F489841

General Info

Members Datasets Scaffolds Average Seq Length
1089 361 2178 160

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10054086|Ga0111539_100540863
Length 185
Sequence LTLEAGNRIEPDRPERRDTTEGAAMQIEMSIKGLMVDPLTNSPIVILRDKDGQRVLPIWVGIFEANAIAQQIENVSPPRPMTHDLLRNVIHDLKASVQKIVVCDLQDNTFYALIYLSLASGTVAIDARPSDAIALALRTRAPIFVEDTVIEHAKPVEFSSENGDAERLQKWLESLDPDDLGKYKM

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
223 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
224 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
225 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
226 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
227 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
228 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
229 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
230 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
231 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
232 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
235 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
236 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
237 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
238 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
239 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
240 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
256 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
322 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
323 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
326 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
331 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
332 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
335 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
336 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
345 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
351 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
352 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
353 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
354 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
359 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
360 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.87
Nodule 0
Rhizoplane 4.68
Rhizosphere 90.36
Stem 0
Stem Tuber 0
Unclassified 3.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10054086 3300009094 Bacteria 4777
2 JGI24751J29686_10105770 3300002459 Unclassified 588
3 JGI24751J29686_10109059 3300002459 Unclassified 579
4 Ga0058862_10055306 3300004803 Bacteria 1626
5 Ga0065704_10137553 3300005289 Bacteria 1544
6 Ga0065704_10156207 3300005289 Bacteria 1389
7 Ga0065712_10068096 3300005290 Bacteria 14862
8 Ga0065712_10122856 3300005290 Bacteria 1646
9 Ga0065715_10111325 3300005293 Bacteria 2577
10 Ga0065715_10260487 3300005293 Bacteria 1130
11 Ga0065715_10268881 3300005293 Bacteria 1115
12 Ga0065715_10355078 3300005293 Bacteria 944
13 Ga0065715_10390721 3300005293 Bacteria 894
14 Ga0065715_10410638 3300005293 Bacteria 870
15 Ga0065715_10412380 3300005293 Bacteria 868
16 Ga0065707_10000704 3300005295 Bacteria 18194
17 Ga0065707_10092637 3300005295 Bacteria 3741
18 Ga0065707_10164660 3300005295 Bacteria 1533
19 Ga0065707_10460696 3300005295 Bacteria 780
20 Ga0070676_10002234 3300005328 Bacteria 9880
21 Ga0070676_10105291 3300005328 Bacteria 1749
22 Ga0070683_100000316 3300005329 Bacteria 33329
23 Ga0070670_100229203 3300005331 Bacteria 1617
24 Ga0070670_100695913 3300005331 Bacteria 914
25 Ga0070670_100731908 3300005331 Bacteria 891
26 Ga0068869_100172768 3300005334 Bacteria 1689
27 Ga0068869_101108170 3300005334 Unclassified 693
28 Ga0070666_10190234 3300005335 Bacteria 1442
29 Ga0070666_10292184 3300005335 Bacteria 1160
30 Ga0070666_10361508 3300005335 Bacteria 1040
31 Ga0070666_10832163 3300005335 Bacteria 681
32 Ga0070680_100131933 3300005336 Bacteria 2091
33 Ga0070682_100125347 3300005337 Bacteria 1730
34 Ga0070682_100127679 3300005337 Bacteria 1717
35 Ga0070682_100386031 3300005337 Bacteria 1055
36 Ga0070682_100772959 3300005337 Bacteria 778
37 Ga0068868_100068610 3300005338 Bacteria 2824
38 Ga0068868_100143487 3300005338 Bacteria 1962
39 Ga0068868_100497701 3300005338 Bacteria 1067
40 Ga0068868_100532750 3300005338 Bacteria 1033
41 Ga0068868_100594236 3300005338 Bacteria 980
42 Ga0070660_100179128 3300005339 Bacteria 1715
43 Ga0070660_100367765 3300005339 Bacteria 1186
44 Ga0070689_100319887 3300005340 Bacteria 1295
45 Ga0070689_100699706 3300005340 Bacteria 885
46 Ga0070691_10014813 3300005341 Bacteria 3579
47 Ga0070687_100145475 3300005343 Bacteria 1385
48 Ga0070661_100017481 3300005344 Bacteria 5088
49 Ga0070661_100099602 3300005344 Bacteria 2160
50 Ga0070661_100114069 3300005344 Bacteria 2020
51 Ga0070668_100024110 3300005347 Bacteria 4607
52 Ga0070668_100278120 3300005347 Bacteria 1397
53 Ga0070668_100325193 3300005347 Bacteria 1295
54 Ga0070669_100000133 3300005353 Bacteria 67886
55 Ga0070669_100025652 3300005353 Bacteria 4234
56 Ga0070669_100041966 3300005353 Bacteria 3329
57 Ga0070669_100274596 3300005353 Bacteria 1349
58 Ga0070669_101298228 3300005353 Unclassified 630
59 Ga0070675_100077773 3300005354 Bacteria 2762
60 Ga0070675_100232478 3300005354 Bacteria 1609
61 Ga0070675_100262492 3300005354 Bacteria 1514
62 Ga0070675_100991976 3300005354 Bacteria 771
63 Ga0070675_101356185 3300005354 Bacteria 656
64 Ga0070671_100033323 3300005355 Bacteria 4258
65 Ga0070671_100189912 3300005355 Bacteria 1741
66 Ga0070674_100006139 3300005356 Bacteria 6986
67 Ga0070674_100058216 3300005356 Bacteria 2685
68 Ga0070674_100146193 3300005356 Bacteria 1780
69 Ga0070674_100176286 3300005356 Bacteria 1634
70 Ga0070674_100535205 3300005356 Bacteria 981
71 Ga0070674_101076625 3300005356 Bacteria 709
72 Ga0070673_100033313 3300005364 Bacteria 3889
73 Ga0070673_100190087 3300005364 Bacteria 1763
74 Ga0070673_100246724 3300005364 Bacteria 1555
75 Ga0070673_100333779 3300005364 Bacteria 1342
76 Ga0070688_100076892 3300005365 Bacteria 2149
77 Ga0070688_100117349 3300005365 Bacteria 1778
78 Ga0070688_100228311 3300005365 Bacteria 1316
79 Ga0070659_100046664 3300005366 Bacteria 3395
80 Ga0070659_100232923 3300005366 Bacteria 1522
81 Ga0070659_100320427 3300005366 Bacteria 1296
82 Ga0070667_100487674 3300005367 Bacteria 1129
83 Ga0070667_100526786 3300005367 Bacteria 1085
84 Ga0070667_100868677 3300005367 Bacteria 839
85 Ga0070703_10098194 3300005406 Bacteria 1028
86 Ga0070703_10124493 3300005406 Bacteria 939
87 Ga0070709_10122989 3300005434 Bacteria 1762
88 Ga0070709_10154351 3300005434 Bacteria 1590
89 Ga0070709_10374713 3300005434 Bacteria 1057
90 Ga0070713_100010368 3300005436 Bacteria 6733
91 Ga0070713_100534434 3300005436 Unclassified 1109
92 Ga0070701_10053475 3300005438 Bacteria 2102
93 Ga0070701_10058002 3300005438 Bacteria 2031
94 Ga0070701_10496222 3300005438 Bacteria 792
95 Ga0070711_100143030 3300005439 Bacteria 1795
96 Ga0070711_100479900 3300005439 Bacteria 1022
97 Ga0070705_100038011 3300005440 Bacteria 2720
98 Ga0070700_100012835 3300005441 Bacteria 4692
99 Ga0070700_100020307 3300005441 Bacteria 3845
100 Ga0070700_100047305 3300005441 Bacteria 2662
101 Ga0070700_100395373 3300005441 Bacteria 1038
102 Ga0070694_100004392 3300005444 Bacteria 8480
103 Ga0070694_100085919 3300005444 Bacteria 2198
104 Ga0070694_100154002 3300005444 Bacteria 1681
105 Ga0070694_100264915 3300005444 Bacteria 1305
106 Ga0070694_100327383 3300005444 Bacteria 1181
107 Ga0070708_100511561 3300005445 Bacteria 1133
108 Ga0070708_100936556 3300005445 Unclassified 813
109 Ga0070663_100358029 3300005455 Bacteria 1183
110 Ga0070678_100172518 3300005456 Bacteria 1763
111 Ga0070678_100214175 3300005456 Bacteria 1598
112 Ga0070678_100447391 3300005456 Bacteria 1131
113 Ga0070678_100552780 3300005456 Bacteria 1022
114 Ga0070662_100683829 3300005457 Bacteria 867
115 Ga0070662_100705775 3300005457 Bacteria 854
116 Ga0070681_10281170 3300005458 Bacteria 1575
117 Ga0068867_100031849 3300005459 Bacteria 3810
118 Ga0068867_100053521 3300005459 Bacteria 2981
119 Ga0068867_101024407 3300005459 Bacteria 750
120 Ga0070685_10481541 3300005466 Bacteria 875
121 Ga0070707_100140438 3300005468 Bacteria 2351
122 Ga0070707_100223211 3300005468 Bacteria 1835
123 Ga0070707_100452421 3300005468 Bacteria 1245
124 Ga0070698_100030790 3300005471 Bacteria 5564
125 Ga0070698_100290888 3300005471 Bacteria 1565
126 Ga0070699_100161689 3300005518 Bacteria 1982
127 Ga0070699_100347900 3300005518 Bacteria 1335
128 Ga0070699_101041002 3300005518 Bacteria 751
129 Ga0070679_100478231 3300005530 Bacteria 1190
130 Ga0070679_100555315 3300005530 Bacteria 1092
131 Ga0070684_100045298 3300005535 Bacteria 3809
132 Ga0070684_100084357 3300005535 Bacteria 2816
133 Ga0070684_100220815 3300005535 Bacteria 1729
134 Ga0070684_101979572 3300005535 Bacteria 550
135 Ga0070697_100029672 3300005536 Bacteria 4387
136 Ga0070697_100209629 3300005536 Bacteria 1659
137 Ga0070697_100514273 3300005536 Bacteria 1048
138 Ga0070697_100693000 3300005536 Bacteria 899
139 Ga0070697_100887999 3300005536 Bacteria 791
140 Ga0070697_101001758 3300005536 Bacteria 743
141 Ga0070697_101943506 3300005536 Bacteria 527
142 Ga0068853_100569551 3300005539 Bacteria 1074
143 Ga0070672_100464204 3300005543 Bacteria 1092
144 Ga0070672_100542629 3300005543 Bacteria 1009
145 Ga0070672_100997166 3300005543 Bacteria 742
146 Ga0070672_101255045 3300005543 Bacteria 661
147 Ga0070686_100045837 3300005544 Bacteria 2755
148 Ga0070686_100102806 3300005544 Bacteria 1933
149 Ga0070686_100358426 3300005544 Bacteria 1098
150 Ga0070686_101255941 3300005544 Bacteria 617
151 Ga0070695_100029123 3300005545 Bacteria 3430
152 Ga0070695_100033497 3300005545 Bacteria 3214
153 Ga0070695_100745161 3300005545 Bacteria 781
154 Ga0070695_100760065 3300005545 Bacteria 774
155 Ga0070696_100002672 3300005546 Bacteria 11810
156 Ga0070696_100194319 3300005546 Bacteria 1512
157 Ga0070696_101070457 3300005546 Bacteria 677
158 Ga0070696_101464853 3300005546 Bacteria 584
159 Ga0070693_100117698 3300005547 Bacteria 1644
160 Ga0070693_101017313 3300005547 Bacteria 628
161 Ga0070665_100009032 3300005548 Bacteria 10099
162 Ga0070665_100062203 3300005548 Bacteria 3743
163 Ga0070665_100143748 3300005548 Bacteria 2389
164 Ga0070665_100406375 3300005548 Bacteria 1370
165 Ga0070704_100021379 3300005549 Bacteria 4193
166 Ga0070704_100026757 3300005549 Bacteria 3817
167 Ga0070704_100102737 3300005549 Bacteria 2158
