F489814

General Info

Members Datasets Scaffolds Average Seq Length
1087 535 988 130

Family's Representative Sequence

Representative Sequence 3300047317|Ga0495604_0372664|Ga0495604_0372664_150_623
Length 157
Sequence MWRQADPEPGACRRIPIGKESSDMSLDVSPDLLARAEAGEITDEEFAACVRTSLPYAWQMVSDLATLFHVDGGGETGFVDNRTPPPDEQARGQLLRALASDSIRGCLERYFGVRLAFQNCHRVAVFPKDPSQYSDSYRSFTSVRAQLLNQSPELRDC

Samples

Sample ID Description Type Environment
1 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
8 2643221548 Streptomyces sp. Root55 Isolate Unclassified
9 2643221578 Streptomyces sp. Root63 Isolate Unclassified
10 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
11 2643221647 Streptomyces sp. Root369 Isolate Unclassified
12 2643221670 Streptomyces sp. Root431 Isolate Unclassified
13 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
14 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
15 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
16 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
17 2643221714 Streptomyces sp. Root264 Isolate Unclassified
18 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
19 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
20 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
21 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
22 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
23 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
24 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
25 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
26 2808606448 Streptomyces sp. 193411 Isolate Unclassified
27 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
28 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
29 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
30 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
31 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
32 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
33 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
34 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
35 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
36 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
37 2862574272 Streptomyces sp. AcE210 Isolate Nodule
38 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
39 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
40 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
41 2867369537 Streptomyces sp. Z26 Isolate Unclassified
42 2867428634 Streptomyces sp. RP5T Isolate Unclassified
43 2867475112 Streptomyces sp. TM32 Isolate Unclassified
44 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
45 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
46 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
47 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
48 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
49 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
50 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
51 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
52 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
53 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
54 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
55 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
56 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
57 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
58 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
59 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
60 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
61 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
62 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
63 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
64 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
65 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
66 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
67 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
68 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
69 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
70 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
71 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
72 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
73 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
74 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
75 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
76 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
77 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
78 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
79 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
80 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
81 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
82 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
83 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
84 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
86 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
87 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
88 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
89 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
90 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
91 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
92 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
93 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
94 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
95 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
99 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
100 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
101 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
102 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
103 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
104 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
105 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
106 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
107 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
108 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
109 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
110 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
111 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
112 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
113 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
114 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
115 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
116 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
117 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
118 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
119 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
122 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
123 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
124 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
125 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
126 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
127 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
128 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
129 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
147 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
154 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
155 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
156 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
157 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
163 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
170 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
171 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
174 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
211 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
212 3300028019 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 Metagenome Unclassified
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
218 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
219 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
220 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
221 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
222 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
223 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
224 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
225 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
226 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
227 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
228 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
229 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
230 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
231 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
232 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
233 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
234 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
256 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
257 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
258 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
259 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
260 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
261 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
262 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
263 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
264 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
265 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
266 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
267 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
268 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
269 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
270 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
271 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
272 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
273 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
274 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
275 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
276 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
277 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
278 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
279 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
280 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
281 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
282 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
283 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
284 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
285 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
286 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
287 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
288 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
289 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
290 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
291 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
292 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
293 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
294 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
295 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
296 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
300 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
301 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
302 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
303 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
304 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
305 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
306 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
307 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
308 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
309 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
310 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
311 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
312 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
313 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
314 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
315 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
316 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
317 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
318 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
319 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
320 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
321 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
322 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
323 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
324 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
325 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
326 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
327 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
328 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
329 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
330 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
331 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
332 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
333 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
334 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
335 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
336 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
337 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
338 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
339 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
340 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
341 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
342 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
343 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
344 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
345 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
346 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
347 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
348 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
349 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
350 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
351 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
352 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
353 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
354 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
355 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
356 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
357 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
358 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
359 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
360 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
361 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
362 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
363 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
364 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
365 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
366 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
367 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
368 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
369 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
370 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
371 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
372 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
