0092645 3300046680 Bacteria 1742
774 Ga0495647_0056223 3300046681 Bacteria 1542
775 Ga0495658_0001987 3300046683 Bacteria 10418
776 Ga0495658_0710326 3300046683 Bacteria 644
777 Ga0495658_0844047 3300046683 Bacteria 586
778 Ga0495669_0024837 3300046684 Bacteria 2611
779 Ga0495613_0011731 3300046689 Bacteria 6512
780 Ga0495613_0074931 3300046689 Bacteria 2464
781 Ga0495624_0000818 3300046690 Bacteria 24567
782 Ga0495671_0051171 3300046692 Bacteria 2055
783 Ga0495600_0017589 3300046809 Bacteria 4549
784 Ga0495600_0032884 3300046809 Bacteria 3365
785 Ga0495600_0376087 3300046809 Bacteria 887
786 Ga0495581_0018715 3300047315 Bacteria 4022
787 Ga0495581_0654914 3300047315 Bacteria 607
788 Ga0495581_0829666 3300047315 Bacteria 530
789 Ga0495604_0017963 3300047317 Bacteria 5659
790 Ga0495604_0049475 3300047317 Bacteria 3265
791 Ga0495604_0145575 3300047317 Bacteria 1689
792 Ga0495604_0239240 3300047317 Bacteria 1242
793 Ga0495604_0626011 3300047317 Bacteria 688
794 Ga0495674_0001342 3300047319 Bacteria 23999
795 Ga0495674_0023164 3300047319 Bacteria 5724
796 Ga0495674_0063294 3300047319 Bacteria 3218
797 Ga0495672_0243279 3300047320 Bacteria 877
798 Ga0495676_0030480 3300047321 Bacteria 4577
799 Ga0495676_0539029 3300047321 Bacteria 763
800 Ga0495680_0029937 3300047322 Bacteria 4451
801 Ga0495680_0061007 3300047322 Bacteria 2902
802 Ga0495680_0316245 3300047322 Bacteria 1093
803 Ga0495683_0251771 3300047323 Bacteria 775
804 Ga0495675_0014718 3300047444 Bacteria 4944
805 Ga0495675_0017501 3300047444 Bacteria 4542
806 Ga0495684_0003601 3300047471 Bacteria 12078
807 Ga0495684_0118183 3300047471 Bacteria 1998
808 Ga0495686_0075373 3300047472 Bacteria 2069
809 Ga0495593_0000192 3300047673 Bacteria 32140
810 Ga0495593_0002191 3300047673 Bacteria 11688
811 Ga0495593_0102081 3300047673 Bacteria 1470
812 Ga0495593_0334920 3300047673 Bacteria 756
813 Ga0495593_0543843 3300047673 Bacteria 583
814 Ga0495602_0065512 3300048088 Bacteria 3135
815 Ga0495602_0108298 3300048088 Bacteria 2263
816 Ga0495602_0203622 3300048088 Bacteria 1508
817 Ga0495602_0218235 3300048088 Bacteria 1441
818 Ga0495602_0225779 3300048088 Bacteria 1410
819 Ga0495602_0315689 3300048088 Bacteria 1139
820 Ga0496100_0090361 3300048903 Bacteria 2088
821 Ga0496100_0227244 3300048903 Bacteria 1372
822 Ga0496101_0006237 3300048904 Bacteria 7667
823 Ga0496101_0288229 3300048904 Bacteria 1284
824 Ga0496101_1110884 3300048904 Bacteria 620
825 Ga0496102_0002444 3300048905 Bacteria 15846
826 Ga0496102_0200887 3300048905 Bacteria 1879
827 Ga0496102_0451242 3300048905 Bacteria 1206
828 Ga0496102_1264076 3300048905 Bacteria 657
829 Ga0496102_1355931 3300048905 Bacteria 630
830 Ga0496103_0103626 3300048906 Bacteria 1802
831 Ga0496103_0423432 3300048906 Bacteria 855
832 Ga0496103_0433860 3300048906 Bacteria 843
833 Ga0496104_0004215 3300048907 Bacteria 12487
834 Ga0496104_0007469 3300048907 Bacteria 9661
835 Ga0496104_0109021 3300048907 Bacteria 2654
836 Ga0496104_0166042 3300048907 Bacteria 2117
837 Ga0496105_0062323 3300048908 Bacteria 3077
838 Ga0496105_0492389 3300048908 Bacteria 963
839 Ga0496106_0031456 3300048909 Bacteria 3955
840 Ga0496106_0043168 3300048909 Bacteria 3383
841 Ga0496106_0125048 3300048909 Bacteria 2013
842 Ga0496106_0301891 3300048909 Bacteria 1284
843 Ga0496107_0004195 3300048910 Bacteria 9734
844 Ga0496107_0006772 3300048910 Bacteria 7887
845 Ga0496107_0090516 3300048910 Bacteria 2235
846 Ga0496108_0000515 3300048911 Bacteria 30277
847 Ga0496108_0008382 3300048911 Bacteria 8387
848 Ga0496108_0067607 3300048911 Bacteria 3014
849 Ga0496108_0082965 3300048911 Bacteria 2718
850 Ga0496108_0085647 3300048911 Bacteria 2675
851 Ga0496109_0010441 3300048912 Bacteria 7934
852 Ga0496109_0016411 3300048912 Bacteria 6474
853 Ga0496109_0205174 3300048912 Bacteria 1853
854 Ga0496110_0005518 3300048913 Bacteria 9928
855 Ga0496110_0006362 3300048913 Bacteria 9335
856 Ga0496110_0119527 3300048913 Bacteria 2373
857 Ga0496111_0020163 3300048914 Bacteria 4639
858 Ga0496111_0054972 3300048914 Bacteria 2879
859 Ga0496111_0065725 3300048914 Bacteria 2633
860 Ga0496111_0220481 3300048914 Bacteria 1409
861 Ga0496111_0358477 3300048914 Bacteria 1079
862 Ga0496112_0000004 3300048915 Bacteria 553294
863 Ga0496112_0010287 3300048915 Bacteria 8482
864 Ga0496112_0017441 3300048915 Bacteria 6744
865 Ga0496112_0023073 3300048915 Bacteria 5939
866 Ga0496112_0059262 3300048915 Bacteria 3772
867 Ga0496112_0345924 3300048915 Bacteria 1430
868 Ga0496112_0398793 3300048915 Bacteria 1315
869 Ga0496112_0675683 3300048915 Bacteria 961
870 Ga0496113_0039773 3300048916 Bacteria 3463
871 Ga0496113_0049914 3300048916 Bacteria 3117
872 Ga0496113_0199255 3300048916 Bacteria 1591
873 Ga0496113_1277863 3300048916 Bacteria 571
874 Ga0496114_0460979 3300048917 Bacteria 1125
875 Ga0496114_1173754 3300048917 Bacteria 653
876 Ga0496115_0004586 3300048918 Bacteria 10008
877 Ga0496115_0015076 3300048918 Bacteria 5858
878 Ga0496115_0100494 3300048918 Bacteria 2371
879 Ga0496115_0104091 3300048918 Bacteria 2329
880 Ga0496115_0862211 3300048918 Bacteria 701
881 Ga0496115_1268103 3300048918 Bacteria 550
882 Ga0496117_0010921 3300048920 Bacteria 8185
883 Ga0496117_0039914 3300048920 Bacteria 3459
884 Ga0496118_0060403 3300048921 Bacteria 2815
885 Ga0496118_0163414 3300048921 Bacteria 1372
886 Ga0496118_0310191 3300048921 Bacteria 861
887 Ga0496118_0358072 3300048921 Bacteria 775
888 Ga0496119_0061538 3300048922 Bacteria 2241
889 Ga0496119_0163211 3300048922 Bacteria 1182
890 Ga0496121_0006790 3300048924 Bacteria 14020
891 Ga0496121_0011498 3300048924 Bacteria 9812
892 Ga0496121_0026797 3300048924 Bacteria 5416
893 Ga0496121_0042449 3300048924 Bacteria 3956
894 Ga0496121_0159004 3300048924 Bacteria 1654
895 Ga0496121_0402895 3300048924 Bacteria 895
896 Ga0496121_0589008 3300048924 Bacteria 688
897 Ga0496124_0061538 3300048927 Bacteria 3146
898 Ga0496124_0276115 3300048927 Bacteria 1228
899 Ga0496125_0018110 3300048928 Bacteria 6694
900 Ga0496125_0122695 3300048928 Bacteria 1849
901 Ga0496126_0004265 3300048929 Bacteria 17195
902 Ga0496126_0007329 3300048929 Bacteria 12113
903 Ga0496126_0027426 3300048929 Bacteria 5439
904 Ga0496126_0105247 3300048929 Bacteria 2464
905 Ga0496126_0140280 3300048929 Bacteria 2081
906 Ga0496126_0211341 3300048929 Bacteria 1633
907 Ga0496126_0217819 3300048929 Bacteria 1605
908 Ga0496126_0260682 3300048929 Bacteria 1442
909 Ga0496126_0342862 3300048929 Bacteria 1224
910 Ga0496126_0392418 3300048929 Bacteria 1127
911 Ga0496126_0690528 3300048929 Bacteria 794
912 Ga0496126_0832826 3300048929 Bacteria 705
913 Ga0501031_0000268 3300049568 Bacteria 29430
914 Ga0501031_0525600 3300049568 Bacteria 762
915 Ga0501032_0000619 3300049569 Bacteria 28816
916 Ga0501032_0030178 3300049569 Bacteria 3719
917 Ga0501032_0108134 3300049569 Bacteria 1841
918 Ga0501032_0141775 3300049569 Bacteria 1582
919 Ga0501033_0000108 3300049570 Bacteria 79903
920 Ga0501033_0015026 3300049570 Bacteria 5876
921 Ga0501033_0050162 3300049570 Bacteria 3097
922 Ga0501034_0000100 3300049571 Bacteria 159536
923 Ga0501034_0400933 3300049571 Bacteria 1294
924 Ga0501034_0433157 3300049571 Bacteria 1234
925 Ga0501036_0000228 3300049572 Bacteria 37800
926 Ga0501036_0094300 3300049572 Bacteria 2529
927 Ga0501037_0002072 3300049573 Bacteria 14545
928 Ga0501037_0049351 3300049573 Bacteria 3082
929 Ga0501037_0124154 3300049573 Bacteria 1854
930 Ga0501038_0002060 3300049574 Bacteria 18617
931 Ga0501038_0010248 3300049574 Bacteria 8577
932 Ga0501038_0027992 3300049574 Bacteria 5007
933 Ga0501038_1128446 3300049574 Bacteria 571
934 Ga0501039_0001602 3300049575 Bacteria 16666
935 Ga0501039_0022365 3300049575 Bacteria 4853
936 Ga0501039_0102340 3300049575 Bacteria 2235
937 Ga0501040_0122978 3300049576 Bacteria 1821
938 Ga0501043_0000085 3300049579 Bacteria 83544
939 Ga0501043_0021593 3300049579 Bacteria 5048
940 Ga0501043_1087680 3300049579 Bacteria 565
941 Ga0501046_0000426 3300049580 Bacteria 42186
942 Ga0501046_0064242 3300049580 Bacteria 2866
943 Ga0501046_0284157 3300049580 Bacteria 1211
944 Ga0501046_0313454 3300049580 Bacteria 1144
945 Ga0501047_0000221 3300049581 Bacteria 68563
946 Ga0501047_0063342 3300049581 Bacteria 3567
947 Ga0501047_0067526 3300049581 Bacteria 3445
948 Ga0501048_0000621 3300049582 Bacteria 25292
949 Ga0501067_0000384 3300049583 Bacteria 24036
950 Ga0501067_0061848 3300049583 Bacteria 2072
951 Ga0501068_0001789 3300049584 Bacteria 11428
952 Ga0501068_0018947 3300049584 Bacteria 3989
953 Ga0501068_0664659 3300049584 Bacteria 680
954 Ga0501069_0008876 3300049585 Bacteria 5299
955 Ga0501070_0001287 3300049586 Bacteria 22514
956 Ga0501070_0023486 3300049586 Bacteria 5165
957 Ga0501070_0212803 3300049586 Bacteria 1586
958 Ga0501070_0631729 3300049586 Bacteria 851
959 Ga0501070_1346433 3300049586 Bacteria 544
960 Ga0501071_0028472 3300049587 Bacteria 3939
961 Ga0501071_0318381 3300049587 Bacteria 1181
962 Ga0501072_0001233 3300049588 Bacteria 19088
963 Ga0501072_0554217 3300049588 Bacteria 908
964 Ga0501073_0000290 3300049589 Bacteria 33072
965 Ga0501073_0052946 3300049589 Bacteria 2842
966 Ga0501073_0075738 3300049589 Bacteria 2342
967 Ga0501073_0171646 3300049589 Bacteria 1501
968 Ga0501074_0000094 3300049590 Bacteria 42565
969 Ga0501074_0078833 3300049590 Bacteria 2364
970 Ga0501074_0141012 3300049590 Bacteria 1724
971 Ga0501075_0573540 3300049591 Bacteria 861
972 Ga0501076_0230810 3300049592 Bacteria 1513
973 Ga0501077_0138071 3300049593 Bacteria 1546
974 Ga0501079_0023481 3300049741 Bacteria 4732
975 Ga0501079_0175485 3300049741 Bacteria 1671
976 Ga0501080_0007102 3300049742 Bacteria 10113
977 Ga0501080_0076776 3300049742 Bacteria 3106
978 Ga0501080_0145672 3300049742 Bacteria 2189
979 Ga0501083_0000087 3300049744 Bacteria 62691
980 Ga0501083_0235054 3300049744 Bacteria 1193
981 Ga0501035_0000223 3300049822 Bacteria 67732
982 Ga0501035_0029751 3300049822 Bacteria 4981
983 Ga0501035_0057029 3300049822 Bacteria 3483
984 Ga0501035_0099964 3300049822 Bacteria 2546
985 Ga0501044_0000970 3300049823 Bacteria 34530
986 Ga0501044_0009122 3300049823 Bacteria 10835
987 Ga0501044_0036772 3300049823 Bacteria 5121
988 Ga0501044_0069089 3300049823 Bacteria 3597
989 Ga0501044_0159139 3300049823 Bacteria 2236
990 Ga0501045_0023775 3300049824 Bacteria 4396
991 nmdc:mga03683_239499_c1 3300050489 Bacteria 841
992 nmdc:mga03683_52613_c1 3300050489 Bacteria 1702
993 nmdc:mga03n38_3407_c1 3300050490 Bacteria 5100
994 nmdc:mga00v17_260626_c1 3300050491 Bacteria 1125
995 nmdc:mga0k408_179756_c1 3300050493 Bacteria 1262
996 nmdc:mga0k408_42604_c1 3300050493 Bacteria 2614
997 nmdc:mga06z11_118077_c1 3300050494 Bacteria 1477
998 nmdc:mga06z11_276764_c1 3300050494 Bacteria 994
999 nmdc:mga04h51_87348_c1 3300050495 Bacteria 1117
1000 nmdc:mga07m45_108884_c1 3300050496 Bacteria 1595
1001 nmdc:mga07m45_20250_c1 3300050496 Bacteria 3613
1002 nmdc:mga08y16_1698314_c1 3300050511 Bacteria 587
1003 nmdc:mga08y16_721017_c1 3300050511 Bacteria 995
1004 nmdc:mga0n895_10165_c1 3300050512 Bacteria 8288
1005 nmdc:mga0rr50_856087_c1 3300050513 Bacteria 775
1006 nmdc:mga08x19_26638_c2 3300050514 Bacteria 2966
1007 Ga0495601_0018417 3300053077 Bacteria 4250
1008 Ga0495601_0046570 3300053077 Bacteria 2730
1009 Ga0495601_0338930 3300053077 Bacteria 978
1010 Ga0495601_0532884 3300053077 Bacteria 756
1011 Ga0495612_0169193 3300053078 Bacteria 956
1012 Ga0495612_0253191 3300053078 Bacteria 784
1013 Ga0495612_0271034 3300053078 Bacteria 757
1014 Ga0500635_0001711 3300053080 Bacteria 5319
1015 Ga0495655_0051821 3300053083 Bacteria 1089
1016 Ga0495595_0089522 3300053084 Bacteria 1475
1017 Ga0495619_0020769 3300053085 Bacteria 4187
1018 Ga0495619_0129018 3300053085 Bacteria 1737
1019 Ga0495619_0186346 3300053085 Bacteria 1436
1020 Ga0495619_0622733 3300053085 Bacteria 737
1021 Ga0500651_0025571 3300053093 Bacteria 3704
1022 Ga0500554_106627 3300053102 Bacteria 940
1023 Ga0500556_0062377 3300053104 Bacteria 1375
1024 Ga0500556_0380198 3300053104 Bacteria 544
1025 Ga0500562_056287 3300053108 Bacteria 1054
1026 Ga0500572_000537 3300053111 Bacteria 12870
1027 Ga0500595_005319 3300053119 Bacteria 5636
1028 Ga0500595_005513 3300053119 Bacteria 5519
1029 Ga0500595_007491 3300053119 Bacteria 4528
1030 Ga0500595_012739 3300053119 Bacteria 3240
1031 Ga0500595_023493 3300053119 Bacteria 2166
1032 Ga0500608_141344 3300053122 Bacteria 1067
1033 Ga0500642_0056688 3300053130 Bacteria 1746
1034 Ga0500642_0263239 3300053130 Bacteria 788
1035 Ga0500655_046839 3300053133 Bacteria 856
1036 Ga0500658_0027899 3300053134 Bacteria 2187
1037 Ga0500559_0000143 3300053136 Bacteria 55572
1038 Ga0500568_0013681 3300053139 Bacteria 3690
1039 Ga0500568_0020236 3300053139 Bacteria 2882
1040 Ga0500588_0037631 3300053146 Bacteria 1438
1041 Ga0500590_076753 3300053148 Bacteria 1650
1042 Ga0500603_000415 3300053150 Bacteria 11152
1043 Ga0500603_024182 3300053150 Bacteria 1518
1044 Ga0500603_210452 3300053150 Bacteria 619
1045 Ga0500616_0260636 3300053153 Unclassified 736
1046 Ga0500620_137656 3300053155 Bacteria 854
1047 Ga0500636_0063096 3300053177 Bacteria 2160
1048 Ga0500636_0082467 3300053177 Bacteria 1851
1049 Ga0500637_0333145 3300053178 Bacteria 815
1050 Ga0500576_047455 3300053725 Bacteria 1915
1051 Ga0500645_039828 3300053730 Bacteria 1391
1052 Ga0500609_004208 3300053731 Bacteria 2000
1053 Ga0500596_003194 3300053735 Bacteria 3143
1054 Ga0500601_008773 3300053737 Bacteria 1125
1055 Ga0501084_0008032 3300054114 Bacteria 8689
1056 Ga0501082_0000452 3300060353 Bacteria 36318
1057 Ga0501082_0510663 3300060353 Bacteria 1050
1058 Ga0466962_0325437 3300061719 Bacteria 763
1059 Ga0530510_0787506 3300061734 Bacteria 725