168 Ga0070704_100146302 3300005549 Bacteria 1852
169 Ga0070704_100919817 3300005549 Bacteria 788
170 Ga0070664_100000055 3300005564 Bacteria 69107
171 Ga0070664_100096246 3300005564 Bacteria 2569
172 Ga0070664_100206138 3300005564 Bacteria 1756
173 Ga0070664_100655853 3300005564 Bacteria 975
174 Ga0070664_101338340 3300005564 Bacteria 677
175 Ga0068857_100075268 3300005577 Bacteria 3010
176 Ga0068857_100909937 3300005577 Bacteria 844
177 Ga0068857_101281801 3300005577 Bacteria 711
178 Ga0068854_100525800 3300005578 Bacteria 1000
179 Ga0068854_100925327 3300005578 Bacteria 768
180 Ga0070702_100002187 3300005615 Bacteria 8335
181 Ga0070702_100618287 3300005615 Bacteria 815
182 Ga0068852_100285713 3300005616 Bacteria 1592
183 Ga0068859_100170253 3300005617 Bacteria 2259
184 Ga0068859_100472135 3300005617 Bacteria 1350
185 Ga0068859_100493515 3300005617 Bacteria 1320
186 Ga0068859_101051191 3300005617 Bacteria 895
187 Ga0068859_101623857 3300005617 Bacteria 714
188 Ga0068864_100054826 3300005618 Bacteria 3441
189 Ga0068864_100085988 3300005618 Bacteria 2766
190 Ga0068864_100271643 3300005618 Bacteria 1580
191 Ga0068864_100280627 3300005618 Bacteria 1555
192 Ga0068864_100317274 3300005618 Bacteria 1463
193 Ga0068864_101281528 3300005618 Bacteria 733
194 Ga0068866_10506382 3300005718 Bacteria 800
195 Ga0068861_100026960 3300005719 Bacteria 4181
196 Ga0068861_100164384 3300005719 Bacteria 1834
197 Ga0068861_100305186 3300005719 Bacteria 1380
198 Ga0068861_100468020 3300005719 Bacteria 1133
199 Ga0068851_10115530 3300005834 Bacteria 1437
200 Ga0068863_100656082 3300005841 Bacteria 1041
201 Ga0068858_100001318 3300005842 Bacteria 25636
202 Ga0068858_100002817 3300005842 Bacteria 17483
203 Ga0068858_100524504 3300005842 Bacteria 1146
204 Ga0068858_100830547 3300005842 Bacteria 902
205 Ga0068860_100191071 3300005843 Bacteria 1982
206 Ga0068860_100279950 3300005843 Bacteria 1630
207 Ga0068860_100345293 3300005843 Bacteria 1464
208 Ga0068860_100904883 3300005843 Bacteria 898
209 Ga0068860_101350730 3300005843 Bacteria 734
210 Ga0068860_101380779 3300005843 Bacteria 726
211 Ga0068862_100022231 3300005844 Bacteria 5304
212 Ga0068862_100109422 3300005844 Bacteria 2424
213 Ga0068862_100111174 3300005844 Bacteria 2405
214 Ga0068862_100117090 3300005844 Bacteria 2345
215 Ga0068862_100218909 3300005844 Bacteria 1723
216 Ga0068862_100269481 3300005844 Bacteria 1557
217 Ga0068862_100269597 3300005844 Bacteria 1556
218 Ga0068862_100423609 3300005844 Bacteria 1250
219 Ga0081455_10052838 3300005937 Bacteria 3475
220 Ga0081455_10268309 3300005937 Bacteria 1239
221 Ga0081455_10572765 3300005937 Bacteria 742
222 Ga0081538_10100327 3300005981 Bacteria 1460
223 Ga0070717_10053615 3300006028 Bacteria 3325
224 Ga0070717_10247786 3300006028 Bacteria 1573
225 Ga0075365_10003114 3300006038 Bacteria 8438
226 Ga0075365_10720247 3300006038 Bacteria 705
227 Ga0075368_10025212 3300006042 Bacteria 2282
228 Ga0075368_10121306 3300006042 Unclassified 1083
229 Ga0075363_100090483 3300006048 Bacteria 1683
230 Ga0075364_10011236 3300006051 Bacteria 5435
231 Ga0075364_10090972 3300006051 Bacteria 2024
232 Ga0075364_10209467 3300006051 Bacteria 1322
233 Ga0075367_10014997 3300006178 Bacteria 4200
234 Ga0075367_10053561 3300006178 Bacteria 2391
235 Ga0075367_10193025 3300006178 Bacteria 1271
236 Ga0075367_10193913 3300006178 Bacteria 1268
237 Ga0075367_10311458 3300006178 Unclassified 991
238 Ga0075367_10319460 3300006178 Bacteria 978
239 Ga0075369_10098405 3300006186 Bacteria 1311
240 Ga0075366_10027003 3300006195 Bacteria 3366
241 Ga0075366_10156948 3300006195 Bacteria 1378
242 Ga0075366_10300748 3300006195 Bacteria 981
243 Ga0075366_10335639 3300006195 Unclassified 927
244 Ga0075366_10533685 3300006195 Bacteria 726
245 Ga0097621_100004675 3300006237 Bacteria 9565
246 Ga0097621_100027834 3300006237 Bacteria 4450
247 Ga0097621_100075701 3300006237 Bacteria 2790
248 Ga0097621_100268087 3300006237 Bacteria 1500
249 Ga0097621_100268481 3300006237 Bacteria 1499
250 Ga0097621_100663651 3300006237 Bacteria 958
251 Ga0097621_101244382 3300006237 Bacteria 702
252 Ga0075370_10002052 3300006353 Bacteria 9154
253 Ga0075370_10258887 3300006353 Bacteria 1032
254 Ga0068871_100001757 3300006358 Bacteria 14602
255 Ga0068871_100002033 3300006358 Bacteria 13708
256 Ga0068871_100018724 3300006358 Bacteria 5272
257 Ga0068871_100091627 3300006358 Bacteria 2534
258 Ga0068871_100179269 3300006358 Bacteria 1820
259 Ga0068871_100190610 3300006358 Bacteria 1766
260 Ga0068871_100243021 3300006358 Bacteria 1566
261 Ga0075428_100022345 3300006844 Bacteria 7003
262 Ga0075428_100024361 3300006844 Bacteria 6697
263 Ga0075428_100035046 3300006844 Bacteria 5533
264 Ga0075428_100091152 3300006844 Bacteria 3325
265 Ga0075428_100122444 3300006844 Bacteria 2831
266 Ga0075428_100373975 3300006844 Bacteria 1528
267 Ga0075430_100130145 3300006846 Bacteria 2098
268 Ga0075430_100313784 3300006846 Bacteria 1296
269 Ga0075430_101071484 3300006846 Bacteria 664
270 Ga0075431_100296774 3300006847 Bacteria 1633
271 Ga0075431_100461802 3300006847 Bacteria 1264
272 Ga0075431_100541634 3300006847 Bacteria 1152
273 Ga0075431_100840261 3300006847 Bacteria 890
274 Ga0075431_101364820 3300006847 Bacteria 669
275 Ga0075431_101456173 3300006847 Unclassified 644
276 Ga0075431_101929751 3300006847 Bacteria 546
277 Ga0075433_10034124 3300006852 Bacteria 4368
278 Ga0075433_10057182 3300006852 Bacteria 3409
279 Ga0075433_10145893 3300006852 Bacteria 2103
280 Ga0075433_10169666 3300006852 Bacteria 1942
281 Ga0075433_10202964 3300006852 Bacteria 1762
282 Ga0075433_10207028 3300006852 Bacteria 1744
283 Ga0075433_10247649 3300006852 Bacteria 1581
284 Ga0075434_100002150 3300006871 Bacteria 17166
285 Ga0075434_100036937 3300006871 Bacteria 4833
286 Ga0075434_100038045 3300006871 Bacteria 4765
287 Ga0075434_101088338 3300006871 Bacteria 813
288 Ga0075434_101633719 3300006871 Bacteria 653
289 Ga0075434_101840242 3300006871 Unclassified 612
290 Ga0075429_100342508 3300006880 Bacteria 1309
291 Ga0075429_100382866 3300006880 Bacteria 1232
292 Ga0068865_100007092 3300006881 Bacteria 6880
293 Ga0068865_100052021 3300006881 Bacteria 2837
294 Ga0068865_100070090 3300006881 Bacteria 2483
295 Ga0068865_101114628 3300006881 Bacteria 696
296 Ga0068865_101363704 3300006881 Bacteria 632
297 Ga0075436_100004845 3300006914 Bacteria 9248
298 Ga0075436_100008238 3300006914 Bacteria 7131
299 Ga0075436_100036109 3300006914 Bacteria 3410
300 Ga0097620_100170263 3300006931 Bacteria 2259
301 Ga0097620_100472079 3300006931 Bacteria 1350
302 Ga0097620_100493506 3300006931 Bacteria 1320
303 Ga0097620_101051149 3300006931 Bacteria 895
304 Ga0097620_101623684 3300006931 Bacteria 714
305 Ga0075435_100001064 3300007076 Bacteria 17442
306 Ga0075435_100030003 3300007076 Bacteria 4272
307 Ga0075435_100041313 3300007076 Bacteria 3686
308 Ga0075435_100046251 3300007076 Bacteria 3490
309 Ga0075435_100365745 3300007076 Bacteria 1238
310 Ga0075435_101094015 3300007076 Unclassified 697
311 Ga0105251_10121170 3300009011 Bacteria 1188
312 Ga0105240_10337138 3300009093 Bacteria 1714
313 Ga0111539_10004497 3300009094 Bacteria 18235
314 Ga0111539_10006107 3300009094 Bacteria 15548
315 Ga0111539_10010393 3300009094 Bacteria 11717
316 Ga0111539_10013720 3300009094 Bacteria 10121
317 Ga0111539_10288141 3300009094 Bacteria 1911
318 Ga0111539_10319190 3300009094 Bacteria 1808
319 Ga0111539_10328268 3300009094 Bacteria 1781
320 Ga0111539_11291437 3300009094 Bacteria 847
321 Ga0105245_10028977 3300009098 Bacteria 4889
322 Ga0105245_10060598 3300009098 Bacteria 3408
323 Ga0105245_10409463 3300009098 Bacteria 1357
324 Ga0105245_10473776 3300009098 Bacteria 1264
325 Ga0105245_10941778 3300009098 Bacteria 906
326 Ga0105247_10013096 3300009101 Bacteria 4975
327 Ga0105247_10376448 3300009101 Bacteria 1005
328 Ga0114129_10009194 3300009147 Bacteria 14088
329 Ga0114129_10013715 3300009147 Bacteria 11549
330 Ga0114129_10018673 3300009147 Bacteria 9873
331 Ga0114129_10039945 3300009147 Bacteria 6618
332 Ga0114129_10094163 3300009147 Bacteria 4149
333 Ga0114129_10100613 3300009147 Bacteria 4000
334 Ga0114129_10159097 3300009147 Bacteria 3087
335 Ga0114129_10215567 3300009147 Bacteria 2592
336 Ga0114129_10215580 3300009147 Bacteria 2592
337 Ga0114129_10295672 3300009147 Bacteria 2160
338 Ga0114129_10356635 3300009147 Bacteria 1936
339 Ga0114129_10384041 3300009147 Bacteria 1854
340 Ga0114129_10418437 3300009147 Bacteria 1763
341 Ga0114129_10443504 3300009147 Bacteria 1704
342 Ga0114129_10705640 3300009147 Bacteria 1296
343 Ga0114129_11098511 3300009147 Bacteria 996
344 Ga0114129_11518689 3300009147 Bacteria 822
345 Ga0105243_10233717 3300009148 Bacteria 1632
346 Ga0105243_10593780 3300009148 Bacteria 1065
347 Ga0105243_11378586 3300009148 Bacteria 725
348 Ga0105243_12023840 3300009148 Bacteria 611
349 Ga0105241_10734943 3300009174 Bacteria 904
350 Ga0105242_10035637 3300009176 Bacteria 3990
351 Ga0105242_10039254 3300009176 Bacteria 3809
352 Ga0105242_10284395 3300009176 Bacteria 1503
353 Ga0105242_10313129 3300009176 Bacteria 1437
354 Ga0105242_10316939 3300009176 Bacteria 1429
355 Ga0105242_10629385 3300009176 Bacteria 1041
356 Ga0105242_11024882 3300009176 Bacteria 835
357 Ga0105242_12823408 3300009176 Bacteria 536
358 Ga0105248_10005649 3300009177 Bacteria 13739
359 Ga0105248_10027437 3300009177 Bacteria 6340
360 Ga0105248_10031990 3300009177 Bacteria 5878
361 Ga0105248_10035066 3300009177 Bacteria 5613
362 Ga0105248_10047290 3300009177 Bacteria 4825
363 Ga0105248_10066314 3300009177 Bacteria 4053
364 Ga0105248_10088347 3300009177 Bacteria 3489
365 Ga0105248_10090681 3300009177 Bacteria 3442
366 Ga0105248_10192095 3300009177 Bacteria 2301
367 Ga0105248_10304649 3300009177 Bacteria 1794
368 Ga0105248_10536228 3300009177 Bacteria 1320
369 Ga0105248_10652015 3300009177 Unclassified 1188
370 Ga0105248_11581474 3300009177 Bacteria 743
371 Ga0105237_10138674 3300009545 Bacteria 2427
372 Ga0105237_10339950 3300009545 Bacteria 1506
373 Ga0105237_10455949 3300009545 Bacteria 1284
374 Ga0105238_10832722 3300009551 Bacteria 939
375 Ga0105249_10009405 3300009553 Bacteria 8552
376 Ga0105249_10144338 3300009553 Bacteria 2285
377 Ga0105249_10240685 3300009553 Bacteria 1789
378 Ga0105249_10262544 3300009553 Bacteria 1717
379 Ga0105249_10310764 3300009553 Bacteria 1584
380 Ga0105249_10347465 3300009553 Bacteria 1502
381 Ga0105249_11361279 3300009553 Bacteria 782
382 Ga0105239_10832751 3300010375 Bacteria 1058