373 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
374 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
375 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
376 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
377 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
378 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
379 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
380 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
381 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
382 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
383 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
384 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
385 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
386 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
387 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
388 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
389 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
390 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
391 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
392 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
393 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
394 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
395 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
396 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
397 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
398 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
399 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
400 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
401 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
402 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
403 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
404 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
405 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
412 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
413 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
430 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
431 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
432 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
433 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
434 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
435 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
436 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
437 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
438 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
439 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
440 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
441 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
442 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
443 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
444 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
445 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
446 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
447 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
448 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
451 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
452 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
453 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
454 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
455 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
456 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
457 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
458 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
459 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
460 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
461 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
462 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
463 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
464 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
465 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
466 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
467 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
468 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
469 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
470 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
471 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
472 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
473 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
474 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
475 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
476 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
477 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
478 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
479 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
480 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
481 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
482 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
483 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
484 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
485 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
486 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
487 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
488 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
489 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
490 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
491 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
492 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
493 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
494 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
513 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
514 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
515 8002784119 Frankia sp. AgB1.9 Isolate Nodule
516 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
517 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
518 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
519 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
520 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
521 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
522 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
523 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
524 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
525 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
526 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
527 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
528 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
529 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
530 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
531 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
532 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
533 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
534 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
535 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.61
Metatranscriptomes 8.28
Isolates 9.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 0.55
Rhizoplane 1.38
Rhizosphere 81.42
Stem 0
Stem Tuber 0
Unclassified 10.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJN_F6ESG4R02HG44S 2088090003 Bacteria 505
2 JGI24737J22298_10094530 3300001990 Bacteria 886
3 JGI24735J21928_10057026 3300002067 Bacteria 1124
4 JGI24738J21930_10027978 3300002075 Bacteria 1154
5 Ga0006759J45824_1023985 3300003163 Bacteria 556
6 JGI25406J46586_10008092 3300003203 Bacteria 4774
7 Ga0006777J48905_1041869 3300003308 Bacteria 603
8 Ga0006777J48905_1052988 3300003308 Bacteria 554
9 rootH2_10038439 3300003320 Bacteria 1601
10 rootH2_10038440 3300003320 Bacteria 1529
11 rootH2_10115779 3300003320 Bacteria 1726
12 rootH2_10134987 3300003320 Bacteria 1371
13 rootL2_10015814 3300003322 Bacteria 1699
14 rootL2_10015815 3300003322 Bacteria 2035
15 rootH1_10005533 3300003323 Bacteria 1777
16 rootH1_10005534 3300003323 Bacteria 1916
17 JGI25160J50197_1029327 3300003354 Bacteria 1457
18 Ga0007427J51700_128208 3300003559 Bacteria 570
19 Ga0007410J51695_1021724 3300003574 Bacteria 541
20 Ga0007409J51694_1026987 3300003575 Bacteria 580
21 Ga0006562J51391_1014857 3300003578 Bacteria 736
22 Ga0007429J51699_1037609 3300003579 Bacteria 541
23 Ga0032354_1040524 3300003693 Bacteria 586
24 Ga0058863_11440945 3300004799 Bacteria 514
25 Ga0058863_11726019 3300004799 Bacteria 600
26 Ga0058862_12758211 3300004803 Bacteria 536
27 Ga0070683_100632655 3300005329 Bacteria 1024
28 Ga0070666_10823944 3300005335 Bacteria 684
29 Ga0070660_100196781 3300005339 Bacteria 1634
30 Ga0070660_101897774 3300005339 Bacteria 508
31 Ga0070667_100030080 3300005367 Bacteria 4529
32 Ga0070667_100481019 3300005367 Bacteria 1137
33 Ga0070709_10155399 3300005434 Bacteria 1585
34 Ga0070709_10904676 3300005434 Bacteria 698
35 Ga0070714_100007466 3300005435 Bacteria 8513
36 Ga0070714_100398704 3300005435 Bacteria 1300
37 Ga0070714_100474817 3300005435 Bacteria 1190
38 Ga0070714_100652588 3300005435 Bacteria 1013
39 Ga0070714_100761519 3300005435 Bacteria 936
40 Ga0070714_102133102 3300005435 Unclassified 546
41 Ga0070713_100109119 3300005436 Bacteria 2410
42 Ga0070713_100285818 3300005436 Bacteria 1514
43 Ga0070713_101282585 3300005436 Bacteria 710
44 Ga0070710_11266586 3300005437 Bacteria 547
45 Ga0070711_100727525 3300005439 Bacteria 837
46 Ga0070711_101507223 3300005439 Bacteria 587
47 Ga0070708_100001822 3300005445 Bacteria 16341
48 Ga0070708_100318666 3300005445 Bacteria 1465
49 Ga0070708_100853808 3300005445 Bacteria 855
50 Ga0070663_100300651 3300005455 Bacteria 1284
51 Ga0070681_10053792 3300005458 Bacteria 4011
52 Ga0070706_100021707 3300005467 Bacteria 5913
53 Ga0070706_100133047 3300005467 Bacteria 2321
54 Ga0070706_100507703 3300005467 Bacteria 1122
55 Ga0070706_100780091 3300005467 Bacteria 885
56 Ga0070707_100535360 3300005468 Bacteria 1133
57 Ga0070698_100044076 3300005471 Bacteria 4570
58 Ga0070698_100045313 3300005471 Bacteria 4502
59 Ga0070698_100250027 3300005471 Bacteria 1706
60 Ga0070698_100594151 3300005471 Bacteria 1047
61 Ga0070699_100412515 3300005518 Bacteria 1222
62 Ga0068853_100047259 3300005539 Bacteria 3693
63 Ga0068853_100054346 3300005539 Bacteria 3451
64 Ga0070665_100014993 3300005548 Bacteria 7779
65 Ga0070665_100179347 3300005548 Bacteria 2119
66 Ga0070665_100471533 3300005548 Bacteria 1266
67 Ga0068855_100013371 3300005563 Bacteria 9899
68 Ga0068855_102443224 3300005563 Bacteria 521
69 Ga0068854_100058685 3300005578 Bacteria 2779
70 Ga0068856_100142964 3300005614 Bacteria 2400
71 Ga0068856_100546987 3300005614 Bacteria 1179
72 Ga0068852_100071678 3300005616 Bacteria 3043
73 Ga0068860_101389325 3300005843 Bacteria 723
74 Ga0081455_10074548 3300005937 Bacteria 2802
75 Ga0081538_10000602 3300005981 Bacteria 39838
76 Ga0081539_10000177 3300005985 Bacteria 149939
77 Ga0070717_10457761 3300006028 Bacteria 1150
78 Ga0070717_11450355 3300006028 Bacteria 623
79 Ga0075365_10413876 3300006038 Bacteria 952
80 Ga0075365_10959514 3300006038 Bacteria 603
81 Ga0075365_11261057 3300006038 Bacteria 520
82 Ga0075368_10011789 3300006042 Bacteria 3188
83 Ga0075363_100013133 3300006048 Bacteria 4005
84 Ga0075363_100418568 3300006048 Bacteria 789
85 Ga0075363_100657769 3300006048 Bacteria 631
86 Ga0075364_10920925 3300006051 Bacteria 595
87 Ga0070715_10011216 3300006163 Bacteria 3221
88 Ga0070715_10265494 3300006163 Bacteria 903
89 Ga0070712_100103005 3300006175 Bacteria 2115
90 Ga0070712_100263361 3300006175 Bacteria 1382
91 Ga0070712_101296475 3300006175 Unclassified 635
92 Ga0075367_10011939 3300006178 Bacteria 4615
93 Ga0099826_10090081 3300006948 Bacteria 1879
94 Ga0105251_10011572 3300009011 Bacteria 5034
95 Ga0105244_10074219 3300009036 Bacteria 1692
96 Ga0105244_10448287 3300009036 Bacteria 594
97 Ga0105250_10119467 3300009092 Bacteria 1082
98 Ga0105240_10029108 3300009093 Bacteria 7202
99 Ga0105245_10120323 3300009098 Bacteria 2452
100 Ga0105245_10743002 3300009098 Bacteria 1017
101 Ga0105245_11586482 3300009098 Bacteria 706
102 Ga0105243_10178280 3300009148 Bacteria 1846
103 Ga0105241_10004696 3300009174 Bacteria 10088
104 Ga0105242_11310203 3300009176 Bacteria 748
105 Ga0105242_12280952 3300009176 Bacteria 587
106 Ga0105248_11865327 3300009177 Bacteria 682
107 Ga0105237_10034889 3300009545 Bacteria 5091
108 Ga0105237_11387945 3300009545 Bacteria 709
109 Ga0105237_12051727 3300009545 Bacteria 581
110 Ga0105238_10015709 3300009551 Bacteria 7664
111 Ga0105239_10106549 3300010375 Bacteria 3105
112 Ga0105239_10151882 3300010375 Bacteria 2585
113 Ga0105239_10387042 3300010375 Unclassified 1581
114 Ga0105239_11234579 3300010375 Bacteria 862
115 Ga0105246_10256826 3300011119 Bacteria 1390
116 Ga0105246_10335098 3300011119 Bacteria 1234
117 Ga0105246_10534636 3300011119 Bacteria 1002
118 Ga0157322_1006037 3300012490 Bacteria 853
119 Ga0154016_120640 3300013045 Bacteria 751
120 Ga0154012_105953 3300013059 Bacteria 875
121 Ga0157369_10259557 3300013105 Bacteria 1812
122 Ga0157369_10354398 3300013105 Bacteria 1524
123 Ga0157369_10571963 3300013105 Bacteria 1167
124 Ga0157374_10075017 3300013296 Bacteria 3196
125 Ga0157372_10465578 3300013307 Bacteria 1473
126 Ga0157372_10700796 3300013307 Bacteria 1178
127 Ga0157375_11201230 3300013308 Bacteria 890
128 Ga0182008_10003296 3300014497 Bacteria 9827
129 Ga0182006_1049148 3300015261 Bacteria 1629
130 Ga0182007_10021380 3300015262 Bacteria 2299
131 Ga0182005_1049193 3300015265 Bacteria 1146
132 Ga0183367_1002 3300015688 Bacteria 1101531
133 Ga0163161_10337773 3300017792 Bacteria 1194
134 Ga0197907_10200592 3300020069 Bacteria 756
135 Ga0197907_10230676 3300020069 Bacteria 770
136 Ga0197907_10704798 3300020069 Bacteria 725
137 Ga0197907_10708005 3300020069 Bacteria 766
138 Ga0206356_11000058 3300020070 Bacteria 823
139 Ga0206356_11607154 3300020070 Bacteria 623
140 Ga0206349_1011289 3300020075 Bacteria 656
141 Ga0206349_1353168 3300020075 Bacteria 785
142 Ga0206355_1522735 3300020076 Bacteria 755
143 Ga0206355_1634198 3300020076 Bacteria 720
144 Ga0206351_10011824 3300020077 Bacteria 730
145 Ga0206351_10405507 3300020077 Bacteria 598
146 Ga0206351_10415879 3300020077 Bacteria 596
147 Ga0206351_10965487 3300020077 Unclassified 548
148 Ga0206352_10222767 3300020078 Bacteria 710
149 Ga0206352_10338841 3300020078 Bacteria 716
150 Ga0206352_10427184 3300020078 Unclassified 764
151 Ga0206352_10962197 3300020078 Bacteria 924
152 Ga0206352_11212980 3300020078 Bacteria 754
153 Ga0206352_11223151 3300020078 Bacteria 916
154 Ga0206352_11302190 3300020078 Bacteria 516
155 Ga0206350_10496801 3300020080 Bacteria 810
156 Ga0206350_10617434 3300020080 Bacteria 1434
157 Ga0206350_10854241 3300020080 Bacteria 761
158 Ga0206350_11643667 3300020080 Bacteria 723
159 Ga0206354_10598026 3300020081 Bacteria 590
160 Ga0206354_10676087 3300020081 Bacteria 904
161 Ga0206354_10967460 3300020081 Bacteria 535
162 Ga0206354_11241012 3300020081 Bacteria 632
163 Ga0206353_10176331 3300020082 Bacteria 568
164 Ga0206353_10412605 3300020082 Bacteria 722
165 Ga0206353_10584668 3300020082 Bacteria 548
166 Ga0206353_10786963 3300020082 Bacteria 1278
167 Ga0206353_11078754 3300020082 Bacteria 816
168 Ga0154015_1053415 3300020610 Bacteria 675
169 Ga0213874_10054940 3300021377 Unclassified 1232
170 Ga0213875_10001996 3300021388 Bacteria 12603
171 Ga0224712_10121282 3300022467 Bacteria 1132
172 Ga0224712_10238402 3300022467 Bacteria 837