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035111 Ga0373923_0037693 Ga0373923_0037693_969_1400 143
2 3300035117 Ga0373953_0010843 Ga0373953_0010843_1030_1461 143
3 3300035118 Ga0373954_0168732 Ga0373954_0168732_321_752 143
4 3300035119 Ga0373956_0012101 Ga0373956_0012101_2056_2487 143
5 3300035120 Ga0373957_0099043 Ga0373957_0099043_510_941 143
6 3300035172 Ga0373955_0021151 Ga0373955_0021151_1751_2182 143
7 3300035410 Ga0373924_0034130 Ga0373924_0034130_822_1253 143
8 3300035692 Ga0373935_0701895 Ga0373935_0701895_31_462 143
9 3300035724 Ga0373933_0012105 Ga0373933_0012105_679_1110 143
10 3300036401 Ga0373937_0856007 Ga0373937_0856007_307_738 143
11 3300044735 Ga0466968_0479476 Ga0466968_0479476_35_496 143
12 3300046454 Ga0495592_0021600 Ga0495592_0021600_3871_4302 143
13 3300046459 Ga0495629_0372715 Ga0495629_0372715_474_905 143
14 3300046462 Ga0495651_0124135 Ga0495651_0124135_379_810 143
15 3300046463 Ga0495653_0036033 Ga0495653_0036033_2559_2990 143
16 3300046475 Ga0495639_0266462 Ga0495639_0266462_304_735 143
17 3300046477 Ga0495664_0070146 Ga0495664_0070146_732_1163 143
18 3300046511 Ga0495608_0224479 Ga0495608_0224479_589_1020 143
19 3300046514 Ga0495618_0154405 Ga0495618_0154405_686_1117 143
20 3300046516 Ga0495628_0030315 Ga0495628_0030315_1658_2089 143
21 3300046529 Ga0495652_0061438 Ga0495652_0061438_1774_2205 143
22 3300046533 Ga0495640_0018138 Ga0495640_0018138_2234_2665 143
23 3300046536 Ga0495587_0048810 Ga0495587_0048810_1670_2101 143
24 3300046559 Ga0495667_0007037 Ga0495667_0007037_1889_2320 143
25 3300046642 Ga0495634_0039133 Ga0495634_0039133_1785_2216 143
26 3300046663 Ga0495635_0177840 Ga0495635_0177840_337_768 143
27 3300046675 Ga0495657_0014528 Ga0495657_0014528_3141_3572 143
28 3300046678 Ga0495599_0040272 Ga0495599_0040272_1711_2142 143
29 3300046679 Ga0495623_0045711 Ga0495623_0045711_1984_2415 143
30 3300046680 Ga0495646_0092645 Ga0495646_0092645_961_1392 143
31 3300046689 Ga0495613_0074931 Ga0495613_0074931_927_1358 143
32 3300046809 Ga0495600_0032884 Ga0495600_0032884_2073_2504 143
33 3300047315 Ga0495581_0829666 Ga0495581_0829666_62_493 143
34 3300047317 Ga0495604_0017963 Ga0495604_0017963_5109_5540 143
35 3300047319 Ga0495674_0023164 Ga0495674_0023164_4289_4720 143
36 3300047322 Ga0495680_0029937 Ga0495680_0029937_762_1193 143
37 3300047444 Ga0495675_0014718 Ga0495675_0014718_834_1265 143
38 3300048088 Ga0495602_0065512 Ga0495602_0065512_921_1352 143
39 3300053077 Ga0495601_0018417 Ga0495601_0018417_1670_2101 143
40 3300053078 Ga0495612_0253191 Ga0495612_0253191_213_644 143
41 3300005436 Ga0070713_100099099 Ga0070713_1000990993 144
42 3300005437 Ga0070710_10116312 Ga0070710_101163122 144
43 3300005439 Ga0070711_100004091 Ga0070711_1000040915 144
44 3300006028 Ga0070717_10255564 Ga0070717_102555643 144
45 3300006173 Ga0070716_100059369 Ga0070716_1000593692 144
46 3300006175 Ga0070712_100065329 Ga0070712_1000653292 144
47 3300009093 Ga0105240_11621063 Ga0105240_116210631 144
48 3300048922 Ga0496119_0163211 Ga0496119_0163211_245_739 144
49 3300048916 Ga0496113_1277863 Ga0496113_1277863_104_556 145
50 3300048918 Ga0496115_1268103 Ga0496115_1268103_86_538 145
51 3300048905 Ga0496102_1264076 Ga0496102_1264076_130_591 147
52 iso_pu_bacteria 2513237098 2513674388 148
53 iso_pu_bacteria 2524023210 2524470468 148
54 iso_pu_bacteria 2885383462 2885391054 148
55 iso_pu_bacteria 2903768456 2903773778 148
56 iso_pu_bacteria 8056681323 8056688301 148
57 iso_pu_bacteria 2508501128 2509151641 149
58 iso_pu_bacteria 2513237096 2513657093 149
59 iso_pu_bacteria 2513237137 2513855535 149
60 iso_pu_bacteria 2513237141 2513890187 149
61 iso_pu_bacteria 2513237145 2513918833 149
62 iso_pu_bacteria 2517572143 2517892080 149
63 iso_pu_bacteria 2524023228 2524534164 149
64 iso_pu_bacteria 2667528175 2671121882 149
65 iso_pu_bacteria 2728368998 2728753292 149
66 iso_pu_bacteria 2791355197 2793068835 149
67 iso_pu_bacteria 2885374607 2885379466 149
68 iso_pu_bacteria 2903748898 2903753406 149
69 iso_pu_bacteria 2904690495 2904694854 149
70 iso_pu_bacteria 2904699407 2904702200 149
71 iso_pu_bacteria 2906610324 2906617210 149
72 iso_pu_bacteria 2906635258 2906639270 149
73 iso_pu_bacteria 2906660503 2906662469 149
74 iso_pu_bacteria 2908739725 2908742360 149
75 iso_pu_bacteria 2908756301 2908760004 149
76 iso_pu_bacteria 2922425934 2922430618 149
77 iso_pu_bacteria 2935630451 2935631217 149
78 iso_pu_bacteria 2941507105 2941509958 149
79 iso_pu_bacteria 2941515067 2941518955 149
80 iso_pu_bacteria 2941523033 2941525357 149
81 iso_pu_bacteria 3005474847 3005480529 149
82 iso_pu_bacteria 8006933436 8006940247 149
83 iso_pu_bacteria 8006973647 8006980025 149
84 iso_pu_bacteria 8019555841 8019556230 149
85 iso_pu_bacteria 8019565922 8019569080 149
86 iso_pu_bacteria 8056689827 8056692287 149
87 3300048918 Ga0496115_0100494 Ga0496115_0100494_561_1019 151
88 3300003320 rootH2_10096848 rootH2_100968482 152
89 3300003323 rootH1_10097652 rootH1_100976523 152
90 3300005329 Ga0070683_100736603 Ga0070683_1007366031 152
91 3300005336 Ga0070680_100205224 Ga0070680_1002052243 152
92 3300005339 Ga0070660_101502263 Ga0070660_1015022631 152
93 3300005366 Ga0070659_100070327 Ga0070659_1000703272 152
94 3300005436 Ga0070713_100847184 Ga0070713_1008471841 152
95 3300005455 Ga0070663_100028079 Ga0070663_1000280793 152
96 3300005471 Ga0070698_101693166 Ga0070698_1016931661 152
97 3300005530 Ga0070679_100595170 Ga0070679_1005951701 152
98 3300005563 Ga0068855_100336071 Ga0068855_1003360713 152
99 3300005577 Ga0068857_100223663 Ga0068857_1002236631 152
100 3300005578 Ga0068854_100409245 Ga0068854_1004092452 152
101 3300005614 Ga0068856_100000020 Ga0068856_10000002092 152
102 3300005614 Ga0068856_100011174 Ga0068856_1000111747 152
103 3300005616 Ga0068852_100061971 Ga0068852_1000619713 152
104 3300005983 Ga0081540_1012299 Ga0081540_10122993 152
105 3300009093 Ga0105240_10435270 Ga0105240_104352702 152
106 3300009093 Ga0105240_10723193 Ga0105240_107231931 152
107 3300009545 Ga0105237_10160216 Ga0105237_101602163 152
108 3300013105 Ga0157369_10214507 Ga0157369_102145072 152
109 3300013105 Ga0157369_10290556 Ga0157369_102905562 152
110 3300013307 Ga0157372_10864100 Ga0157372_108641002 152
111 3300014968 Ga0157379_10450416 Ga0157379_104504163 152
112 3300020610 Ga0154015_1684958 Ga0154015_16849582 152
113 3300022467 Ga0224712_10160059 Ga0224712_101600592 152
114 3300025909 Ga0207705_10470212 Ga0207705_104702121 152
115 3300025913 Ga0207695_10996786 Ga0207695_109967861 152
116 3300025914 Ga0207671_10242009 Ga0207671_102420092 152
117 3300025915 Ga0207693_10009635 Ga0207693_100096353 152
118 3300025917 Ga0207660_10645139 Ga0207660_106451391 152
119 3300025921 Ga0207652_10612405 Ga0207652_106124052 152
120 3300025928 Ga0207700_11274261 Ga0207700_112742611 152
121 3300025929 Ga0207664_10446567 Ga0207664_104465672 152
122 3300025932 Ga0207690_10186365 Ga0207690_101863651 152
123 3300025944 Ga0207661_10787835 Ga0207661_107878351 152
124 3300025949 Ga0207667_10291724 Ga0207667_102917243 152
125 3300025981 Ga0207640_11252382 Ga0207640_112523821 152
126 3300026067 Ga0207678_10013512 Ga0207678_100135123 152
127 3300026078 Ga0207702_10000126 Ga0207702_1000012656 152
128 3300026078 Ga0207702_10103752 Ga0207702_101037522 152
129 3300026142 Ga0207698_10512444 Ga0207698_105124441 152
130 3300031249 Ga0265339_10009656 Ga0265339_100096564 152
131 3300031711 Ga0265314_10058323 Ga0265314_100583232 152
132 3300031712 Ga0265342_10035732 Ga0265342_100357322 152
133 3300037471 Ga0395905_0345101 Ga0395905_0345101_736_1194 152
134 3300044694 Ga0466963_0052524 Ga0466963_0052524_1979_2437 152
135 3300044694 Ga0466963_0254548 Ga0466963_0254548_134_592 152
136 3300045976 Ga0466967_0151199 Ga0466967_0151199_407_865 152
137 3300045976 Ga0466967_0228449 Ga0466967_0228449_25_483 152
138 3300046679 Ga0495623_0384792 Ga0495623_0384792_210_668 152
139 3300048088 Ga0495602_0203622 Ga0495602_0203622_252_710 152
140 3300048088 Ga0495602_0315689 Ga0495602_0315689_526_984 152
141 3300048905 Ga0496102_0451242 Ga0496102_0451242_20_478 152
142 3300048910 Ga0496107_0004195 Ga0496107_0004195_914_1372 152
143 3300048911 Ga0496108_0000515 Ga0496108_0000515_505_963 152
144 3300048912 Ga0496109_0010441 Ga0496109_0010441_3960_4418 152
145 3300048913 Ga0496110_0005518 Ga0496110_0005518_7084_7542 152
146 3300048914 Ga0496111_0220481 Ga0496111_0220481_855_1313 152
147 3300048915 Ga0496112_0345924 Ga0496112_0345924_66_524 152
148 3300048915 Ga0496112_0675683 Ga0496112_0675683_136_594 152
149 3300048921 Ga0496118_0060403 Ga0496118_0060403_2089_2595 152
150 3300048922 Ga0496119_0061538 Ga0496119_0061538_1084_1590 152
151 3300048924 Ga0496121_0011498 Ga0496121_0011498_1779_2285 152
152 3300048924 Ga0496121_0159004 Ga0496121_0159004_756_1214 152
153 3300048929 Ga0496126_0140280 Ga0496126_0140280_436_894 152
154 3300048929 Ga0496126_0260682 Ga0496126_0260682_277_735 152
155 3300048929 Ga0496126_0690528 Ga0496126_0690528_148_606 152
156 3300053078 Ga0495612_0271034 Ga0495612_0271034_217_675 152
157 3300053093 Ga0500651_0025571 Ga0500651_0025571_931_1437 152
158 3300053130 Ga0500642_0056688 Ga0500642_0056688_1167_1673 152
159 3300053731 Ga0500609_004208 Ga0500609_004208_1173_1679 152
160 3300000549 LJQas_1020340 LJQas_10203402 153
161 3300005327 Ga0070658_10024846 Ga0070658_100248464 153
162 3300005327 Ga0070658_10095518 Ga0070658_100955182 153
163 3300005327 Ga0070658_10149575 Ga0070658_101495752 153
164 3300005328 Ga0070676_10084466 Ga0070676_100844662 153
165 3300005329 Ga0070683_100008483 Ga0070683_1000084834 153
166 3300005329 Ga0070683_100941533 Ga0070683_1009415331 153
167 3300005331 Ga0070670_100171161 Ga0070670_1001711612 153
168 3300005334 Ga0068869_100548331 Ga0068869_1005483311 153