383 Ga0105239_12605735 3300010375 Bacteria 590
384 Ga0105246_10352035 3300011119 Bacteria 1207
385 Ga0105246_10802726 3300011119 Bacteria 835
386 Ga0157370_10235958 3300013104 Bacteria 1692
387 Ga0157369_10384148 3300013105 Bacteria 1457
388 Ga0157374_10016477 3300013296 Bacteria 6498
389 Ga0157374_10108548 3300013296 Bacteria 2667
390 Ga0157374_10142696 3300013296 Bacteria 2325
391 Ga0157374_12383080 3300013296 Unclassified 557
392 Ga0157378_10082039 3300013297 Bacteria 2915
393 Ga0157378_10276260 3300013297 Bacteria 1618
394 Ga0157378_10611300 3300013297 Bacteria 1102
395 Ga0157378_11175313 3300013297 Bacteria 806
396 Ga0157378_11279238 3300013297 Unclassified 774
397 Ga0157378_12645868 3300013297 Bacteria 554
398 Ga0163162_10077671 3300013306 Bacteria 3384
399 Ga0163162_10082821 3300013306 Bacteria 3281
400 Ga0163162_10127206 3300013306 Bacteria 2655
401 Ga0163162_10278132 3300013306 Bacteria 1806
402 Ga0163162_10306227 3300013306 Bacteria 1721
403 Ga0163162_11763414 3300013306 Bacteria 707
404 Ga0157372_10057524 3300013307 Bacteria 4347
405 Ga0157372_10655840 3300013307 Bacteria 1222
406 Ga0157372_11477298 3300013307 Bacteria 783
407 Ga0157375_10057357 3300013308 Bacteria 3849
408 Ga0157375_10228886 3300013308 Bacteria 2018
409 Ga0157375_10372135 3300013308 Bacteria 1595
410 Ga0157375_10402901 3300013308 Bacteria 1535
411 Ga0157375_10596500 3300013308 Bacteria 1264
412 Ga0157375_10933934 3300013308 Bacteria 1010
413 Ga0157375_11300658 3300013308 Bacteria 855
414 Ga0163163_10046782 3300014325 Bacteria 4250
415 Ga0163163_10098110 3300014325 Bacteria 2951
416 Ga0163163_10322950 3300014325 Bacteria 1597
417 Ga0163163_10425631 3300014325 Bacteria 1387
418 Ga0163163_10478355 3300014325 Bacteria 1306
419 Ga0157380_10023933 3300014326 Bacteria 4615
420 Ga0157380_10037360 3300014326 Bacteria 3763
421 Ga0157380_10351701 3300014326 Bacteria 1379
422 Ga0157380_10364455 3300014326 Bacteria 1357
423 Ga0157380_10497302 3300014326 Bacteria 1183
424 Ga0157380_10506528 3300014326 Bacteria 1174
425 Ga0157380_10651647 3300014326 Bacteria 1050
426 Ga0157377_10086550 3300014745 Bacteria 1842
427 Ga0157377_10261533 3300014745 Bacteria 1126
428 Ga0157377_10307150 3300014745 Bacteria 1049
429 Ga0157377_10336847 3300014745 Bacteria 1008
430 Ga0157379_10026918 3300014968 Bacteria 5119
431 Ga0157379_10217915 3300014968 Bacteria 1729
432 Ga0157379_10239562 3300014968 Bacteria 1645
433 Ga0157379_10621230 3300014968 Bacteria 1010
434 Ga0157379_11232209 3300014968 Bacteria 720
435 Ga0157376_10210022 3300014969 Bacteria 1797
436 Ga0157376_10274993 3300014969 Bacteria 1584
437 Ga0157376_10374463 3300014969 Bacteria 1370
438 Ga0157376_10623251 3300014969 Bacteria 1076
439 Ga0157376_11099579 3300014969 Bacteria 821
440 Ga0207697_10014929 3300025315 Bacteria 3215
441 Ga0207697_10143679 3300025315 Bacteria 1036
442 Ga0207697_10215663 3300025315 Bacteria 846
443 Ga0207697_10303770 3300025315 Unclassified 708
444 Ga0207653_10254370 3300025885 Bacteria 674
445 Ga0207682_10008148 3300025893 Bacteria 4155
446 Ga0207682_10176074 3300025893 Bacteria 975
447 Ga0207710_10015533 3300025900 Bacteria 3220
448 Ga0207710_10258905 3300025900 Bacteria 871
449 Ga0207688_10051819 3300025901 Bacteria 2299
450 Ga0207680_10015101 3300025903 Bacteria 4021
451 Ga0207680_10144814 3300025903 Unclassified 1578
452 Ga0207680_10166250 3300025903 Bacteria 1483
453 Ga0207699_10236948 3300025906 Bacteria 1252
454 Ga0207699_10263222 3300025906 Bacteria 1193
455 Ga0207645_10001664 3300025907 Bacteria 18110
456 Ga0207643_10423523 3300025908 Bacteria 844
457 Ga0207684_10696382 3300025910 Bacteria 864
458 Ga0207707_10260182 3300025912 Bacteria 1506
459 Ga0207693_10551293 3300025915 Bacteria 899
460 Ga0207663_10100928 3300025916 Bacteria 1938
461 Ga0207663_10119477 3300025916 Bacteria 1802
462 Ga0207662_10091715 3300025918 Bacteria 1870
463 Ga0207662_10310097 3300025918 Bacteria 1051
464 Ga0207657_10058308 3300025919 Bacteria 3323
465 Ga0207657_10250973 3300025919 Bacteria 1410
466 Ga0207657_10441830 3300025919 Bacteria 1021
467 Ga0207649_10033659 3300025920 Bacteria 3064
468 Ga0207649_10092377 3300025920 Bacteria 1984
469 Ga0207652_10452340 3300025921 Bacteria 1157
470 Ga0207646_10047330 3300025922 Bacteria 3857
471 Ga0207646_10058808 3300025922 Bacteria 3433
472 Ga0207646_10244196 3300025922 Bacteria 1622
473 Ga0207646_10531514 3300025922 Bacteria 1058
474 Ga0207646_10695299 3300025922 Bacteria 909
475 Ga0207681_10054932 3300025923 Bacteria 2710
476 Ga0207681_10056950 3300025923 Bacteria 2668
477 Ga0207681_10077951 3300025923 Bacteria 2331
478 Ga0207681_10146495 3300025923 Bacteria 1765
479 Ga0207681_10153293 3300025923 Bacteria 1729
480 Ga0207681_10222651 3300025923 Bacteria 1461
481 Ga0207681_10275100 3300025923 Bacteria 1323
482 Ga0207681_10832371 3300025923 Bacteria 772
483 Ga0207650_10054043 3300025925 Bacteria 2978
484 Ga0207650_10095144 3300025925 Bacteria 2283
485 Ga0207650_10243504 3300025925 Bacteria 1454
486 Ga0207650_10626571 3300025925 Bacteria 906
487 Ga0207659_10001050 3300025926 Bacteria 16372
488 Ga0207659_10104527 3300025926 Bacteria 2141
489 Ga0207659_10111426 3300025926 Bacteria 2081
490 Ga0207659_10341956 3300025926 Bacteria 1239
491 Ga0207659_10863678 3300025926 Bacteria 778
492 Ga0207687_10052143 3300025927 Bacteria 2854
493 Ga0207687_10243392 3300025927 Unclassified 1427
494 Ga0207687_10349997 3300025927 Bacteria 1203
495 Ga0207687_11170663 3300025927 Bacteria 661
496 Ga0207700_10056166 3300025928 Bacteria 2963
497 Ga0207700_11401292 3300025928 Bacteria 621
498 Ga0207644_10040224 3300025931 Bacteria 3304
499 Ga0207644_10420794 3300025931 Bacteria 1094
500 Ga0207644_10530488 3300025931 Bacteria 973
501 Ga0207644_10815300 3300025931 Bacteria 781
502 Ga0207644_10887666 3300025931 Bacteria 747
503 Ga0207690_10261499 3300025932 Bacteria 1341
504 Ga0207690_10393420 3300025932 Bacteria 1104
505 Ga0207690_10432782 3300025932 Bacteria 1054
506 Ga0207706_10166526 3300025933 Bacteria 1937
507 Ga0207706_10273052 3300025933 Bacteria 1475
508 Ga0207706_10568259 3300025933 Bacteria 975
509 Ga0207686_10008087 3300025934 Bacteria 5673
510 Ga0207686_10050782 3300025934 Bacteria 2580
511 Ga0207686_10594535 3300025934 Bacteria 870
512 Ga0207686_10733307 3300025934 Bacteria 788
513 Ga0207709_10215596 3300025935 Bacteria 1381
514 Ga0207709_10229920 3300025935 Bacteria 1343
515 Ga0207709_10395694 3300025935 Bacteria 1055
516 Ga0207669_10131519 3300025937 Bacteria 1720
517 Ga0207669_10242653 3300025937 Bacteria 1336
518 Ga0207669_10384200 3300025937 Unclassified 1095
519 Ga0207669_10788283 3300025937 Bacteria 787
520 Ga0207669_10995292 3300025937 Bacteria 704
521 Ga0207704_10007270 3300025938 Bacteria 5219
522 Ga0207704_10067921 3300025938 Bacteria 2245
523 Ga0207704_10138379 3300025938 Bacteria 1699
524 Ga0207704_10213604 3300025938 Bacteria 1422
525 Ga0207665_10142893 3300025939 Bacteria 1708
526 Ga0207665_10460159 3300025939 Bacteria 978
527 Ga0207691_10119960 3300025940 Bacteria 2332
528 Ga0207691_10128688 3300025940 Bacteria 2238
529 Ga0207691_10177894 3300025940 Bacteria 1860
530 Ga0207691_10328002 3300025940 Bacteria 1312
531 Ga0207691_10741311 3300025940 Bacteria 827
532 Ga0207691_10910440 3300025940 Bacteria 736
533 Ga0207711_10020250 3300025941 Bacteria 5543
534 Ga0207711_10060332 3300025941 Bacteria 3268
535 Ga0207711_10124605 3300025941 Bacteria 2303
536 Ga0207711_10154000 3300025941 Bacteria 2076
537 Ga0207711_10248308 3300025941 Bacteria 1633
538 Ga0207711_10477336 3300025941 Bacteria 1161
539 Ga0207711_10541770 3300025941 Bacteria 1085
540 Ga0207711_11067339 3300025941 Bacteria 748
541 Ga0207711_11078429 3300025941 Bacteria 744
542 Ga0207689_10444376 3300025942 Unclassified 1083
543 Ga0207689_10651248 3300025942 Bacteria 887
544 Ga0207661_10004092 3300025944 Bacteria 10190
545 Ga0207661_10483908 3300025944 Bacteria 1130
546 Ga0207679_10000699 3300025945 Bacteria 22433
547 Ga0207679_10247118 3300025945 Bacteria 1515
548 Ga0207679_10303332 3300025945 Bacteria 1377
549 Ga0207679_10448268 3300025945 Bacteria 1144
550 Ga0207679_10957605 3300025945 Bacteria 784
551 Ga0207679_11291054 3300025945 Bacteria 670
552 Ga0207651_10055148 3300025960 Bacteria 2728
553 Ga0207651_10186824 3300025960 Bacteria 1649
554 Ga0207651_10233422 3300025960 Bacteria 1495
555 Ga0207651_10253619 3300025960 Bacteria 1441
556 Ga0207651_10338539 3300025960 Bacteria 1263
557 Ga0207712_10003974 3300025961 Bacteria 9334
558 Ga0207712_10165757 3300025961 Bacteria 1722
559 Ga0207712_10347523 3300025961 Bacteria 1232
560 Ga0207668_10359135 3300025972 Bacteria 1220
561 Ga0207668_10646357 3300025972 Bacteria 925
562 Ga0207668_10894357 3300025972 Bacteria 790
563 Ga0207640_10314425 3300025981 Bacteria 1244
564 Ga0207640_10403502 3300025981 Bacteria 1114
565 Ga0207640_10480226 3300025981 Bacteria 1031
566 Ga0207658_10048974 3300025986 Bacteria 3102
567 Ga0207658_10168130 3300025986 Bacteria 1804
568 Ga0207658_10370553 3300025986 Bacteria 1252
569 Ga0207658_10701071 3300025986 Bacteria 915
570 Ga0207677_10100242 3300026023 Bacteria 2129
571 Ga0207677_10173772 3300026023 Bacteria 1688
572 Ga0207677_10436391 3300026023 Bacteria 1119
573 Ga0207677_10509791 3300026023 Unclassified 1042
574 Ga0207703_10003829 3300026035 Bacteria 12502
575 Ga0207703_10036680 3300026035 Bacteria 3903
576 Ga0207703_10115745 3300026035 Bacteria 2294
577 Ga0207703_10199813 3300026035 Bacteria 1776
578 Ga0207703_10463693 3300026035 Bacteria 1185
579 Ga0207678_10060013 3300026067 Bacteria 3272
580 Ga0207678_11118362 3300026067 Bacteria 697
581 Ga0207708_10002261 3300026075 Bacteria 14190
582 Ga0207708_10033072 3300026075 Bacteria 3928
583 Ga0207708_10112308 3300026075 Bacteria 2117
584 Ga0207708_10250087 3300026075 Bacteria 1428
585 Ga0207708_10419754 3300026075 Unclassified 1109
586 Ga0207708_10426608 3300026075 Bacteria 1100
587 Ga0207708_10724162 3300026075 Bacteria 852
588 Ga0207641_10003603 3300026088 Bacteria 13671
589 Ga0207648_10045431 3300026089 Bacteria 3852
590 Ga0207648_10109450 3300026089 Bacteria 2425
591 Ga0207648_10176612 3300026089 Bacteria 1889
592 Ga0207648_10301588 3300026089 Bacteria 1437
593 Ga0207648_10678756 3300026089 Bacteria 953
594 Ga0207648_10830275 3300026089 Bacteria 861
595 Ga0207648_10864561 3300026089 Unclassified 844
596 Ga0207648_11085095 3300026089 Bacteria 751
597 Ga0207676_10122619 3300026095 Bacteria 2195
598 Ga0207676_10259559 3300026095 Bacteria 1568
599 Ga0207676_10612675 3300026095 Bacteria 1047