173 Ga0224712_10253202 3300022467 Bacteria 814
174 Ga0224712_10598646 3300022467 Bacteria 538
175 Ga0224712_10617934 3300022467 Bacteria 530
176 Ga0224712_10640531 3300022467 Bacteria 521
177 Ga0209673_1070969 3300025273 Bacteria 829
178 Ga0209758_1008145 3300025297 Bacteria 6889
179 Ga0207426_1001450 3300025302 Bacteria 19608
180 Ga0207426_1025097 3300025302 Bacteria 2011
181 Ga0207426_1034160 3300025302 Bacteria 1633
182 Ga0207426_1038839 3300025302 Bacteria 1496
183 Ga0207656_10729185 3300025321 Bacteria 508
184 Ga0207696_1064574 3300025711 Bacteria 1025
185 Ga0207713_1054939 3300025735 Bacteria 1557
186 Ga0207688_10373228 3300025901 Bacteria 882
187 Ga0207680_10691276 3300025903 Bacteria 731
188 Ga0207647_10003737 3300025904 Bacteria 11380
189 Ga0207647_10015250 3300025904 Bacteria 5275
190 Ga0207685_10115157 3300025905 Bacteria 1171
191 Ga0207699_10134114 3300025906 Bacteria 1619
192 Ga0207643_10753530 3300025908 Bacteria 630
193 Ga0207684_10047679 3300025910 Bacteria 3634
194 Ga0207684_10112199 3300025910 Bacteria 2334
195 Ga0207654_10039292 3300025911 Bacteria 2661
196 Ga0207707_10012054 3300025912 Bacteria 7518
197 Ga0207695_10010754 3300025913 Bacteria 11164
198 Ga0207671_10004875 3300025914 Bacteria 12621
199 Ga0207671_10673415 3300025914 Bacteria 823
200 Ga0207671_11563059 3300025914 Bacteria 508
201 Ga0207693_10250350 3300025915 Bacteria 1390
202 Ga0207693_10336397 3300025915 Bacteria 1182
203 Ga0207657_10418932 3300025919 Bacteria 1053
204 Ga0207657_11074365 3300025919 Bacteria 616
205 Ga0207646_10413441 3300025922 Bacteria 1218
206 Ga0207694_10007071 3300025924 Bacteria 8522
207 Ga0207694_10428848 3300025924 Bacteria 1102
208 Ga0207687_10073268 3300025927 Bacteria 2452
209 Ga0207687_10514744 3300025927 Bacteria 1000
210 Ga0207687_11359671 3300025927 Bacteria 610
211 Ga0207700_10027338 3300025928 Bacteria 3993
212 Ga0207700_10030939 3300025928 Bacteria 3797
213 Ga0207700_10211518 3300025928 Bacteria 1640
214 Ga0207700_10265550 3300025928 Bacteria 1471
215 Ga0207700_10696906 3300025928 Bacteria 906
216 Ga0207664_10004838 3300025929 Bacteria 9154
217 Ga0207664_10020227 3300025929 Bacteria 4931
218 Ga0207664_10149837 3300025929 Bacteria 1981
219 Ga0207664_10788458 3300025929 Unclassified 855
220 Ga0207664_10893585 3300025929 Bacteria 798
221 Ga0207686_10811076 3300025934 Bacteria 751
222 Ga0207709_10139376 3300025935 Bacteria 1665
223 Ga0207691_10176268 3300025940 Bacteria 1870
224 Ga0207711_11138999 3300025941 Bacteria 721
225 Ga0207661_10669176 3300025944 Bacteria 954
226 Ga0207667_11316262 3300025949 Bacteria 698
227 Ga0207668_11311363 3300025972 Bacteria 652
228 Ga0207640_10043405 3300025981 Bacteria 2873
229 Ga0207640_10908081 3300025981 Bacteria 770
230 Ga0207658_10020850 3300025986 Bacteria 4541
231 Ga0207639_10051086 3300026041 Bacteria 3143
232 Ga0207639_10784360 3300026041 Bacteria 887
233 Ga0207639_11156113 3300026041 Bacteria 726
234 Ga0207678_10035603 3300026067 Bacteria 4333
235 Ga0207702_10259524 3300026078 Bacteria 1635
236 Ga0207702_11630333 3300026078 Bacteria 638
237 Ga0207683_11473167 3300026121 Bacteria 629
238 Ga0209371_1007342 3300027312 Bacteria 3858
239 Ga0209371_1041852 3300027312 Bacteria 925
240 Ga0209282_1328291 3300027666 Bacteria 637
241 Ga0209813_10027116 3300027866 Bacteria 1661
242 Ga0224573_1014732 3300028019 Bacteria 606
243 Ga0268266_10135758 3300028379 Bacteria 2203
244 Ga0268266_11379203 3300028379 Bacteria 680
245 Ga0268264_11202145 3300028381 Bacteria 767
246 Ga0307517_10003614 3300028786 Bacteria 24021
247 Ga0307517_10018520 3300028786 Bacteria 9000
248 Ga0307517_10367052 3300028786 Bacteria 775
249 Ga0307515_10004012 3300028794 Bacteria 30728
250 Ga0307515_10160116 3300028794 Bacteria 2301
251 Ga0307515_10301566 3300028794 Bacteria 1286
252 Ga0265338_10826467 3300028800 Bacteria 634
253 Ga0311003_121122 3300029282 Bacteria 526
254 Ga0310981_1089018 3300029285 Bacteria 523
255 Ga0310981_1096449 3300029285 Bacteria 636
256 Ga0265324_10070180 3300029957 Bacteria 1194
257 Ga0268256_1007098 3300030500 Bacteria 4053
258 Ga0268256_1047445 3300030500 Bacteria 925
259 Ga0268256_1059971 3300030500 Bacteria 767
260 Ga0307511_10062864 3300030521 Bacteria 2812
261 Ga0307512_10002762 3300030522 Bacteria 21451
262 Ga0307512_10016900 3300030522 Bacteria 6718
263 Ga0307512_10027864 3300030522 Bacteria 4963
264 Ga0307512_10060614 3300030522 Bacteria 2923
265 Ga0316177_1141283 3300030731 Bacteria 771
266 Ga0316176_1011376 3300030732 Bacteria 943
267 Ga0314311_1203010 3300030733 Bacteria 647
268 Ga0316178_1060430 3300030735 Bacteria 1287
269 Ga0316180_1105364 3300030736 Bacteria 810
270 Ga0316183_1196293 3300030742 Bacteria 1296
271 Ga0316181_1206647 3300030744 Bacteria 1609
272 Ga0307513_10000001 3300031456 Bacteria 1660464
273 Ga0307513_10006763 3300031456 Bacteria 14959
274 Ga0307513_10013386 3300031456 Bacteria 10069
275 Ga0307513_10021476 3300031456 Bacteria 7621
276 Ga0307513_10063901 3300031456 Bacteria 3882
277 Ga0307509_10151820 3300031507 Bacteria 2230
278 Ga0307509_10444491 3300031507 Bacteria 992
279 Ga0307508_10013541 3300031616 Bacteria 7454
280 Ga0307508_10021854 3300031616 Bacteria 5821
281 Ga0307508_10047272 3300031616 Bacteria 3839
282 Ga0307508_10102787 3300031616 Bacteria 2454
283 Ga0307508_10137600 3300031616 Bacteria 2045
284 Ga0307508_10461738 3300031616 Bacteria 863
285 Ga0307514_10009038 3300031649 Bacteria 8415
286 Ga0307514_10068734 3300031649 Bacteria 2669
287 Ga0307514_10069439 3300031649 Bacteria 2651
288 Ga0307514_10072409 3300031649 Bacteria 2581
289 Ga0307514_10194055 3300031649 Bacteria 1288
290 Ga0307514_10541582 3300031649 Bacteria 540
291 Ga0307516_10011933 3300031730 Bacteria 9398
292 Ga0307516_10073687 3300031730 Bacteria 3271
293 Ga0307516_10085486 3300031730 Bacteria 2992
294 Ga0307516_10471169 3300031730 Bacteria 911
295 Ga0307516_10671228 3300031730 Bacteria 692
296 Ga0307405_11161838 3300031731 Bacteria 666
297 Ga0307413_10181917 3300031824 Bacteria 1500
298 Ga0307518_10625368 3300031838 Bacteria 506
299 Ga0307410_10112499 3300031852 Bacteria 1972
300 Ga0307412_10749149 3300031911 Bacteria 843
301 Ga0307416_101136349 3300032002 Bacteria 886
302 Ga0307416_101320259 3300032002 Bacteria 827
303 Ga0307416_102933116 3300032002 Unclassified 571
304 Ga0307411_10019959 3300032005 Bacteria 3885
305 Ga0307507_10000024 3300033179 Bacteria 212340
306 Ga0307507_10045345 3300033179 Bacteria 4327
307 Ga0307507_10046672 3300033179 Bacteria 4242
308 Ga0307507_10347002 3300033179 Bacteria 875
309 Ga0307510_10012527 3300033180 Bacteria 10058
310 Ga0307510_10042716 3300033180 Bacteria 4936
311 Ga0307510_10406050 3300033180 Bacteria 805
312 Ga0307510_10483010 3300033180 Bacteria 680
313 Ga0316214_1065596 3300033545 Bacteria 533
314 Ga0373933_0014212 3300035724 Bacteria 4422
315 Ga0373933_0032249 3300035724 Unclassified 3044
316 Ga0373933_0424616 3300035724 Unclassified 868
317 Ga0373925_0000348 3300037068 Bacteria 48026
318 Ga0395899_0106055 3300037312 Bacteria 2024
319 Ga0395900_0473095 3300037418 Bacteria 1206
320 Ga0395898_0029604 3300037466 Bacteria 5481
321 Ga0395898_0310377 3300037466 Bacteria 1504
322 Ga0395905_0101042 3300037471 Bacteria 2708
323 Ga0436364_0162507 3300037853 Bacteria 90260
324 Ga0436364_0268454 3300037853 Bacteria 2309
325 Ga0395901_0014818 3300038443 Bacteria 7921
326 Ga0395901_0505392 3300038443 Bacteria 1230
327 Ga0436365_0220139 3300039437 Bacteria 562
328 Ga0436365_0654894 3300039437 Unclassified 951
329 Ga0436363_0115510 3300039450 Bacteria 533
330 Ga0436363_0671136 3300039450 Bacteria 720
331 Ga0436363_1105319 3300039450 Bacteria 2081
332 Ga0439436_0003937 3300041404 Bacteria 4555
333 Ga0439436_0010487 3300041404 Bacteria 2824
334 Ga0439436_0040854 3300041404 Bacteria 1328
335 Ga0439439_0002096 3300041406 Bacteria 4162
336 Ga0439439_0004871 3300041406 Bacteria 3041
337 Ga0439439_0099970 3300041406 Bacteria 798
338 Ga0439466_0060717 3300041411 Bacteria 1218
339 Ga0439465_0241022 3300041413 Bacteria 667
340 Ga0451790_05773 3300041444 Bacteria 523
341 Ga0451802_0862397 3300041460 Bacteria 2427
342 Ga0451805_108507 3300041461 Bacteria 523
343 Ga0451804_0235254 3300041463 Unclassified 544
344 Ga0451804_0942079 3300041463 Bacteria 585
345 Ga0451837_0921921 3300041494 Bacteria 3498
346 Ga0451839_0641366 3300041496 Bacteria 1244
347 Ga0451841_0721461 3300041498 Bacteria 1014
348 Ga0451845_0441870 3300041501 Bacteria 1388
349 Ga0451846_16207 3300041502 Bacteria 546
350 Ga0451850_26095 3300041506 Bacteria 559
351 Ga0451851_0375984 3300041507 Bacteria 1406
352 Ga0451843_0606551 3300041509 Bacteria 2138
353 Ga0451854_32235 3300041510 Bacteria 658
354 Ga0451853_2612288 3300041512 Bacteria 2806
355 Ga0439431_0068049 3300041997 Bacteria 945
356 Ga0439433_0000632 3300041999 Bacteria 6730
357 Ga0439433_0021444 3300041999 Bacteria 1445
358 Ga0439442_006630 3300042002 Bacteria 2325
359 Ga0439442_069300 3300042002 Bacteria 750
360 Ga0439448_0036930 3300042005 Bacteria 1568
361 Ga0439448_0049286 3300042005 Bacteria 1376
362 Ga0439449_0001150 3300042007 Bacteria 10383
363 Ga0439449_0002175 3300042007 Bacteria 7704
364 Ga0439449_0012546 3300042007 Bacteria 3187
365 Ga0439449_0175661 3300042007 Bacteria 800
366 Ga0439450_026846 3300042008 Bacteria 1272
367 Ga0439454_006489 3300042011 Bacteria 1441
368 Ga0439455_0002135 3300042012 Bacteria 3535
369 Ga0439457_000481 3300042014 Bacteria 11518
370 Ga0439457_003831 3300042014 Bacteria 4032
371 Ga0439457_062779 3300042014 Bacteria 843
372 Ga0439457_098290 3300042014 Bacteria 681
373 Ga0439457_174325 3300042014 Bacteria 523
374 Ga0450920_032484 3300042122 Bacteria 1030
375 Ga0450894_000022 3300042131 Bacteria 21795
376 Ga0450896_001115 3300042133 Bacteria 3188
377 Ga0450898_073904 3300042134 Bacteria 686
378 Ga0450899_000954 3300042135 Bacteria 3282
379 Ga0450900_028781 3300042136 Bacteria 801
380 Ga0450903_000614 3300042138 Bacteria 7198
381 Ga0450906_012450 3300042145 Bacteria 1576
382 Ga0439458_0003368 3300042157 Bacteria 3747
383 Ga0439434_0225600 3300042435 Bacteria 637
384 Ga0439459_0220617 3300042438 Bacteria 525
385 Ga0466969_0000400 3300044656 Bacteria 23837
386 Ga0466969_0001309 3300044656 Bacteria 13412
387 Ga0466969_0005724 3300044656 Bacteria 6607
388 Ga0466969_0016641 3300044656 Bacteria 3846
389 Ga0466969_0030439 3300044656 Bacteria 2750
390 Ga0466969_0045691 3300044656 Bacteria 2173
391 Ga0466969_0062623 3300044656 Bacteria 1804
392 Ga0466969_0207428 3300044656 Bacteria 893
393 Ga0466969_0296867 3300044656 Bacteria 731
394 Ga0466972_0004075 3300044658 Bacteria 7297
395 Ga0466972_0005652 3300044658 Bacteria 6274
396 Ga0466972_0006093 3300044658 Bacteria 6056
397 Ga0466972_0034156 3300044658 Bacteria 2493
398 Ga0466972_0096600 3300044658 Unclassified 1399
399 Ga0466972_0126891 3300044658 Bacteria 1202
400 Ga0466972_0394132 3300044658 Bacteria 649
401 Ga0466965_0000907 3300044683 Bacteria 11336
402 Ga0466965_0090009 3300044683 Bacteria 1560
403 Ga0466965_0608063 3300044683 Bacteria 621
404 Ga0466965_0947458 3300044683 Bacteria 504
405 Ga0466966_0000534 3300044684 Bacteria 24194
406 Ga0466966_0002876 3300044684 Bacteria 11337
407 Ga0466966_0018275 3300044684 Bacteria 4625
408 Ga0466966_0021345 3300044684 Bacteria 4252
409 Ga0466966_0038389 3300044684 Bacteria 3086
410 Ga0466966_0111153 3300044684 Bacteria 1689
411 Ga0466966_0119917 3300044684 Bacteria 1616
412 Ga0466966_0162762 3300044684 Bacteria 1358
413 Ga0466966_0260761 3300044684 Bacteria 1044
414 Ga0466961_0000308 3300044693 Bacteria 32406
415 Ga0466961_0002104 3300044693 Bacteria 12391
416 Ga0466961_0011811 3300044693 Bacteria 5582
417 Ga0466961_0013999 3300044693 Bacteria 5142
418 Ga0466961_0031962 3300044693 Bacteria 3382
419 Ga0466961_0106941 3300044693 Bacteria 1761
420 Ga0466961_0123710 3300044693 Bacteria 1623
421 Ga0466961_0134222 3300044693 Unclassified 1551
422 Ga0466961_0259370 3300044693 Bacteria 1066
423 Ga0466961_0520584 3300044693 Bacteria 717
424 Ga0466963_0067775 3300044694 Bacteria 2395
425 Ga0466963_0318208 3300044694 Bacteria 1095
426 Ga0466964_0029133 3300044706 Bacteria 2178
427 Ga0466964_0076919 3300044706 Bacteria 1424
428 Ga0466971_0000332 3300044719 Bacteria 18072
429 Ga0466971_0000463 3300044719 Bacteria 15866
430 Ga0466971_0048653 3300044719 Bacteria 1906
431 Ga0466971_0093045 3300044719 Bacteria 1381
432 Ga0466971_0218186 3300044719 Bacteria 903
433 Ga0466968_0000051 3300044735 Bacteria 33313
434 Ga0466968_0014055 3300044735 Bacteria 3158
435 Ga0466968_0476928 3300044735 Bacteria 619
436 Ga0466968_0514955 3300044735 Bacteria 597
437 Ga0466968_0535518 3300044735 Bacteria 586
438 Ga0466970_0000145 3300044765 Bacteria 32723
439 Ga0466970_0004998 3300044765 Bacteria 6550
440 Ga0466970_0014443 3300044765 Bacteria 4055
441 Ga0466970_0044429 3300044765 Bacteria 2365
442 Ga0466970_0080766 3300044765 Bacteria 1757
443 Ga0466970_0254963 3300044765 Unclassified 983
444 Ga0466970_0265705 3300044765 Bacteria 963
445 Ga0466970_0397530 3300044765 Bacteria 786
446 Ga0466970_0418366 3300044765 Bacteria 766
447 Ga0466970_0593999 3300044765 Unclassified 642
448 Ga0466970_0635632 3300044765 Bacteria 620
449 Ga0466957_0006604 3300044842 Bacteria 6560
450 Ga0466957_0121381 3300044842 Bacteria 1666
451 Ga0466957_0205918 3300044842 Bacteria 1294
452 Ga0466957_0295524 3300044842 Bacteria 1087
453 Ga0466957_0368705 3300044842 Bacteria 977
454 Ga0466957_0521283 3300044842 Bacteria 826
455 Ga0466957_1165670 3300044842 Bacteria 557
456 Ga0466957_1281957 3300044842 Bacteria 531
457 Ga0466960_0013352 3300044901 Bacteria 3487
458 Ga0466960_0242572 3300044901 Bacteria 998
459 Ga0466959_0000668 3300045049 Bacteria 20018
460 Ga0466959_0002190 3300045049 Bacteria 12428
461 Ga0466959_0004032 3300045049 Bacteria 9762
462 Ga0466959_0015896 3300045049 Bacteria 5491
463 Ga0466959_0030947 3300045049 Bacteria 3962
464 Ga0466959_0046010 3300045049 Bacteria 3212
465 Ga0466959_0084983 3300045049 Bacteria 2278
466 Ga0466959_0200536 3300045049 Bacteria 1389
467 Ga0466959_0446168 3300045049 Bacteria 877
468 Ga0466958_0000773 3300045836 Bacteria 14072
469 Ga0466958_0103073 3300045836 Bacteria 1776
470 Ga0466958_0165811 3300045836 Bacteria 1397
471 Ga0466958_0310163 3300045836 Bacteria 1013
472 Ga0466958_0689249 3300045836 Bacteria 665
473 Ga0466967_0038433 3300045976 Bacteria 4105
474 Ga0466967_0040073 3300045976 Bacteria 4031
475 Ga0466967_0061682 3300045976 Bacteria 3327
476 Ga0466967_0516550 3300045976 Bacteria 1173
477 Ga0466967_1091721 3300045976 Bacteria 795
478 Ga0495617_024406 3300046452 Bacteria 2040
479 Ga0495627_044002 3300046453 Bacteria 1364
480 Ga0495592_0048333 3300046454 Bacteria 3165
481 Ga0495592_0060598 3300046454 Bacteria 2783
482 Ga0495592_0087256 3300046454 Bacteria 2245
483 Ga0495592_0225487 3300046454 Bacteria 1250
484 Ga0495603_0000638 3300046455 Bacteria 19717
485 Ga0495603_0001879 3300046455 Bacteria 12388
486 Ga0495603_0005158 3300046455 Bacteria 7803
487 Ga0495603_0023079 3300046455 Bacteria 3766
488 Ga0495603_0026665 3300046455 Bacteria 3490
489 Ga0495603_0063291 3300046455 Bacteria 2182
490 Ga0495590_0308109 3300046457 Bacteria 596
491 Ga0495629_0001217 3300046459 Bacteria 20212
492 Ga0495629_0003212 3300046459 Bacteria 12366
493 Ga0495629_0007463 3300046459 Bacteria 8056
494 Ga0495629_0019525 3300046459 Bacteria 4840
495 Ga0495629_0050969 3300046459 Bacteria 2897
496 Ga0495629_0073348 3300046459 Bacteria 2390
497 Ga0495629_0111160 3300046459 Bacteria 1910
498 Ga0495629_1093796 3300046459 Bacteria 515
499 Ga0495638_0020561 3300046460 Bacteria 4360