169 3300005336 Ga0070680_100011935 Ga0070680_1000119355 153
170 3300005336 Ga0070680_100030530 Ga0070680_1000305303 153
171 3300005336 Ga0070680_100096296 Ga0070680_1000962962 153
172 3300005336 Ga0070680_100098880 Ga0070680_1000988801 153
173 3300005337 Ga0070682_100034380 Ga0070682_1000343803 153
174 3300005337 Ga0070682_100065584 Ga0070682_1000655842 153
175 3300005337 Ga0070682_100356620 Ga0070682_1003566201 153
176 3300005338 Ga0068868_100014105 Ga0068868_1000141052 153
177 3300005338 Ga0068868_100020935 Ga0068868_1000209353 153
178 3300005339 Ga0070660_100004475 Ga0070660_1000044754 153
179 3300005339 Ga0070660_100201255 Ga0070660_1002012552 153
180 3300005339 Ga0070660_100314234 Ga0070660_1003142341 153
181 3300005339 Ga0070660_100392798 Ga0070660_1003927982 153
182 3300005340 Ga0070689_100221844 Ga0070689_1002218442 153
183 3300005341 Ga0070691_10127901 Ga0070691_101279012 153
184 3300005341 Ga0070691_10236878 Ga0070691_102368781 153
185 3300005343 Ga0070687_100465680 Ga0070687_1004656802 153
186 3300005344 Ga0070661_100504410 Ga0070661_1005044101 153
187 3300005344 Ga0070661_100584991 Ga0070661_1005849912 153
188 3300005344 Ga0070661_101108480 Ga0070661_1011084801 153
189 3300005345 Ga0070692_10479303 Ga0070692_104793031 153
190 3300005354 Ga0070675_101043782 Ga0070675_1010437821 153
191 3300005355 Ga0070671_100371807 Ga0070671_1003718072 153
192 3300005364 Ga0070673_100043176 Ga0070673_1000431762 153
193 3300005364 Ga0070673_101400834 Ga0070673_1014008341 153
194 3300005366 Ga0070659_100059496 Ga0070659_1000594964 153
195 3300005366 Ga0070659_100146550 Ga0070659_1001465501 153
196 3300005367 Ga0070667_100164177 Ga0070667_1001641773 153
197 3300005367 Ga0070667_101599645 Ga0070667_1015996451 153
198 3300005434 Ga0070709_10001966 Ga0070709_100019663 153
199 3300005434 Ga0070709_10123740 Ga0070709_101237402 153
200 3300005434 Ga0070709_10159933 Ga0070709_101599332 153
201 3300005434 Ga0070709_10188557 Ga0070709_101885572 153
202 3300005434 Ga0070709_10319028 Ga0070709_103190282 153
203 3300005434 Ga0070709_10416553 Ga0070709_104165532 153
204 3300005435 Ga0070714_100004035 Ga0070714_1000040357 153
205 3300005435 Ga0070714_100141278 Ga0070714_1001412782 153
206 3300005435 Ga0070714_100170471 Ga0070714_1001704713 153
207 3300005436 Ga0070713_100002369 Ga0070713_10000236910 153
208 3300005436 Ga0070713_100004315 Ga0070713_1000043157 153
209 3300005436 Ga0070713_100008716 Ga0070713_1000087163 153
210 3300005436 Ga0070713_100126864 Ga0070713_1001268641 153
211 3300005436 Ga0070713_100255959 Ga0070713_1002559592 153
212 3300005436 Ga0070713_100295578 Ga0070713_1002955782 153
213 3300005436 Ga0070713_100351263 Ga0070713_1003512633 153
214 3300005436 Ga0070713_100366951 Ga0070713_1003669511 153
215 3300005436 Ga0070713_100814741 Ga0070713_1008147411 153
216 3300005437 Ga0070710_10000567 Ga0070710_100005672 153
217 3300005437 Ga0070710_10039600 Ga0070710_100396001 153
218 3300005437 Ga0070710_10055501 Ga0070710_100555012 153
219 3300005437 Ga0070710_10175357 Ga0070710_101753572 153
220 3300005437 Ga0070710_10641649 Ga0070710_106416492 153
221 3300005439 Ga0070711_100003229 Ga0070711_1000032294 153
222 3300005439 Ga0070711_100019383 Ga0070711_1000193833 153
223 3300005439 Ga0070711_100024479 Ga0070711_1000244793 153
224 3300005444 Ga0070694_100527569 Ga0070694_1005275692 153
225 3300005444 Ga0070694_100801545 Ga0070694_1008015451 153
226 3300005445 Ga0070708_100129226 Ga0070708_1001292262 153
227 3300005455 Ga0070663_100047389 Ga0070663_1000473893 153
228 3300005455 Ga0070663_100240136 Ga0070663_1002401363 153
229 3300005455 Ga0070663_100289021 Ga0070663_1002890212 153
230 3300005455 Ga0070663_100368589 Ga0070663_1003685891 153
231 3300005456 Ga0070678_100185071 Ga0070678_1001850713 153
232 3300005456 Ga0070678_100228337 Ga0070678_1002283372 153
233 3300005457 Ga0070662_100101270 Ga0070662_1001012702 153
234 3300005457 Ga0070662_100745308 Ga0070662_1007453081 153
235 3300005458 Ga0070681_10005095 Ga0070681_100050954 153
236 3300005458 Ga0070681_10006707 Ga0070681_1000670710 153
237 3300005458 Ga0070681_10085129 Ga0070681_100851293 153
238 3300005458 Ga0070681_10328629 Ga0070681_103286292 153
239 3300005458 Ga0070681_10726322 Ga0070681_107263221 153
240 3300005458 Ga0070681_11745969 Ga0070681_117459691 153
241 3300005467 Ga0070706_100304014 Ga0070706_1003040142 153
242 3300005467 Ga0070706_100400523 Ga0070706_1004005232 153
243 3300005471 Ga0070698_100074338 Ga0070698_1000743383 153
244 3300005471 Ga0070698_100220198 Ga0070698_1002201982 153
245 3300005471 Ga0070698_100326992 Ga0070698_1003269922 153
246 3300005530 Ga0070679_100037795 Ga0070679_1000377954 153
247 3300005530 Ga0070679_100055759 Ga0070679_1000557593 153
248 3300005530 Ga0070679_100094267 Ga0070679_1000942674 153
249 3300005530 Ga0070679_100111091 Ga0070679_1001110912 153
250 3300005530 Ga0070679_100772411 Ga0070679_1007724112 153
251 3300005530 Ga0070679_101045829 Ga0070679_1010458291 153
252 3300005535 Ga0070684_100002527 Ga0070684_1000025274 153
253 3300005535 Ga0070684_100051408 Ga0070684_1000514083 153
254 3300005535 Ga0070684_100148173 Ga0070684_1001481732 153
255 3300005535 Ga0070684_100296017 Ga0070684_1002960171 153
256 3300005539 Ga0068853_100012545 Ga0068853_1000125453 153
257 3300005539 Ga0068853_100092352 Ga0068853_1000923522 153
258 3300005539 Ga0068853_100234150 Ga0068853_1002341502 153
259 3300005539 Ga0068853_100380670 Ga0068853_1003806702 153
260 3300005539 Ga0068853_100629957 Ga0068853_1006299572 153
261 3300005539 Ga0068853_101261304 Ga0068853_1012613042 153
262 3300005543 Ga0070672_100477049 Ga0070672_1004770492 153
263 3300005545 Ga0070695_100551589 Ga0070695_1005515892 153
264 3300005547 Ga0070693_100275530 Ga0070693_1002755302 153
265 3300005547 Ga0070693_100295747 Ga0070693_1002957472 153
266 3300005548 Ga0070665_100021649 Ga0070665_1000216495 153
267 3300005548 Ga0070665_100106979 Ga0070665_1001069792 153
268 3300005548 Ga0070665_100124068 Ga0070665_1001240682 153
269 3300005548 Ga0070665_100301910 Ga0070665_1003019101 153
270 3300005563 Ga0068855_100034077 Ga0068855_1000340775 153
271 3300005563 Ga0068855_100364411 Ga0068855_1003644111 153
272 3300005563 Ga0068855_100747051 Ga0068855_1007470512 153
273 3300005563 Ga0068855_101860781 Ga0068855_1018607811 153
274 3300005564 Ga0070664_100150017 Ga0070664_1001500172 153
275 3300005564 Ga0070664_100394887 Ga0070664_1003948871 153
276 3300005564 Ga0070664_101195936 Ga0070664_1011959361 153
277 3300005577 Ga0068857_100025397 Ga0068857_1000253973 153
278 3300005577 Ga0068857_100494946 Ga0068857_1004949462 153
279 3300005578 Ga0068854_100397014 Ga0068854_1003970142 153
280 3300005578 Ga0068854_100444079 Ga0068854_1004440791 153
281 3300005614 Ga0068856_100040177 Ga0068856_1000401772 153
282 3300005614 Ga0068856_100188037 Ga0068856_1001880373 153
283 3300005614 Ga0068856_100932901 Ga0068856_1009329011 153
284 3300005615 Ga0070702_100128310 Ga0070702_1001283101 153
285 3300005615 Ga0070702_100482888 Ga0070702_1004828882 153
286 3300005616 Ga0068852_100071443 Ga0068852_1000714433 153
287 3300005616 Ga0068852_100214457 Ga0068852_1002144572 153
288 3300005616 Ga0068852_100945521 Ga0068852_1009455212 153
289 3300005618 Ga0068864_100112090 Ga0068864_1001120901 153
290 3300005618 Ga0068864_100149203 Ga0068864_1001492032 153
291 3300005618 Ga0068864_100303283 Ga0068864_1003032834 153
292 3300005618 Ga0068864_100386226 Ga0068864_1003862262 153
293 3300005719 Ga0068861_100042275 Ga0068861_1000422752 153
294 3300005834 Ga0068851_10001206 Ga0068851_100012065 153
295 3300005834 Ga0068851_10853706 Ga0068851_108537061 153
296 3300005840 Ga0068870_10039043 Ga0068870_100390433 153
297 3300005841 Ga0068863_100412187 Ga0068863_1004121872 153
298 3300005842 Ga0068858_100042777 Ga0068858_1000427773 153
299 3300005842 Ga0068858_100224211 Ga0068858_1002242111 153
300 3300005842 Ga0068858_100419664 Ga0068858_1004196642 153
301 3300005842 Ga0068858_100980137 Ga0068858_1009801372 153
302 3300005843 Ga0068860_100124121 Ga0068860_1001241213 153
303 3300005843 Ga0068860_101088991 Ga0068860_1010889912 153
304 3300005844 Ga0068862_100053763 Ga0068862_1000537633 153
305 3300005937 Ga0081455_10252274 Ga0081455_102522742 153
306 3300005983 Ga0081540_1026137 Ga0081540_10261374 153
307 3300005983 Ga0081540_1142344 Ga0081540_11423442 153
308 3300006028 Ga0070717_10002140 Ga0070717_1000214010 153
309 3300006028 Ga0070717_10005547 Ga0070717_100055473 153
310 3300006028 Ga0070717_10022680 Ga0070717_100226803 153
311 3300006028 Ga0070717_10278877 Ga0070717_102788772 153
312 3300006028 Ga0070717_10459558 Ga0070717_104595582 153
313 3300006038 Ga0075365_10082143 Ga0075365_100821432 153
314 3300006038 Ga0075365_10082825 Ga0075365_100828252 153
315 3300006042 Ga0075368_10056630 Ga0075368_100566304 153
316 3300006048 Ga0075363_100050059 Ga0075363_1000500592 153
317 3300006051 Ga0075364_10136674 Ga0075364_101366742 153
318 3300006163 Ga0070715_10001480 Ga0070715_100014808 153
319 3300006163 Ga0070715_10094023 Ga0070715_100940232 153
320 3300006163 Ga0070715_10293906 Ga0070715_102939061 153
321 3300006173 Ga0070716_100050844 Ga0070716_1000508443 153
322 3300006173 Ga0070716_100089790 Ga0070716_1000897903 153
323 3300006173 Ga0070716_100124803 Ga0070716_1001248031 153
324 3300006173 Ga0070716_100125300 Ga0070716_1001253002 153
325 3300006173 Ga0070716_100214089 Ga0070716_1002140892 153
326 3300006173 Ga0070716_100352250 Ga0070716_1003522501 153
327 3300006173 Ga0070716_100526190 Ga0070716_1005261901 153
328 3300006175 Ga0070712_100021818 Ga0070712_1000218182 153
329 3300006175 Ga0070712_100055365 Ga0070712_1000553653 153
330 3300006175 Ga0070712_100237660 Ga0070712_1002376602 153
331 3300006175 Ga0070712_100386456 Ga0070712_1003864562 153