600 Ga0207674_10097459 3300026116 Bacteria 2924
601 Ga0207674_10455994 3300026116 Bacteria 1236
602 Ga0207675_100002835 3300026118 Bacteria 17058
603 Ga0207675_100026965 3300026118 Bacteria 5348
604 Ga0207675_100094800 3300026118 Bacteria 2807
605 Ga0207675_100267255 3300026118 Bacteria 1659
606 Ga0207675_100548872 3300026118 Bacteria 1154
607 Ga0207675_100826872 3300026118 Bacteria 940
608 Ga0207675_101234306 3300026118 Bacteria 768
609 Ga0207683_10004066 3300026121 Bacteria 12643
610 Ga0207683_10081332 3300026121 Bacteria 2875
611 Ga0207683_10127933 3300026121 Bacteria 2284
612 Ga0207683_10158852 3300026121 Bacteria 2043
613 Ga0207683_10280619 3300026121 Bacteria 1522
614 Ga0207683_10465045 3300026121 Bacteria 1167
615 Ga0207683_10870207 3300026121 Bacteria 837
616 Ga0207698_10470062 3300026142 Bacteria 1218
617 Ga0207698_10470355 3300026142 Bacteria 1217
618 Ga0210000_1050162 3300027462 Unclassified 669
619 Ga0209983_1054870 3300027665 Bacteria 875
620 Ga0209971_1018609 3300027682 Bacteria 1649
621 Ga0209813_10026642 3300027866 Bacteria 1673
622 Ga0209813_10037734 3300027866 Bacteria 1457
623 Ga0209813_10229645 3300027866 Unclassified 698
624 Ga0209974_10014472 3300027876 Bacteria 2625
625 Ga0207428_10001107 3300027907 Bacteria 29337
626 Ga0207428_10032256 3300027907 Bacteria 4310
627 Ga0207428_10041948 3300027907 Bacteria 3703
628 Ga0207428_10044264 3300027907 Bacteria 3592
629 Ga0207428_10146247 3300027907 Bacteria 1801
630 Ga0268266_10038017 3300028379 Bacteria 4098
631 Ga0268266_10255871 3300028379 Bacteria 1621
632 Ga0268266_10310463 3300028379 Bacteria 1473
633 Ga0268266_10330830 3300028379 Bacteria 1428
634 Ga0268266_11792760 3300028379 Bacteria 588
635 Ga0268265_10130356 3300028380 Bacteria 2088
636 Ga0268265_10144291 3300028380 Bacteria 1997
637 Ga0268265_10195682 3300028380 Bacteria 1749
638 Ga0268265_10297509 3300028380 Bacteria 1451
639 Ga0268265_10456471 3300028380 Bacteria 1195
640 Ga0268265_11942590 3300028380 Bacteria 595
641 Ga0268264_10071756 3300028381 Bacteria 2935
642 Ga0268264_10247199 3300028381 Bacteria 1655
643 Ga0268264_10280572 3300028381 Bacteria 1560
644 Ga0268264_10516333 3300028381 Bacteria 1167
645 Ga0268264_12256558 3300028381 Bacteria 552
646 Ga0265318_10117137 3300028577 Bacteria 979
647 Ga0265330_10292156 3300031235 Bacteria 687
648 Ga0265316_10114812 3300031344 Bacteria 2036
649 Ga0307408_100080835 3300031548 Bacteria 2429
650 Ga0307408_100116125 3300031548 Bacteria 2065
651 Ga0307408_100281189 3300031548 Bacteria 1386
652 Ga0316576_10185835 3300031727 Bacteria 1567
653 Ga0307405_10074413 3300031731 Bacteria 2197
654 Ga0307405_10225863 3300031731 Bacteria 1377
655 Ga0307405_10304094 3300031731 Bacteria 1211
656 Ga0307413_10161840 3300031824 Bacteria 1573
657 Ga0307413_10234802 3300031824 Bacteria 1349
658 Ga0307413_10451635 3300031824 Unclassified 1020
659 Ga0307413_11094713 3300031824 Unclassified 688
660 Ga0307410_10009644 3300031852 Bacteria 5428
661 Ga0307410_10086786 3300031852 Bacteria 2211
662 Ga0307406_10171114 3300031901 Bacteria 1572
663 Ga0307407_10062482 3300031903 Bacteria 2181
664 Ga0307407_10074916 3300031903 Bacteria 2027
665 Ga0307407_10698621 3300031903 Bacteria 764
666 Ga0307412_10259831 3300031911 Bacteria 1353
667 Ga0307412_11493731 3300031911 Bacteria 614
668 Ga0307409_100093412 3300031995 Bacteria 2472
669 Ga0307409_100184011 3300031995 Bacteria 1852
670 Ga0307409_100504115 3300031995 Bacteria 1179
671 Ga0307409_101223977 3300031995 Bacteria 775
672 Ga0307409_101272199 3300031995 Bacteria 760
673 Ga0307409_101282641 3300031995 Bacteria 757
674 Ga0307416_100043076 3300032002 Bacteria 3531
675 Ga0307416_100586984 3300032002 Bacteria 1192
676 Ga0307416_100679338 3300032002 Bacteria 1117
677 Ga0307416_102175155 3300032002 Bacteria 656
678 Ga0307414_10749792 3300032004 Unclassified 887
679 Ga0307414_10900546 3300032004 Bacteria 811
680 Ga0307411_10748700 3300032005 Bacteria 856
681 Ga0307411_10768779 3300032005 Bacteria 845
682 Ga0307411_11279642 3300032005 Bacteria 667
683 Ga0307415_100044088 3300032126 Bacteria 2980
684 Ga0307415_100141712 3300032126 Bacteria 1837
685 Ga0307415_100903652 3300032126 Bacteria 814
686 Ga0373934_0034046 3300035086 Bacteria 2002
687 Ga0373944_0080816 3300035089 Bacteria 1073
688 Ga0373944_0100952 3300035089 Bacteria 975
689 Ga0373944_0206230 3300035089 Bacteria 713
690 Ga0373923_0142435 3300035111 Bacteria 1084
691 Ga0373939_0049142 3300035114 Bacteria 1303
692 Ga0373941_0157522 3300035115 Bacteria 837
693 Ga0373953_0208504 3300035117 Bacteria 846
694 Ga0373954_0054916 3300035118 Bacteria 1874
695 Ga0373954_0141087 3300035118 Bacteria 1175
696 Ga0373957_0501496 3300035120 Bacteria 528
697 Ga0373943_0022851 3300035170 Bacteria 2903
698 Ga0373943_0077652 3300035170 Bacteria 1696
699 Ga0373943_0078051 3300035170 Bacteria 1692
700 Ga0373943_0341605 3300035170 Bacteria 857
701 Ga0373943_0446542 3300035170 Unclassified 751
702 Ga0373943_0631688 3300035170 Bacteria 632
703 Ga0373946_0124444 3300035171 Bacteria 1180
704 Ga0373946_0317866 3300035171 Bacteria 773
705 Ga0373946_0401076 3300035171 Bacteria 692
706 Ga0373955_0004142 3300035172 Bacteria 6400
707 Ga0373955_0454017 3300035172 Bacteria 781
708 Ga0316574_0256844 3300035398 Bacteria 1116
709 Ga0373931_0730497 3300035691 Bacteria 656
710 Ga0373935_0043773 3300035692 Bacteria 2819
711 Ga0373935_0299742 3300035692 Bacteria 1136
712 Ga0373935_0462366 3300035692 Bacteria 918
713 Ga0373935_0649815 3300035692 Bacteria 774
714 Ga0373927_0496092 3300035695 Bacteria 807
715 Ga0373933_0004802 3300035724 Bacteria 7389
716 Ga0373947_0006602 3300035725 Bacteria 6733
717 Ga0373947_0025355 3300035725 Bacteria 3458
718 Ga0373947_0380852 3300035725 Bacteria 950
719 Ga0373947_0460480 3300035725 Bacteria 862
720 Ga0373937_0045151 3300036401 Bacteria 4025
721 Ga0373937_0092423 3300036401 Bacteria 2805
722 Ga0373937_0112131 3300036401 Bacteria 2537
723 Ga0373937_0400997 3300036401 Bacteria 1301
724 Ga0373937_0516237 3300036401 Bacteria 1135
725 Ga0373937_0973002 3300036401 Bacteria 797
726 Ga0373937_1395303 3300036401 Bacteria 648
727 Ga0316582_0948276 3300036647 Bacteria 588
728 Ga0373925_0097037 3300037068 Bacteria 2260
729 Ga0373925_0226962 3300037068 Bacteria 1492
730 Ga0373925_0240151 3300037068 Bacteria 1451
731 Ga0373925_0279110 3300037068 Bacteria 1345
732 Ga0373925_0290177 3300037068 Bacteria 1319
733 Ga0395900_0689273 3300037418 Bacteria 956
734 Ga0395901_1667019 3300038443 Bacteria 590
735 Ga0439439_0018851 3300041406 Bacteria 1708
736 Ga0439453_0011343 3300041408 Bacteria 1485
737 Ga0451807_0884807 3300041486 Bacteria 2656
738 Ga0451839_0837387 3300041496 Bacteria 642
739 Ga0439431_0037854 3300041997 Bacteria 1219
740 Ga0439433_0072203 3300041999 Bacteria 832
741 Ga0439441_059890 3300042001 Bacteria 800
742 Ga0439443_081925 3300042003 Bacteria 601
743 Ga0439443_086457 3300042003 Bacteria 588
744 Ga0439450_091487 3300042008 Bacteria 765
745 Ga0439456_051027 3300042013 Bacteria 904
746 Ga0439462_0017266 3300042015 Bacteria 1870
747 Ga0450890_017717 3300042127 Bacteria 949
748 Ga0439446_0036029 3300042156 Bacteria 1445
749 Ga0439446_0208726 3300042156 Bacteria 662
750 Ga0439434_0018211 3300042435 Bacteria 2101
751 Ga0439434_0033356 3300042435 Bacteria 1569
752 Ga0439435_0160584 3300042436 Bacteria 725
753 Ga0439435_0236672 3300042436 Bacteria 611
754 Ga0439464_0038668 3300042439 Bacteria 1355
755 Ga0439460_0039836 3300042461 Bacteria 1375
756 Ga0439460_0135947 3300042461 Bacteria 813
757 Ga0450916_027429 3300042530 Bacteria 814
758 Ga0439440_0060701 3300042993 Bacteria 965
759 Ga0453683_0847630 3300044673 Bacteria 603
760 Ga0451576_0314922 3300045051 Bacteria 1637
761 Ga0451576_0502249 3300045051 Bacteria 1274
762 Ga0451576_1315666 3300045051 Bacteria 753
763 Ga0466967_0706198 3300045976 Bacteria 999
764 Ga0495592_0014532 3300046454 Bacteria 5974
765 Ga0495603_0110596 3300046455 Bacteria 1603
766 Ga0495629_0639311 3300046459 Bacteria 710
767 Ga0495638_0051992 3300046460 Bacteria 2553
768 Ga0495638_0066115 3300046460 Bacteria 2223
769 Ga0495651_0442781 3300046462 Bacteria 841
770 Ga0495653_0360011 3300046463 Bacteria 934
771 Ga0495580_0040644 3300046472 Bacteria 3321
772 Ga0495580_0076071 3300046472 Bacteria 2342
773 Ga0495580_0429778 3300046472 Bacteria 888
774 Ga0495582_0040322 3300046473 Bacteria 2572
775 Ga0495582_0112911 3300046473 Bacteria 1527
776 Ga0495639_0250244 3300046475 Bacteria 876
777 Ga0495639_0329004 3300046475 Bacteria 765
778 Ga0495585_0368851 3300046492 Bacteria 695
779 Ga0495618_0322819 3300046514 Bacteria 956
780 Ga0495628_0010401 3300046516 Bacteria 7902
781 Ga0495628_0874067 3300046516 Bacteria 625
782 Ga0495644_0269937 3300046523 Bacteria 663
783 Ga0495666_0320591 3300046526 Bacteria 700
784 Ga0495652_0224318 3300046529 Bacteria 1410
785 Ga0495640_0229685 3300046533 Bacteria 1167
786 Ga0495586_0102140 3300046535 Bacteria 1592
787 Ga0495587_0019297 3300046536 Bacteria 4222
788 Ga0495621_0179476 3300046539 Bacteria 844
789 Ga0495621_0389586 3300046539 Bacteria 590
790 Ga0495645_0091509 3300046543 Bacteria 2172
791 Ga0495645_0638315 3300046543 Bacteria 652
792 Ga0495656_0453577 3300046615 Bacteria 676
793 Ga0495634_0664967 3300046642 Bacteria 601
794 Ga0495625_0710568 3300046660 Unclassified 593
795 Ga0495635_0080667 3300046663 Bacteria 2227
796 Ga0495635_0608350 3300046663 Bacteria 713
797 Ga0495635_1049835 3300046663 Bacteria 517
798 Ga0495657_0183238 3300046675 Bacteria 1284
799 Ga0495599_0142922 3300046678 Bacteria 1484
800 Ga0495599_0464821 3300046678 Bacteria 748
801 Ga0495646_0336941 3300046680 Bacteria 792
802 Ga0495647_0073646 3300046681 Bacteria 1372
803 Ga0495647_0441969 3300046681 Bacteria 601
804 Ga0495658_0109825 3300046683 Bacteria 1657
805 Ga0495658_0128940 3300046683 Bacteria 1538
806 Ga0495658_0145595 3300046683 Bacteria 1452
807 Ga0495658_0252814 3300046683 Bacteria 1109
808 Ga0495658_0469701 3300046683 Bacteria 804
809 Ga0495658_0979838 3300046683 Bacteria 540
810 Ga0495669_0002483 3300046684 Bacteria 7530
811 Ga0495669_0028140 3300046684 Bacteria 2460
812 Ga0495669_0194750 3300046684 Bacteria 968
813 Ga0495669_0204410 3300046684 Bacteria 945
814 Ga0495613_0000598 3300046689 Bacteria 29033
815 Ga0495670_0773327 3300046691 Bacteria 524
816 Ga0495600_0051841 3300046809 Bacteria 2679
817 Ga0495600_0530349 3300046809 Bacteria 721
818 Ga0495581_0138587 3300047315 Bacteria 1419
819 Ga0495604_0040740 3300047317 Bacteria 3645