500 Ga0495638_0049586 3300046460 Bacteria 2625
501 Ga0495638_0180924 3300046460 Bacteria 1203
502 Ga0495638_0216315 3300046460 Bacteria 1073
503 Ga0495638_0234738 3300046460 Bacteria 1018
504 Ga0495641_0159489 3300046461 Bacteria 1009
505 Ga0495651_0000752 3300046462 Bacteria 25055
506 Ga0495651_0000989 3300046462 Bacteria 22069
507 Ga0495651_0001909 3300046462 Bacteria 16139
508 Ga0495651_0187091 3300046462 Bacteria 1460
509 Ga0495651_0741986 3300046462 Bacteria 609
510 Ga0495653_0101896 3300046463 Bacteria 2079
511 Ga0495582_0137865 3300046473 Bacteria 1381
512 Ga0495582_0286255 3300046473 Bacteria 947
513 Ga0495605_0016690 3300046474 Bacteria 3970
514 Ga0495662_0000804 3300046476 Bacteria 15227
515 Ga0495662_0018436 3300046476 Bacteria 3378
516 Ga0495664_0001534 3300046477 Bacteria 12218
517 Ga0495664_0054271 3300046477 Bacteria 2383
518 Ga0495664_0763251 3300046477 Bacteria 569
519 Ga0495584_0024076 3300046491 Bacteria 3087
520 Ga0495585_0010037 3300046492 Bacteria 5656
521 Ga0495585_0056404 3300046492 Bacteria 2169
522 Ga0495585_0057137 3300046492 Bacteria 2154
523 Ga0495585_0114767 3300046492 Bacteria 1429
524 Ga0495585_0183403 3300046492 Bacteria 1075
525 Ga0495594_0001615 3300046499 Bacteria 11732
526 Ga0495594_0038933 3300046499 Bacteria 2597
527 Ga0495594_0053658 3300046499 Bacteria 2220
528 Ga0495594_0108551 3300046499 Bacteria 1564
529 Ga0495596_0097190 3300046500 Bacteria 1143
530 Ga0495596_0137373 3300046500 Bacteria 949
531 Ga0495607_0035092 3300046501 Bacteria 3037
532 Ga0495607_0073669 3300046501 Bacteria 1897
533 Ga0495583_0121650 3300046506 Bacteria 1098
534 Ga0495583_0178411 3300046506 Bacteria 870
535 Ga0495606_0021860 3300046507 Bacteria 4678
536 Ga0495608_0280901 3300046511 Bacteria 1033
537 Ga0495610_0050106 3300046512 Bacteria 2040
538 Ga0495616_0003394 3300046513 Bacteria 10209
539 Ga0495620_0011476 3300046515 Bacteria 4621
540 Ga0495628_0001200 3300046516 Bacteria 23680
541 Ga0495628_0183377 3300046516 Bacteria 1582
542 Ga0495628_0369201 3300046516 Bacteria 1052
543 Ga0495628_0885675 3300046516 Bacteria 620
544 Ga0495630_0005265 3300046517 Bacteria 9127
545 Ga0495630_0225832 3300046517 Bacteria 1430
546 Ga0495630_0254616 3300046517 Bacteria 1341
547 Ga0495631_0046728 3300046518 Bacteria 1902
548 Ga0495631_0058036 3300046518 Bacteria 1683
549 Ga0495631_0145178 3300046518 Bacteria 1018
550 Ga0495631_0331775 3300046518 Bacteria 647
551 Ga0495632_0329541 3300046519 Bacteria 673
552 Ga0495637_0034789 3300046520 Bacteria 2204
553 Ga0495637_0112670 3300046520 Bacteria 1053
554 Ga0495643_0001610 3300046522 Bacteria 19994
555 Ga0495643_0002300 3300046522 Bacteria 15428
556 Ga0495643_0305890 3300046522 Bacteria 723
557 Ga0495644_0091979 3300046523 Bacteria 1145
558 Ga0495644_0121416 3300046523 Bacteria 994
559 Ga0495648_0066584 3300046524 Bacteria 2111
560 Ga0495648_0192116 3300046524 Bacteria 1029
561 Ga0495666_0047319 3300046526 Bacteria 2071
562 Ga0495666_0162104 3300046526 Bacteria 1037
563 Ga0495666_0176513 3300046526 Bacteria 987
564 Ga0495642_0048827 3300046528 Bacteria 1737
565 Ga0495652_0000586 3300046529 Bacteria 42555
566 Ga0495652_0002867 3300046529 Bacteria 17391
567 Ga0495652_0020630 3300046529 Bacteria 5857
568 Ga0495652_0239473 3300046529 Bacteria 1351
569 Ga0495652_0429479 3300046529 Bacteria 929
570 Ga0495654_0033076 3300046530 Bacteria 2618
571 Ga0495640_0005552 3300046533 Bacteria 10028
572 Ga0495640_0010404 3300046533 Bacteria 7195
573 Ga0495640_0035007 3300046533 Bacteria 3556
574 Ga0495586_0147133 3300046535 Bacteria 1324
575 Ga0495587_0001229 3300046536 Bacteria 16979
576 Ga0495587_0106106 3300046536 Bacteria 1616
577 Ga0495609_0012628 3300046538 Bacteria 4005
578 Ga0495609_0144931 3300046538 Bacteria 1012
579 Ga0495597_0014194 3300046542 Bacteria 3796
580 Ga0495597_0040776 3300046542 Bacteria 2075
581 Ga0495645_0005253 3300046543 Bacteria 8866
582 Ga0495645_0014240 3300046543 Bacteria 5640
583 Ga0495645_0055025 3300046543 Bacteria 2890
584 Ga0495645_0081590 3300046543 Bacteria 2320
585 Ga0495622_0064679 3300046557 Bacteria 1691
586 Ga0495622_0065555 3300046557 Bacteria 1679
587 Ga0495622_0120786 3300046557 Bacteria 1196
588 Ga0495622_0125871 3300046557 Bacteria 1168
589 Ga0495622_0183450 3300046557 Bacteria 938
590 Ga0495622_0335613 3300046557 Bacteria 655
591 Ga0495633_0008493 3300046558 Bacteria 5776
592 Ga0495633_0133167 3300046558 Bacteria 1150
593 Ga0495633_0304652 3300046558 Bacteria 724
594 Ga0495667_0350488 3300046559 Bacteria 932
595 Ga0495668_0042882 3300046616 Bacteria 2518
596 Ga0495668_0137291 3300046616 Bacteria 1338
597 Ga0495634_0001818 3300046642 Bacteria 18414
598 Ga0495634_0045317 3300046642 Bacteria 2974
599 Ga0495634_0088769 3300046642 Bacteria 2010
600 Ga0495611_0013050 3300046648 Bacteria 3533
601 Ga0495611_0036490 3300046648 Bacteria 2181
602 Ga0495611_0053131 3300046648 Bacteria 1828
603 Ga0495625_0021558 3300046660 Bacteria 4958
604 Ga0495625_0035084 3300046660 Bacteria 3698
605 Ga0495625_0152743 3300046660 Bacteria 1551
606 Ga0495625_0744739 3300046660 Bacteria 575
607 Ga0495635_0000586 3300046663 Bacteria 23438
608 Ga0495635_0003044 3300046663 Bacteria 11523
609 Ga0495635_0098026 3300046663 Bacteria 2004
610 Ga0495659_0304416 3300046664 Bacteria 674
611 Ga0495661_0017649 3300046665 Bacteria 4709
612 Ga0495661_0302359 3300046665 Bacteria 800
613 Ga0495588_0013636 3300046674 Bacteria 3873
614 Ga0495588_0016192 3300046674 Bacteria 3600
615 Ga0495588_0031500 3300046674 Bacteria 2669
616 Ga0495588_0188139 3300046674 Bacteria 1090
617 Ga0495657_0000796 3300046675 Bacteria 28012
618 Ga0495657_0023246 3300046675 Bacteria 4430
619 Ga0495657_0237580 3300046675 Bacteria 1100
620 Ga0495657_0693902 3300046675 Bacteria 585
621 Ga0495599_0112865 3300046678 Bacteria 1692
622 Ga0495599_0262766 3300046678 Bacteria 1048
623 Ga0495623_0029613 3300046679 Bacteria 3523
624 Ga0495623_0205831 3300046679 Bacteria 1129
625 Ga0495623_0298730 3300046679 Bacteria 890
626 Ga0495646_0002293 3300046680 Bacteria 11696
627 Ga0495646_0027540 3300046680 Bacteria 3565
628 Ga0495646_0201664 3300046680 Bacteria 1083
629 Ga0495646_0306774 3300046680 Bacteria 838
630 Ga0495658_0049798 3300046683 Bacteria 2367
631 Ga0495658_0057579 3300046683 Bacteria 2220
632 Ga0495613_0002324 3300046689 Bacteria 14400
633 Ga0495613_0025321 3300046689 Bacteria 4421
634 Ga0495613_0079557 3300046689 Bacteria 2383
635 Ga0495613_0120711 3300046689 Bacteria 1882
636 Ga0495613_0171071 3300046689 Bacteria 1542
637 Ga0495613_0234335 3300046689 Bacteria 1285
638 Ga0495624_0088479 3300046690 Bacteria 1912
639 Ga0495624_0104000 3300046690 Bacteria 1747
640 Ga0495670_0039497 3300046691 Bacteria 2354
641 Ga0495670_0165579 3300046691 Bacteria 1163
642 Ga0495670_0361067 3300046691 Bacteria 782
643 Ga0495671_0003815 3300046692 Bacteria 9165
644 Ga0495649_0054498 3300046694 Bacteria 2162
645 Ga0495649_0110071 3300046694 Bacteria 1461
646 Ga0495589_0006450 3300046794 Bacteria 6186
647 Ga0495589_0033221 3300046794 Bacteria 2592
648 Ga0495589_0048666 3300046794 Bacteria 2098
649 Ga0495589_0078242 3300046794 Bacteria 1610
650 Ga0495600_0001390 3300046809 Bacteria 13370
651 Ga0495600_0003691 3300046809 Bacteria 9041
652 Ga0495600_0006527 3300046809 Bacteria 7099
653 Ga0495600_0043331 3300046809 Bacteria 2935
654 Ga0495600_0052676 3300046809 Bacteria 2657
655 Ga0495660_0035201 3300046810 Bacteria 2799
656 Ga0495581_0004218 3300047315 Bacteria 8283
657 Ga0495581_0051070 3300047315 Bacteria 2388
658 Ga0495581_0106775 3300047315 Bacteria 1627
659 Ga0495581_0180188 3300047315 Bacteria 1235
660 Ga0495604_0000695 3300047317 Bacteria 28567
661 Ga0495604_0004263 3300047317 Bacteria 11322
662 Ga0495604_0031309 3300047317 Bacteria 4220
663 Ga0495604_0079704 3300047317 Bacteria 2455
664 Ga0495604_0372664 3300047317 Bacteria 945
665 Ga0495636_0002781 3300047318 Bacteria 6752
666 Ga0495636_0007046 3300047318 Bacteria 4422
667 Ga0495636_0022839 3300047318 Bacteria 2531
668 Ga0495636_0045118 3300047318 Bacteria 1837
669 Ga0495636_0065687 3300047318 Bacteria 1541
670 Ga0495674_0256906 3300047319 Bacteria 1436
671 Ga0495672_0028599 3300047320 Bacteria 3523
672 Ga0495676_0007640 3300047321 Bacteria 9915
673 Ga0495676_0009942 3300047321 Bacteria 8642
674 Ga0495676_0028414 3300047321 Bacteria 4775
675 Ga0495680_0096193 3300047322 Bacteria 2212
676 Ga0495683_0019687 3300047323 Bacteria 3483
677 Ga0495683_0083660 3300047323 Bacteria 1553
678 Ga0495683_0090897 3300047323 Bacteria 1479
679 Ga0495687_003278 3300047443 Bacteria 11919
680 Ga0495687_005559 3300047443 Bacteria 7993
681 Ga0495687_019035 3300047443 Bacteria 3379
682 Ga0495687_020827 3300047443 Bacteria 3188
683 Ga0495675_0068124 3300047444 Bacteria 2248
684 Ga0495675_0366072 3300047444 Bacteria 845
685 Ga0495675_0550835 3300047444 Bacteria 658
686 Ga0495677_0068192 3300047445 Bacteria 1324
687 Ga0495677_0304151 3300047445 Bacteria 627
688 Ga0495679_036338 3300047446 Bacteria 1556
689 Ga0495679_045759 3300047446 Bacteria 1335
690 Ga0495685_001698 3300047447 Bacteria 6783
691 Ga0495685_007252 3300047447 Bacteria 3656
692 Ga0495685_007505 3300047447 Bacteria 3602
693 Ga0495685_010371 3300047447 Bacteria 3123
694 Ga0495685_012966 3300047447 Bacteria 2826
695 Ga0495673_0130076 3300047469 Bacteria 990
696 Ga0495681_0000484 3300047470 Bacteria 30579
697 Ga0495681_0362849 3300047470 Bacteria 548
698 Ga0495684_0017005 3300047471 Bacteria 5604
699 Ga0495684_0316784 3300047471 Bacteria 1116
700 Ga0495686_0012981 3300047472 Bacteria 5804
701 Ga0495686_0017187 3300047472 Bacteria 4881
702 Ga0495686_0058569 3300047472 Bacteria 2401
703 Ga0495593_0001318 3300047673 Bacteria 14549
704 Ga0495593_0033161 3300047673 Bacteria 2813
705 Ga0495602_0048486 3300048088 Bacteria 3816
706 Ga0495602_0741135 3300048088 Bacteria 664
707 Ga0495614_0000529 3300048089 Bacteria 15758
708 Ga0495614_0001808 3300048089 Bacteria 9365
709 Ga0495614_0059165 3300048089 Bacteria 1646
710 Ga0495614_0318058 3300048089 Bacteria 721
711 Ga0495614_0580472 3300048089 Bacteria 537
712 Ga0495626_0063393 3300048091 Bacteria 1677
713 Ga0496102_0833904 3300048905 Bacteria 844
714 Ga0496104_0344186 3300048907 Bacteria 1404
715 Ga0496104_1718297 3300048907 Bacteria 530
716 Ga0496105_0482043 3300048908 Bacteria 976
717 Ga0496106_0339334 3300048909 Bacteria 1207
718 Ga0496108_0077340 3300048911 Bacteria 2814
719 Ga0496111_0185931 3300048914 Bacteria 1545
720 Ga0496113_0200630 3300048916 Bacteria 1586
721 Ga0496113_1404487 3300048916 Bacteria 541
722 Ga0496126_0030170 3300048929 Bacteria 5141
723 Ga0496126_1038570 3300048929 Bacteria 612
724 Ga0501306_051309 3300049127 Bacteria 662
725 Ga0501308_038226 3300049128 Bacteria 668
726 Ga0501309_099916 3300049129 Bacteria 502
727 Ga0501304_023281 3300049160 Bacteria 626
728 Ga0501305_106765 3300049161 Bacteria 526
729 Ga0501307_063577 3300049162 Bacteria 577
730 Ga0495678_056769 3300049459 Bacteria 1486
731 Ga0495682_0065758 3300049460 Bacteria 1307
732 Ga0501315_069559 3300049531 Bacteria 582
733 Ga0501031_0007283 3300049568 Bacteria 7221
734 Ga0501031_0021237 3300049568 Bacteria 4233
735 Ga0501031_0033610 3300049568 Bacteria 3346
736 Ga0501031_0168019 3300049568 Bacteria 1433
737 Ga0501031_0419558 3300049568 Bacteria 865
738 Ga0501032_0001990 3300049569 Bacteria 16091
739 Ga0501032_0039760 3300049569 Bacteria 3198
740 Ga0501032_0042190 3300049569 Bacteria 3095
741 Ga0501032_0046767 3300049569 Bacteria 2924
742 Ga0501032_0098405 3300049569 Bacteria 1938
743 Ga0501032_0292053 3300049569 Bacteria 1055
744 Ga0501032_0330186 3300049569 Bacteria 983
745 Ga0501033_0009919 3300049570 Bacteria 7312
746 Ga0501033_0030574 3300049570 Bacteria 4046
747 Ga0501033_0092653 3300049570 Bacteria 2209
748 Ga0501033_0152049 3300049570 Bacteria 1669
749 Ga0501033_0174966 3300049570 Bacteria 1540
750 Ga0501033_0240627 3300049570 Bacteria 1284
751 Ga0501033_0444803 3300049570 Bacteria 901
752 Ga0501034_0005363 3300049571 Bacteria 14038
753 Ga0501034_0005698 3300049571 Bacteria 13538
754 Ga0501034_0018502 3300049571 Bacteria 7143
755 Ga0501034_0060680 3300049571 Bacteria 3798
756 Ga0501034_0089866 3300049571 Bacteria 3069
757 Ga0501034_0097780 3300049571 Bacteria 2931
758 Ga0501034_0151625 3300049571 Bacteria 2293
759 Ga0501034_0510163 3300049571 Bacteria 1115
760 Ga0501034_0959366 3300049571 Bacteria 740
761 Ga0501034_1089096 3300049571 Bacteria 680
762 Ga0501036_0000553 3300049572 Bacteria 26858
763 Ga0501036_0010697 3300049572 Bacteria 7584
764 Ga0501036_0023104 3300049572 Bacteria 5234
765 Ga0501036_0032873 3300049572 Bacteria 4386
766 Ga0501036_0051941 3300049572 Bacteria 3471
767 Ga0501036_0087173 3300049572 Bacteria 2639
768 Ga0501036_0298239 3300049572 Bacteria 1348
769 Ga0501036_0557796 3300049572 Bacteria 951
770 Ga0501037_0002550 3300049573 Bacteria 13171
771 Ga0501037_0030551 3300049573 Bacteria 3981
772 Ga0501037_0050338 3300049573 Bacteria 3049
773 Ga0501037_0072793 3300049573 Unclassified 2499
774 Ga0501037_0155175 3300049573 Bacteria 1634
775 Ga0501037_0217993 3300049573 Bacteria 1343
776 Ga0501037_0228775 3300049573 Bacteria 1306
777 Ga0501038_0002207 3300049574 Bacteria 18105
778 Ga0501038_0005677 3300049574 Bacteria 11575
779 Ga0501038_0014436 3300049574 Bacteria 7200
780 Ga0501038_0014677 3300049574 Bacteria 7139
781 Ga0501038_0061328 3300049574 Bacteria 3216
782 Ga0501038_0070220 3300049574 Bacteria 2974
783 Ga0501038_0149106 3300049574 Bacteria 1908
784 Ga0501038_0390960 3300049574 Bacteria 1077
785 Ga0501038_0393492 3300049574 Bacteria 1073
786 Ga0501039_0002645 3300049575 Bacteria 13380
787 Ga0501039_0015464 3300049575 Bacteria 5842
788 Ga0501039_0032315 3300049575 Bacteria 4034
789 Ga0501039_0830449 3300049575 Bacteria 720
790 Ga0501039_1356548 3300049575 Bacteria 548
791 Ga0501040_0040801 3300049576 Bacteria 3159
792 Ga0501040_0890790 3300049576 Bacteria 644
793 Ga0501040_0929819 3300049576 Bacteria 630
794 Ga0501041_0000849 3300049577 Bacteria 16447
795 Ga0501041_0561274 3300049577 Bacteria 728
796 Ga0501042_0001880 3300049578 Bacteria 12601
797 Ga0501042_0028160 3300049578 Bacteria 3955
798 Ga0501042_0196332 3300049578 Bacteria 1455
799 Ga0501042_0391904 3300049578 Bacteria 1006
800 Ga0501042_1201338 3300049578 Bacteria 553
801 Ga0501043_0005890 3300049579 Bacteria 9861
802 Ga0501043_0009787 3300049579 Bacteria 7513
803 Ga0501043_0020943 3300049579 Bacteria 5127
804 Ga0501043_0119835 3300049579 Bacteria 2063
805 Ga0501043_0146961 3300049579 Bacteria 1845
806 Ga0501043_0290415 3300049579 Bacteria 1252
807 Ga0501043_0299692 3300049579 Bacteria 1228
808 Ga0501043_0822591 3300049579 Bacteria 670
809 Ga0501046_0005490 3300049580 Bacteria 11326
810 Ga0501046_0042485 3300049580 Bacteria 3624
811 Ga0501046_0095304 3300049580 Bacteria 2286
812 Ga0501046_0281545 3300049580 Bacteria 1218
813 Ga0501046_0295582 3300049580 Bacteria 1184
814 Ga0501047_0005878 3300049581 Bacteria 11545
815 Ga0501047_0013772 3300049581 Bacteria 7681
816 Ga0501047_0017015 3300049581 Bacteria 6951
817 Ga0501047_0023366 3300049581 Bacteria 5936
818 Ga0501047_0023815 3300049581 Bacteria 5878
819 Ga0501047_0041485 3300049581 Bacteria 4447
820 Ga0501047_0051699 3300049581 Bacteria 3971
821 Ga0501047_0071007 3300049581 Bacteria 3352
822 Ga0501047_0150227 3300049581 Bacteria 2206
823 Ga0501047_0346521 3300049581 Bacteria 1322
824 Ga0501047_1164544 3300049581 Bacteria 584
825 Ga0501048_0002755 3300049582 Bacteria 13406
826 Ga0501048_0025711 3300049582 Bacteria 4288
827 Ga0501048_0291714 3300049582 Bacteria 1160
828 Ga0501048_0357085 3300049582 Bacteria 1042