332 3300006175 Ga0070712_100491597 Ga0070712_1004915972 153
333 3300006175 Ga0070712_100795788 Ga0070712_1007957883 153
334 3300006178 Ga0075367_10038655 Ga0075367_100386553 153
335 3300006178 Ga0075367_10157989 Ga0075367_101579892 153
336 3300006195 Ga0075366_10029987 Ga0075366_100299872 153
337 3300006195 Ga0075366_10046408 Ga0075366_100464083 153
338 3300006195 Ga0075366_10799967 Ga0075366_107999671 153
339 3300006237 Ga0097621_100582349 Ga0097621_1005823492 153
340 3300006353 Ga0075370_10024128 Ga0075370_100241283 153
341 3300006353 Ga0075370_10074510 Ga0075370_100745101 153
342 3300006353 Ga0075370_10149586 Ga0075370_101495862 153
343 3300006358 Ga0068871_100065852 Ga0068871_1000658523 153
344 3300006358 Ga0068871_102131530 Ga0068871_1021315301 153
345 3300006871 Ga0075434_100019249 Ga0075434_1000192498 153
346 3300006871 Ga0075434_100071223 Ga0075434_1000712231 153
347 3300006881 Ga0068865_100059487 Ga0068865_1000594872 153
348 3300006941 Ga0099825_1037663 Ga0099825_10376632 153
349 3300006942 Ga0099824_1004403 Ga0099824_100440314 153
350 3300006943 Ga0099822_1010345 Ga0099822_10103453 153
351 3300007076 Ga0075435_100072236 Ga0075435_1000722362 153
352 3300007076 Ga0075435_100185678 Ga0075435_1001856782 153
353 3300007265 Ga0099794_10044069 Ga0099794_100440692 153
354 3300007265 Ga0099794_10049659 Ga0099794_100496592 153
355 3300007265 Ga0099794_10128070 Ga0099794_101280702 153
356 3300007265 Ga0099794_10238940 Ga0099794_102389402 153
357 3300007788 Ga0099795_10028392 Ga0099795_100283921 153
358 3300007788 Ga0099795_10056583 Ga0099795_100565831 153
359 3300007788 Ga0099795_10082883 Ga0099795_100828832 153
360 3300009092 Ga0105250_10113993 Ga0105250_101139931 153
361 3300009093 Ga0105240_10011430 Ga0105240_100114303 153
362 3300009093 Ga0105240_10033677 Ga0105240_100336773 153
363 3300009093 Ga0105240_10041672 Ga0105240_100416723 153
364 3300009093 Ga0105240_10174546 Ga0105240_101745463 153
365 3300009093 Ga0105240_10434589 Ga0105240_104345891 153
366 3300009094 Ga0111539_10520252 Ga0111539_105202523 153
367 3300009094 Ga0111539_12259434 Ga0111539_122594341 153
368 3300009098 Ga0105245_10010375 Ga0105245_100103752 153
369 3300009098 Ga0105245_10041649 Ga0105245_100416493 153
370 3300009101 Ga0105247_10024997 Ga0105247_100249971 153
371 3300009101 Ga0105247_10052319 Ga0105247_100523193 153
372 3300009148 Ga0105243_10953299 Ga0105243_109532992 153
373 3300009174 Ga0105241_10008992 Ga0105241_100089923 153
374 3300009174 Ga0105241_10098436 Ga0105241_100984362 153
375 3300009174 Ga0105241_10292561 Ga0105241_102925612 153
376 3300009176 Ga0105242_10139312 Ga0105242_101393122 153
377 3300009177 Ga0105248_10007295 Ga0105248_100072957 153
378 3300009177 Ga0105248_10322149 Ga0105248_103221491 153
379 3300009177 Ga0105248_10439338 Ga0105248_104393382 153
380 3300009177 Ga0105248_10511467 Ga0105248_105114671 153
381 3300009545 Ga0105237_10020611 Ga0105237_100206112 153
382 3300009545 Ga0105237_10090787 Ga0105237_100907871 153
383 3300009545 Ga0105237_10107427 Ga0105237_101074272 153
384 3300009545 Ga0105237_10317087 Ga0105237_103170872 153
385 3300009545 Ga0105237_10342056 Ga0105237_103420562 153
386 3300009545 Ga0105237_10357241 Ga0105237_103572412 153
387 3300009545 Ga0105237_10864703 Ga0105237_108647032 153
388 3300009545 Ga0105237_11127656 Ga0105237_111276561 153
389 3300009545 Ga0105237_11152515 Ga0105237_111525151 153
390 3300009551 Ga0105238_10002484 Ga0105238_100024845 153
391 3300009551 Ga0105238_10010951 Ga0105238_100109513 153
392 3300009551 Ga0105238_10080278 Ga0105238_100802783 153
393 3300009551 Ga0105238_10125769 Ga0105238_101257693 153
394 3300009551 Ga0105238_10132782 Ga0105238_101327822 153
395 3300009551 Ga0105238_10167854 Ga0105238_101678542 153
396 3300009551 Ga0105238_10192295 Ga0105238_101922952 153
397 3300009551 Ga0105238_10301821 Ga0105238_103018212 153
398 3300009551 Ga0105238_10498867 Ga0105238_104988672 153
399 3300009551 Ga0105238_10619763 Ga0105238_106197632 153
400 3300009553 Ga0105249_10283975 Ga0105249_102839751 153
401 3300010159 Ga0099796_10012129 Ga0099796_100121293 153
402 3300010159 Ga0099796_10023786 Ga0099796_100237863 153
403 3300010159 Ga0099796_10057068 Ga0099796_100570683 153
404 3300010375 Ga0105239_10046757 Ga0105239_100467573 153
405 3300010375 Ga0105239_10053947 Ga0105239_100539472 153
406 3300010375 Ga0105239_10069461 Ga0105239_100694612 153
407 3300010375 Ga0105239_10150170 Ga0105239_101501702 153
408 3300010375 Ga0105239_10215960 Ga0105239_102159602 153
409 3300010375 Ga0105239_10400524 Ga0105239_104005242 153
410 3300010375 Ga0105239_10473487 Ga0105239_104734872 153
411 3300010375 Ga0105239_10521800 Ga0105239_105218003 153
412 3300010375 Ga0105239_12028928 Ga0105239_120289281 153
413 3300011119 Ga0105246_10004587 Ga0105246_100045877 153
414 3300011119 Ga0105246_10038703 Ga0105246_100387033 153
415 3300011119 Ga0105246_10052688 Ga0105246_100526883 153
416 3300011119 Ga0105246_10283331 Ga0105246_102833312 153
417 3300013100 Ga0157373_10095005 Ga0157373_100950052 153
418 3300013102 Ga0157371_10064333 Ga0157371_100643333 153
419 3300013104 Ga0157370_10012436 Ga0157370_100124362 153
420 3300013104 Ga0157370_10026797 Ga0157370_100267973 153
421 3300013104 Ga0157370_10032211 Ga0157370_100322113 153
422 3300013104 Ga0157370_10210884 Ga0157370_102108842 153
423 3300013104 Ga0157370_10360975 Ga0157370_103609752 153
424 3300013105 Ga0157369_10005811 Ga0157369_100058115 153
425 3300013105 Ga0157369_10018574 Ga0157369_100185745 153
426 3300013105 Ga0157369_10025441 Ga0157369_100254412 153
427 3300013105 Ga0157369_10109029 Ga0157369_101090293 153
428 3300013105 Ga0157369_11289808 Ga0157369_112898081 153
429 3300013296 Ga0157374_10007971 Ga0157374_100079716 153
430 3300013296 Ga0157374_10025510 Ga0157374_100255103 153
431 3300013296 Ga0157374_10073117 Ga0157374_100731173 153
432 3300013296 Ga0157374_10497389 Ga0157374_104973892 153
433 3300013297 Ga0157378_10077118 Ga0157378_100771183 153
434 3300013306 Ga0163162_10110844 Ga0163162_101108442 153
435 3300013306 Ga0163162_10139362 Ga0163162_101393622 153
436 3300013306 Ga0163162_10294129 Ga0163162_102941292 153
437 3300013306 Ga0163162_11131291 Ga0163162_111312912 153
438 3300013306 Ga0163162_11431088 Ga0163162_114310881 153
439 3300013306 Ga0163162_11514511 Ga0163162_115145111 153
440 3300013307 Ga0157372_10045854 Ga0157372_100458541 153
441 3300013307 Ga0157372_10059405 Ga0157372_100594053 153
442 3300013307 Ga0157372_10258661 Ga0157372_102586612 153
443 3300013307 Ga0157372_10785701 Ga0157372_107857012 153
444 3300013307 Ga0157372_11712331 Ga0157372_117123311 153
445 3300013308 Ga0157375_10009619 Ga0157375_100096193 153
446 3300013308 Ga0157375_10420774 Ga0157375_104207741 153
447 3300014325 Ga0163163_10046523 Ga0163163_100465234 153
448 3300014325 Ga0163163_10060622 Ga0163163_100606225 153
449 3300014326 Ga0157380_10116271 Ga0157380_101162713 153
450 3300014745 Ga0157377_10075301 Ga0157377_100753012 153
451 3300014745 Ga0157377_10303368 Ga0157377_103033682 153
452 3300014968 Ga0157379_10039979 Ga0157379_100399793 153
453 3300014968 Ga0157379_10261564 Ga0157379_102615642 153
454 3300014969 Ga0157376_10048036 Ga0157376_100480363 153
455 3300014969 Ga0157376_10272345 Ga0157376_102723452 153
456 3300017792 Ga0163161_10395348 Ga0163161_103953481 153
457 3300020082 Ga0206353_10729202 Ga0206353_107292021 153
458 3300021358 Ga0213873_10016491 Ga0213873_100164912 153
459 3300021361 Ga0213872_10077681 Ga0213872_100776812 153
460 3300021384 Ga0213876_10048362 Ga0213876_100483622 153
461 3300021384 Ga0213876_10100808 Ga0213876_101008082 153
462 3300021388 Ga0213875_10069571 Ga0213875_100695712 153
463 3300021441 Ga0213871_10024691 Ga0213871_100246912 153
464 3300025253 Ga0209677_103424 Ga0209677_1034244 153
465 3300025254 Ga0209148_1007368 Ga0209148_10073683 153
466 3300025261 Ga0209233_1003510 Ga0209233_10035105 153
467 3300025261 Ga0209233_1004457 Ga0209233_10044573 153
468 3300025272 Ga0209455_1004847 Ga0209455_10048472 153
469 3300025272 Ga0209455_1011161 Ga0209455_10111612 153
470 3300025297 Ga0209758_1003593 Ga0209758_10035938 153
471 3300025321 Ga0207656_10001137 Ga0207656_100011375 153
472 3300025898 Ga0207692_10055141 Ga0207692_100551412 153
473 3300025898 Ga0207692_10083372 Ga0207692_100833722 153
474 3300025898 Ga0207692_10121321 Ga0207692_101213212 153
475 3300025898 Ga0207692_10194240 Ga0207692_101942402 153
476 3300025898 Ga0207692_10240782 Ga0207692_102407821 153
477 3300025898 Ga0207692_10511720 Ga0207692_105117201 153
478 3300025900 Ga0207710_10026452 Ga0207710_100264522 153
479 3300025900 Ga0207710_10227818 Ga0207710_102278181 153
480 3300025901 Ga0207688_10021898 Ga0207688_100218983 153
481 3300025901 Ga0207688_10037540 Ga0207688_100375402 153
482 3300025904 Ga0207647_10043784 Ga0207647_100437843 153
483 3300025904 Ga0207647_10135717 Ga0207647_101357172 153
484 3300025904 Ga0207647_10141574 Ga0207647_101415743 153
485 3300025904 Ga0207647_10235786 Ga0207647_102357862 153
486 3300025905 Ga0207685_10088570 Ga0207685_100885701 153
487 3300025905 Ga0207685_10212952 Ga0207685_102129522 153
488 3300025905 Ga0207685_10310783 Ga0207685_103107831 153
489 3300025906 Ga0207699_10002259 Ga0207699_100022595 153
490 3300025906 Ga0207699_10003128 Ga0207699_100031289 153
491 3300025906 Ga0207699_10007908 Ga0207699_100079084 153
492 3300025906 Ga0207699_10017498 Ga0207699_100174983 153
493 3300025906 Ga0207699_10205233 Ga0207699_102052332 153
494 3300025906 Ga0207699_10347888 Ga0207699_103478882 153
495 3300025906 Ga0207699_10901810 Ga0207699_109018101 153
496 3300025909 Ga0207705_10080181 Ga0207705_100801813 153
497 3300025909 Ga0207705_10096802 Ga0207705_100968021 153
498 3300025909 Ga0207705_10136991 Ga0207705_101369912 153
499 3300025910 Ga0207684_10017435 Ga0207684_100174353 153