820 Ga0495674_0038315 3300047319 Bacteria 4303
821 Ga0495674_0862038 3300047319 Bacteria 701
822 Ga0495676_0789225 3300047321 Bacteria 612
823 Ga0495675_0054096 3300047444 Bacteria 2548
824 Ga0495684_0002960 3300047471 Bacteria 13369
825 Ga0495684_0243638 3300047471 Bacteria 1310
826 Ga0495684_0368280 3300047471 Bacteria 1016
827 Ga0495684_0712353 3300047471 Bacteria 664
828 Ga0495593_0362180 3300047673 Bacteria 725
829 Ga0495614_0582076 3300048089 Unclassified 537
830 Ga0496101_0001418 3300048904 Bacteria 14342
831 Ga0496101_0468130 3300048904 Bacteria 995
832 Ga0496102_0106480 3300048905 Bacteria 2610
833 Ga0496102_0186648 3300048905 Bacteria 1954
834 Ga0496102_0318257 3300048905 Bacteria 1466
835 Ga0496102_0525388 3300048905 Bacteria 1106
836 Ga0496104_0270554 3300048907 Bacteria 1611
837 Ga0496104_0416459 3300048907 Bacteria 1256
838 Ga0496104_0426432 3300048907 Bacteria 1238
839 Ga0496104_1531859 3300048907 Bacteria 570
840 Ga0496105_0053985 3300048908 Bacteria 3319
841 Ga0496105_0332095 3300048908 Bacteria 1217
842 Ga0496105_0867313 3300048908 Bacteria 682
843 Ga0496105_1124837 3300048908 Bacteria 582
844 Ga0496106_0075948 3300048909 Bacteria 2575
845 Ga0496106_0483841 3300048909 Bacteria 994
846 Ga0496107_0067243 3300048910 Bacteria 2600
847 Ga0496107_0279926 3300048910 Bacteria 1242
848 Ga0496107_0937571 3300048910 Unclassified 630
849 Ga0496107_0999578 3300048910 Bacteria 607
850 Ga0496108_0003929 3300048911 Bacteria 11934
851 Ga0496108_0071531 3300048911 Bacteria 2927
852 Ga0496108_0093169 3300048911 Bacteria 2562
853 Ga0496108_0163800 3300048911 Bacteria 1923
854 Ga0496108_0269910 3300048911 Bacteria 1481
855 Ga0496108_0472727 3300048911 Bacteria 1095
856 Ga0496109_0001173 3300048912 Bacteria 21797
857 Ga0496109_0219064 3300048912 Bacteria 1790
858 Ga0496109_0358014 3300048912 Bacteria 1379
859 Ga0496109_0518321 3300048912 Bacteria 1125
860 Ga0496109_0830890 3300048912 Unclassified 862
861 Ga0496110_0001473 3300048913 Bacteria 17050
862 Ga0496110_0084917 3300048913 Bacteria 2826
863 Ga0496111_0008760 3300048914 Bacteria 6716
864 Ga0496111_0187839 3300048914 Bacteria 1536
865 Ga0496112_0000262 3300048915 Bacteria 33688
866 Ga0496112_0016713 3300048915 Bacteria 6879
867 Ga0496112_0040152 3300048915 Bacteria 4575
868 Ga0496112_0231752 3300048915 Bacteria 1801
869 Ga0496112_0366004 3300048915 Bacteria 1383
870 Ga0496112_1458525 3300048915 Bacteria 598
871 Ga0496113_0098492 3300048916 Bacteria 2263
872 Ga0496113_0268190 3300048916 Bacteria 1364
873 Ga0496113_1186740 3300048916 Bacteria 596
874 Ga0496114_0000128 3300048917 Bacteria 54547
875 Ga0496114_0236077 3300048917 Bacteria 1607
876 Ga0496114_0249490 3300048917 Bacteria 1562
877 Ga0496114_0443193 3300048917 Bacteria 1150
878 Ga0496114_0478319 3300048917 Bacteria 1102
879 Ga0496114_0529577 3300048917 Bacteria 1042
880 Ga0501291_072235 3300049514 Bacteria 671
881 Ga0501291_077649 3300049514 Bacteria 655
882 Ga0501031_0527611 3300049568 Bacteria 761
883 Ga0501033_0290038 3300049570 Bacteria 1154
884 Ga0501034_0058187 3300049571 Bacteria 3885
885 Ga0501034_0095146 3300049571 Bacteria 2975
886 Ga0501034_0157196 3300049571 Bacteria 2247
887 Ga0501036_0161693 3300049572 Bacteria 1888
888 Ga0501036_0296959 3300049572 Unclassified 1351
889 Ga0501038_0453867 3300049574 Bacteria 985
890 Ga0501039_0363514 3300049575 Bacteria 1137
891 Ga0501039_1210571 3300049575 Bacteria 584
892 Ga0501040_0420263 3300049576 Bacteria 961
893 Ga0501040_0552279 3300049576 Bacteria 831
894 Ga0501040_1040227 3300049576 Bacteria 594
895 Ga0501040_1291750 3300049576 Bacteria 529
896 Ga0501041_0270632 3300049577 Bacteria 1068
897 Ga0501041_0488977 3300049577 Bacteria 782
898 Ga0501041_0627088 3300049577 Bacteria 687
899 Ga0501042_0325692 3300049578 Bacteria 1110
900 Ga0501042_1087004 3300049578 Bacteria 583
901 Ga0501043_0163927 3300049579 Bacteria 1736
902 Ga0501043_0854295 3300049579 Bacteria 655
903 Ga0501046_0186088 3300049580 Bacteria 1551
904 Ga0501047_0102474 3300049581 Bacteria 2742
905 Ga0501048_0345568 3300049582 Bacteria 1061
906 Ga0501048_0825688 3300049582 Bacteria 666
907 Ga0501067_0672195 3300049583 Bacteria 582
908 Ga0501069_0356964 3300049585 Bacteria 862
909 Ga0501070_1138814 3300049586 Bacteria 601
910 Ga0501071_0054384 3300049587 Bacteria 2889
911 Ga0501071_0409533 3300049587 Bacteria 1036
912 Ga0501071_0492022 3300049587 Bacteria 940
913 Ga0501071_0575007 3300049587 Bacteria 866
914 Ga0501072_0310504 3300049588 Bacteria 1253
915 Ga0501072_0508914 3300049588 Bacteria 952
916 Ga0501073_0011820 3300049589 Bacteria 6372
917 Ga0501073_0552349 3300049589 Bacteria 796
918 Ga0501073_0572628 3300049589 Bacteria 780
919 Ga0501074_0452716 3300049590 Bacteria 910
920 Ga0501075_0079432 3300049591 Bacteria 2483
921 Ga0501075_0149183 3300049591 Bacteria 1782
922 Ga0501075_0210293 3300049591 Bacteria 1484
923 Ga0501075_0465827 3300049591 Bacteria 964
924 Ga0501076_0006351 3300049592 Bacteria 8571
925 Ga0501076_0006517 3300049592 Bacteria 8471
926 Ga0501076_0133426 3300049592 Bacteria 2015
927 Ga0501076_0470339 3300049592 Bacteria 1035
928 Ga0501076_0538096 3300049592 Bacteria 963
929 Ga0501076_0814677 3300049592 Bacteria 770
930 Ga0501077_0661591 3300049593 Unclassified 671
931 Ga0501233_261373 3300049668 Unclassified 523
932 Ga0501235_086669 3300049669 Bacteria 752
933 Ga0501225_0237910 3300049705 Bacteria 593
934 Ga0501079_0951573 3300049741 Bacteria 676
935 Ga0501079_1028685 3300049741 Bacteria 649
936 Ga0501080_0048031 3300049742 Bacteria 3974
937 Ga0501080_0170584 3300049742 Bacteria 2007
938 Ga0501080_0407957 3300049742 Bacteria 1222
939 Ga0501081_0028798 3300049743 Bacteria 3750
940 Ga0501081_0055439 3300049743 Bacteria 2739
941 Ga0501081_0186099 3300049743 Bacteria 1503
942 Ga0501081_0612857 3300049743 Unclassified 815
943 Ga0501035_0287614 3300049822 Bacteria 1388
944 Ga0501035_0411871 3300049822 Bacteria 1123
945 Ga0501035_0637311 3300049822 Bacteria 865
946 Ga0501035_0789474 3300049822 Bacteria 759
947 Ga0501044_0043849 3300049823 Bacteria 4645
948 Ga0501045_0031537 3300049824 Bacteria 3839
949 Ga0501045_0111334 3300049824 Bacteria 2030
950 Ga0501045_0422268 3300049824 Bacteria 992
951 Ga0501045_0427399 3300049824 Bacteria 985
952 Ga0501045_0476152 3300049824 Bacteria 928
953 Ga0501045_1036495 3300049824 Bacteria 601
954 nmdc:mga03n38_59967_c1 3300050490 Bacteria 1728
955 nmdc:mga00v17_131131_c1 3300050491 Bacteria 1602
956 nmdc:mga00v17_278740_c1 3300050491 Bacteria 1085
957 nmdc:mga00v17_485107_c1 3300050491 Bacteria 802
958 nmdc:mga00v17_59147_c1 3300050491 Bacteria 2350
959 nmdc:mga00v17_74639_c1 3300050491 Bacteria 2108
960 nmdc:mga0yw44_147990_c1 3300050492 Bacteria 1530
961 nmdc:mga0yw44_669034_c1 3300050492 Bacteria 705
962 nmdc:mga0k408_3112_c1 3300050493 Bacteria 8792
963 nmdc:mga0k408_383977_c1 3300050493 Bacteria 837
964 nmdc:mga0k408_423433_c1 3300050493 Bacteria 792
965 nmdc:mga0k408_819962_c1 3300050493 Bacteria 542
966 nmdc:mga06z11_131035_c1 3300050494 Bacteria 1408
967 nmdc:mga06z11_397486_c1 3300050494 Bacteria 829
968 nmdc:mga06z11_42528_c1 3300050494 Bacteria 2280
969 nmdc:mga06z11_46954_c1 3300050494 Bacteria 2191
970 nmdc:mga06z11_52379_c1 3300050494 Bacteria 2094
971 nmdc:mga06z11_78940_c1 3300050494 Bacteria 1761
972 nmdc:mga04h51_10455_c1 3300050495 Bacteria 2549
973 nmdc:mga04h51_33593_c1 3300050495 Bacteria 1634
974 nmdc:mga07m45_233238_c1 3300050496 Bacteria 1071
975 nmdc:mga07m45_238681_c1 3300050496 Bacteria 1058
976 nmdc:mga05p37_1108548_c1 3300050507 Bacteria 828
977 nmdc:mga05p37_11340_c1 3300050507 Bacteria 10602
978 nmdc:mga05p37_119358_c1 3300050507 Bacteria 3240
979 nmdc:mga05p37_185529_c1 3300050507 Bacteria 2529
980 nmdc:mga05p37_20722_c2 3300050507 Bacteria 1696
981 nmdc:mga05p37_208674_c1 3300050507 Bacteria 2362
982 nmdc:mga05p37_267613_c1 3300050507 Bacteria 2043
983 nmdc:mga05p37_276690_c1 3300050507 Bacteria 2004
984 nmdc:mga05p37_30370_c1 3300050507 Bacteria 6593
985 nmdc:mga05p37_374952_c1 3300050507 Bacteria 1669
986 nmdc:mga05p37_38798_c1 3300050507 Bacteria 5844
987 nmdc:mga05p37_406560_c1 3300050507 Bacteria 1588
988 nmdc:mga05p37_420499_c1 3300050507 Bacteria 1555
989 nmdc:mga05p37_63169_c1 3300050507 Bacteria 4557
990 nmdc:mga05p37_689708_c1 3300050507 Bacteria 1137
991 nmdc:mga05p37_711851_c1 3300050507 Bacteria 1113
992 nmdc:mga05p37_759480_c1 3300050507 Bacteria 1067
993 nmdc:mga05p37_969574_c1 3300050507 Bacteria 907
994 nmdc:mga09592_1132798_c1 3300050508 Bacteria 649
995 nmdc:mga09592_1252974_c1 3300050508 Bacteria 611
996 nmdc:mga09592_495600_c1 3300050508 Bacteria 1052
997 nmdc:mga09592_514132_c1 3300050508 Bacteria 1030
998 nmdc:mga09592_611013_c1 3300050508 Bacteria 933
999 nmdc:mga09592_69181_c1 3300050508 Bacteria 2994
1000 nmdc:mga06r32_11001_c1 3300050510 Bacteria 8145
1001 nmdc:mga06r32_1108201_c1 3300050510 Bacteria 740
1002 nmdc:mga06r32_1164728_c1 3300050510 Bacteria 718
1003 nmdc:mga06r32_1234294_c1 3300050510 Bacteria 693
1004 nmdc:mga06r32_173849_c1 3300050510 Bacteria 2138
1005 nmdc:mga06r32_374861_c1 3300050510 Bacteria 1406
1006 nmdc:mga06r32_680025_c1 3300050510 Bacteria 996
1007 nmdc:mga06r32_917597_c1 3300050510 Bacteria 832
1008 nmdc:mga08y16_111356_c1 3300050511 Bacteria 2850
1009 nmdc:mga08y16_1380_c1 3300050511 Bacteria 24268
1010 nmdc:mga08y16_175411_c1 3300050511 Bacteria 2226
1011 nmdc:mga08y16_21491_c1 3300050511 Bacteria 6815
1012 nmdc:mga08y16_2223_c1 3300050511 Bacteria 19880
1013 nmdc:mga08y16_281973_c1 3300050511 Bacteria 1714
1014 nmdc:mga08y16_294709_c1 3300050511 Bacteria 1672
1015 nmdc:mga08y16_488654_c1 3300050511 Bacteria 1252
1016 nmdc:mga08y16_618143_c1 3300050511 Bacteria 1091
1017 nmdc:mga08y16_66257_c1 3300050511 Bacteria 3769
1018 nmdc:mga08y16_94642_c1 3300050511 Bacteria 3112
1019 nmdc:mga0n895_1303969_c1 3300050512 Bacteria 697
1020 nmdc:mga0n895_139970_c1 3300050512 Bacteria 2448
1021 nmdc:mga0n895_1452277_c1 3300050512 Bacteria 653
1022 nmdc:mga0n895_1505249_c1 3300050512 Bacteria 639
1023 nmdc:mga0n895_1539639_c1 3300050512 Unclassified 630
1024 nmdc:mga0n895_242721_c1 3300050512 Bacteria 1828
1025 nmdc:mga0n895_282399_c1 3300050512 Bacteria 1683
1026 nmdc:mga0n895_650_c1 3300050512 Bacteria 24250
1027 nmdc:mga0n895_8344_c1 3300050512 Bacteria 8966
1028 nmdc:mga0rr50_105210_c1 3300050513 Bacteria 2225
1029 nmdc:mga0rr50_154101_c1 3300050513 Bacteria 1860
1030 nmdc:mga0rr50_1669874_c1 3300050513 Bacteria 537
1031 nmdc:mga0rr50_2152_c1 3300050513 Bacteria 11013