829 Ga0501048_0412883 3300049582 Bacteria 965
830 Ga0501048_0494157 3300049582 Bacteria 877
831 Ga0501048_0750068 3300049582 Bacteria 701
832 Ga0501067_0007326 3300049583 Bacteria 6128
833 Ga0501067_0711021 3300049583 Bacteria 565
834 Ga0501068_0062071 3300049584 Bacteria 2271
835 Ga0501068_0108969 3300049584 Bacteria 1721
836 Ga0501069_0038843 3300049585 Bacteria 2628
837 Ga0501069_0111469 3300049585 Bacteria 1558
838 Ga0501070_0000903 3300049586 Bacteria 27034
839 Ga0501070_0188761 3300049586 Bacteria 1694
840 Ga0501070_0272252 3300049586 Bacteria 1382
841 Ga0501070_0420523 3300049586 Bacteria 1079
842 Ga0501070_0599222 3300049586 Bacteria 878
843 Ga0501071_0001385 3300049587 Bacteria 13892
844 Ga0501071_0152106 3300049587 Bacteria 1727
845 Ga0501071_0999195 3300049587 Bacteria 646
846 Ga0501071_1085438 3300049587 Bacteria 618
847 Ga0501072_0017666 3300049588 Bacteria 5485
848 Ga0501072_0379948 3300049588 Bacteria 1121
849 Ga0501072_1194013 3300049588 Bacteria 591
850 Ga0501073_0154658 3300049589 Bacteria 1589
851 Ga0501073_0401518 3300049589 Bacteria 947
852 Ga0501073_1272372 3300049589 Bacteria 504
853 Ga0501074_0000685 3300049590 Bacteria 21150
854 Ga0501074_0206939 3300049590 Bacteria 1398
855 Ga0501074_0210669 3300049590 Bacteria 1384
856 Ga0501074_0513327 3300049590 Bacteria 849
857 Ga0501075_0640712 3300049591 Bacteria 810
858 Ga0501076_0016555 3300049592 Bacteria 5589
859 Ga0501076_0312388 3300049592 Bacteria 1289
860 Ga0501077_0081465 3300049593 Bacteria 2050
861 Ga0501077_0094327 3300049593 Bacteria 1897
862 Ga0501077_0400452 3300049593 Bacteria 877
863 Ga0501202_057607 3300049652 Bacteria 872
864 Ga0501223_076749 3300049663 Bacteria 665
865 Ga0501079_0032385 3300049741 Bacteria 4018
866 Ga0501079_0425238 3300049741 Bacteria 1043
867 Ga0501080_0107698 3300049742 Bacteria 2583
868 Ga0501080_0861550 3300049742 Bacteria 791
869 Ga0501081_0100340 3300049743 Bacteria 2046
870 Ga0501083_0211714 3300049744 Bacteria 1263
871 Ga0501083_0290317 3300049744 Bacteria 1064
872 Ga0501264_020435 3300049761 Bacteria 700
873 Ga0501282_013501 3300049778 Bacteria 885
874 Ga0501035_0002519 3300049822 Bacteria 17915
875 Ga0501035_0004257 3300049822 Bacteria 13582
876 Ga0501035_0022434 3300049822 Bacteria 5797
877 Ga0501035_0029012 3300049822 Bacteria 5047
878 Ga0501035_0032276 3300049822 Bacteria 4765
879 Ga0501035_0105598 3300049822 Bacteria 2469
880 Ga0501035_0131465 3300049822 Bacteria 2182
881 Ga0501035_0205013 3300049822 Bacteria 1689
882 Ga0501035_0256618 3300049822 Bacteria 1483
883 Ga0501035_0789146 3300049822 Bacteria 759
884 Ga0501044_0007347 3300049823 Bacteria 12111
885 Ga0501044_0009230 3300049823 Bacteria 10770
886 Ga0501044_0012456 3300049823 Bacteria 9210
887 Ga0501044_0021769 3300049823 Bacteria 6836
888 Ga0501044_0023137 3300049823 Bacteria 6613
889 Ga0501044_0038017 3300049823 Bacteria 5027
890 Ga0501044_0080660 3300049823 Bacteria 3295
891 Ga0501044_0282609 3300049823 Bacteria 1592
892 Ga0501044_0667963 3300049823 Bacteria 927
893 Ga0501045_0015881 3300049824 Bacteria 5340
894 Ga0501045_0048873 3300049824 Bacteria 3083
895 Ga0501045_0303559 3300049824 Bacteria 1188
896 Ga0501045_0338954 3300049824 Bacteria 1119
897 nmdc:mga0yw44_606416_c1 3300050492 Bacteria 744
898 nmdc:mga0yw44_996525_c1 3300050492 Bacteria 567
899 nmdc:mga06z11_759715_c1 3300050494 Bacteria 591
900 nmdc:mga06z11_8290_c1 3300050494 Bacteria 4325
901 nmdc:mga04h51_28168_c1 3300050495 Bacteria 1751
902 nmdc:mga07m45_415360_c1 3300050496 Bacteria 781
903 nmdc:mga08x19_512198_c1 3300050514 Bacteria 847
904 Ga0495601_0012919 3300053077 Bacteria 5014
905 Ga0495601_0222963 3300053077 Bacteria 1231
906 Ga0495601_0530919 3300053077 Bacteria 758
907 Ga0495612_0003333 3300053078 Bacteria 6657
908 Ga0495612_0011773 3300053078 Bacteria 3525
909 Ga0495612_0522533 3300053078 Bacteria 545
910 Ga0500610_0232357 3300053079 Bacteria 864
911 Ga0495619_0122367 3300053085 Bacteria 1784
912 Ga0495619_0211454 3300053085 Bacteria 1343
913 Ga0495619_0693378 3300053085 Bacteria 693
914 Ga0500578_0137294 3300053086 Bacteria 1530
915 Ga0500644_0014989 3300053088 Bacteria 2199
916 Ga0500644_0019832 3300053088 Bacteria 1990
917 Ga0500583_0495849 3300053092 Bacteria 574
918 Ga0500566_0047067 3300053094 Bacteria 2476
919 Ga0500640_006196 3300053095 Bacteria 4541
920 Ga0500650_0099354 3300053098 Bacteria 1362
921 Ga0500654_088991 3300053099 Bacteria 1388
922 Ga0500660_241757 3300053100 Bacteria 566
923 Ga0500556_0054793 3300053104 Bacteria 1453
924 Ga0500558_121645 3300053106 Bacteria 1010
925 Ga0500560_005308 3300053107 Bacteria 2840
926 Ga0500569_002482 3300053109 Bacteria 3641
927 Ga0500607_093798 3300053121 Bacteria 1505
928 Ga0500614_014576 3300053123 Bacteria 1743
929 Ga0500621_104158 3300053126 Bacteria 1116
930 Ga0500628_048126 3300053129 Bacteria 1001
931 Ga0500652_009284 3300053131 Bacteria 3319
932 Ga0500652_282806 3300053131 Bacteria 647
933 Ga0500658_0003289 3300053134 Bacteria 6131
934 Ga0500559_0144810 3300053136 Bacteria 1114
935 Ga0500559_0381026 3300053136 Bacteria 658
936 Ga0500561_0000719 3300053137 Bacteria 5258
937 Ga0500573_0004777 3300053140 Bacteria 7175
938 Ga0500573_0025166 3300053140 Bacteria 3422
939 Ga0500573_0143800 3300053140 Bacteria 1311
940 Ga0500577_0167810 3300053142 Bacteria 937
941 Ga0500579_033415 3300053143 Bacteria 3289
942 Ga0500600_0022644 3300053149 Bacteria 3759
943 Ga0500600_0193322 3300053149 Bacteria 966
944 Ga0500603_159476 3300053150 Bacteria 703
945 Ga0500616_0019242 3300053153 Bacteria 3849
946 Ga0500633_0000323 3300053160 Bacteria 7116
947 Ga0500633_0167843 3300053160 Bacteria 824
948 Ga0500634_0050684 3300053161 Bacteria 2235
949 Ga0500636_0491563 3300053177 Bacteria 544
950 Ga0500637_0417640 3300053178 Unclassified 691
951 Ga0500656_001749 3300053732 Bacteria 1904
952 Ga0500587_005962 3300053739 Bacteria 1628
953 Ga0501084_0020844 3300054114 Bacteria 5466
954 Ga0501084_0085233 3300054114 Bacteria 2652
955 Ga0590075_029891 3300059424 Bacteria 1379
956 Ga0587073_0157947 3300059492 Bacteria 647
957 Ga0587088_135006 3300059508 Bacteria 584
958 Ga0587089_114224 3300059509 Bacteria 501
959 Ga0587091_236711 3300059511 Bacteria 506
960 Ga0587092_086480 3300059512 Bacteria 627
961 Ga0587098_064776 3300059604 Bacteria 581
962 Ga0587106_008852 3300059605 Bacteria 1266
963 Ga0587106_071356 3300059605 Bacteria 658
964 Ga0587125_065590 3300059607 Bacteria 539
965 Ga0587115_117074 3300059626 Bacteria 509
966 Ga0587122_022878 3300059628 Bacteria 692
967 Ga0587062_073449 3300059639 Bacteria 623
968 Ga0587067_055686 3300059640 Bacteria 814
969 Ga0587068_142120 3300059641 Bacteria 537
970 Ga0587072_184510 3300059643 Bacteria 522
971 Ga0587075_152803 3300059644 Bacteria 501
972 Ga0587107_102603 3300059652 Bacteria 568
973 Ga0587108_031698 3300059653 Bacteria 542
974 Ga0587111_0124372 3300060346 Bacteria 668
975 Ga0587111_0182248 3300060346 Bacteria 585
976 Ga0501082_0014461 3300060353 Bacteria 6793
977 Ga0501082_0153158 3300060353 Bacteria 2003
978 Ga0466962_0000572 3300061719 Bacteria 16176
979 Ga0466962_0000635 3300061719 Bacteria 15613
980 Ga0466962_0052208 3300061719 Bacteria 1954
981 Ga0466962_0055762 3300061719 Bacteria 1888
982 Ga0466962_0132716 3300061719 Bacteria 1204
983 Ga0466962_0220632 3300061719 Archaea 929
984 Ga0466962_0236502 3300061719 Bacteria 896
985 Ga0466962_0266643 3300061719 Bacteria 843
986 Ga0530510_0030267 3300061734 Bacteria 3888
987 Ga0530510_0187467 3300061734 Bacteria 1535
988 Ga0530510_0382341 3300061734 Bacteria 1060

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0062623 Ga0466969_0062623_466_804 111
2 3300044684 Ga0466966_0119917 Ga0466966_0119917_908_1246 111
3 3300044693 Ga0466961_0013999 Ga0466961_0013999_2681_3019 111
4 3300044765 Ga0466970_0254963 Ga0466970_0254963_188_526 111
5 3300045049 Ga0466959_0004032 Ga0466959_0004032_1094_1432 111
6 3300045836 Ga0466958_0310163 Ga0466958_0310163_415_753 111
7 3300006175 Ga0070712_101296475 Ga0070712_1012964752 115
8 3300046558 Ga0495633_0304652 Ga0495633_0304652_144_497 115
9 3300047323 Ga0495683_0090897 Ga0495683_0090897_1092_1457 119
10 3300005435 Ga0070714_100652588 Ga0070714_1006525882 120
11 3300025929 Ga0207664_10893585 Ga0207664_108935852 120
12 iso_pu_bacteria 3002998708 3003007422 122
13 iso_pu_bacteria 2547132111 2547408389 124
14 iso_pu_bacteria 2582581312 2585296615 124
15 iso_pu_bacteria 2582581313 2585309058 124
16 iso_pu_bacteria 2582581314 2585319248 124
17 iso_pu_bacteria 2616644814 2616697300 124
18 iso_pu_bacteria 2616644941 2616903244 124
19 iso_pu_bacteria 2643221548 2643764022 124
20 iso_pu_bacteria 2643221578 2643902257 124
21 iso_pu_bacteria 2643221587 2643943916 124
22 iso_pu_bacteria 2643221647 2644265806 124
23 iso_pu_bacteria 2643221670 2644386900 124
24 iso_pu_bacteria 2643221673 2644403828 124
25 iso_pu_bacteria 2643221677 2644434653 124
26 iso_pu_bacteria 2643221678 2644440053 124
27 iso_pu_bacteria 2643221682 2644461545 124
28 iso_pu_bacteria 2643221714 2644632622 124
29 iso_pu_bacteria 2784132148 2784590416 124
30 iso_pu_bacteria 2784746763 2785341199 124
31 iso_pu_bacteria 2784746768 2785371504 124
32 iso_pu_bacteria 2786546132 2786672662 124
33 iso_pu_bacteria 2791355406 2793985230 124
34 iso_pu_bacteria 2802429296 2804847905 124
35 iso_pu_bacteria 2808606359 2808844031 124
36 iso_pu_bacteria 2808606375 2808913627 124
37 iso_pu_bacteria 2808606448 2809234089 124
38 iso_pu_bacteria 2808606982 2811844410 124
39 iso_pu_bacteria 2811994879 2812355940 124
40 iso_pu_bacteria 2811994917 2812478749 124
41 iso_pu_bacteria 2818991463 2819694626 124
42 iso_pu_bacteria 2852635781 2852641024 124
43 iso_pu_bacteria 2862178590 2862186415 124
44 iso_pu_bacteria 2862281513 2862284744 124
45 iso_pu_bacteria 2862290372 2862293496 124
46 iso_pu_bacteria 2862382967 2862390430 124
47 iso_pu_bacteria 2862507626 2862512675 124
48 iso_pu_bacteria 2862574272 2862577505 124
49 iso_pu_bacteria 2862705112 2862710925 124
50 iso_pu_bacteria 2863404153 2863408619 124
51 iso_pu_bacteria 2867346516 2867349163 124
52 iso_pu_bacteria 2867369537 2867373873 124
53 iso_pu_bacteria 2867428634 2867436324 124
54 iso_pu_bacteria 2867475112 2867476800 124
55 iso_pu_bacteria 2873151551 2873154051 124
56 iso_pu_bacteria 2875391855 2875396696 124
57 iso_pu_bacteria 2877676314 2877679102 124
58 iso_pu_bacteria 2912715099 2912717614 124
59 iso_pu_bacteria 2912723979 2912730154 124
60 iso_pu_bacteria 2912757875 2912762755 124
61 iso_pu_bacteria 2918501144 2918506509 124
62 iso_pu_bacteria 2919468124 2919471736 124
63 iso_pu_bacteria 2935390628 2935395078 124
64 iso_pu_bacteria 2946045630 2946047856 124
65 iso_pu_bacteria 2946064051 2946069847 124
66 iso_pu_bacteria 2946072368 2946077764 124
67 iso_pu_bacteria 2947224130 2947226952 124
68 iso_pu_bacteria 2954002825 2954005471 124
69 iso_pu_bacteria 2954380949 2954384006 124
70 iso_pu_bacteria 2954673503 2954678955 124
71 iso_pu_bacteria 2954682443 2954685197 124
72 iso_pu_bacteria 2954691527 2954694805 124
73 iso_pu_bacteria 2954701450 2954710007 124
74 iso_pu_bacteria 2954711539 2954714314 124
75 iso_pu_bacteria 2954721474 2954724263 124
76 iso_pu_bacteria 2954731030 2954737577 124
77 iso_pu_bacteria 2954740390 2954743160 124
78 iso_pu_bacteria 2954749733 2954756410 124
79 iso_pu_bacteria 2954759201 2954762118 124
80 iso_pu_bacteria 2966598605 2966600860 124
81 iso_pu_bacteria 2990044586 2990046174 124
82 iso_pu_bacteria 2990059506 2990062946 124
83 iso_pu_bacteria 2990088156 2990089790 124
84 iso_pu_bacteria 2997451912 2997452867 124
85 iso_pu_bacteria 2997600082 2997606048 124
86 iso_pu_bacteria 3006321560 3006322589 124
87 iso_pu_bacteria 3006425503 3006429893 124
88 iso_pu_bacteria 3006486233 3006490328 124
89 iso_pu_bacteria 3006493962 3006500124 124
90 iso_pu_bacteria 8002784119 8002789007 124
91 iso_pu_bacteria 8008485437 8008491540 124
92 iso_pu_bacteria 8008558824 8008562790 124
93 iso_pu_bacteria 8008574985 8008577164 124
94 iso_pu_bacteria 8023623736 8023627196 124
95 iso_pu_bacteria 8025413630 8025419413 124
96 iso_pu_bacteria 8025524527 8025524596 124
97 iso_pu_bacteria 8025530807 8025531303 124
98 iso_pu_bacteria 8033684223 8033686500 124
99 iso_pu_bacteria 8047893842 8047896101 124
100 iso_pu_bacteria 8048127548 8048132262 124
101 iso_pu_bacteria 8048356638 8048362834 124
102 iso_pu_bacteria 8048369669 8048373126 124
103 iso_pu_bacteria 8048379754 8048382059 124
104 iso_pu_bacteria 8048406513 8048411661 124
105 iso_pu_bacteria 8053945823 8053952302 124
106 iso_pu_bacteria 8054160619 8054163303 124
107 iso_pu_bacteria 8055172936 8055181082 124
108 iso_pu_bacteria 8056054917 8056055097 124
109 iso_pu_bacteria 8056447290 8056453799 124
110 iso_pu_bacteria 8056829672 8056832204 124
111 3300005367 Ga0070667_100030080 Ga0070667_1000300808 126
112 3300005843 Ga0068860_101389325 Ga0068860_1013893251 126
113 3300006163 Ga0070715_10011216 Ga0070715_100112163 126
114 3300025986 Ga0207658_10020850 Ga0207658_100208508 126
115 3300028381 Ga0268264_11202145 Ga0268264_112021451 126
116 3300031507 Ga0307509_10444491 Ga0307509_104444911 126
117 3300044684 Ga0466966_0018275 Ga0466966_0018275_3530_3916 126
118 3300044765 Ga0466970_0635632 Ga0466970_0635632_113_499 126
119 3300045049 Ga0466959_0200536 Ga0466959_0200536_860_1246 126
120 3300046543 Ga0495645_0014240 Ga0495645_0014240_2092_2493 126
121 3300049571 Ga0501034_1089096 Ga0501034_1089096_248_634 126
122 3300049581 Ga0501047_0150227 Ga0501047_0150227_121_507 126
123 3300049581 Ga0501047_1164544 Ga0501047_1164544_71_457 126
124 3300049823 Ga0501044_0667963 Ga0501044_0667963_143_529 126
125 3300003559 Ga0007427J51700_128208 Ga0007427J51700_1282081 127
126 3300006175 Ga0070712_100103005 Ga0070712_1001030052 127
127 3300025915 Ga0207693_10336397 Ga0207693_103363971 127
128 3300025928 Ga0207700_10265550 Ga0207700_102655502 127
129 2088090003 LJN_F6ESG4R02HG44S LJN_02150030 128
130 3300001990 JGI24737J22298_10094530 JGI24737J22298_100945302 128
131 3300002067 JGI24735J21928_10057026 JGI24735J21928_100570261 128
132 3300002075 JGI24738J21930_10027978 JGI24738J21930_100279782 128
133 3300003163 Ga0006759J45824_1023985 Ga0006759J45824_10239851 128
134 3300003203 JGI25406J46586_10008092 JGI25406J46586_100080923 128
135 3300003308 Ga0006777J48905_1041869 Ga0006777J48905_10418691 128
136 3300003308 Ga0006777J48905_1052988 Ga0006777J48905_10529881 128
137 3300003320 rootH2_10038439 rootH2_100384392 128
138 3300003320 rootH2_10038440 rootH2_100384402 128
139 3300003320 rootH2_10115779 rootH2_101157793 128
140 3300003320 rootH2_10134987 rootH2_101349872 128
141 3300003322 rootL2_10015814 rootL2_100158142 128
142 3300003322 rootL2_10015815 rootL2_100158152 128
143 3300003323 rootH1_10005533 rootH1_100055332 128
144 3300003323 rootH1_10005534 rootH1_100055342 128
145 3300003354 JGI25160J50197_1029327 JGI25160J50197_10293272 128
146 3300003574 Ga0007410J51695_1021724 Ga0007410J51695_10217241 128
147 3300003575 Ga0007409J51694_1026987 Ga0007409J51694_10269871 128
148 3300003578 Ga0006562J51391_1014857 Ga0006562J51391_10148571 128
149 3300003579 Ga0007429J51699_1037609 Ga0007429J51699_10376091 128
150 3300003693 Ga0032354_1040524 Ga0032354_10405241 128
151 3300004799 Ga0058863_11440945 Ga0058863_114409451 128
152 3300004799 Ga0058863_11726019 Ga0058863_117260191 128
153 3300004803 Ga0058862_12758211 Ga0058862_127582111 128
154 3300005329 Ga0070683_100632655 Ga0070683_1006326551 128
155 3300005335 Ga0070666_10823944 Ga0070666_108239441 128
156 3300005339 Ga0070660_100196781 Ga0070660_1001967812 128