500 3300025910 Ga0207684_10289773 Ga0207684_102897732 153
501 3300025910 Ga0207684_10612818 Ga0207684_106128181 153
502 3300025910 Ga0207684_11274979 Ga0207684_112749791 153
503 3300025911 Ga0207654_10015391 Ga0207654_100153913 153
504 3300025911 Ga0207654_10493473 Ga0207654_104934732 153
505 3300025912 Ga0207707_10000359 Ga0207707_1000035924 153
506 3300025912 Ga0207707_10010747 Ga0207707_100107472 153
507 3300025912 Ga0207707_10030608 Ga0207707_100306085 153
508 3300025912 Ga0207707_10112286 Ga0207707_101122863 153
509 3300025912 Ga0207707_10427986 Ga0207707_104279862 153
510 3300025912 Ga0207707_10669275 Ga0207707_106692751 153
511 3300025913 Ga0207695_10015120 Ga0207695_100151206 153
512 3300025913 Ga0207695_10042841 Ga0207695_100428413 153
513 3300025913 Ga0207695_10096157 Ga0207695_100961573 153
514 3300025913 Ga0207695_11225365 Ga0207695_112253651 153
515 3300025914 Ga0207671_10065375 Ga0207671_100653752 153
516 3300025914 Ga0207671_10272611 Ga0207671_102726112 153
517 3300025914 Ga0207671_10746561 Ga0207671_107465611 153
518 3300025914 Ga0207671_11028289 Ga0207671_110282891 153
519 3300025915 Ga0207693_10000581 Ga0207693_1000058120 153
520 3300025915 Ga0207693_10003453 Ga0207693_100034539 153
521 3300025915 Ga0207693_10111900 Ga0207693_101119003 153
522 3300025915 Ga0207693_10253283 Ga0207693_102532832 153
523 3300025915 Ga0207693_10270756 Ga0207693_102707562 153
524 3300025916 Ga0207663_10000084 Ga0207663_100000849 153
525 3300025916 Ga0207663_10008412 Ga0207663_100084123 153
526 3300025916 Ga0207663_10054543 Ga0207663_100545434 153
527 3300025916 Ga0207663_10137659 Ga0207663_101376593 153
528 3300025917 Ga0207660_10008448 Ga0207660_100084482 153
529 3300025917 Ga0207660_10022333 Ga0207660_100223333 153
530 3300025917 Ga0207660_10045743 Ga0207660_100457432 153
531 3300025917 Ga0207660_10056652 Ga0207660_100566522 153
532 3300025917 Ga0207660_10094596 Ga0207660_100945962 153
533 3300025917 Ga0207660_10229577 Ga0207660_102295772 153
534 3300025917 Ga0207660_10608780 Ga0207660_106087801 153
535 3300025919 Ga0207657_10007612 Ga0207657_100076129 153
536 3300025919 Ga0207657_10050134 Ga0207657_100501342 153
537 3300025920 Ga0207649_10088873 Ga0207649_100888733 153
538 3300025920 Ga0207649_10631680 Ga0207649_106316802 153
539 3300025920 Ga0207649_10926056 Ga0207649_109260561 153
540 3300025921 Ga0207652_10001857 Ga0207652_100018575 153
541 3300025921 Ga0207652_10018612 Ga0207652_100186124 153
542 3300025921 Ga0207652_10222393 Ga0207652_102223932 153
543 3300025921 Ga0207652_10864530 Ga0207652_108645301 153
544 3300025921 Ga0207652_11072876 Ga0207652_110728761 153
545 3300025921 Ga0207652_11161666 Ga0207652_111616661 153
546 3300025924 Ga0207694_10008673 Ga0207694_100086734 153
547 3300025924 Ga0207694_10050805 Ga0207694_100508052 153
548 3300025924 Ga0207694_10297841 Ga0207694_102978412 153
549 3300025924 Ga0207694_10306093 Ga0207694_103060932 153
550 3300025924 Ga0207694_10539356 Ga0207694_105393561 153
551 3300025924 Ga0207694_10555686 Ga0207694_105556862 153
552 3300025927 Ga0207687_10061184 Ga0207687_100611842 153
553 3300025927 Ga0207687_10399768 Ga0207687_103997682 153
554 3300025928 Ga0207700_10002181 Ga0207700_100021813 153
555 3300025928 Ga0207700_10002410 Ga0207700_100024106 153
556 3300025928 Ga0207700_10011068 Ga0207700_100110683 153
557 3300025928 Ga0207700_10102508 Ga0207700_101025082 153
558 3300025928 Ga0207700_10321622 Ga0207700_103216222 153
559 3300025928 Ga0207700_10422071 Ga0207700_104220712 153
560 3300025929 Ga0207664_10033743 Ga0207664_100337433 153
561 3300025929 Ga0207664_10776847 Ga0207664_107768472 153
562 3300025931 Ga0207644_10211660 Ga0207644_102116602 153
563 3300025931 Ga0207644_10414897 Ga0207644_104148972 153
564 3300025931 Ga0207644_10915142 Ga0207644_109151421 153
565 3300025932 Ga0207690_10165092 Ga0207690_101650922 153
566 3300025932 Ga0207690_10535873 Ga0207690_105358731 153
567 3300025933 Ga0207706_10071983 Ga0207706_100719833 153
568 3300025934 Ga0207686_10418701 Ga0207686_104187011 153
569 3300025935 Ga0207709_10191202 Ga0207709_101912023 153
570 3300025938 Ga0207704_10492411 Ga0207704_104924111 153
571 3300025939 Ga0207665_10001451 Ga0207665_1000145110 153
572 3300025939 Ga0207665_10019859 Ga0207665_100198592 153
573 3300025939 Ga0207665_10021271 Ga0207665_100212714 153
574 3300025939 Ga0207665_10254343 Ga0207665_102543432 153
575 3300025941 Ga0207711_10045435 Ga0207711_100454352 153
576 3300025942 Ga0207689_10030221 Ga0207689_100302214 153
577 3300025944 Ga0207661_10001574 Ga0207661_100015748 153
578 3300025944 Ga0207661_10045131 Ga0207661_100451312 153
579 3300025945 Ga0207679_10256663 Ga0207679_102566631 153
580 3300025945 Ga0207679_10434123 Ga0207679_104341231 153
581 3300025945 Ga0207679_10570800 Ga0207679_105708002 153
582 3300025949 Ga0207667_10011919 Ga0207667_100119197 153
583 3300025949 Ga0207667_10107180 Ga0207667_101071802 153
584 3300025949 Ga0207667_10380094 Ga0207667_103800941 153
585 3300025949 Ga0207667_10936257 Ga0207667_109362571 153
586 3300025960 Ga0207651_10085394 Ga0207651_100853942 153
587 3300025961 Ga0207712_10360888 Ga0207712_103608882 153
588 3300025981 Ga0207640_10569046 Ga0207640_105690461 153
589 3300025986 Ga0207658_11469893 Ga0207658_114698931 153
590 3300026023 Ga0207677_10017270 Ga0207677_100172702 153
591 3300026023 Ga0207677_10620284 Ga0207677_106202842 153
592 3300026035 Ga0207703_10152408 Ga0207703_101524082 153
593 3300026035 Ga0207703_11449680 Ga0207703_114496802 153
594 3300026041 Ga0207639_10075879 Ga0207639_100758792 153
595 3300026041 Ga0207639_10082509 Ga0207639_100825092 153
596 3300026041 Ga0207639_10127196 Ga0207639_101271963 153
597 3300026041 Ga0207639_10221216 Ga0207639_102212162 153
598 3300026041 Ga0207639_10465652 Ga0207639_104656522 153
599 3300026041 Ga0207639_10551835 Ga0207639_105518351 153
600 3300026067 Ga0207678_10021128 Ga0207678_100211283 153
601 3300026067 Ga0207678_10057693 Ga0207678_100576932 153
602 3300026067 Ga0207678_10073418 Ga0207678_100734182 153
603 3300026067 Ga0207678_10460350 Ga0207678_104603502 153
604 3300026067 Ga0207678_10877321 Ga0207678_108773211 153
605 3300026067 Ga0207678_11134638 Ga0207678_111346381 153
606 3300026078 Ga0207702_10025939 Ga0207702_100259391 153
607 3300026078 Ga0207702_10139175 Ga0207702_101391753 153
608 3300026078 Ga0207702_10740032 Ga0207702_107400322 153
609 3300026095 Ga0207676_10126359 Ga0207676_101263593 153
610 3300026095 Ga0207676_10137279 Ga0207676_101372793 153
611 3300026095 Ga0207676_10336260 Ga0207676_103362602 153
612 3300026095 Ga0207676_11022194 Ga0207676_110221941 153
613 3300026116 Ga0207674_10047527 Ga0207674_100475272 153
614 3300026116 Ga0207674_11577883 Ga0207674_115778831 153
615 3300026118 Ga0207675_100053776 Ga0207675_1000537763 153
616 3300026121 Ga0207683_10027970 Ga0207683_100279703 153
617 3300026121 Ga0207683_10098624 Ga0207683_100986243 153
618 3300026121 Ga0207683_10222039 Ga0207683_102220392 153
619 3300026142 Ga0207698_10016536 Ga0207698_100165361 153
620 3300026142 Ga0207698_10115167 Ga0207698_101151671 153
621 3300026142 Ga0207698_10378503 Ga0207698_103785032 153
622 3300026142 Ga0207698_11083948 Ga0207698_110839482 153
623 3300027357 Ga0209589_1000001 Ga0209589_1000001231 153
624 3300027361 Ga0209489_100001 Ga0209489_100001231 153
625 3300027363 Ga0209700_100001 Ga0209700_100001231 153
626 3300027512 Ga0209179_1029993 Ga0209179_10299932 153
627 3300027866 Ga0209813_10016059 Ga0209813_100160592 153
628 3300027866 Ga0209813_10046909 Ga0209813_100469091 153
629 3300028379 Ga0268266_10044743 Ga0268266_100447433 153
630 3300028379 Ga0268266_10068095 Ga0268266_100680953 153
631 3300028379 Ga0268266_10233579 Ga0268266_102335791 153
632 3300028381 Ga0268264_10026839 Ga0268264_100268393 153
633 3300028556 Ga0265337_1065525 Ga0265337_10655251 153
634 3300028563 Ga0265319_1023466 Ga0265319_10234661 153
635 3300028573 Ga0265334_10001652 Ga0265334_100016523 153
636 3300028653 Ga0265323_10001443 Ga0265323_1000144313 153
637 3300028654 Ga0265322_10039901 Ga0265322_100399012 153
638 3300028666 Ga0265336_10000335 Ga0265336_1000033512 153
639 3300028800 Ga0265338_10000321 Ga0265338_1000032126 153
640 3300029957 Ga0265324_10015723 Ga0265324_100157233 153
641 3300030763 Ga0265763_1002214 Ga0265763_10022142 153
642 3300031235 Ga0265330_10057434 Ga0265330_100574342 153
643 3300031235 Ga0265330_10116879 Ga0265330_101168792 153
644 3300031238 Ga0265332_10040278 Ga0265332_100402782 153
645 3300031238 Ga0265332_10043920 Ga0265332_100439201 153
646 3300031239 Ga0265328_10039897 Ga0265328_100398972 153
647 3300031241 Ga0265325_10002843 Ga0265325_100028434 153
648 3300031247 Ga0265340_10125235 Ga0265340_101252352 153
649 3300031249 Ga0265339_10137109 Ga0265339_101371092 153
650 3300031250 Ga0265331_10094541 Ga0265331_100945411 153
651 3300031250 Ga0265331_10185792 Ga0265331_101857922 153
652 3300031250 Ga0265331_10234461 Ga0265331_102344612 153
653 3300031344 Ga0265316_10357857 Ga0265316_103578571 153
654 3300031344 Ga0265316_10373207 Ga0265316_103732072 153
655 3300031595 Ga0265313_10220810 Ga0265313_102208101 153
656 3300031616 Ga0307508_10180419 Ga0307508_101804193 153
657 3300031711 Ga0265314_10412105 Ga0265314_104121051 153
658 3300031712 Ga0265342_10015861 Ga0265342_100158615 153
659 3300031712 Ga0265342_10028907 Ga0265342_100289072 153
660 3300031712 Ga0265342_10413998 Ga0265342_104139981 153
661 3300032005 Ga0307411_10257060 Ga0307411_102570602 153
662 3300033180 Ga0307510_10159803 Ga0307510_101598031 153
663 3300033442 Ga0315911_1000006 Ga0315911_1000006337 153
664 3300033544 Ga0316215_1001093 Ga0316215_10010931 153
665 3300035083 Ga0373926_0078379 Ga0373926_0078379_454_918 153
666 3300035086 Ga0373934_0018616 Ga0373934_0018616_647_1108 153