1032 nmdc:mga0rr50_33493_c1 3300050513 Bacteria 3671
1033 nmdc:mga0rr50_35162_c1 3300050513 Bacteria 3596
1034 nmdc:mga0rr50_448948_c1 3300050513 Bacteria 1093
1035 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
1036 nmdc:mga08x19_37375_c1 3300050514 Bacteria 3081
1037 nmdc:mga08x19_50255_c1 3300050514 Bacteria 2676
1038 nmdc:mga08x19_73021_c1 3300050514 Bacteria 2239
1039 nmdc:mga08x19_906_c1 3300050514 Bacteria 18743
1040 nmdc:mga0a205_103595_c1 3300050515 Bacteria 2744
1041 nmdc:mga0a205_246665_c1 3300050515 Bacteria 1666
1042 nmdc:mga0a205_362448_c1 3300050515 Bacteria 1316
1043 nmdc:mga0a205_377366_c1 3300050515 Bacteria 1283
1044 nmdc:mga0a205_407779_c1 3300050515 Bacteria 1222
1045 nmdc:mga0a205_641105_c1 3300050515 Bacteria 914
1046 nmdc:mga0a205_64616_c1 3300050515 Bacteria 3535
1047 nmdc:mga0a205_71942_c1 3300050515 Bacteria 3340
1048 nmdc:mga0a205_82782_c1 3300050515 Bacteria 3100
1049 nmdc:mga0sz30_185368_c1 3300050516 Bacteria 924
1050 Ga0495601_0010674 3300053077 Bacteria 5476
1051 Ga0495601_0016141 3300053077 Bacteria 4522
1052 Ga0495601_0036154 3300053077 Bacteria 3084
1053 Ga0495601_0039243 3300053077 Bacteria 2965
1054 Ga0495601_0711418 3300053077 Bacteria 640
1055 Ga0495612_0262480 3300053078 Bacteria 770
1056 Ga0495595_0062828 3300053084 Bacteria 1742
1057 Ga0495595_0074229 3300053084 Bacteria 1612
1058 Ga0495595_0127273 3300053084 Bacteria 1243
1059 Ga0495619_0005032 3300053085 Bacteria 8397
1060 Ga0495619_0341214 3300053085 Bacteria 1037
1061 Ga0495619_0345099 3300053085 Bacteria 1030
1062 Ga0495619_0375458 3300053085 Bacteria 983
1063 Ga0495619_0658799 3300053085 Bacteria 714
1064 Ga0500641_0000167 3300053096 Bacteria 24634
1065 Ga0500628_039766 3300053129 Bacteria 1068
1066 Ga0500588_0369163 3300053146 Bacteria 546
1067 Ga0500627_0189481 3300053158 Unclassified 924
1068 Ga0500611_113727 3300053727 Unclassified 714
1069 Ga0501084_0012619 3300054114 Bacteria 7000
1070 Ga0501084_0110371 3300054114 Bacteria 2311
1071 Ga0501084_0126589 3300054114 Bacteria 2150
1072 Ga0590071_000450 3300059421 Bacteria 11957
1073 Ga0590071_005409 3300059421 Bacteria 3069
1074 Ga0590071_031080 3300059421 Bacteria 1272
1075 Ga0590071_036002 3300059421 Bacteria 1186
1076 Ga0590071_079773 3300059421 Bacteria 813
1077 Ga0590074_000270 3300059423 Bacteria 7016
1078 Ga0590074_015566 3300059423 Bacteria 1292
1079 Ga0590074_064358 3300059423 Bacteria 685
1080 Ga0590075_016638 3300059424 Bacteria 1809
1081 Ga0590077_000042 3300059426 Bacteria 29090
1082 Ga0590077_000416 3300059426 Bacteria 11961
1083 Ga0501082_0300818 3300060353 Bacteria 1397
1084 Ga0501082_0584568 3300060353 Bacteria 977
1085 Ga0501082_0801249 3300060353 Bacteria 824
1086 Ga0501082_1439512 3300060353 Unclassified 602
1087 Ga0530510_0167291 3300061734 Bacteria 1628
1088 Ga0530510_0220469 3300061734 Bacteria 1410
1089 Ga0530510_0338701 3300061734 Bacteria 1129
1090 Ga0111539_10054086
1091 JGI24751J29686_10105770
1092 JGI24751J29686_10109059
1093 Ga0058862_10055306
1094 Ga0065704_10137553
1095 Ga0065704_10156207
1096 Ga0065712_10068096
1097 Ga0065712_10122856
1098 Ga0065715_10111325
1099 Ga0065715_10260487
1100 Ga0065715_10268881
1101 Ga0065715_10355078
1102 Ga0065715_10390721
1103 Ga0065715_10410638
1104 Ga0065715_10412380
1105 Ga0065707_10000704
1106 Ga0065707_10092637
1107 Ga0065707_10164660
1108 Ga0065707_10460696
1109 Ga0070676_10002234
1110 Ga0070676_10105291
1111 Ga0070683_100000316
1112 Ga0070670_100229203
1113 Ga0070670_100695913
1114 Ga0070670_100731908
1115 Ga0068869_100172768
1116 Ga0068869_101108170
1117 Ga0070666_10190234
1118 Ga0070666_10292184
1119 Ga0070666_10361508
1120 Ga0070666_10832163
1121 Ga0070680_100131933
1122 Ga0070682_100125347
1123 Ga0070682_100127679
1124 Ga0070682_100386031
1125 Ga0070682_100772959
1126 Ga0068868_100068610
1127 Ga0068868_100143487
1128 Ga0068868_100497701
1129 Ga0068868_100532750
1130 Ga0068868_100594236
1131 Ga0070660_100179128
1132 Ga0070660_100367765
1133 Ga0070689_100319887
1134 Ga0070689_100699706
1135 Ga0070691_10014813
1136 Ga0070687_100145475
1137 Ga0070661_100017481
1138 Ga0070661_100099602
1139 Ga0070661_100114069
1140 Ga0070668_100024110
1141 Ga0070668_100278120
1142 Ga0070668_100325193
1143 Ga0070669_100000133
1144 Ga0070669_100025652
1145 Ga0070669_100041966
1146 Ga0070669_100274596
1147 Ga0070669_101298228
1148 Ga0070675_100077773
1149 Ga0070675_100232478
1150 Ga0070675_100262492
1151 Ga0070675_100991976
1152 Ga0070675_101356185
1153 Ga0070671_100033323
1154 Ga0070671_100189912
1155 Ga0070674_100006139
1156 Ga0070674_100058216
1157 Ga0070674_100146193
1158 Ga0070674_100176286
1159 Ga0070674_100535205
1160 Ga0070674_101076625
1161 Ga0070673_100033313
1162 Ga0070673_100190087
1163 Ga0070673_100246724
1164 Ga0070673_100333779
1165 Ga0070688_100076892
1166 Ga0070688_100117349
1167 Ga0070688_100228311
1168 Ga0070659_100046664
1169 Ga0070659_100232923
1170 Ga0070659_100320427
1171 Ga0070667_100487674
1172 Ga0070667_100526786
1173 Ga0070667_100868677
1174 Ga0070703_10098194
1175 Ga0070703_10124493
1176 Ga0070709_10122989
1177 Ga0070709_10154351
1178 Ga0070709_10374713
1179 Ga0070713_100010368
1180 Ga0070713_100534434
1181 Ga0070701_10053475
1182 Ga0070701_10058002
1183 Ga0070701_10496222
1184 Ga0070711_100143030
1185 Ga0070711_100479900
1186 Ga0070705_100038011
1187 Ga0070700_100012835
1188 Ga0070700_100020307
1189 Ga0070700_100047305
1190 Ga0070700_100395373
1191 Ga0070694_100004392
1192 Ga0070694_100085919
1193 Ga0070694_100154002
1194 Ga0070694_100264915
1195 Ga0070694_100327383
1196 Ga0070708_100511561
1197 Ga0070708_100936556
1198 Ga0070663_100358029
1199 Ga0070678_100172518
1200 Ga0070678_100214175
1201 Ga0070678_100447391
1202 Ga0070678_100552780
1203 Ga0070662_100683829
1204 Ga0070662_100705775
1205 Ga0070681_10281170
1206 Ga0068867_100031849
1207 Ga0068867_100053521
1208 Ga0068867_101024407
1209 Ga0070685_10481541
1210 Ga0070707_100140438
1211 Ga0070707_100223211
1212 Ga0070707_100452421
1213 Ga0070698_100030790
1214 Ga0070698_100290888
1215 Ga0070699_100161689
1216 Ga0070699_100347900
1217 Ga0070699_101041002
1218 Ga0070679_100478231
1219 Ga0070679_100555315
1220 Ga0070684_100045298
1221 Ga0070684_100084357
1222 Ga0070684_100220815
1223 Ga0070684_101979572
1224 Ga0070697_100029672
1225 Ga0070697_100209629
1226 Ga0070697_100514273
1227 Ga0070697_100693000
1228 Ga0070697_100887999
1229 Ga0070697_101001758
1230 Ga0070697_101943506
1231 Ga0068853_100569551
1232 Ga0070672_100464204
1233 Ga0070672_100542629
1234 Ga0070672_100997166
1235 Ga0070672_101255045
1236 Ga0070686_100045837
1237 Ga0070686_100102806
1238 Ga0070686_100358426
1239 Ga0070686_101255941
1240 Ga0070695_100029123
1241 Ga0070695_100033497
1242 Ga0070695_100745161
1243 Ga0070695_100760065
1244 Ga0070696_100002672
1245 Ga0070696_100194319
1246 Ga0070696_101070457
1247 Ga0070696_101464853
1248 Ga0070693_100117698
1249 Ga0070693_101017313
1250 Ga0070665_100009032
1251 Ga0070665_100062203
1252 Ga0070665_100143748
1253 Ga0070665_100406375
1254 Ga0070704_100021379
1255 Ga0070704_100026757
1256 Ga0070704_100102737
1257 Ga0070704_100146302
1258 Ga0070704_100919817
1259 Ga0070664_100000055
1260 Ga0070664_100096246
1261 Ga0070664_100206138
1262 Ga0070664_100655853
1263 Ga0070664_101338340
1264 Ga0068857_100075268
1265 Ga0068857_100909937
1266 Ga0068857_101281801
1267 Ga0068854_100525800
1268 Ga0068854_100925327
1269 Ga0070702_100002187
1270 Ga0070702_100618287
1271 Ga0068852_100285713
1272 Ga0068859_100170253
1273 Ga0068859_100472135
1274 Ga0068859_100493515
1275 Ga0068859_101051191
1276 Ga0068859_101623857
1277 Ga0068864_100054826
1278 Ga0068864_100085988
1279 Ga0068864_100271643
1280 Ga0068864_100280627
1281 Ga0068864_100317274
1282 Ga0068864_101281528
1283 Ga0068866_10506382
1284 Ga0068861_100026960
1285 Ga0068861_100164384
1286 Ga0068861_100305186
1287 Ga0068861_100468020
1288 Ga0068851_10115530
1289 Ga0068863_100656082
1290 Ga0068858_100001318
1291 Ga0068858_100002817
1292 Ga0068858_100524504
1293 Ga0068858_100830547
1294 Ga0068860_100191071
1295 Ga0068860_100279950
1296 Ga0068860_100345293
1297 Ga0068860_100904883
1298 Ga0068860_101350730
1299 Ga0068860_101380779
1300 Ga0068862_100022231
1301 Ga0068862_100109422
1302 Ga0068862_100111174
1303 Ga0068862_100117090
1304 Ga0068862_100218909
1305 Ga0068862_100269481
1306 Ga0068862_100269597
1307 Ga0068862_100423609
1308 Ga0081455_10052838
1309 Ga0081455_10268309
1310 Ga0081455_10572765
1311 Ga0081538_10100327
1312 Ga0070717_10053615
1313 Ga0070717_10247786
1314 Ga0075365_10003114
1315 Ga0075365_10720247
1316 Ga0075368_10025212
1317 Ga0075368_10121306
1318 Ga0075363_100090483
1319 Ga0075364_10011236
1320 Ga0075364_10090972
1321 Ga0075364_10209467
1322 Ga0075367_10014997
1323 Ga0075367_10053561
1324 Ga0075367_10193025
1325 Ga0075367_10193913
1326 Ga0075367_10311458
1327 Ga0075367_10319460
1328 Ga0075369_10098405
1329 Ga0075366_10027003
1330 Ga0075366_10156948
1331 Ga0075366_10300748
1332 Ga0075366_10335639
1333 Ga0075366_10533685
1334 Ga0097621_100004675
1335 Ga0097621_100027834
1336 Ga0097621_100075701
1337 Ga0097621_100268087
1338 Ga0097621_100268481
1339 Ga0097621_100663651
1340 Ga0097621_101244382
1341 Ga0075370_10002052
1342 Ga0075370_10258887
1343 Ga0068871_100001757
1344 Ga0068871_100002033
1345 Ga0068871_100018724
1346 Ga0068871_100091627
1347 Ga0068871_100179269
1348 Ga0068871_100190610
1349 Ga0068871_100243021
1350 Ga0075428_100022345
1351 Ga0075428_100024361
1352 Ga0075428_100035046
1353 Ga0075428_100091152
1354 Ga0075428_100122444
1355 Ga0075428_100373975
1356 Ga0075430_100130145
1357 Ga0075430_100313784
1358 Ga0075430_101071484
1359 Ga0075431_100296774
1360 Ga0075431_100461802
1361 Ga0075431_100541634
1362 Ga0075431_100840261
1363 Ga0075431_101364820
1364 Ga0075431_101456173
1365 Ga0075431_101929751
1366 Ga0075433_10034124
1367 Ga0075433_10057182
1368 Ga0075433_10145893
1369 Ga0075433_10169666
1370 Ga0075433_10202964
1371 Ga0075433_10207028
1372 Ga0075433_10247649
1373 Ga0075434_100002150
1374 Ga0075434_100036937
1375 Ga0075434_100038045
1376 Ga0075434_101088338
1377 Ga0075434_101633719
1378 Ga0075434_101840242
1379 Ga0075429_100342508
1380 Ga0075429_100382866
1381 Ga0068865_100007092
1382 Ga0068865_100052021
1383 Ga0068865_100070090
1384 Ga0068865_101114628
1385 Ga0068865_101363704
1386 Ga0075436_100004845
1387 Ga0075436_100008238
1388 Ga0075436_100036109
1389 Ga0097620_100170263
1390 Ga0097620_100472079
1391 Ga0097620_100493506
1392 Ga0097620_101051149
1393 Ga0097620_101623684