157 3300005339 Ga0070660_101897774 Ga0070660_1018977741 128
158 3300005367 Ga0070667_100481019 Ga0070667_1004810191 128
159 3300005434 Ga0070709_10155399 Ga0070709_101553991 128
160 3300005434 Ga0070709_10904676 Ga0070709_109046761 128
161 3300005435 Ga0070714_100007466 Ga0070714_1000074663 128
162 3300005435 Ga0070714_100398704 Ga0070714_1003987041 128
163 3300005435 Ga0070714_100474817 Ga0070714_1004748173 128
164 3300005435 Ga0070714_100761519 Ga0070714_1007615191 128
165 3300005435 Ga0070714_102133102 Ga0070714_1021331021 128
166 3300005436 Ga0070713_100109119 Ga0070713_1001091193 128
167 3300005436 Ga0070713_100285818 Ga0070713_1002858182 128
168 3300005436 Ga0070713_101282585 Ga0070713_1012825852 128
169 3300005437 Ga0070710_11266586 Ga0070710_112665861 128
170 3300005439 Ga0070711_100727525 Ga0070711_1007275251 128
171 3300005439 Ga0070711_101507223 Ga0070711_1015072231 128
172 3300005445 Ga0070708_100001822 Ga0070708_10000182215 128
173 3300005445 Ga0070708_100318666 Ga0070708_1003186662 128
174 3300005445 Ga0070708_100853808 Ga0070708_1008538081 128
175 3300005455 Ga0070663_100300651 Ga0070663_1003006512 128
176 3300005458 Ga0070681_10053792 Ga0070681_100537924 128
177 3300005467 Ga0070706_100021707 Ga0070706_1000217077 128
178 3300005467 Ga0070706_100133047 Ga0070706_1001330472 128
179 3300005467 Ga0070706_100507703 Ga0070706_1005077032 128
180 3300005467 Ga0070706_100780091 Ga0070706_1007800911 128
181 3300005468 Ga0070707_100535360 Ga0070707_1005353601 128
182 3300005471 Ga0070698_100044076 Ga0070698_1000440762 128
183 3300005471 Ga0070698_100045313 Ga0070698_1000453135 128
184 3300005471 Ga0070698_100250027 Ga0070698_1002500272 128
185 3300005471 Ga0070698_100594151 Ga0070698_1005941512 128
186 3300005518 Ga0070699_100412515 Ga0070699_1004125152 128
187 3300005539 Ga0068853_100047259 Ga0068853_1000472593 128
188 3300005539 Ga0068853_100054346 Ga0068853_1000543463 128
189 3300005548 Ga0070665_100014993 Ga0070665_1000149932 128
190 3300005548 Ga0070665_100179347 Ga0070665_1001793473 128
191 3300005548 Ga0070665_100471533 Ga0070665_1004715332 128
192 3300005563 Ga0068855_100013371 Ga0068855_1000133713 128
193 3300005563 Ga0068855_102443224 Ga0068855_1024432241 128
194 3300005578 Ga0068854_100058685 Ga0068854_1000586853 128
195 3300005614 Ga0068856_100142964 Ga0068856_1001429641 128
196 3300005614 Ga0068856_100546987 Ga0068856_1005469872 128
197 3300005616 Ga0068852_100071678 Ga0068852_1000716783 128
198 3300005937 Ga0081455_10074548 Ga0081455_100745482 128
199 3300005981 Ga0081538_10000602 Ga0081538_1000060222 128
200 3300005985 Ga0081539_10000177 Ga0081539_10000177158 128
201 3300006028 Ga0070717_10457761 Ga0070717_104577612 128
202 3300006028 Ga0070717_11450355 Ga0070717_114503551 128
203 3300006038 Ga0075365_10413876 Ga0075365_104138761 128
204 3300006038 Ga0075365_10959514 Ga0075365_109595141 128
205 3300006038 Ga0075365_11261057 Ga0075365_112610571 128
206 3300006042 Ga0075368_10011789 Ga0075368_100117891 128
207 3300006048 Ga0075363_100013133 Ga0075363_1000131333 128
208 3300006048 Ga0075363_100418568 Ga0075363_1004185681 128
209 3300006048 Ga0075363_100657769 Ga0075363_1006577691 128
210 3300006051 Ga0075364_10920925 Ga0075364_109209251 128
211 3300006163 Ga0070715_10265494 Ga0070715_102654941 128
212 3300006175 Ga0070712_100263361 Ga0070712_1002633612 128
213 3300006178 Ga0075367_10011939 Ga0075367_100119393 128
214 3300006948 Ga0099826_10090081 Ga0099826_100900812 128
215 3300009011 Ga0105251_10011572 Ga0105251_100115724 128
216 3300009036 Ga0105244_10074219 Ga0105244_100742192 128
217 3300009036 Ga0105244_10448287 Ga0105244_104482871 128
218 3300009092 Ga0105250_10119467 Ga0105250_101194672 128
219 3300009093 Ga0105240_10029108 Ga0105240_100291083 128
220 3300009098 Ga0105245_10120323 Ga0105245_101203232 128
221 3300009098 Ga0105245_10743002 Ga0105245_107430022 128
222 3300009098 Ga0105245_11586482 Ga0105245_115864821 128
223 3300009148 Ga0105243_10178280 Ga0105243_101782803 128
224 3300009174 Ga0105241_10004696 Ga0105241_100046966 128
225 3300009176 Ga0105242_11310203 Ga0105242_113102031 128
226 3300009176 Ga0105242_12280952 Ga0105242_122809521 128
227 3300009177 Ga0105248_11865327 Ga0105248_118653271 128
228 3300009545 Ga0105237_10034889 Ga0105237_100348893 128
229 3300009545 Ga0105237_11387945 Ga0105237_113879451 128
230 3300009545 Ga0105237_12051727 Ga0105237_120517271 128
231 3300009551 Ga0105238_10015709 Ga0105238_100157093 128
232 3300010375 Ga0105239_10106549 Ga0105239_101065493 128
233 3300010375 Ga0105239_10151882 Ga0105239_101518823 128
234 3300010375 Ga0105239_10387042 Ga0105239_103870422 128
235 3300010375 Ga0105239_11234579 Ga0105239_112345791 128
236 3300011119 Ga0105246_10256826 Ga0105246_102568262 128
237 3300011119 Ga0105246_10335098 Ga0105246_103350982 128
238 3300011119 Ga0105246_10534636 Ga0105246_105346361 128
239 3300012490 Ga0157322_1006037 Ga0157322_10060371 128
240 3300013045 Ga0154016_120640 Ga0154016_1206401 128
241 3300013059 Ga0154012_105953 Ga0154012_1059531 128
242 3300013105 Ga0157369_10259557 Ga0157369_102595572 128
243 3300013105 Ga0157369_10354398 Ga0157369_103543982 128
244 3300013105 Ga0157369_10571963 Ga0157369_105719631 128
245 3300013296 Ga0157374_10075017 Ga0157374_100750173 128
246 3300013307 Ga0157372_10465578 Ga0157372_104655782 128
247 3300013307 Ga0157372_10700796 Ga0157372_107007962 128
248 3300013308 Ga0157375_11201230 Ga0157375_112012301 128
249 3300014497 Ga0182008_10003296 Ga0182008_100032969 128
250 3300015261 Ga0182006_1049148 Ga0182006_10491483 128
251 3300015262 Ga0182007_10021380 Ga0182007_100213803 128
252 3300015265 Ga0182005_1049193 Ga0182005_10491932 128
253 3300015688 Ga0183367_1002 Ga0183367_100266 128
254 3300017792 Ga0163161_10337773 Ga0163161_103377732 128
255 3300020069 Ga0197907_10200592 Ga0197907_102005921 128
256 3300020069 Ga0197907_10230676 Ga0197907_102306761 128
257 3300020069 Ga0197907_10704798 Ga0197907_107047981 128
258 3300020069 Ga0197907_10708005 Ga0197907_107080051 128
259 3300020070 Ga0206356_11000058 Ga0206356_110000581 128
260 3300020070 Ga0206356_11607154 Ga0206356_116071541 128
261 3300020075 Ga0206349_1011289 Ga0206349_10112891 128
262 3300020075 Ga0206349_1353168 Ga0206349_13531682 128
263 3300020076 Ga0206355_1522735 Ga0206355_15227351 128
264 3300020076 Ga0206355_1634198 Ga0206355_16341981 128
265 3300020077 Ga0206351_10011824 Ga0206351_100118241 128
266 3300020077 Ga0206351_10405507 Ga0206351_104055071 128
267 3300020077 Ga0206351_10415879 Ga0206351_104158791 128
268 3300020077 Ga0206351_10965487 Ga0206351_109654871 128
269 3300020078 Ga0206352_10222767 Ga0206352_102227671 128
270 3300020078 Ga0206352_10338841 Ga0206352_103388411 128
271 3300020078 Ga0206352_10427184 Ga0206352_104271841 128
272 3300020078 Ga0206352_10962197 Ga0206352_109621972 128
273 3300020078 Ga0206352_11212980 Ga0206352_112129801 128
274 3300020078 Ga0206352_11223151 Ga0206352_112231512 128
275 3300020078 Ga0206352_11302190 Ga0206352_113021901 128
276 3300020080 Ga0206350_10496801 Ga0206350_104968011 128
277 3300020080 Ga0206350_10617434 Ga0206350_106174341 128
278 3300020080 Ga0206350_10854241 Ga0206350_108542411 128
279 3300020080 Ga0206350_11643667 Ga0206350_116436671 128
280 3300020081 Ga0206354_10598026 Ga0206354_105980261 128
281 3300020081 Ga0206354_10676087 Ga0206354_106760871 128
282 3300020081 Ga0206354_10967460 Ga0206354_109674601 128
283 3300020081 Ga0206354_11241012 Ga0206354_112410121 128
284 3300020082 Ga0206353_10176331 Ga0206353_101763311 128
285 3300020082 Ga0206353_10412605 Ga0206353_104126051 128
286 3300020082 Ga0206353_10584668 Ga0206353_105846681 128
287 3300020082 Ga0206353_10786963 Ga0206353_107869632 128
288 3300020082 Ga0206353_11078754 Ga0206353_110787541 128
289 3300020610 Ga0154015_1053415 Ga0154015_10534151 128
290 3300021377 Ga0213874_10054940 Ga0213874_100549402 128
291 3300021388 Ga0213875_10001996 Ga0213875_100019969 128
292 3300022467 Ga0224712_10121282 Ga0224712_101212821 128
293 3300022467 Ga0224712_10238402 Ga0224712_102384021 128
294 3300022467 Ga0224712_10253202 Ga0224712_102532021 128
295 3300022467 Ga0224712_10598646 Ga0224712_105986461 128
296 3300022467 Ga0224712_10617934 Ga0224712_106179341 128
297 3300022467 Ga0224712_10640531 Ga0224712_106405311 128
298 3300025273 Ga0209673_1070969 Ga0209673_10709692 128
299 3300025297 Ga0209758_1008145 Ga0209758_10081452 128
300 3300025302 Ga0207426_1001450 Ga0207426_10014508 128
301 3300025302 Ga0207426_1025097 Ga0207426_10250972 128
302 3300025302 Ga0207426_1034160 Ga0207426_10341602 128
303 3300025302 Ga0207426_1038839 Ga0207426_10388392 128
304 3300025321 Ga0207656_10729185 Ga0207656_107291851 128
305 3300025711 Ga0207696_1064574 Ga0207696_10645742 128
306 3300025735 Ga0207713_1054939 Ga0207713_10549392 128
307 3300025901 Ga0207688_10373228 Ga0207688_103732281 128
308 3300025903 Ga0207680_10691276 Ga0207680_106912761 128
309 3300025904 Ga0207647_10003737 Ga0207647_100037378 128
310 3300025904 Ga0207647_10015250 Ga0207647_100152505 128
311 3300025905 Ga0207685_10115157 Ga0207685_101151572 128
312 3300025906 Ga0207699_10134114 Ga0207699_101341143 128
313 3300025908 Ga0207643_10753530 Ga0207643_107535301 128
314 3300025910 Ga0207684_10047679 Ga0207684_100476791 128
315 3300025910 Ga0207684_10112199 Ga0207684_101121992 128
316 3300025911 Ga0207654_10039292 Ga0207654_100392923 128
317 3300025912 Ga0207707_10012054 Ga0207707_100120548 128
318 3300025913 Ga0207695_10010754 Ga0207695_100107547 128
319 3300025914 Ga0207671_10004875 Ga0207671_100048757 128
320 3300025914 Ga0207671_10673415 Ga0207671_106734151 128
321 3300025914 Ga0207671_11563059 Ga0207671_115630591 128
322 3300025915 Ga0207693_10250350 Ga0207693_102503502 128
323 3300025919 Ga0207657_10418932 Ga0207657_104189321 128
324 3300025919 Ga0207657_11074365 Ga0207657_110743651 128
325 3300025922 Ga0207646_10413441 Ga0207646_104134411 128
326 3300025924 Ga0207694_10007071 Ga0207694_100070715 128
327 3300025924 Ga0207694_10428848 Ga0207694_104288481 128
328 3300025927 Ga0207687_10073268 Ga0207687_100732683 128
329 3300025927 Ga0207687_10514744 Ga0207687_105147441 128
330 3300025927 Ga0207687_11359671 Ga0207687_113596711 128
331 3300025928 Ga0207700_10027338 Ga0207700_100273384 128
332 3300025928 Ga0207700_10030939 Ga0207700_100309392 128
333 3300025928 Ga0207700_10211518 Ga0207700_102115182 128
334 3300025928 Ga0207700_10696906 Ga0207700_106969061 128
335 3300025929 Ga0207664_10004838 Ga0207664_100048389 128
336 3300025929 Ga0207664_10020227 Ga0207664_100202273 128
337 3300025929 Ga0207664_10149837 Ga0207664_101498372 128
338 3300025929 Ga0207664_10788458 Ga0207664_107884582 128
339 3300025934 Ga0207686_10811076 Ga0207686_108110761 128
340 3300025935 Ga0207709_10139376 Ga0207709_101393762 128
341 3300025940 Ga0207691_10176268 Ga0207691_101762682 128
342 3300025941 Ga0207711_11138999 Ga0207711_111389991 128
343 3300025944 Ga0207661_10669176 Ga0207661_106691762 128
344 3300025949 Ga0207667_11316262 Ga0207667_113162622 128
345 3300025972 Ga0207668_11311363 Ga0207668_113113631 128
346 3300025981 Ga0207640_10043405 Ga0207640_100434053 128
347 3300025981 Ga0207640_10908081 Ga0207640_109080811 128
348 3300026041 Ga0207639_10051086 Ga0207639_100510864 128
349 3300026041 Ga0207639_10784360 Ga0207639_107843602 128
350 3300026041 Ga0207639_11156113 Ga0207639_111561131 128
351 3300026067 Ga0207678_10035603 Ga0207678_100356033 128
352 3300026078 Ga0207702_10259524 Ga0207702_102595242 128
353 3300026078 Ga0207702_11630333 Ga0207702_116303331 128
354 3300026121 Ga0207683_11473167 Ga0207683_114731671 128
355 3300027312 Ga0209371_1007342 Ga0209371_10073425 128
356 3300027312 Ga0209371_1041852 Ga0209371_10418522 128
357 3300027666 Ga0209282_1328291 Ga0209282_13282911 128
358 3300027866 Ga0209813_10027116 Ga0209813_100271161 128
359 3300028019 Ga0224573_1014732 Ga0224573_10147321 128
360 3300028379 Ga0268266_10135758 Ga0268266_101357581 128
361 3300028379 Ga0268266_11379203 Ga0268266_113792031 128
362 3300028786 Ga0307517_10003614 Ga0307517_1000361415 128
363 3300028786 Ga0307517_10018520 Ga0307517_100185209 128
364 3300028786 Ga0307517_10367052 Ga0307517_103670521 128
365 3300028794 Ga0307515_10004012 Ga0307515_1000401224 128
366 3300028794 Ga0307515_10160116 Ga0307515_101601162 128
367 3300028794 Ga0307515_10301566 Ga0307515_103015662 128
368 3300028800 Ga0265338_10826467 Ga0265338_108264672 128
369 3300029282 Ga0311003_121122 Ga0311003_1211221 128
370 3300029285 Ga0310981_1089018 Ga0310981_10890181 128
371 3300029285 Ga0310981_1096449 Ga0310981_10964491 128
372 3300029957 Ga0265324_10070180 Ga0265324_100701802 128
373 3300030500 Ga0268256_1007098 Ga0268256_10070982 128
374 3300030500 Ga0268256_1047445 Ga0268256_10474451 128
375 3300030500 Ga0268256_1059971 Ga0268256_10599711 128
376 3300030521 Ga0307511_10062864 Ga0307511_100628642 128
377 3300030522 Ga0307512_10002762 Ga0307512_100027624 128
378 3300030522 Ga0307512_10016900 Ga0307512_100169002 128
379 3300030522 Ga0307512_10027864 Ga0307512_100278642 128
380 3300030522 Ga0307512_10060614 Ga0307512_100606143 128
381 3300030731 Ga0316177_1141283 Ga0316177_11412832 128
382 3300030732 Ga0316176_1011376 Ga0316176_10113761 128
383 3300030733 Ga0314311_1203010 Ga0314311_12030101 128
384 3300030735 Ga0316178_1060430 Ga0316178_10604302 128
385 3300030736 Ga0316180_1105364 Ga0316180_11053642 128
386 3300030742 Ga0316183_1196293 Ga0316183_11962932 128
387 3300030744 Ga0316181_1206647 Ga0316181_12066472 128
388 3300031456 Ga0307513_10000001 Ga0307513_100000011345 128
389 3300031456 Ga0307513_10006763 Ga0307513_100067635 128
390 3300031456 Ga0307513_10013386 Ga0307513_100133869 128
391 3300031456 Ga0307513_10021476 Ga0307513_100214765 128
392 3300031456 Ga0307513_10063901 Ga0307513_100639013 128
393 3300031507 Ga0307509_10151820 Ga0307509_101518202 128
394 3300031616 Ga0307508_10013541 Ga0307508_100135416 128
395 3300031616 Ga0307508_10021854 Ga0307508_100218541 128
396 3300031616 Ga0307508_10047272 Ga0307508_100472724 128
397 3300031616 Ga0307508_10102787 Ga0307508_101027872 128
398 3300031616 Ga0307508_10137600 Ga0307508_101376002 128
399 3300031616 Ga0307508_10461738 Ga0307508_104617382 128
400 3300031649 Ga0307514_10009038 Ga0307514_100090386 128
401 3300031649 Ga0307514_10068734 Ga0307514_100687341 128
402 3300031649 Ga0307514_10069439 Ga0307514_100694392 128
403 3300031649 Ga0307514_10072409 Ga0307514_100724092 128
404 3300031649 Ga0307514_10194055 Ga0307514_101940552 128
405 3300031649 Ga0307514_10541582 Ga0307514_105415821 128
406 3300031730 Ga0307516_10011933 Ga0307516_100119335 128
407 3300031730 Ga0307516_10073687 Ga0307516_100736873 128
408 3300031730 Ga0307516_10085486 Ga0307516_100854862 128
409 3300031730 Ga0307516_10471169 Ga0307516_104711692 128
410 3300031730 Ga0307516_10671228 Ga0307516_106712281 128
411 3300031731 Ga0307405_11161838 Ga0307405_111618382 128
412 3300031824 Ga0307413_10181917 Ga0307413_101819172 128
413 3300031838 Ga0307518_10625368 Ga0307518_106253681 128
414 3300031852 Ga0307410_10112499 Ga0307410_101124992 128
415 3300031911 Ga0307412_10749149 Ga0307412_107491491 128
416 3300032002 Ga0307416_101136349 Ga0307416_1011363491 128
417 3300032002 Ga0307416_101320259 Ga0307416_1013202592 128
418 3300032002 Ga0307416_102933116 Ga0307416_1029331161 128
419 3300032005 Ga0307411_10019959 Ga0307411_100199595 128
420 3300033179 Ga0307507_10000024 Ga0307507_1000002487 128
421 3300033179 Ga0307507_10045345 Ga0307507_100453452 128
422 3300033179 Ga0307507_10046672 Ga0307507_100466722 128