667 3300035086 Ga0373934_0026167 Ga0373934_0026167_1242_1706 153
668 3300035089 Ga0373944_0035380 Ga0373944_0035380_183_647 153
669 3300035091 Ga0373951_0252775 Ga0373951_0252775_20_481 153
670 3300035111 Ga0373923_0013083 Ga0373923_0013083_2326_2787 153
671 3300035111 Ga0373923_0113651 Ga0373923_0113651_46_507 153
672 3300035113 Ga0373936_0020273 Ga0373936_0020273_667_1128 153
673 3300035113 Ga0373936_0094888 Ga0373936_0094888_239_700 153
674 3300035113 Ga0373936_0237573 Ga0373936_0237573_271_732 153
675 3300035116 Ga0373945_0053527 Ga0373945_0053527_192_653 153
676 3300035117 Ga0373953_0005987 Ga0373953_0005987_1362_1823 153
677 3300035118 Ga0373954_0077813 Ga0373954_0077813_656_1117 153
678 3300035118 Ga0373954_0135759 Ga0373954_0135759_677_1138 153
679 3300035119 Ga0373956_0036736 Ga0373956_0036736_125_589 153
680 3300035120 Ga0373957_0002003 Ga0373957_0002003_1687_2148 153
681 3300035120 Ga0373957_0316845 Ga0373957_0316845_105_566 153
682 3300035120 Ga0373957_0340537 Ga0373957_0340537_125_589 153
683 3300035170 Ga0373943_0047895 Ga0373943_0047895_612_1073 153
684 3300035170 Ga0373943_0121655 Ga0373943_0121655_405_869 153
685 3300035170 Ga0373943_0163581 Ga0373943_0163581_671_1132 153
686 3300035171 Ga0373946_0000984 Ga0373946_0000984_3842_4303 153
687 3300035171 Ga0373946_0207549 Ga0373946_0207549_303_767 153
688 3300035171 Ga0373946_0216540 Ga0373946_0216540_331_792 153
689 3300035172 Ga0373955_0002892 Ga0373955_0002892_3436_3897 153
690 3300035172 Ga0373955_0067026 Ga0373955_0067026_1446_1907 153
691 3300035172 Ga0373955_0177046 Ga0373955_0177046_247_708 153
692 3300035410 Ga0373924_0006496 Ga0373924_0006496_1767_2228 153
693 3300035692 Ga0373935_0000769 Ga0373935_0000769_2911_3372 153
694 3300035692 Ga0373935_0134841 Ga0373935_0134841_596_1060 153
695 3300035692 Ga0373935_0199476 Ga0373935_0199476_518_979 153
696 3300035692 Ga0373935_0523742 Ga0373935_0523742_314_775 153
697 3300035695 Ga0373927_0002152 Ga0373927_0002152_463_924 153
698 3300035695 Ga0373927_0006718 Ga0373927_0006718_947_1408 153
699 3300035695 Ga0373927_0069075 Ga0373927_0069075_1339_1803 153
700 3300035695 Ga0373927_0076271 Ga0373927_0076271_1043_1504 153
701 3300035724 Ga0373933_0003725 Ga0373933_0003725_7124_7585 153
702 3300035724 Ga0373933_0024995 Ga0373933_0024995_361_822 153
703 3300035724 Ga0373933_0110694 Ga0373933_0110694_892_1353 153
704 3300035725 Ga0373947_0002495 Ga0373947_0002495_4211_4672 153
705 3300035725 Ga0373947_0013965 Ga0373947_0013965_1983_2444 153
706 3300035725 Ga0373947_0058241 Ga0373947_0058241_433_894 153
707 3300035725 Ga0373947_0452871 Ga0373947_0452871_118_582 153
708 3300036401 Ga0373937_0044375 Ga0373937_0044375_241_702 153
709 3300036401 Ga0373937_0059943 Ga0373937_0059943_81_542 153
710 3300036401 Ga0373937_0080055 Ga0373937_0080055_2408_2869 153
711 3300036401 Ga0373937_0082618 Ga0373937_0082618_491_952 153
712 3300036401 Ga0373937_0120382 Ga0373937_0120382_1287_1748 153
713 3300036401 Ga0373937_0335947 Ga0373937_0335947_277_741 153
714 3300036401 Ga0373937_0800747 Ga0373937_0800747_393_854 153
715 3300036401 Ga0373937_0890770 Ga0373937_0890770_145_606 153
716 3300036459 Ga0372808_032717 Ga0372808_032717_168_629 153
717 3300036459 Ga0372808_049697 Ga0372808_049697_63_524 153
718 3300037068 Ga0373925_0014642 Ga0373925_0014642_2625_3086 153
719 3300037068 Ga0373925_0017659 Ga0373925_0017659_4333_4797 153
720 3300037068 Ga0373925_0055417 Ga0373925_0055417_1917_2378 153
721 3300037068 Ga0373925_0086872 Ga0373925_0086872_365_826 153
722 3300037068 Ga0373925_0555204 Ga0373925_0555204_409_870 153
723 3300037312 Ga0395899_0096351 Ga0395899_0096351_487_990 153
724 3300037312 Ga0395899_0482062 Ga0395899_0482062_311_772 153
725 3300037418 Ga0395900_0036594 Ga0395900_0036594_3042_3503 153
726 3300037418 Ga0395900_0264443 Ga0395900_0264443_491_970 153
727 3300037418 Ga0395900_0281373 Ga0395900_0281373_306_767 153
728 3300037418 Ga0395900_1214395 Ga0395900_1214395_158_631 153
729 3300037466 Ga0395898_0183739 Ga0395898_0183739_42_515 153
730 3300037466 Ga0395898_0656312 Ga0395898_0656312_330_833 153
731 3300037471 Ga0395905_0737023 Ga0395905_0737023_306_767 153
732 3300037853 Ga0436364_1238755 Ga0436364_1238755_249_722 153
733 3300037853 Ga0436364_1440766 Ga0436364_1440766_3629_4090 153
734 3300038443 Ga0395901_0102630 Ga0395901_0102630_763_1224 153
735 3300038443 Ga0395901_0302042 Ga0395901_0302042_340_843 153
736 3300038443 Ga0395901_0419125 Ga0395901_0419125_789_1268 153
737 3300038443 Ga0395901_0920692 Ga0395901_0920692_349_810 153
738 3300038443 Ga0395901_1317682 Ga0395901_1317682_19_480 153
739 3300039437 Ga0436365_0055150 Ga0436365_0055150_829_1290 153
740 3300039437 Ga0436365_0154445 Ga0436365_0154445_114_575 153
741 3300039437 Ga0436365_0274379 Ga0436365_0274379_37_498 153
742 3300039437 Ga0436365_0278773 Ga0436365_0278773_401_874 153
743 3300039437 Ga0436365_1321630 Ga0436365_1321630_781_1242 153
744 3300039437 Ga0436365_1533174 Ga0436365_1533174_671_1132 153
745 3300039437 Ga0436365_1596305 Ga0436365_1596305_411_896 153
746 3300039437 Ga0436365_1698216 Ga0436365_1698216_202_663 153
747 3300039438 Ga0436360_0359314 Ga0436360_0359314_74_535 153
748 3300039438 Ga0436360_0858327 Ga0436360_0858327_1849_2310 153
749 3300039447 Ga0436361_0402608 Ga0436361_0402608_2263_2724 153
750 3300039447 Ga0436361_0499397 Ga0436361_0499397_71_532 153
751 3300039447 Ga0436361_1046855 Ga0436361_1046855_1325_1786 153
752 3300039447 Ga0436361_1055508 Ga0436361_1055508_227_688 153
753 3300039450 Ga0436363_1424999 Ga0436363_1424999_3845_4309 153
754 3300039450 Ga0436363_1654142 Ga0436363_1654142_376_837 153
755 3300039453 Ga0436362_1037639 Ga0436362_1037639_453_914 153
756 3300041512 Ga0451853_1110420 Ga0451853_1110420_159_620 153
757 3300042005 Ga0439448_0197900 Ga0439448_0197900_38_499 153
758 3300044656 Ga0466969_0316039 Ga0466969_0316039_71_532 153
759 3300044656 Ga0466969_0354856 Ga0466969_0354856_121_582 153
760 3300044684 Ga0466966_0040049 Ga0466966_0040049_152_613 153
761 3300044684 Ga0466966_0142565 Ga0466966_0142565_427_888 153
762 3300044684 Ga0466966_0183123 Ga0466966_0183123_366_827 153
763 3300044693 Ga0466961_0400694 Ga0466961_0400694_127_588 153
764 3300044694 Ga0466963_1117532 Ga0466963_1117532_43_504 153
765 3300044706 Ga0466964_0186039 Ga0466964_0186039_189_653 153
766 3300044842 Ga0466957_0096028 Ga0466957_0096028_1276_1737 153
767 3300044842 Ga0466957_0736790 Ga0466957_0736790_211_672 153
768 3300045049 Ga0466959_0075500 Ga0466959_0075500_884_1345 153
769 3300045049 Ga0466959_0079916 Ga0466959_0079916_255_716 153
770 3300045049 Ga0466959_0213534 Ga0466959_0213534_109_570 153
771 3300045049 Ga0466959_0216292 Ga0466959_0216292_819_1280 153
772 3300045976 Ga0466967_0132208 Ga0466967_0132208_691_1152 153
773 3300045976 Ga0466967_0150124 Ga0466967_0150124_1603_2064 153
774 3300046454 Ga0495592_0029228 Ga0495592_0029228_2899_3360 153
775 3300046454 Ga0495592_0031028 Ga0495592_0031028_156_617 153
776 3300046454 Ga0495592_0182524 Ga0495592_0182524_405_869 153
777 3300046455 Ga0495603_0000191 Ga0495603_0000191_14097_14558 153
778 3300046455 Ga0495603_0027330 Ga0495603_0027330_2742_3203 153
779 3300046457 Ga0495590_0207442 Ga0495590_0207442_187_648 153
780 3300046459 Ga0495629_0000500 Ga0495629_0000500_18976_19437 153
781 3300046459 Ga0495629_0324696 Ga0495629_0324696_150_641 153
782 3300046460 Ga0495638_0048758 Ga0495638_0048758_57_518 153
783 3300046461 Ga0495641_0001436 Ga0495641_0001436_1272_1733 153
784 3300046461 Ga0495641_0458131 Ga0495641_0458131_69_530 153
785 3300046462 Ga0495651_0143760 Ga0495651_0143760_81_542 153
786 3300046462 Ga0495651_0273396 Ga0495651_0273396_202_663 153
787 3300046463 Ga0495653_0003914 Ga0495653_0003914_7349_7810 153
788 3300046472 Ga0495580_0003014 Ga0495580_0003014_13327_13788 153
789 3300046472 Ga0495580_0025302 Ga0495580_0025302_1846_2307 153
790 3300046472 Ga0495580_0165342 Ga0495580_0165342_355_819 153
791 3300046473 Ga0495582_0000251 Ga0495582_0000251_19925_20386 153
792 3300046475 Ga0495639_0000077 Ga0495639_0000077_14374_14835 153
793 3300046477 Ga0495664_0052529 Ga0495664_0052529_1586_2047 153
794 3300046477 Ga0495664_0055406 Ga0495664_0055406_288_749 153
795 3300046477 Ga0495664_0066459 Ga0495664_0066459_124_588 153
796 3300046477 Ga0495664_0106235 Ga0495664_0106235_203_664 153
797 3300046477 Ga0495664_0220896 Ga0495664_0220896_228_689 153
798 3300046477 Ga0495664_0244929 Ga0495664_0244929_605_1066 153
799 3300046499 Ga0495594_0000938 Ga0495594_0000938_566_1027 153
800 3300046499 Ga0495594_0537971 Ga0495594_0537971_19_483 153
801 3300046500 Ga0495596_0251580 Ga0495596_0251580_19_510 153
802 3300046507 Ga0495606_0089210 Ga0495606_0089210_1425_1886 153
803 3300046507 Ga0495606_0198576 Ga0495606_0198576_169_660 153
804 3300046511 Ga0495608_0009143 Ga0495608_0009143_3309_3770 153
805 3300046512 Ga0495610_0067508 Ga0495610_0067508_920_1381 153
806 3300046513 Ga0495616_0094447 Ga0495616_0094447_230_691 153
807 3300046514 Ga0495618_0020218 Ga0495618_0020218_3622_4086 153
808 3300046514 Ga0495618_0420867 Ga0495618_0420867_160_621 153
809 3300046516 Ga0495628_0228204 Ga0495628_0228204_115_576 153
810 3300046516 Ga0495628_0416196 Ga0495628_0416196_134_595 153
811 3300046517 Ga0495630_0332361 Ga0495630_0332361_656_1120 153
812 3300046518 Ga0495631_0185392 Ga0495631_0185392_338_799 153
813 3300046524 Ga0495648_0006022 Ga0495648_0006022_9216_9677 153
814 3300046524 Ga0495648_0242594 Ga0495648_0242594_20_496 153
815 3300046526 Ga0495666_0039136 Ga0495666_0039136_1023_1484 153
816 3300046529 Ga0495652_0003535 Ga0495652_0003535_1478_1939 153
817 3300046529 Ga0495652_0699938 Ga0495652_0699938_22_483 153
818 3300046529 Ga0495652_0888203 Ga0495652_0888203_70_531 153