1394 Ga0075435_100001064
1395 Ga0075435_100030003
1396 Ga0075435_100041313
1397 Ga0075435_100046251
1398 Ga0075435_100365745
1399 Ga0075435_101094015
1400 Ga0105251_10121170
1401 Ga0105240_10337138
1402 Ga0111539_10004497
1403 Ga0111539_10006107
1404 Ga0111539_10010393
1405 Ga0111539_10013720
1406 Ga0111539_10288141
1407 Ga0111539_10319190
1408 Ga0111539_10328268
1409 Ga0111539_11291437
1410 Ga0105245_10028977
1411 Ga0105245_10060598
1412 Ga0105245_10409463
1413 Ga0105245_10473776
1414 Ga0105245_10941778
1415 Ga0105247_10013096
1416 Ga0105247_10376448
1417 Ga0114129_10009194
1418 Ga0114129_10013715
1419 Ga0114129_10018673
1420 Ga0114129_10039945
1421 Ga0114129_10094163
1422 Ga0114129_10100613
1423 Ga0114129_10159097
1424 Ga0114129_10215567
1425 Ga0114129_10215580
1426 Ga0114129_10295672
1427 Ga0114129_10356635
1428 Ga0114129_10384041
1429 Ga0114129_10418437
1430 Ga0114129_10443504
1431 Ga0114129_10705640
1432 Ga0114129_11098511
1433 Ga0114129_11518689
1434 Ga0105243_10233717
1435 Ga0105243_10593780
1436 Ga0105243_11378586
1437 Ga0105243_12023840
1438 Ga0105241_10734943
1439 Ga0105242_10035637
1440 Ga0105242_10039254
1441 Ga0105242_10284395
1442 Ga0105242_10313129
1443 Ga0105242_10316939
1444 Ga0105242_10629385
1445 Ga0105242_11024882
1446 Ga0105242_12823408
1447 Ga0105248_10005649
1448 Ga0105248_10027437
1449 Ga0105248_10031990
1450 Ga0105248_10035066
1451 Ga0105248_10047290
1452 Ga0105248_10066314
1453 Ga0105248_10088347
1454 Ga0105248_10090681
1455 Ga0105248_10192095
1456 Ga0105248_10304649
1457 Ga0105248_10536228
1458 Ga0105248_10652015
1459 Ga0105248_11581474
1460 Ga0105237_10138674
1461 Ga0105237_10339950
1462 Ga0105237_10455949
1463 Ga0105238_10832722
1464 Ga0105249_10009405
1465 Ga0105249_10144338
1466 Ga0105249_10240685
1467 Ga0105249_10262544
1468 Ga0105249_10310764
1469 Ga0105249_10347465
1470 Ga0105249_11361279
1471 Ga0105239_10832751
1472 Ga0105239_12605735
1473 Ga0105246_10352035
1474 Ga0105246_10802726
1475 Ga0157370_10235958
1476 Ga0157369_10384148
1477 Ga0157374_10016477
1478 Ga0157374_10108548
1479 Ga0157374_10142696
1480 Ga0157374_12383080
1481 Ga0157378_10082039
1482 Ga0157378_10276260
1483 Ga0157378_10611300
1484 Ga0157378_11175313
1485 Ga0157378_11279238
1486 Ga0157378_12645868
1487 Ga0163162_10077671
1488 Ga0163162_10082821
1489 Ga0163162_10127206
1490 Ga0163162_10278132
1491 Ga0163162_10306227
1492 Ga0163162_11763414
1493 Ga0157372_10057524
1494 Ga0157372_10655840
1495 Ga0157372_11477298
1496 Ga0157375_10057357
1497 Ga0157375_10228886
1498 Ga0157375_10372135
1499 Ga0157375_10402901
1500 Ga0157375_10596500
1501 Ga0157375_10933934
1502 Ga0157375_11300658
1503 Ga0163163_10046782
1504 Ga0163163_10098110
1505 Ga0163163_10322950
1506 Ga0163163_10425631
1507 Ga0163163_10478355
1508 Ga0157380_10023933
1509 Ga0157380_10037360
1510 Ga0157380_10351701
1511 Ga0157380_10364455
1512 Ga0157380_10497302
1513 Ga0157380_10506528
1514 Ga0157380_10651647
1515 Ga0157377_10086550
1516 Ga0157377_10261533
1517 Ga0157377_10307150
1518 Ga0157377_10336847
1519 Ga0157379_10026918
1520 Ga0157379_10217915
1521 Ga0157379_10239562
1522 Ga0157379_10621230
1523 Ga0157379_11232209
1524 Ga0157376_10210022
1525 Ga0157376_10274993
1526 Ga0157376_10374463
1527 Ga0157376_10623251
1528 Ga0157376_11099579
1529 Ga0207697_10014929
1530 Ga0207697_10143679
1531 Ga0207697_10215663
1532 Ga0207697_10303770
1533 Ga0207653_10254370
1534 Ga0207682_10008148
1535 Ga0207682_10176074
1536 Ga0207710_10015533
1537 Ga0207710_10258905
1538 Ga0207688_10051819
1539 Ga0207680_10015101
1540 Ga0207680_10144814
1541 Ga0207680_10166250
1542 Ga0207699_10236948
1543 Ga0207699_10263222
1544 Ga0207645_10001664
1545 Ga0207643_10423523
1546 Ga0207684_10696382
1547 Ga0207707_10260182
1548 Ga0207693_10551293
1549 Ga0207663_10100928
1550 Ga0207663_10119477
1551 Ga0207662_10091715
1552 Ga0207662_10310097
1553 Ga0207657_10058308
1554 Ga0207657_10250973
1555 Ga0207657_10441830
1556 Ga0207649_10033659
1557 Ga0207649_10092377
1558 Ga0207652_10452340
1559 Ga0207646_10047330
1560 Ga0207646_10058808
1561 Ga0207646_10244196
1562 Ga0207646_10531514
1563 Ga0207646_10695299
1564 Ga0207681_10054932
1565 Ga0207681_10056950
1566 Ga0207681_10077951
1567 Ga0207681_10146495
1568 Ga0207681_10153293
1569 Ga0207681_10222651
1570 Ga0207681_10275100
1571 Ga0207681_10832371
1572 Ga0207650_10054043
1573 Ga0207650_10095144
1574 Ga0207650_10243504
1575 Ga0207650_10626571
1576 Ga0207659_10001050
1577 Ga0207659_10104527
1578 Ga0207659_10111426
1579 Ga0207659_10341956
1580 Ga0207659_10863678
1581 Ga0207687_10052143
1582 Ga0207687_10243392
1583 Ga0207687_10349997
1584 Ga0207687_11170663
1585 Ga0207700_10056166
1586 Ga0207700_11401292
1587 Ga0207644_10040224
1588 Ga0207644_10420794
1589 Ga0207644_10530488
1590 Ga0207644_10815300
1591 Ga0207644_10887666
1592 Ga0207690_10261499
1593 Ga0207690_10393420
1594 Ga0207690_10432782
1595 Ga0207706_10166526
1596 Ga0207706_10273052
1597 Ga0207706_10568259
1598 Ga0207686_10008087
1599 Ga0207686_10050782
1600 Ga0207686_10594535
1601 Ga0207686_10733307
1602 Ga0207709_10215596
1603 Ga0207709_10229920
1604 Ga0207709_10395694
1605 Ga0207669_10131519
1606 Ga0207669_10242653
1607 Ga0207669_10384200
1608 Ga0207669_10788283
1609 Ga0207669_10995292
1610 Ga0207704_10007270
1611 Ga0207704_10067921
1612 Ga0207704_10138379
1613 Ga0207704_10213604
1614 Ga0207665_10142893
1615 Ga0207665_10460159
1616 Ga0207691_10119960
1617 Ga0207691_10128688
1618 Ga0207691_10177894
1619 Ga0207691_10328002
1620 Ga0207691_10741311
1621 Ga0207691_10910440
1622 Ga0207711_10020250
1623 Ga0207711_10060332
1624 Ga0207711_10124605
1625 Ga0207711_10154000
1626 Ga0207711_10248308
1627 Ga0207711_10477336
1628 Ga0207711_10541770
1629 Ga0207711_11067339
1630 Ga0207711_11078429
1631 Ga0207689_10444376
1632 Ga0207689_10651248
1633 Ga0207661_10004092
1634 Ga0207661_10483908
1635 Ga0207679_10000699
1636 Ga0207679_10247118
1637 Ga0207679_10303332
1638 Ga0207679_10448268
1639 Ga0207679_10957605
1640 Ga0207679_11291054
1641 Ga0207651_10055148
1642 Ga0207651_10186824
1643 Ga0207651_10233422
1644 Ga0207651_10253619
1645 Ga0207651_10338539
1646 Ga0207712_10003974
1647 Ga0207712_10165757
1648 Ga0207712_10347523
1649 Ga0207668_10359135
1650 Ga0207668_10646357
1651 Ga0207668_10894357
1652 Ga0207640_10314425
1653 Ga0207640_10403502
1654 Ga0207640_10480226
1655 Ga0207658_10048974
1656 Ga0207658_10168130
1657 Ga0207658_10370553
1658 Ga0207658_10701071
1659 Ga0207677_10100242
1660 Ga0207677_10173772
1661 Ga0207677_10436391
1662 Ga0207677_10509791
1663 Ga0207703_10003829
1664 Ga0207703_10036680
1665 Ga0207703_10115745
1666 Ga0207703_10199813
1667 Ga0207703_10463693
1668 Ga0207678_10060013
1669 Ga0207678_11118362
1670 Ga0207708_10002261
1671 Ga0207708_10033072
1672 Ga0207708_10112308
1673 Ga0207708_10250087
1674 Ga0207708_10419754
1675 Ga0207708_10426608
1676 Ga0207708_10724162
1677 Ga0207641_10003603
1678 Ga0207648_10045431
1679 Ga0207648_10109450
1680 Ga0207648_10176612
1681 Ga0207648_10301588
1682 Ga0207648_10678756
1683 Ga0207648_10830275
1684 Ga0207648_10864561
1685 Ga0207648_11085095
1686 Ga0207676_10122619
1687 Ga0207676_10259559
1688 Ga0207676_10612675
1689 Ga0207674_10097459
1690 Ga0207674_10455994
1691 Ga0207675_100002835
1692 Ga0207675_100026965
1693 Ga0207675_100094800
1694 Ga0207675_100267255
1695 Ga0207675_100548872
1696 Ga0207675_100826872
1697 Ga0207675_101234306
1698 Ga0207683_10004066
1699 Ga0207683_10081332
1700 Ga0207683_10127933
1701 Ga0207683_10158852
1702 Ga0207683_10280619
1703 Ga0207683_10465045
1704 Ga0207683_10870207
1705 Ga0207698_10470062
1706 Ga0207698_10470355
1707 Ga0210000_1050162
1708 Ga0209983_1054870
1709 Ga0209971_1018609
1710 Ga0209813_10026642
1711 Ga0209813_10037734
1712 Ga0209813_10229645
1713 Ga0209974_10014472
1714 Ga0207428_10001107
1715 Ga0207428_10032256
1716 Ga0207428_10041948
1717 Ga0207428_10044264
1718 Ga0207428_10146247
1719 Ga0268266_10038017
1720 Ga0268266_10255871
1721 Ga0268266_10310463
1722 Ga0268266_10330830
1723 Ga0268266_11792760
1724 Ga0268265_10130356
1725 Ga0268265_10144291
1726 Ga0268265_10195682
1727 Ga0268265_10297509
1728 Ga0268265_10456471
1729 Ga0268265_11942590
1730 Ga0268264_10071756
1731 Ga0268264_10247199
1732 Ga0268264_10280572
1733 Ga0268264_10516333
1734 Ga0268264_12256558
1735 Ga0265318_10117137
1736 Ga0265330_10292156
1737 Ga0265316_10114812
1738 Ga0307408_100080835
1739 Ga0307408_100116125
1740 Ga0307408_100281189
1741 Ga0316576_10185835
1742 Ga0307405_10074413
1743 Ga0307405_10225863
1744 Ga0307405_10304094
1745 Ga0307413_10161840
1746 Ga0307413_10234802
1747 Ga0307413_10451635
1748 Ga0307413_11094713
1749 Ga0307410_10009644
1750 Ga0307410_10086786
1751 Ga0307406_10171114
1752 Ga0307407_10062482
1753 Ga0307407_10074916
1754 Ga0307407_10698621
1755 Ga0307412_10259831
1756 Ga0307412_11493731
1757 Ga0307409_100093412
1758 Ga0307409_100184011
1759 Ga0307409_100504115
1760 Ga0307409_101223977
1761 Ga0307409_101272199
1762 Ga0307409_101282641
1763 Ga0307416_100043076
1764 Ga0307416_100586984
1765 Ga0307416_100679338
1766 Ga0307416_102175155
1767 Ga0307414_10749792
1768 Ga0307414_10900546
1769 Ga0307411_10748700
1770 Ga0307411_10768779
1771 Ga0307411_11279642
1772 Ga0307415_100044088
1773 Ga0307415_100141712
1774 Ga0307415_100903652
1775 Ga0373934_0034046
1776 Ga0373944_0080816
1777 Ga0373944_0100952
1778 Ga0373944_0206230
1779 Ga0373923_0142435
1780 Ga0373939_0049142
1781 Ga0373941_0157522
1782 Ga0373953_0208504
1783 Ga0373954_0054916
1784 Ga0373954_0141087
1785 Ga0373957_0501496
1786 Ga0373943_0022851
1787 Ga0373943_0077652
1788 Ga0373943_0078051
1789 Ga0373943_0341605
1790 Ga0373943_0446542
1791 Ga0373943_0631688
1792 Ga0373946_0124444
1793 Ga0373946_0317866
1794 Ga0373946_0401076
1795 Ga0373955_0004142
1796 Ga0373955_0454017
1797 Ga0316574_0256844
1798 Ga0373931_0730497
1799 Ga0373935_0043773
1800 Ga0373935_0299742
1801 Ga0373935_0462366
1802 Ga0373935_0649815
1803 Ga0373927_0496092
1804 Ga0373933_0004802
1805 Ga0373947_0006602
1806 Ga0373947_0025355
1807 Ga0373947_0380852
1808 Ga0373947_0460480
1809 Ga0373937_0045151
1810 Ga0373937_0092423
1811 Ga0373937_0112131
1812 Ga0373937_0400997
1813 Ga0373937_0516237
1814 Ga0373937_0973002
1815 Ga0373937_1395303
1816 Ga0316582_0948276
1817 Ga0373925_0097037
1818 Ga0373925_0226962
1819 Ga0373925_0240151
1820 Ga0373925_0279110
1821 Ga0373925_0290177
1822 Ga0395900_0689273
1823 Ga0395901_1667019
1824 Ga0439439_0018851
1825 Ga0439453_0011343
1826 Ga0451807_0884807
1827 Ga0451839_0837387
1828 Ga0439431_0037854