423 3300033179 Ga0307507_10347002 Ga0307507_103470021 128
424 3300033180 Ga0307510_10012527 Ga0307510_100125274 128
425 3300033180 Ga0307510_10042716 Ga0307510_100427165 128
426 3300033180 Ga0307510_10406050 Ga0307510_104060502 128
427 3300033180 Ga0307510_10483010 Ga0307510_104830101 128
428 3300033545 Ga0316214_1065596 Ga0316214_10655961 128
429 3300035724 Ga0373933_0014212 Ga0373933_0014212_3810_4217 128
430 3300035724 Ga0373933_0032249 Ga0373933_0032249_1306_1695 128
431 3300035724 Ga0373933_0424616 Ga0373933_0424616_11_400 128
432 3300037068 Ga0373925_0000348 Ga0373925_0000348_8946_9332 128
433 3300037312 Ga0395899_0106055 Ga0395899_0106055_214_606 128
434 3300037418 Ga0395900_0473095 Ga0395900_0473095_767_1159 128
435 3300037466 Ga0395898_0029604 Ga0395898_0029604_4424_4816 128
436 3300037466 Ga0395898_0310377 Ga0395898_0310377_215_607 128
437 3300037471 Ga0395905_0101042 Ga0395905_0101042_1122_1514 128
438 3300037853 Ga0436364_0162507 Ga0436364_0162507_70062_70448 128
439 3300037853 Ga0436364_0268454 Ga0436364_0268454_198_590 128
440 3300038443 Ga0395901_0014818 Ga0395901_0014818_6904_7296 128
441 3300038443 Ga0395901_0505392 Ga0395901_0505392_658_1050 128
442 3300039437 Ga0436365_0220139 Ga0436365_0220139_80_472 128
443 3300039437 Ga0436365_0654894 Ga0436365_0654894_134_523 128
444 3300039450 Ga0436363_0115510 Ga0436363_0115510_51_461 128
445 3300039450 Ga0436363_0671136 Ga0436363_0671136_46_435 128
446 3300039450 Ga0436363_1105319 Ga0436363_1105319_257_646 128
447 3300041404 Ga0439436_0003937 Ga0439436_0003937_532_924 128
448 3300041404 Ga0439436_0010487 Ga0439436_0010487_1075_1485 128
449 3300041404 Ga0439436_0040854 Ga0439436_0040854_759_1151 128
450 3300041406 Ga0439439_0002096 Ga0439439_0002096_849_1259 128
451 3300041406 Ga0439439_0004871 Ga0439439_0004871_1973_2365 128
452 3300041406 Ga0439439_0099970 Ga0439439_0099970_28_420 128
453 3300041411 Ga0439466_0060717 Ga0439466_0060717_141_551 128
454 3300041413 Ga0439465_0241022 Ga0439465_0241022_221_613 128
455 3300041444 Ga0451790_05773 Ga0451790_05773_42_434 128
456 3300041460 Ga0451802_0862397 Ga0451802_0862397_576_968 128
457 3300041461 Ga0451805_108507 Ga0451805_108507_91_483 128
458 3300041463 Ga0451804_0235254 Ga0451804_0235254_60_452 128
459 3300041463 Ga0451804_0942079 Ga0451804_0942079_76_468 128
460 3300041494 Ga0451837_0921921 Ga0451837_0921921_1474_1866 128
461 3300041496 Ga0451839_0641366 Ga0451839_0641366_820_1212 128
462 3300041498 Ga0451841_0721461 Ga0451841_0721461_395_787 128
463 3300041501 Ga0451845_0441870 Ga0451845_0441870_260_652 128
464 3300041502 Ga0451846_16207 Ga0451846_16207_66_458 128
465 3300041506 Ga0451850_26095 Ga0451850_26095_154_546 128
466 3300041507 Ga0451851_0375984 Ga0451851_0375984_740_1132 128
467 3300041509 Ga0451843_0606551 Ga0451843_0606551_1068_1460 128
468 3300041510 Ga0451854_32235 Ga0451854_32235_175_567 128
469 3300041512 Ga0451853_2612288 Ga0451853_2612288_1679_2071 128
470 3300041997 Ga0439431_0068049 Ga0439431_0068049_152_544 128
471 3300041999 Ga0439433_0000632 Ga0439433_0000632_5189_5581 128
472 3300041999 Ga0439433_0021444 Ga0439433_0021444_876_1268 128
473 3300042002 Ga0439442_006630 Ga0439442_006630_1720_2112 128
474 3300042002 Ga0439442_069300 Ga0439442_069300_108_500 128
475 3300042005 Ga0439448_0036930 Ga0439448_0036930_467_859 128
476 3300042005 Ga0439448_0049286 Ga0439448_0049286_177_569 128
477 3300042007 Ga0439449_0001150 Ga0439449_0001150_173_565 128
478 3300042007 Ga0439449_0002175 Ga0439449_0002175_1667_2077 128
479 3300042007 Ga0439449_0012546 Ga0439449_0012546_2605_3015 128
480 3300042007 Ga0439449_0175661 Ga0439449_0175661_309_701 128
481 3300042008 Ga0439450_026846 Ga0439450_026846_630_1022 128
482 3300042011 Ga0439454_006489 Ga0439454_006489_967_1359 128
483 3300042012 Ga0439455_0002135 Ga0439455_0002135_2517_2909 128
484 3300042014 Ga0439457_000481 Ga0439457_000481_4770_5162 128
485 3300042014 Ga0439457_003831 Ga0439457_003831_1697_2089 128
486 3300042014 Ga0439457_062779 Ga0439457_062779_19_429 128
487 3300042014 Ga0439457_098290 Ga0439457_098290_255_665 128
488 3300042014 Ga0439457_174325 Ga0439457_174325_90_482 128
489 3300042122 Ga0450920_032484 Ga0450920_032484_405_797 128
490 3300042131 Ga0450894_000022 Ga0450894_000022_14912_15304 128
491 3300042133 Ga0450896_001115 Ga0450896_001115_833_1225 128
492 3300042134 Ga0450898_073904 Ga0450898_073904_273_665 128
493 3300042135 Ga0450899_000954 Ga0450899_000954_1186_1578 128
494 3300042136 Ga0450900_028781 Ga0450900_028781_257_649 128
495 3300042138 Ga0450903_000614 Ga0450903_000614_4108_4500 128
496 3300042145 Ga0450906_012450 Ga0450906_012450_533_925 128
497 3300042157 Ga0439458_0003368 Ga0439458_0003368_318_710 128
498 3300042435 Ga0439434_0225600 Ga0439434_0225600_53_445 128
499 3300042438 Ga0439459_0220617 Ga0439459_0220617_31_423 128
500 3300044656 Ga0466969_0000400 Ga0466969_0000400_10450_10839 128
501 3300044656 Ga0466969_0001309 Ga0466969_0001309_11483_11887 128
502 3300044656 Ga0466969_0005724 Ga0466969_0005724_4659_5051 128
503 3300044656 Ga0466969_0016641 Ga0466969_0016641_2185_2589 128
504 3300044656 Ga0466969_0030439 Ga0466969_0030439_514_918 128
505 3300044656 Ga0466969_0045691 Ga0466969_0045691_1030_1422 128
506 3300044656 Ga0466969_0207428 Ga0466969_0207428_301_687 128
507 3300044656 Ga0466969_0296867 Ga0466969_0296867_28_432 128
508 3300044658 Ga0466972_0004075 Ga0466972_0004075_4654_5046 128
509 3300044658 Ga0466972_0005652 Ga0466972_0005652_3108_3497 128
510 3300044658 Ga0466972_0006093 Ga0466972_0006093_462_854 128
511 3300044658 Ga0466972_0034156 Ga0466972_0034156_819_1211 128
512 3300044658 Ga0466972_0096600 Ga0466972_0096600_772_1161 128
513 3300044658 Ga0466972_0126891 Ga0466972_0126891_472_864 128
514 3300044658 Ga0466972_0394132 Ga0466972_0394132_68_457 128
515 3300044683 Ga0466965_0000907 Ga0466965_0000907_9291_9683 128
516 3300044683 Ga0466965_0090009 Ga0466965_0090009_1106_1498 128
517 3300044683 Ga0466965_0608063 Ga0466965_0608063_193_585 128
518 3300044683 Ga0466965_0947458 Ga0466965_0947458_82_486 128
519 3300044684 Ga0466966_0000534 Ga0466966_0000534_10480_10869 128
520 3300044684 Ga0466966_0002876 Ga0466966_0002876_9157_9549 128
521 3300044684 Ga0466966_0021345 Ga0466966_0021345_3637_4041 128
522 3300044684 Ga0466966_0038389 Ga0466966_0038389_2536_2928 128
523 3300044684 Ga0466966_0111153 Ga0466966_0111153_711_1103 128
524 3300044684 Ga0466966_0162762 Ga0466966_0162762_54_458 128
525 3300044684 Ga0466966_0260761 Ga0466966_0260761_440_844 128
526 3300044693 Ga0466961_0000308 Ga0466961_0000308_29324_29716 128
527 3300044693 Ga0466961_0002104 Ga0466961_0002104_3046_3450 128
528 3300044693 Ga0466961_0011811 Ga0466961_0011811_1096_1488 128
529 3300044693 Ga0466961_0031962 Ga0466961_0031962_1906_2310 128
530 3300044693 Ga0466961_0106941 Ga0466961_0106941_219_623 128
531 3300044693 Ga0466961_0123710 Ga0466961_0123710_266_670 128
532 3300044693 Ga0466961_0134222 Ga0466961_0134222_526_915 128
533 3300044693 Ga0466961_0259370 Ga0466961_0259370_421_825 128
534 3300044693 Ga0466961_0520584 Ga0466961_0520584_258_662 128
535 3300044694 Ga0466963_0067775 Ga0466963_0067775_638_1030 128
536 3300044694 Ga0466963_0318208 Ga0466963_0318208_254_661 128
537 3300044706 Ga0466964_0029133 Ga0466964_0029133_752_1144 128
538 3300044706 Ga0466964_0076919 Ga0466964_0076919_334_726 128
539 3300044719 Ga0466971_0000332 Ga0466971_0000332_11563_11955 128
540 3300044719 Ga0466971_0000463 Ga0466971_0000463_1664_2068 128
541 3300044719 Ga0466971_0048653 Ga0466971_0048653_1108_1500 128
542 3300044719 Ga0466971_0093045 Ga0466971_0093045_33_437 128
543 3300044719 Ga0466971_0218186 Ga0466971_0218186_208_612 128
544 3300044735 Ga0466968_0000051 Ga0466968_0000051_11085_11474 128
545 3300044735 Ga0466968_0014055 Ga0466968_0014055_1273_1665 128
546 3300044735 Ga0466968_0476928 Ga0466968_0476928_145_537 128
547 3300044735 Ga0466968_0514955 Ga0466968_0514955_162_554 128
548 3300044735 Ga0466968_0535518 Ga0466968_0535518_106_504 128
549 3300044765 Ga0466970_0000145 Ga0466970_0000145_10459_10848 128
550 3300044765 Ga0466970_0004998 Ga0466970_0004998_1021_1413 128
551 3300044765 Ga0466970_0014443 Ga0466970_0014443_2560_2952 128
552 3300044765 Ga0466970_0044429 Ga0466970_0044429_269_661 128
553 3300044765 Ga0466970_0080766 Ga0466970_0080766_723_1127 128
554 3300044765 Ga0466970_0265705 Ga0466970_0265705_204_608 128
555 3300044765 Ga0466970_0397530 Ga0466970_0397530_116_520 128
556 3300044765 Ga0466970_0418366 Ga0466970_0418366_56_460 128
557 3300044765 Ga0466970_0593999 Ga0466970_0593999_55_444 128
558 3300044842 Ga0466957_0006604 Ga0466957_0006604_5137_5529 128
559 3300044842 Ga0466957_0121381 Ga0466957_0121381_910_1302 128
560 3300044842 Ga0466957_0205918 Ga0466957_0205918_754_1143 128
561 3300044842 Ga0466957_0295524 Ga0466957_0295524_162_566 128
562 3300044842 Ga0466957_0368705 Ga0466957_0368705_378_782 128
563 3300044842 Ga0466957_0521283 Ga0466957_0521283_360_746 128
564 3300044842 Ga0466957_1165670 Ga0466957_1165670_143_532 128
565 3300044842 Ga0466957_1281957 Ga0466957_1281957_130_516 128
566 3300044901 Ga0466960_0013352 Ga0466960_0013352_803_1195 128
567 3300044901 Ga0466960_0242572 Ga0466960_0242572_89_481 128
568 3300045049 Ga0466959_0000668 Ga0466959_0000668_9899_10291 128
569 3300045049 Ga0466959_0002190 Ga0466959_0002190_9083_9487 128
570 3300045049 Ga0466959_0015896 Ga0466959_0015896_3573_3977 128
571 3300045049 Ga0466959_0030947 Ga0466959_0030947_2739_3128 128
572 3300045049 Ga0466959_0046010 Ga0466959_0046010_1125_1517 128
573 3300045049 Ga0466959_0084983 Ga0466959_0084983_1764_2150 128
574 3300045049 Ga0466959_0446168 Ga0466959_0446168_416_802 128
575 3300045836 Ga0466958_0000773 Ga0466958_0000773_2725_3117 128
576 3300045836 Ga0466958_0103073 Ga0466958_0103073_1343_1747 128
577 3300045836 Ga0466958_0165811 Ga0466958_0165811_101_505 128
578 3300045836 Ga0466958_0689249 Ga0466958_0689249_44_433 128
579 3300045976 Ga0466967_0038433 Ga0466967_0038433_2647_3039 128
580 3300045976 Ga0466967_0040073 Ga0466967_0040073_1401_1793 128
581 3300045976 Ga0466967_0061682 Ga0466967_0061682_99_491 128
582 3300045976 Ga0466967_0516550 Ga0466967_0516550_200_592 128
583 3300045976 Ga0466967_1091721 Ga0466967_1091721_107_499 128
584 3300046452 Ga0495617_024406 Ga0495617_024406_207_599 128
585 3300046453 Ga0495627_044002 Ga0495627_044002_894_1286 128
586 3300046454 Ga0495592_0048333 Ga0495592_0048333_1681_2085 128
587 3300046454 Ga0495592_0060598 Ga0495592_0060598_1405_1797 128
588 3300046454 Ga0495592_0087256 Ga0495592_0087256_44_448 128
589 3300046454 Ga0495592_0225487 Ga0495592_0225487_341_733 128
590 3300046455 Ga0495603_0000638 Ga0495603_0000638_12575_12967 128
591 3300046455 Ga0495603_0001879 Ga0495603_0001879_6699_7091 128
592 3300046455 Ga0495603_0005158 Ga0495603_0005158_4341_4733 128
593 3300046455 Ga0495603_0023079 Ga0495603_0023079_82_474 128
594 3300046455 Ga0495603_0026665 Ga0495603_0026665_2371_2763 128
595 3300046455 Ga0495603_0063291 Ga0495603_0063291_814_1206 128
596 3300046457 Ga0495590_0308109 Ga0495590_0308109_99_491 128
597 3300046459 Ga0495629_0001217 Ga0495629_0001217_6722_7114 128
598 3300046459 Ga0495629_0003212 Ga0495629_0003212_7174_7566 128
599 3300046459 Ga0495629_0007463 Ga0495629_0007463_4363_4755 128
600 3300046459 Ga0495629_0019525 Ga0495629_0019525_1570_1962 128
601 3300046459 Ga0495629_0050969 Ga0495629_0050969_678_1070 128
602 3300046459 Ga0495629_0073348 Ga0495629_0073348_441_833 128
603 3300046459 Ga0495629_0111160 Ga0495629_0111160_537_929 128
604 3300046459 Ga0495629_1093796 Ga0495629_1093796_57_449 128
605 3300046460 Ga0495638_0020561 Ga0495638_0020561_3007_3399 128
606 3300046460 Ga0495638_0049586 Ga0495638_0049586_624_1016 128
607 3300046460 Ga0495638_0180924 Ga0495638_0180924_786_1178 128
608 3300046460 Ga0495638_0216315 Ga0495638_0216315_461_853 128
609 3300046460 Ga0495638_0234738 Ga0495638_0234738_602_994 128
610 3300046461 Ga0495641_0159489 Ga0495641_0159489_431_823 128
611 3300046462 Ga0495651_0000752 Ga0495651_0000752_7970_8374 128
612 3300046462 Ga0495651_0000989 Ga0495651_0000989_9736_10128 128
613 3300046462 Ga0495651_0001909 Ga0495651_0001909_12338_12742 128
614 3300046462 Ga0495651_0187091 Ga0495651_0187091_967_1359 128
615 3300046462 Ga0495651_0741986 Ga0495651_0741986_160_564 128
616 3300046463 Ga0495653_0101896 Ga0495653_0101896_1177_1569 128
617 3300046473 Ga0495582_0137865 Ga0495582_0137865_725_1117 128
618 3300046473 Ga0495582_0286255 Ga0495582_0286255_493_885 128
619 3300046474 Ga0495605_0016690 Ga0495605_0016690_2225_2617 128
620 3300046476 Ga0495662_0000804 Ga0495662_0000804_4685_5077 128
621 3300046476 Ga0495662_0018436 Ga0495662_0018436_2636_3028 128
622 3300046477 Ga0495664_0001534 Ga0495664_0001534_10236_10628 128
623 3300046477 Ga0495664_0054271 Ga0495664_0054271_675_1079 128
624 3300046477 Ga0495664_0763251 Ga0495664_0763251_150_542 128
625 3300046491 Ga0495584_0024076 Ga0495584_0024076_1145_1537 128
626 3300046492 Ga0495585_0010037 Ga0495585_0010037_1736_2128 128
627 3300046492 Ga0495585_0056404 Ga0495585_0056404_969_1361 128
628 3300046492 Ga0495585_0057137 Ga0495585_0057137_954_1346 128
629 3300046492 Ga0495585_0114767 Ga0495585_0114767_194_586 128
630 3300046492 Ga0495585_0183403 Ga0495585_0183403_197_589 128
631 3300046499 Ga0495594_0001615 Ga0495594_0001615_6223_6615 128
632 3300046499 Ga0495594_0038933 Ga0495594_0038933_1271_1663 128
633 3300046499 Ga0495594_0053658 Ga0495594_0053658_663_1055 128
634 3300046499 Ga0495594_0108551 Ga0495594_0108551_716_1108 128
635 3300046500 Ga0495596_0097190 Ga0495596_0097190_297_689 128
636 3300046500 Ga0495596_0137373 Ga0495596_0137373_284_676 128
637 3300046501 Ga0495607_0035092 Ga0495607_0035092_2036_2428 128
638 3300046501 Ga0495607_0073669 Ga0495607_0073669_626_1018 128
639 3300046506 Ga0495583_0121650 Ga0495583_0121650_213_605 128
640 3300046506 Ga0495583_0178411 Ga0495583_0178411_412_804 128
641 3300046507 Ga0495606_0021860 Ga0495606_0021860_96_488 128
642 3300046511 Ga0495608_0280901 Ga0495608_0280901_550_942 128
643 3300046512 Ga0495610_0050106 Ga0495610_0050106_715_1107 128
644 3300046513 Ga0495616_0003394 Ga0495616_0003394_6948_7340 128
645 3300046515 Ga0495620_0011476 Ga0495620_0011476_412_804 128
646 3300046516 Ga0495628_0001200 Ga0495628_0001200_13344_13748 128
647 3300046516 Ga0495628_0183377 Ga0495628_0183377_210_602 128
648 3300046516 Ga0495628_0369201 Ga0495628_0369201_411_815 128
649 3300046516 Ga0495628_0885675 Ga0495628_0885675_34_426 128
650 3300046517 Ga0495630_0005265 Ga0495630_0005265_2970_3362 128
651 3300046517 Ga0495630_0225832 Ga0495630_0225832_859_1251 128
652 3300046517 Ga0495630_0254616 Ga0495630_0254616_533_925 128
653 3300046518 Ga0495631_0046728 Ga0495631_0046728_1149_1541 128
654 3300046518 Ga0495631_0058036 Ga0495631_0058036_312_704 128
655 3300046518 Ga0495631_0145178 Ga0495631_0145178_406_798 128
656 3300046518 Ga0495631_0331775 Ga0495631_0331775_31_423 128
657 3300046519 Ga0495632_0329541 Ga0495632_0329541_183_575 128
658 3300046520 Ga0495637_0034789 Ga0495637_0034789_937_1329 128
659 3300046520 Ga0495637_0112670 Ga0495637_0112670_132_524 128
660 3300046522 Ga0495643_0001610 Ga0495643_0001610_1395_1787 128
661 3300046522 Ga0495643_0002300 Ga0495643_0002300_1661_2053 128
662 3300046522 Ga0495643_0305890 Ga0495643_0305890_41_433 128
663 3300046523 Ga0495644_0091979 Ga0495644_0091979_527_919 128
664 3300046523 Ga0495644_0121416 Ga0495644_0121416_592_984 128
665 3300046524 Ga0495648_0066584 Ga0495648_0066584_700_1092 128