819 3300046531 Ga0495665_0000363 Ga0495665_0000363_3653_4114 153
820 3300046533 Ga0495640_0008340 Ga0495640_0008340_1269_1730 153
821 3300046543 Ga0495645_0018802 Ga0495645_0018802_4095_4556 153
822 3300046543 Ga0495645_0128339 Ga0495645_0128339_819_1280 153
823 3300046557 Ga0495622_0016899 Ga0495622_0016899_1465_1926 153
824 3300046557 Ga0495622_0191992 Ga0495622_0191992_190_651 153
825 3300046559 Ga0495667_0012558 Ga0495667_0012558_1626_2087 153
826 3300046559 Ga0495667_0050074 Ga0495667_0050074_564_1025 153
827 3300046559 Ga0495667_0218115 Ga0495667_0218115_287_748 153
828 3300046616 Ga0495668_0123906 Ga0495668_0123906_504_965 153
829 3300046642 Ga0495634_0000440 Ga0495634_0000440_34483_34944 153
830 3300046642 Ga0495634_0006578 Ga0495634_0006578_1837_2298 153
831 3300046642 Ga0495634_0014949 Ga0495634_0014949_198_662 153
832 3300046660 Ga0495625_0098496 Ga0495625_0098496_1527_1988 153
833 3300046663 Ga0495635_0000425 Ga0495635_0000425_13601_14062 153
834 3300046663 Ga0495635_0036763 Ga0495635_0036763_867_1331 153
835 3300046663 Ga0495635_0092525 Ga0495635_0092525_260_721 153
836 3300046674 Ga0495588_0001638 Ga0495588_0001638_3203_3664 153
837 3300046674 Ga0495588_0498649 Ga0495588_0498649_44_508 153
838 3300046675 Ga0495657_0071597 Ga0495657_0071597_361_822 153
839 3300046675 Ga0495657_0166830 Ga0495657_0166830_811_1272 153
840 3300046675 Ga0495657_0838134 Ga0495657_0838134_48_509 153
841 3300046678 Ga0495599_0151580 Ga0495599_0151580_836_1297 153
842 3300046678 Ga0495599_0236719 Ga0495599_0236719_587_1051 153
843 3300046680 Ga0495646_0015975 Ga0495646_0015975_1903_2364 153
844 3300046680 Ga0495646_0040856 Ga0495646_0040856_470_931 153
845 3300046681 Ga0495647_0056223 Ga0495647_0056223_143_604 153
846 3300046683 Ga0495658_0001987 Ga0495658_0001987_2911_3372 153
847 3300046683 Ga0495658_0710326 Ga0495658_0710326_123_584 153
848 3300046683 Ga0495658_0844047 Ga0495658_0844047_66_527 153
849 3300046684 Ga0495669_0024837 Ga0495669_0024837_1928_2389 153
850 3300046689 Ga0495613_0011731 Ga0495613_0011731_2911_3372 153
851 3300046690 Ga0495624_0000818 Ga0495624_0000818_10232_10693 153
852 3300046692 Ga0495671_0051171 Ga0495671_0051171_866_1327 153
853 3300046809 Ga0495600_0017589 Ga0495600_0017589_2068_2529 153
854 3300046809 Ga0495600_0376087 Ga0495600_0376087_21_482 153
855 3300047315 Ga0495581_0018715 Ga0495581_0018715_493_957 153
856 3300047315 Ga0495581_0654914 Ga0495581_0654914_122_583 153
857 3300047317 Ga0495604_0049475 Ga0495604_0049475_519_980 153
858 3300047317 Ga0495604_0145575 Ga0495604_0145575_125_586 153
859 3300047317 Ga0495604_0239240 Ga0495604_0239240_175_636 153
860 3300047317 Ga0495604_0626011 Ga0495604_0626011_103_564 153
861 3300047319 Ga0495674_0001342 Ga0495674_0001342_8445_8906 153
862 3300047319 Ga0495674_0063294 Ga0495674_0063294_155_616 153
863 3300047320 Ga0495672_0243279 Ga0495672_0243279_274_735 153
864 3300047321 Ga0495676_0030480 Ga0495676_0030480_3186_3647 153
865 3300047321 Ga0495676_0539029 Ga0495676_0539029_129_590 153
866 3300047322 Ga0495680_0061007 Ga0495680_0061007_2249_2710 153
867 3300047322 Ga0495680_0316245 Ga0495680_0316245_502_963 153
868 3300047323 Ga0495683_0251771 Ga0495683_0251771_21_482 153
869 3300047444 Ga0495675_0017501 Ga0495675_0017501_2604_3065 153
870 3300047471 Ga0495684_0003601 Ga0495684_0003601_6350_6811 153
871 3300047471 Ga0495684_0118183 Ga0495684_0118183_1020_1481 153
872 3300047472 Ga0495686_0075373 Ga0495686_0075373_729_1190 153
873 3300047673 Ga0495593_0000192 Ga0495593_0000192_17355_17816 153
874 3300047673 Ga0495593_0002191 Ga0495593_0002191_3769_4230 153
875 3300047673 Ga0495593_0102081 Ga0495593_0102081_610_1074 153
876 3300047673 Ga0495593_0334920 Ga0495593_0334920_84_545 153
877 3300047673 Ga0495593_0543843 Ga0495593_0543843_61_552 153
878 3300048088 Ga0495602_0108298 Ga0495602_0108298_133_594 153
879 3300048088 Ga0495602_0218235 Ga0495602_0218235_787_1248 153
880 3300048088 Ga0495602_0225779 Ga0495602_0225779_797_1258 153
881 3300048903 Ga0496100_0090361 Ga0496100_0090361_1153_1614 153
882 3300048903 Ga0496100_0227244 Ga0496100_0227244_455_916 153
883 3300048904 Ga0496101_0006237 Ga0496101_0006237_6475_6966 153
884 3300048904 Ga0496101_0288229 Ga0496101_0288229_248_724 153
885 3300048904 Ga0496101_1110884 Ga0496101_1110884_101_562 153
886 3300048905 Ga0496102_0002444 Ga0496102_0002444_6570_7061 153
887 3300048905 Ga0496102_0200887 Ga0496102_0200887_1224_1685 153
888 3300048905 Ga0496102_1355931 Ga0496102_1355931_16_477 153
889 3300048906 Ga0496103_0103626 Ga0496103_0103626_71_562 153
890 3300048906 Ga0496103_0423432 Ga0496103_0423432_107_568 153
891 3300048906 Ga0496103_0433860 Ga0496103_0433860_43_504 153
892 3300048907 Ga0496104_0004215 Ga0496104_0004215_8560_9051 153
893 3300048907 Ga0496104_0007469 Ga0496104_0007469_7317_7778 153
894 3300048907 Ga0496104_0109021 Ga0496104_0109021_1488_1949 153
895 3300048907 Ga0496104_0166042 Ga0496104_0166042_108_584 153
896 3300048908 Ga0496105_0062323 Ga0496105_0062323_1590_2081 153
897 3300048908 Ga0496105_0492389 Ga0496105_0492389_429_890 153
898 3300048909 Ga0496106_0031456 Ga0496106_0031456_1486_1977 153
899 3300048909 Ga0496106_0043168 Ga0496106_0043168_1837_2298 153
900 3300048909 Ga0496106_0125048 Ga0496106_0125048_1359_1820 153
901 3300048909 Ga0496106_0301891 Ga0496106_0301891_693_1154 153
902 3300048910 Ga0496107_0006772 Ga0496107_0006772_2465_2956 153
903 3300048910 Ga0496107_0090516 Ga0496107_0090516_757_1218 153
904 3300048911 Ga0496108_0008382 Ga0496108_0008382_354_845 153
905 3300048911 Ga0496108_0067607 Ga0496108_0067607_2462_2923 153
906 3300048911 Ga0496108_0082965 Ga0496108_0082965_1338_1799 153
907 3300048911 Ga0496108_0085647 Ga0496108_0085647_1231_1692 153
908 3300048912 Ga0496109_0016411 Ga0496109_0016411_4741_5232 153
909 3300048912 Ga0496109_0205174 Ga0496109_0205174_845_1309 153
910 3300048913 Ga0496110_0006362 Ga0496110_0006362_5833_6324 153
911 3300048913 Ga0496110_0119527 Ga0496110_0119527_1795_2256 153
912 3300048914 Ga0496111_0020163 Ga0496111_0020163_311_775 153
913 3300048914 Ga0496111_0054972 Ga0496111_0054972_341_832 153
914 3300048914 Ga0496111_0065725 Ga0496111_0065725_1464_1925 153
915 3300048914 Ga0496111_0358477 Ga0496111_0358477_438_899 153
916 3300048915 Ga0496112_0000004 Ga0496112_0000004_342189_342650 153
917 3300048915 Ga0496112_0010287 Ga0496112_0010287_517_978 153
918 3300048915 Ga0496112_0017441 Ga0496112_0017441_4363_4824 153
919 3300048915 Ga0496112_0023073 Ga0496112_0023073_1911_2372 153
920 3300048915 Ga0496112_0059262 Ga0496112_0059262_2574_3035 153
921 3300048915 Ga0496112_0398793 Ga0496112_0398793_16_507 153
922 3300048916 Ga0496113_0039773 Ga0496113_0039773_1489_1950 153
923 3300048916 Ga0496113_0049914 Ga0496113_0049914_1242_1733 153
924 3300048916 Ga0496113_0199255 Ga0496113_0199255_474_935 153
925 3300048917 Ga0496114_0460979 Ga0496114_0460979_501_962 153
926 3300048917 Ga0496114_1173754 Ga0496114_1173754_19_510 153
927 3300048918 Ga0496115_0004586 Ga0496115_0004586_7921_8412 153
928 3300048918 Ga0496115_0015076 Ga0496115_0015076_4689_5150 153
929 3300048918 Ga0496115_0104091 Ga0496115_0104091_818_1279 153
930 3300048918 Ga0496115_0862211 Ga0496115_0862211_97_558 153
931 3300048920 Ga0496117_0010921 Ga0496117_0010921_2734_3195 153
932 3300048920 Ga0496117_0039914 Ga0496117_0039914_156_617 153
933 3300048921 Ga0496118_0163414 Ga0496118_0163414_806_1267 153
934 3300048921 Ga0496118_0310191 Ga0496118_0310191_101_562 153
935 3300048921 Ga0496118_0358072 Ga0496118_0358072_85_546 153
936 3300048924 Ga0496121_0006790 Ga0496121_0006790_3760_4242 153
937 3300048924 Ga0496121_0026797 Ga0496121_0026797_917_1378 153
938 3300048924 Ga0496121_0042449 Ga0496121_0042449_1299_1760 153
939 3300048924 Ga0496121_0402895 Ga0496121_0402895_418_879 153
940 3300048924 Ga0496121_0589008 Ga0496121_0589008_50_511 153
941 3300048927 Ga0496124_0061538 Ga0496124_0061538_1707_2168 153
942 3300048927 Ga0496124_0276115 Ga0496124_0276115_466_927 153
943 3300048928 Ga0496125_0018110 Ga0496125_0018110_5967_6428 153
944 3300048928 Ga0496125_0122695 Ga0496125_0122695_551_1012 153
945 3300048929 Ga0496126_0004265 Ga0496126_0004265_10458_10919 153
946 3300048929 Ga0496126_0007329 Ga0496126_0007329_7366_7827 153
947 3300048929 Ga0496126_0027426 Ga0496126_0027426_3753_4214 153
948 3300048929 Ga0496126_0105247 Ga0496126_0105247_295_756 153
949 3300048929 Ga0496126_0211341 Ga0496126_0211341_499_960 153
950 3300048929 Ga0496126_0217819 Ga0496126_0217819_915_1376 153
951 3300048929 Ga0496126_0342862 Ga0496126_0342862_676_1137 153
952 3300048929 Ga0496126_0392418 Ga0496126_0392418_477_938 153
953 3300048929 Ga0496126_0832826 Ga0496126_0832826_188_664 153
954 3300049568 Ga0501031_0000268 Ga0501031_0000268_25477_25938 153
955 3300049568 Ga0501031_0525600 Ga0501031_0525600_42_518 153
956 3300049569 Ga0501032_0000619 Ga0501032_0000619_360_821 153
957 3300049569 Ga0501032_0030178 Ga0501032_0030178_22_498 153
958 3300049569 Ga0501032_0108134 Ga0501032_0108134_889_1365 153
959 3300049569 Ga0501032_0141775 Ga0501032_0141775_528_1004 153
960 3300049570 Ga0501033_0000108 Ga0501033_0000108_12660_13121 153
961 3300049570 Ga0501033_0015026 Ga0501033_0015026_1135_1611 153
962 3300049570 Ga0501033_0050162 Ga0501033_0050162_1235_1711 153
963 3300049571 Ga0501034_0000100 Ga0501034_0000100_109727_110188 153
964 3300049571 Ga0501034_0400933 Ga0501034_0400933_24_500 153
965 3300049571 Ga0501034_0433157 Ga0501034_0433157_249_725 153
966 3300049572 Ga0501036_0000228 Ga0501036_0000228_13356_13817 153
967 3300049572 Ga0501036_0094300 Ga0501036_0094300_1744_2220 153
968 3300049573 Ga0501037_0002072 Ga0501037_0002072_8308_8769 153
969 3300049573 Ga0501037_0049351 Ga0501037_0049351_2239_2715 153
970 3300049573 Ga0501037_0124154 Ga0501037_0124154_1134_1610 153