1829 Ga0439433_0072203
1830 Ga0439441_059890
1831 Ga0439443_081925
1832 Ga0439443_086457
1833 Ga0439450_091487
1834 Ga0439456_051027
1835 Ga0439462_0017266
1836 Ga0450890_017717
1837 Ga0439446_0036029
1838 Ga0439446_0208726
1839 Ga0439434_0018211
1840 Ga0439434_0033356
1841 Ga0439435_0160584
1842 Ga0439435_0236672
1843 Ga0439464_0038668
1844 Ga0439460_0039836
1845 Ga0439460_0135947
1846 Ga0450916_027429
1847 Ga0439440_0060701
1848 Ga0453683_0847630
1849 Ga0451576_0314922
1850 Ga0451576_0502249
1851 Ga0451576_1315666
1852 Ga0466967_0706198
1853 Ga0495592_0014532
1854 Ga0495603_0110596
1855 Ga0495629_0639311
1856 Ga0495638_0051992
1857 Ga0495638_0066115
1858 Ga0495651_0442781
1859 Ga0495653_0360011
1860 Ga0495580_0040644
1861 Ga0495580_0076071
1862 Ga0495580_0429778
1863 Ga0495582_0040322
1864 Ga0495582_0112911
1865 Ga0495639_0250244
1866 Ga0495639_0329004
1867 Ga0495585_0368851
1868 Ga0495618_0322819
1869 Ga0495628_0010401
1870 Ga0495628_0874067
1871 Ga0495644_0269937
1872 Ga0495666_0320591
1873 Ga0495652_0224318
1874 Ga0495640_0229685
1875 Ga0495586_0102140
1876 Ga0495587_0019297
1877 Ga0495621_0179476
1878 Ga0495621_0389586
1879 Ga0495645_0091509
1880 Ga0495645_0638315
1881 Ga0495656_0453577
1882 Ga0495634_0664967
1883 Ga0495625_0710568
1884 Ga0495635_0080667
1885 Ga0495635_0608350
1886 Ga0495635_1049835
1887 Ga0495657_0183238
1888 Ga0495599_0142922
1889 Ga0495599_0464821
1890 Ga0495646_0336941
1891 Ga0495647_0073646
1892 Ga0495647_0441969
1893 Ga0495658_0109825
1894 Ga0495658_0128940
1895 Ga0495658_0145595
1896 Ga0495658_0252814
1897 Ga0495658_0469701
1898 Ga0495658_0979838
1899 Ga0495669_0002483
1900 Ga0495669_0028140
1901 Ga0495669_0194750
1902 Ga0495669_0204410
1903 Ga0495613_0000598
1904 Ga0495670_0773327
1905 Ga0495600_0051841
1906 Ga0495600_0530349
1907 Ga0495581_0138587
1908 Ga0495604_0040740
1909 Ga0495674_0038315
1910 Ga0495674_0862038
1911 Ga0495676_0789225
1912 Ga0495675_0054096
1913 Ga0495684_0002960
1914 Ga0495684_0243638
1915 Ga0495684_0368280
1916 Ga0495684_0712353
1917 Ga0495593_0362180
1918 Ga0495614_0582076
1919 Ga0496101_0001418
1920 Ga0496101_0468130
1921 Ga0496102_0106480
1922 Ga0496102_0186648
1923 Ga0496102_0318257
1924 Ga0496102_0525388
1925 Ga0496104_0270554
1926 Ga0496104_0416459
1927 Ga0496104_0426432
1928 Ga0496104_1531859
1929 Ga0496105_0053985
1930 Ga0496105_0332095
1931 Ga0496105_0867313
1932 Ga0496105_1124837
1933 Ga0496106_0075948
1934 Ga0496106_0483841
1935 Ga0496107_0067243
1936 Ga0496107_0279926
1937 Ga0496107_0937571
1938 Ga0496107_0999578
1939 Ga0496108_0003929
1940 Ga0496108_0071531
1941 Ga0496108_0093169
1942 Ga0496108_0163800
1943 Ga0496108_0269910
1944 Ga0496108_0472727
1945 Ga0496109_0001173
1946 Ga0496109_0219064
1947 Ga0496109_0358014
1948 Ga0496109_0518321
1949 Ga0496109_0830890
1950 Ga0496110_0001473
1951 Ga0496110_0084917
1952 Ga0496111_0008760
1953 Ga0496111_0187839
1954 Ga0496112_0000262
1955 Ga0496112_0016713
1956 Ga0496112_0040152
1957 Ga0496112_0231752
1958 Ga0496112_0366004
1959 Ga0496112_1458525
1960 Ga0496113_0098492
1961 Ga0496113_0268190
1962 Ga0496113_1186740
1963 Ga0496114_0000128
1964 Ga0496114_0236077
1965 Ga0496114_0249490
1966 Ga0496114_0443193
1967 Ga0496114_0478319
1968 Ga0496114_0529577
1969 Ga0501291_072235
1970 Ga0501291_077649
1971 Ga0501031_0527611
1972 Ga0501033_0290038
1973 Ga0501034_0058187
1974 Ga0501034_0095146
1975 Ga0501034_0157196
1976 Ga0501036_0161693
1977 Ga0501036_0296959
1978 Ga0501038_0453867
1979 Ga0501039_0363514
1980 Ga0501039_1210571
1981 Ga0501040_0420263
1982 Ga0501040_0552279
1983 Ga0501040_1040227
1984 Ga0501040_1291750
1985 Ga0501041_0270632
1986 Ga0501041_0488977
1987 Ga0501041_0627088
1988 Ga0501042_0325692
1989 Ga0501042_1087004
1990 Ga0501043_0163927
1991 Ga0501043_0854295
1992 Ga0501046_0186088
1993 Ga0501047_0102474
1994 Ga0501048_0345568
1995 Ga0501048_0825688
1996 Ga0501067_0672195
1997 Ga0501069_0356964
1998 Ga0501070_1138814
1999 Ga0501071_0054384
2000 Ga0501071_0409533
2001 Ga0501071_0492022
2002 Ga0501071_0575007
2003 Ga0501072_0310504
2004 Ga0501072_0508914
2005 Ga0501073_0011820
2006 Ga0501073_0552349
2007 Ga0501073_0572628
2008 Ga0501074_0452716
2009 Ga0501075_0079432
2010 Ga0501075_0149183
2011 Ga0501075_0210293
2012 Ga0501075_0465827
2013 Ga0501076_0006351
2014 Ga0501076_0006517
2015 Ga0501076_0133426
2016 Ga0501076_0470339
2017 Ga0501076_0538096
2018 Ga0501076_0814677
2019 Ga0501077_0661591
2020 Ga0501233_261373
2021 Ga0501235_086669
2022 Ga0501225_0237910
2023 Ga0501079_0951573
2024 Ga0501079_1028685
2025 Ga0501080_0048031
2026 Ga0501080_0170584
2027 Ga0501080_0407957
2028 Ga0501081_0028798
2029 Ga0501081_0055439
2030 Ga0501081_0186099
2031 Ga0501081_0612857
2032 Ga0501035_0287614
2033 Ga0501035_0411871
2034 Ga0501035_0637311
2035 Ga0501035_0789474
2036 Ga0501044_0043849
2037 Ga0501045_0031537
2038 Ga0501045_0111334
2039 Ga0501045_0422268
2040 Ga0501045_0427399
2041 Ga0501045_0476152
2042 Ga0501045_1036495
2043 nmdc:mga03n38_59967_c1
2044 nmdc:mga00v17_131131_c1
2045 nmdc:mga00v17_278740_c1
2046 nmdc:mga00v17_485107_c1
2047 nmdc:mga00v17_59147_c1
2048 nmdc:mga00v17_74639_c1
2049 nmdc:mga0yw44_147990_c1
2050 nmdc:mga0yw44_669034_c1
2051 nmdc:mga0k408_3112_c1
2052 nmdc:mga0k408_383977_c1
2053 nmdc:mga0k408_423433_c1
2054 nmdc:mga0k408_819962_c1
2055 nmdc:mga06z11_131035_c1
2056 nmdc:mga06z11_397486_c1
2057 nmdc:mga06z11_42528_c1
2058 nmdc:mga06z11_46954_c1
2059 nmdc:mga06z11_52379_c1
2060 nmdc:mga06z11_78940_c1
2061 nmdc:mga04h51_10455_c1
2062 nmdc:mga04h51_33593_c1
2063 nmdc:mga07m45_233238_c1
2064 nmdc:mga07m45_238681_c1
2065 nmdc:mga05p37_1108548_c1
2066 nmdc:mga05p37_11340_c1
2067 nmdc:mga05p37_119358_c1
2068 nmdc:mga05p37_185529_c1
2069 nmdc:mga05p37_20722_c2
2070 nmdc:mga05p37_208674_c1
2071 nmdc:mga05p37_267613_c1
2072 nmdc:mga05p37_276690_c1
2073 nmdc:mga05p37_30370_c1
2074 nmdc:mga05p37_374952_c1
2075 nmdc:mga05p37_38798_c1
2076 nmdc:mga05p37_406560_c1
2077 nmdc:mga05p37_420499_c1
2078 nmdc:mga05p37_63169_c1
2079 nmdc:mga05p37_689708_c1
2080 nmdc:mga05p37_711851_c1
2081 nmdc:mga05p37_759480_c1
2082 nmdc:mga05p37_969574_c1
2083 nmdc:mga09592_1132798_c1
2084 nmdc:mga09592_1252974_c1
2085 nmdc:mga09592_495600_c1
2086 nmdc:mga09592_514132_c1
2087 nmdc:mga09592_611013_c1
2088 nmdc:mga09592_69181_c1
2089 nmdc:mga06r32_11001_c1
2090 nmdc:mga06r32_1108201_c1
2091 nmdc:mga06r32_1164728_c1
2092 nmdc:mga06r32_1234294_c1
2093 nmdc:mga06r32_173849_c1
2094 nmdc:mga06r32_374861_c1
2095 nmdc:mga06r32_680025_c1
2096 nmdc:mga06r32_917597_c1
2097 nmdc:mga08y16_111356_c1
2098 nmdc:mga08y16_1380_c1
2099 nmdc:mga08y16_175411_c1
2100 nmdc:mga08y16_21491_c1
2101 nmdc:mga08y16_2223_c1
2102 nmdc:mga08y16_281973_c1
2103 nmdc:mga08y16_294709_c1
2104 nmdc:mga08y16_488654_c1
2105 nmdc:mga08y16_618143_c1
2106 nmdc:mga08y16_66257_c1
2107 nmdc:mga08y16_94642_c1
2108 nmdc:mga0n895_1303969_c1
2109 nmdc:mga0n895_139970_c1
2110 nmdc:mga0n895_1452277_c1
2111 nmdc:mga0n895_1505249_c1
2112 nmdc:mga0n895_1539639_c1
2113 nmdc:mga0n895_242721_c1
2114 nmdc:mga0n895_282399_c1
2115 nmdc:mga0n895_650_c1
2116 nmdc:mga0n895_8344_c1
2117 nmdc:mga0rr50_105210_c1
2118 nmdc:mga0rr50_154101_c1
2119 nmdc:mga0rr50_1669874_c1
2120 nmdc:mga0rr50_2152_c1
2121 nmdc:mga0rr50_33493_c1
2122 nmdc:mga0rr50_35162_c1
2123 nmdc:mga0rr50_448948_c1
2124 nmdc:mga0rr50_8_c1
2125 nmdc:mga08x19_37375_c1
2126 nmdc:mga08x19_50255_c1
2127 nmdc:mga08x19_73021_c1
2128 nmdc:mga08x19_906_c1
2129 nmdc:mga0a205_103595_c1
2130 nmdc:mga0a205_246665_c1
2131 nmdc:mga0a205_362448_c1
2132 nmdc:mga0a205_377366_c1
2133 nmdc:mga0a205_407779_c1
2134 nmdc:mga0a205_641105_c1
2135 nmdc:mga0a205_64616_c1
2136 nmdc:mga0a205_71942_c1
2137 nmdc:mga0a205_82782_c1
2138 nmdc:mga0sz30_185368_c1
2139 Ga0495601_0010674
2140 Ga0495601_0016141
2141 Ga0495601_0036154
2142 Ga0495601_0039243
2143 Ga0495601_0711418
2144 Ga0495612_0262480
2145 Ga0495595_0062828
2146 Ga0495595_0074229
2147 Ga0495595_0127273
2148 Ga0495619_0005032
2149 Ga0495619_0341214
2150 Ga0495619_0345099
2151 Ga0495619_0375458
2152 Ga0495619_0658799
2153 Ga0500641_0000167
2154 Ga0500628_039766
2155 Ga0500588_0369163
2156 Ga0500627_0189481
2157 Ga0500611_113727
2158 Ga0501084_0012619
2159 Ga0501084_0110371
2160 Ga0501084_0126589
2161 Ga0590071_000450
2162 Ga0590071_005409
2163 Ga0590071_031080
2164 Ga0590071_036002
2165 Ga0590071_079773
2166 Ga0590074_000270
2167 Ga0590074_015566
2168 Ga0590074_064358
2169 Ga0590075_016638
2170 Ga0590077_000042
2171 Ga0590077_000416
2172 Ga0501082_0300818
2173 Ga0501082_0584568
2174 Ga0501082_0801249
2175 Ga0501082_1439512
2176 Ga0530510_0167291
2177 Ga0530510_0220469
2178 Ga0530510_0338701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02577

BFN_dom

Bifunctional nuclease domain

45

157

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sj5-assembly1.cif.gz_A crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 2.8 a resolution 0.9424 1 129
1vjl-assembly1.cif.gz_A crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 1.90 a resolution 0.9384 1 129
1vjl-assembly1.cif.gz_B crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 1.90 a resolution 0.9356 1 129
1sj5-assembly1.cif.gz_B crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 2.8 a resolution 0.9301 1 129
1vjl-assembly1.cif.gz_B crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 1.90 a resolution 0.877 1 129
ID Description Score Start End Superfamily
af_P9WLR5_1_139_3.10.690.10 Alpha Beta;Roll;Bifunctional nuclease domain;Bifunctional nuclease domain 0.9593 3 129 3.10.690.10
af_Q9FWS6_123_258_3.10.690.10 Alpha Beta;Roll;Bifunctional nuclease domain;Bifunctional nuclease domain 0.948 18 129 3.10.690.10
1sj5A00 Alpha Beta;Roll;Bifunctional nuclease domain;Bifunctional nuclease domain 0.9424 1 129 3.10.690.10
af_A0A1D6MW07_142_273_3.10.690.10 Alpha Beta;Roll;Bifunctional nuclease domain;Bifunctional nuclease domain 0.9398 18 122 3.10.690.10
af_I1LI65_127_259_3.10.690.10 Alpha Beta;Roll;Bifunctional nuclease domain;Bifunctional nuclease domain 0.8896 15 126 3.10.690.10
ID Description Score Start End GO Terms
AF-A0A2E8WA39-F1-model_v4 Bifunctional nuclease family protein 0.9859 2 129 GO:0004518
AF-A0A1Q7SI96-F1-model_v4 BFN domain-containing protein 0.9846 6 132 GO:0004518
AF-A0A535BLB8-F1-model_v4 Bifunctional nuclease family protein 0.9823 1 129 GO:0004518
AF-A0A2V9M732-F1-model_v4 BFN domain-containing protein 0.9801 1 121 GO:0004518
AF-A0A2V9QYG9-F1-model_v4 PDZ domain-containing protein 0.9797 1 124 GO:0004518

Map