971 3300049574 Ga0501038_0002060 Ga0501038_0002060_2661_3137 153
972 3300049574 Ga0501038_0010248 Ga0501038_0010248_7757_8218 153
973 3300049574 Ga0501038_0027992 Ga0501038_0027992_78_554 153
974 3300049574 Ga0501038_1128446 Ga0501038_1128446_18_494 153
975 3300049575 Ga0501039_0001602 Ga0501039_0001602_2263_2724 153
976 3300049575 Ga0501039_0022365 Ga0501039_0022365_3266_3742 153
977 3300049575 Ga0501039_0102340 Ga0501039_0102340_1425_1901 153
978 3300049576 Ga0501040_0122978 Ga0501040_0122978_1304_1780 153
979 3300049579 Ga0501043_0000085 Ga0501043_0000085_66148_66609 153
980 3300049579 Ga0501043_0021593 Ga0501043_0021593_1804_2280 153
981 3300049579 Ga0501043_1087680 Ga0501043_1087680_72_548 153
982 3300049580 Ga0501046_0000426 Ga0501046_0000426_13897_14358 153
983 3300049580 Ga0501046_0064242 Ga0501046_0064242_1098_1559 153
984 3300049580 Ga0501046_0284157 Ga0501046_0284157_75_551 153
985 3300049580 Ga0501046_0313454 Ga0501046_0313454_189_665 153
986 3300049581 Ga0501047_0000221 Ga0501047_0000221_54288_54749 153
987 3300049581 Ga0501047_0063342 Ga0501047_0063342_329_790 153
988 3300049581 Ga0501047_0067526 Ga0501047_0067526_2952_3428 153
989 3300049582 Ga0501048_0000621 Ga0501048_0000621_13116_13577 153
990 3300049583 Ga0501067_0000384 Ga0501067_0000384_22791_23252 153
991 3300049583 Ga0501067_0061848 Ga0501067_0061848_178_654 153
992 3300049584 Ga0501068_0001789 Ga0501068_0001789_6215_6676 153
993 3300049584 Ga0501068_0018947 Ga0501068_0018947_356_832 153
994 3300049584 Ga0501068_0664659 Ga0501068_0664659_178_654 153
995 3300049585 Ga0501069_0008876 Ga0501069_0008876_1775_2236 153
996 3300049586 Ga0501070_0001287 Ga0501070_0001287_10897_11358 153
997 3300049586 Ga0501070_0023486 Ga0501070_0023486_3657_4118 153
998 3300049586 Ga0501070_0212803 Ga0501070_0212803_663_1139 153
999 3300049586 Ga0501070_0631729 Ga0501070_0631729_301_777 153
1000 3300049586 Ga0501070_1346433 Ga0501070_1346433_27_506 153
1001 3300049587 Ga0501071_0028472 Ga0501071_0028472_1552_2013 153
1002 3300049587 Ga0501071_0318381 Ga0501071_0318381_629_1105 153
1003 3300049588 Ga0501072_0001233 Ga0501072_0001233_16359_16820 153
1004 3300049588 Ga0501072_0554217 Ga0501072_0554217_93_569 153
1005 3300049589 Ga0501073_0000290 Ga0501073_0000290_2869_3330 153
1006 3300049589 Ga0501073_0052946 Ga0501073_0052946_218_679 153
1007 3300049589 Ga0501073_0075738 Ga0501073_0075738_1337_1813 153
1008 3300049589 Ga0501073_0171646 Ga0501073_0171646_420_896 153
1009 3300049590 Ga0501074_0000094 Ga0501074_0000094_16514_16975 153
1010 3300049590 Ga0501074_0078833 Ga0501074_0078833_292_768 153
1011 3300049590 Ga0501074_0141012 Ga0501074_0141012_45_506 153
1012 3300049591 Ga0501075_0573540 Ga0501075_0573540_352_828 153
1013 3300049592 Ga0501076_0230810 Ga0501076_0230810_541_1017 153
1014 3300049593 Ga0501077_0138071 Ga0501077_0138071_635_1111 153
1015 3300049741 Ga0501079_0023481 Ga0501079_0023481_487_948 153
1016 3300049741 Ga0501079_0175485 Ga0501079_0175485_465_941 153
1017 3300049742 Ga0501080_0007102 Ga0501080_0007102_8499_8960 153
1018 3300049742 Ga0501080_0076776 Ga0501080_0076776_1733_2209 153
1019 3300049742 Ga0501080_0145672 Ga0501080_0145672_93_569 153
1020 3300049744 Ga0501083_0000087 Ga0501083_0000087_59529_59990 153
1021 3300049744 Ga0501083_0235054 Ga0501083_0235054_660_1136 153
1022 3300049822 Ga0501035_0000223 Ga0501035_0000223_60078_60539 153
1023 3300049822 Ga0501035_0029751 Ga0501035_0029751_3119_3598 153
1024 3300049822 Ga0501035_0057029 Ga0501035_0057029_1874_2350 153
1025 3300049822 Ga0501035_0099964 Ga0501035_0099964_2049_2525 153
1026 3300049823 Ga0501044_0000970 Ga0501044_0000970_15356_15817 153
1027 3300049823 Ga0501044_0009122 Ga0501044_0009122_6117_6593 153
1028 3300049823 Ga0501044_0036772 Ga0501044_0036772_1281_1742 153
1029 3300049823 Ga0501044_0069089 Ga0501044_0069089_2155_2637 153
1030 3300049823 Ga0501044_0159139 Ga0501044_0159139_336_812 153
1031 3300049824 Ga0501045_0023775 Ga0501045_0023775_3522_3998 153
1032 3300050489 nmdc:mga03683_239499_c1 nmdc:mga03683_239499_c1_169_630 153
1033 3300050489 nmdc:mga03683_52613_c1 nmdc:mga03683_52613_c1_381_857 153
1034 3300050490 nmdc:mga03n38_3407_c1 nmdc:mga03n38_3407_c1_3965_4441 153
1035 3300050491 nmdc:mga00v17_260626_c1 nmdc:mga00v17_260626_c1_40_501 153
1036 3300050493 nmdc:mga0k408_179756_c1 nmdc:mga0k408_179756_c1_724_1185 153
1037 3300050493 nmdc:mga0k408_42604_c1 nmdc:mga0k408_42604_c1_102_578 153
1038 3300050494 nmdc:mga06z11_118077_c1 nmdc:mga06z11_118077_c1_531_1007 153
1039 3300050494 nmdc:mga06z11_276764_c1 nmdc:mga06z11_276764_c1_101_562 153
1040 3300050495 nmdc:mga04h51_87348_c1 nmdc:mga04h51_87348_c1_93_554 153
1041 3300050496 nmdc:mga07m45_108884_c1 nmdc:mga07m45_108884_c1_1042_1503 153
1042 3300050496 nmdc:mga07m45_20250_c1 nmdc:mga07m45_20250_c1_13_489 153
1043 3300050511 nmdc:mga08y16_1698314_c1 nmdc:mga08y16_1698314_c1_94_570 153
1044 3300050511 nmdc:mga08y16_721017_c1 nmdc:mga08y16_721017_c1_29_490 153
1045 3300050512 nmdc:mga0n895_10165_c1 nmdc:mga0n895_10165_c1_7106_7567 153
1046 3300050513 nmdc:mga0rr50_856087_c1 nmdc:mga0rr50_856087_c1_87_548 153
1047 3300050514 nmdc:mga08x19_26638_c2 nmdc:mga08x19_26638_c2_111_572 153
1048 3300053077 Ga0495601_0046570 Ga0495601_0046570_2249_2710 153
1049 3300053077 Ga0495601_0338930 Ga0495601_0338930_69_530 153
1050 3300053077 Ga0495601_0532884 Ga0495601_0532884_139_600 153
1051 3300053078 Ga0495612_0169193 Ga0495612_0169193_195_656 153
1052 3300053080 Ga0500635_0001711 Ga0500635_0001711_2466_2927 153
1053 3300053083 Ga0495655_0051821 Ga0495655_0051821_154_645 153
1054 3300053084 Ga0495595_0089522 Ga0495595_0089522_451_912 153
1055 3300053085 Ga0495619_0020769 Ga0495619_0020769_1478_1939 153
1056 3300053085 Ga0495619_0129018 Ga0495619_0129018_1209_1670 153
1057 3300053085 Ga0495619_0186346 Ga0495619_0186346_945_1406 153
1058 3300053085 Ga0495619_0622733 Ga0495619_0622733_49_510 153
1059 3300053102 Ga0500554_106627 Ga0500554_106627_155_616 153
1060 3300053104 Ga0500556_0062377 Ga0500556_0062377_317_820 153
1061 3300053104 Ga0500556_0380198 Ga0500556_0380198_40_516 153
1062 3300053108 Ga0500562_056287 Ga0500562_056287_102_563 153
1063 3300053111 Ga0500572_000537 Ga0500572_000537_3611_4117 153
1064 3300053119 Ga0500595_005319 Ga0500595_005319_353_829 153
1065 3300053119 Ga0500595_005513 Ga0500595_005513_4010_4513 153
1066 3300053119 Ga0500595_007491 Ga0500595_007491_2728_3204 153
1067 3300053119 Ga0500595_012739 Ga0500595_012739_2029_2490 153
1068 3300053119 Ga0500595_023493 Ga0500595_023493_800_1276 153
1069 3300053122 Ga0500608_141344 Ga0500608_141344_370_876 153
1070 3300053130 Ga0500642_0263239 Ga0500642_0263239_64_525 153
1071 3300053133 Ga0500655_046839 Ga0500655_046839_15_476 153
1072 3300053134 Ga0500658_0027899 Ga0500658_0027899_292_753 153
1073 3300053136 Ga0500559_0000143 Ga0500559_0000143_10522_11028 153
1074 3300053139 Ga0500568_0013681 Ga0500568_0013681_2860_3363 153
1075 3300053139 Ga0500568_0020236 Ga0500568_0020236_1579_2055 153
1076 3300053146 Ga0500588_0037631 Ga0500588_0037631_584_1060 153
1077 3300053148 Ga0500590_076753 Ga0500590_076753_550_1011 153
1078 3300053150 Ga0500603_000415 Ga0500603_000415_7941_8402 153
1079 3300053150 Ga0500603_024182 Ga0500603_024182_689_1150 153
1080 3300053150 Ga0500603_210452 Ga0500603_210452_112_573 153
1081 3300053153 Ga0500616_0260636 Ga0500616_0260636_112_615 153
1082 3300053155 Ga0500620_137656 Ga0500620_137656_174_650 153
1083 3300053177 Ga0500636_0063096 Ga0500636_0063096_31_492 153
1084 3300053177 Ga0500636_0082467 Ga0500636_0082467_272_733 153
1085 3300053178 Ga0500637_0333145 Ga0500637_0333145_295_756 153
1086 3300053725 Ga0500576_047455 Ga0500576_047455_482_988 153
1087 3300053730 Ga0500645_039828 Ga0500645_039828_73_534 153
1088 3300053735 Ga0500596_003194 Ga0500596_003194_208_714 153
1089 3300053737 Ga0500601_008773 Ga0500601_008773_216_677 153
1090 3300054114 Ga0501084_0008032 Ga0501084_0008032_7741_8202 153
1091 3300060353 Ga0501082_0000452 Ga0501082_0000452_35310_35771 153
1092 3300060353 Ga0501082_0510663 Ga0501082_0510663_330_806 153
1093 3300061719 Ga0466962_0325437 Ga0466962_0325437_86_547 153
1094 3300061734 Ga0530510_0787506 Ga0530510_0787506_74_550 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

56

113

0.98

PF12802

MarR_2

MarR family

54

113

0.98

PF13463

HTH_27

Winged helix DNA-binding domain

57

122

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.957 36 86
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9545 40 95
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9482 36 96
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.942 40 96
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9351 36 86
ID Description Score Start End Superfamily
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9545 40 95 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9511 36 97 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9482 36 96 1.10.10.10
1s3jB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9474 33 96 1.10.10.10
af_A0A368UHH6_2_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9467 43 77 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3D4NER3-F1-model_v4 MarR family transcriptional regulator 0.9792 9 140 GO:0003677
GO:0003700
AF-A0A4R3Y2Y2-F1-model_v4 DNA-binding MarR family transcriptional regulator 0.969 9 136 GO:0003677
GO:0003700
AF-A0A7X7XU90-F1-model_v4 MarR family transcriptional regulator 0.9663 5 142 GO:0003677
GO:0003700
AF-A0A166D5M6-F1-model_v4 Transcriptional regulator HosA 0.9643 9 145 GO:0003677
GO:0003700
AF-A0A2S4M9V9-F1-model_v4 MarR family transcriptional regulator 0.964 5 147 GO:0003700
GO:0006950

Feature Viewer

pLDDT pTM Quality
91.44 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map