666 3300046524 Ga0495648_0192116 Ga0495648_0192116_597_989 128
667 3300046526 Ga0495666_0047319 Ga0495666_0047319_1149_1541 128
668 3300046526 Ga0495666_0162104 Ga0495666_0162104_358_750 128
669 3300046526 Ga0495666_0176513 Ga0495666_0176513_281_673 128
670 3300046528 Ga0495642_0048827 Ga0495642_0048827_793_1185 128
671 3300046529 Ga0495652_0000586 Ga0495652_0000586_16047_16451 128
672 3300046529 Ga0495652_0002867 Ga0495652_0002867_3759_4163 128
673 3300046529 Ga0495652_0020630 Ga0495652_0020630_3079_3471 128
674 3300046529 Ga0495652_0239473 Ga0495652_0239473_71_463 128
675 3300046529 Ga0495652_0429479 Ga0495652_0429479_485_889 128
676 3300046530 Ga0495654_0033076 Ga0495654_0033076_1078_1470 128
677 3300046533 Ga0495640_0005552 Ga0495640_0005552_3186_3578 128
678 3300046533 Ga0495640_0010404 Ga0495640_0010404_6633_7025 128
679 3300046533 Ga0495640_0035007 Ga0495640_0035007_2502_2894 128
680 3300046535 Ga0495586_0147133 Ga0495586_0147133_247_651 128
681 3300046536 Ga0495587_0001229 Ga0495587_0001229_5541_5933 128
682 3300046536 Ga0495587_0106106 Ga0495587_0106106_762_1166 128
683 3300046538 Ga0495609_0012628 Ga0495609_0012628_1034_1426 128
684 3300046538 Ga0495609_0144931 Ga0495609_0144931_211_603 128
685 3300046542 Ga0495597_0014194 Ga0495597_0014194_1421_1813 128
686 3300046542 Ga0495597_0040776 Ga0495597_0040776_566_958 128
687 3300046543 Ga0495645_0005253 Ga0495645_0005253_7541_7945 128
688 3300046543 Ga0495645_0055025 Ga0495645_0055025_1404_1796 128
689 3300046543 Ga0495645_0081590 Ga0495645_0081590_895_1287 128
690 3300046557 Ga0495622_0064679 Ga0495622_0064679_1019_1411 128
691 3300046557 Ga0495622_0065555 Ga0495622_0065555_142_534 128
692 3300046557 Ga0495622_0120786 Ga0495622_0120786_17_421 128
693 3300046557 Ga0495622_0125871 Ga0495622_0125871_535_927 128
694 3300046557 Ga0495622_0183450 Ga0495622_0183450_256_648 128
695 3300046557 Ga0495622_0335613 Ga0495622_0335613_34_426 128
696 3300046558 Ga0495633_0008493 Ga0495633_0008493_963_1355 128
697 3300046558 Ga0495633_0133167 Ga0495633_0133167_336_728 128
698 3300046559 Ga0495667_0350488 Ga0495667_0350488_153_545 128
699 3300046616 Ga0495668_0042882 Ga0495668_0042882_1616_2008 128
700 3300046616 Ga0495668_0137291 Ga0495668_0137291_412_804 128
701 3300046642 Ga0495634_0001818 Ga0495634_0001818_16114_16506 128
702 3300046642 Ga0495634_0045317 Ga0495634_0045317_1998_2402 128
703 3300046642 Ga0495634_0088769 Ga0495634_0088769_1409_1801 128
704 3300046648 Ga0495611_0013050 Ga0495611_0013050_1098_1490 128
705 3300046648 Ga0495611_0036490 Ga0495611_0036490_623_1015 128
706 3300046648 Ga0495611_0053131 Ga0495611_0053131_436_828 128
707 3300046660 Ga0495625_0021558 Ga0495625_0021558_3143_3535 128
708 3300046660 Ga0495625_0035084 Ga0495625_0035084_3230_3622 128
709 3300046660 Ga0495625_0152743 Ga0495625_0152743_436_828 128
710 3300046660 Ga0495625_0744739 Ga0495625_0744739_149_541 128
711 3300046663 Ga0495635_0000586 Ga0495635_0000586_17147_17551 128
712 3300046663 Ga0495635_0003044 Ga0495635_0003044_6471_6863 128
713 3300046663 Ga0495635_0098026 Ga0495635_0098026_1544_1936 128
714 3300046664 Ga0495659_0304416 Ga0495659_0304416_217_609 128
715 3300046665 Ga0495661_0017649 Ga0495661_0017649_2904_3296 128
716 3300046665 Ga0495661_0302359 Ga0495661_0302359_18_410 128
717 3300046674 Ga0495588_0013636 Ga0495588_0013636_2374_2766 128
718 3300046674 Ga0495588_0016192 Ga0495588_0016192_2652_3044 128
719 3300046674 Ga0495588_0031500 Ga0495588_0031500_2227_2619 128
720 3300046674 Ga0495588_0188139 Ga0495588_0188139_180_572 128
721 3300046675 Ga0495657_0000796 Ga0495657_0000796_10162_10554 128
722 3300046675 Ga0495657_0023246 Ga0495657_0023246_1916_2308 128
723 3300046675 Ga0495657_0237580 Ga0495657_0237580_559_951 128
724 3300046675 Ga0495657_0693902 Ga0495657_0693902_127_531 128
725 3300046678 Ga0495599_0112865 Ga0495599_0112865_1033_1425 128
726 3300046678 Ga0495599_0262766 Ga0495599_0262766_630_1034 128
727 3300046679 Ga0495623_0029613 Ga0495623_0029613_1651_2055 128
728 3300046679 Ga0495623_0205831 Ga0495623_0205831_561_953 128
729 3300046679 Ga0495623_0298730 Ga0495623_0298730_169_561 128
730 3300046680 Ga0495646_0002293 Ga0495646_0002293_10517_10909 128
731 3300046680 Ga0495646_0027540 Ga0495646_0027540_2687_3091 128
732 3300046680 Ga0495646_0201664 Ga0495646_0201664_436_840 128
733 3300046680 Ga0495646_0306774 Ga0495646_0306774_112_504 128
734 3300046683 Ga0495658_0049798 Ga0495658_0049798_385_777 128
735 3300046683 Ga0495658_0057579 Ga0495658_0057579_1350_1742 128
736 3300046689 Ga0495613_0002324 Ga0495613_0002324_1542_1934 128
737 3300046689 Ga0495613_0025321 Ga0495613_0025321_377_769 128
738 3300046689 Ga0495613_0079557 Ga0495613_0079557_449_841 128
739 3300046689 Ga0495613_0120711 Ga0495613_0120711_103_495 128
740 3300046689 Ga0495613_0171071 Ga0495613_0171071_775_1167 128
741 3300046689 Ga0495613_0234335 Ga0495613_0234335_434_826 128
742 3300046690 Ga0495624_0088479 Ga0495624_0088479_547_939 128
743 3300046690 Ga0495624_0104000 Ga0495624_0104000_1206_1598 128
744 3300046691 Ga0495670_0039497 Ga0495670_0039497_1688_2080 128
745 3300046691 Ga0495670_0165579 Ga0495670_0165579_540_932 128
746 3300046691 Ga0495670_0361067 Ga0495670_0361067_342_734 128
747 3300046692 Ga0495671_0003815 Ga0495671_0003815_7997_8389 128
748 3300046694 Ga0495649_0054498 Ga0495649_0054498_925_1317 128
749 3300046694 Ga0495649_0110071 Ga0495649_0110071_136_528 128
750 3300046794 Ga0495589_0006450 Ga0495589_0006450_4711_5103 128
751 3300046794 Ga0495589_0033221 Ga0495589_0033221_975_1367 128
752 3300046794 Ga0495589_0048666 Ga0495589_0048666_1484_1876 128
753 3300046794 Ga0495589_0078242 Ga0495589_0078242_650_1042 128
754 3300046809 Ga0495600_0001390 Ga0495600_0001390_6985_7389 128
755 3300046809 Ga0495600_0003691 Ga0495600_0003691_1591_1983 128
756 3300046809 Ga0495600_0006527 Ga0495600_0006527_3572_3976 128
757 3300046809 Ga0495600_0043331 Ga0495600_0043331_554_946 128
758 3300046809 Ga0495600_0052676 Ga0495600_0052676_531_923 128
759 3300046810 Ga0495660_0035201 Ga0495660_0035201_1425_1817 128
760 3300047315 Ga0495581_0004218 Ga0495581_0004218_2552_2944 128
761 3300047315 Ga0495581_0051070 Ga0495581_0051070_1580_1972 128
762 3300047315 Ga0495581_0106775 Ga0495581_0106775_896_1288 128
763 3300047315 Ga0495581_0180188 Ga0495581_0180188_360_752 128
764 3300047317 Ga0495604_0000695 Ga0495604_0000695_4950_5342 128
765 3300047317 Ga0495604_0004263 Ga0495604_0004263_4400_4792 128
766 3300047317 Ga0495604_0031309 Ga0495604_0031309_3676_4080 128
767 3300047317 Ga0495604_0079704 Ga0495604_0079704_946_1338 128
768 3300047317 Ga0495604_0372664 Ga0495604_0372664_150_623 128
769 3300047318 Ga0495636_0002781 Ga0495636_0002781_4575_4967 128
770 3300047318 Ga0495636_0007046 Ga0495636_0007046_1051_1443 128
771 3300047318 Ga0495636_0022839 Ga0495636_0022839_1519_1911 128
772 3300047318 Ga0495636_0045118 Ga0495636_0045118_1167_1559 128
773 3300047318 Ga0495636_0065687 Ga0495636_0065687_230_622 128
774 3300047319 Ga0495674_0256906 Ga0495674_0256906_265_657 128
775 3300047320 Ga0495672_0028599 Ga0495672_0028599_2171_2563 128
776 3300047321 Ga0495676_0007640 Ga0495676_0007640_201_593 128
777 3300047321 Ga0495676_0009942 Ga0495676_0009942_6849_7241 128
778 3300047321 Ga0495676_0028414 Ga0495676_0028414_77_469 128
779 3300047322 Ga0495680_0096193 Ga0495680_0096193_812_1204 128
780 3300047323 Ga0495683_0019687 Ga0495683_0019687_597_989 128
781 3300047323 Ga0495683_0083660 Ga0495683_0083660_78_470 128
782 3300047443 Ga0495687_003278 Ga0495687_003278_2113_2505 128
783 3300047443 Ga0495687_005559 Ga0495687_005559_1359_1751 128
784 3300047443 Ga0495687_019035 Ga0495687_019035_2832_3224 128
785 3300047443 Ga0495687_020827 Ga0495687_020827_2059_2451 128
786 3300047444 Ga0495675_0068124 Ga0495675_0068124_1573_1965 128
787 3300047444 Ga0495675_0366072 Ga0495675_0366072_371_763 128
788 3300047444 Ga0495675_0550835 Ga0495675_0550835_219_623 128
789 3300047445 Ga0495677_0068192 Ga0495677_0068192_455_847 128
790 3300047445 Ga0495677_0304151 Ga0495677_0304151_97_489 128
791 3300047446 Ga0495679_036338 Ga0495679_036338_1033_1425 128
792 3300047446 Ga0495679_045759 Ga0495679_045759_530_922 128
793 3300047447 Ga0495685_001698 Ga0495685_001698_3091_3483 128
794 3300047447 Ga0495685_007252 Ga0495685_007252_961_1353 128
795 3300047447 Ga0495685_007505 Ga0495685_007505_1989_2381 128
796 3300047447 Ga0495685_010371 Ga0495685_010371_1140_1532 128
797 3300047447 Ga0495685_012966 Ga0495685_012966_740_1132 128
798 3300047469 Ga0495673_0130076 Ga0495673_0130076_245_637 128
799 3300047470 Ga0495681_0000484 Ga0495681_0000484_29598_29990 128
800 3300047470 Ga0495681_0362849 Ga0495681_0362849_11_403 128
801 3300047471 Ga0495684_0017005 Ga0495684_0017005_3486_3878 128
802 3300047471 Ga0495684_0316784 Ga0495684_0316784_255_647 128
803 3300047472 Ga0495686_0012981 Ga0495686_0012981_1129_1521 128
804 3300047472 Ga0495686_0017187 Ga0495686_0017187_3529_3921 128
805 3300047472 Ga0495686_0058569 Ga0495686_0058569_1514_1906 128
806 3300047673 Ga0495593_0001318 Ga0495593_0001318_2911_3303 128
807 3300047673 Ga0495593_0033161 Ga0495593_0033161_348_740 128
808 3300048088 Ga0495602_0048486 Ga0495602_0048486_3131_3523 128
809 3300048088 Ga0495602_0741135 Ga0495602_0741135_241_645 128
810 3300048089 Ga0495614_0000529 Ga0495614_0000529_12135_12527 128
811 3300048089 Ga0495614_0001808 Ga0495614_0001808_8168_8560 128
812 3300048089 Ga0495614_0059165 Ga0495614_0059165_836_1228 128
813 3300048089 Ga0495614_0318058 Ga0495614_0318058_50_442 128
814 3300048089 Ga0495614_0580472 Ga0495614_0580472_98_490 128
815 3300048091 Ga0495626_0063393 Ga0495626_0063393_986_1378 128
816 3300048905 Ga0496102_0833904 Ga0496102_0833904_30_422 128
817 3300048907 Ga0496104_0344186 Ga0496104_0344186_766_1158 128
818 3300048907 Ga0496104_1718297 Ga0496104_1718297_40_432 128
819 3300048908 Ga0496105_0482043 Ga0496105_0482043_279_671 128
820 3300048909 Ga0496106_0339334 Ga0496106_0339334_358_750 128
821 3300048911 Ga0496108_0077340 Ga0496108_0077340_1437_1829 128
822 3300048914 Ga0496111_0185931 Ga0496111_0185931_419_811 128
823 3300048916 Ga0496113_0200630 Ga0496113_0200630_519_911 128
824 3300048916 Ga0496113_1404487 Ga0496113_1404487_51_443 128
825 3300048929 Ga0496126_0030170 Ga0496126_0030170_1582_1968 128
826 3300048929 Ga0496126_1038570 Ga0496126_1038570_178_597 128
827 3300049127 Ga0501306_051309 Ga0501306_051309_177_569 128
828 3300049128 Ga0501308_038226 Ga0501308_038226_189_581 128
829 3300049129 Ga0501309_099916 Ga0501309_099916_81_473 128
830 3300049160 Ga0501304_023281 Ga0501304_023281_23_415 128
831 3300049161 Ga0501305_106765 Ga0501305_106765_48_440 128
832 3300049162 Ga0501307_063577 Ga0501307_063577_164_556 128
833 3300049459 Ga0495678_056769 Ga0495678_056769_988_1380 128
834 3300049460 Ga0495682_0065758 Ga0495682_0065758_225_617 128
835 3300049531 Ga0501315_069559 Ga0501315_069559_22_414 128
836 3300049568 Ga0501031_0007283 Ga0501031_0007283_6625_7017 128
837 3300049568 Ga0501031_0021237 Ga0501031_0021237_3376_3768 128
838 3300049568 Ga0501031_0033610 Ga0501031_0033610_1999_2391 128
839 3300049568 Ga0501031_0168019 Ga0501031_0168019_876_1268 128
840 3300049568 Ga0501031_0419558 Ga0501031_0419558_456_848 128
841 3300049569 Ga0501032_0001990 Ga0501032_0001990_11191_11583 128
842 3300049569 Ga0501032_0039760 Ga0501032_0039760_1876_2268 128
843 3300049569 Ga0501032_0042190 Ga0501032_0042190_1187_1579 128
844 3300049569 Ga0501032_0046767 Ga0501032_0046767_1929_2321 128
845 3300049569 Ga0501032_0098405 Ga0501032_0098405_972_1364 128
846 3300049569 Ga0501032_0292053 Ga0501032_0292053_385_777 128
847 3300049569 Ga0501032_0330186 Ga0501032_0330186_472_864 128
848 3300049570 Ga0501033_0009919 Ga0501033_0009919_3934_4326 128
849 3300049570 Ga0501033_0030574 Ga0501033_0030574_990_1382 128
850 3300049570 Ga0501033_0092653 Ga0501033_0092653_360_752 128
851 3300049570 Ga0501033_0152049 Ga0501033_0152049_931_1323 128
852 3300049570 Ga0501033_0174966 Ga0501033_0174966_1084_1476 128
853 3300049570 Ga0501033_0240627 Ga0501033_0240627_627_1019 128
854 3300049570 Ga0501033_0444803 Ga0501033_0444803_234_626 128
855 3300049571 Ga0501034_0005363 Ga0501034_0005363_9058_9450 128
856 3300049571 Ga0501034_0005698 Ga0501034_0005698_1735_2127 128
857 3300049571 Ga0501034_0018502 Ga0501034_0018502_3697_4089 128
858 3300049571 Ga0501034_0060680 Ga0501034_0060680_2671_3063 128
859 3300049571 Ga0501034_0089866 Ga0501034_0089866_733_1125 128
860 3300049571 Ga0501034_0097780 Ga0501034_0097780_1202_1594 128
861 3300049571 Ga0501034_0151625 Ga0501034_0151625_876_1268 128
862 3300049571 Ga0501034_0510163 Ga0501034_0510163_445_837 128
863 3300049571 Ga0501034_0959366 Ga0501034_0959366_302_694 128
864 3300049572 Ga0501036_0000553 Ga0501036_0000553_16493_16885 128
865 3300049572 Ga0501036_0010697 Ga0501036_0010697_5458_5850 128
866 3300049572 Ga0501036_0023104 Ga0501036_0023104_2183_2575 128
867 3300049572 Ga0501036_0032873 Ga0501036_0032873_772_1164 128
868 3300049572 Ga0501036_0051941 Ga0501036_0051941_1775_2167 128
869 3300049572 Ga0501036_0087173 Ga0501036_0087173_496_888 128
870 3300049572 Ga0501036_0298239 Ga0501036_0298239_616_1008 128
871 3300049572 Ga0501036_0557796 Ga0501036_0557796_446_838 128
872 3300049573 Ga0501037_0002550 Ga0501037_0002550_11191_11583 128
873 3300049573 Ga0501037_0030551 Ga0501037_0030551_137_529 128
874 3300049573 Ga0501037_0050338 Ga0501037_0050338_1708_2100 128
875 3300049573 Ga0501037_0072793 Ga0501037_0072793_1810_2199 128
876 3300049573 Ga0501037_0155175 Ga0501037_0155175_1102_1494 128
877 3300049573 Ga0501037_0217993 Ga0501037_0217993_205_597 128
878 3300049573 Ga0501037_0228775 Ga0501037_0228775_631_1023 128
879 3300049574 Ga0501038_0002207 Ga0501038_0002207_485_877 128
880 3300049574 Ga0501038_0005677 Ga0501038_0005677_9306_9698 128
881 3300049574 Ga0501038_0014436 Ga0501038_0014436_6209_6601 128
882 3300049574 Ga0501038_0014677 Ga0501038_0014677_1703_2095 128
883 3300049574 Ga0501038_0061328 Ga0501038_0061328_209_601 128
884 3300049574 Ga0501038_0070220 Ga0501038_0070220_46_438 128
885 3300049574 Ga0501038_0149106 Ga0501038_0149106_401_790 128
886 3300049574 Ga0501038_0390960 Ga0501038_0390960_446_838 128
887 3300049574 Ga0501038_0393492 Ga0501038_0393492_216_608 128
888 3300049575 Ga0501039_0002645 Ga0501039_0002645_11933_12325 128
889 3300049575 Ga0501039_0015464 Ga0501039_0015464_5244_5636 128
890 3300049575 Ga0501039_0032315 Ga0501039_0032315_2305_2697 128
891 3300049575 Ga0501039_0830449 Ga0501039_0830449_189_581 128
892 3300049575 Ga0501039_1356548 Ga0501039_1356548_119_511 128
893 3300049576 Ga0501040_0040801 Ga0501040_0040801_1812_2204 128
894 3300049576 Ga0501040_0890790 Ga0501040_0890790_25_417 128
895 3300049576 Ga0501040_0929819 Ga0501040_0929819_67_459 128
896 3300049577 Ga0501041_0000849 Ga0501041_0000849_4702_5094 128
897 3300049577 Ga0501041_0561274 Ga0501041_0561274_47_439 128
898 3300049578 Ga0501042_0001880 Ga0501042_0001880_1586_1978 128
899 3300049578 Ga0501042_0028160 Ga0501042_0028160_1014_1406 128
900 3300049578 Ga0501042_0196332 Ga0501042_0196332_497_889 128
901 3300049578 Ga0501042_0391904 Ga0501042_0391904_399_791 128
902 3300049578 Ga0501042_1201338 Ga0501042_1201338_25_417 128
903 3300049579 Ga0501043_0005890 Ga0501043_0005890_1045_1437 128
904 3300049579 Ga0501043_0009787 Ga0501043_0009787_303_695 128
905 3300049579 Ga0501043_0020943 Ga0501043_0020943_2203_2595 128
906 3300049579 Ga0501043_0119835 Ga0501043_0119835_660_1052 128
907 3300049579 Ga0501043_0146961 Ga0501043_0146961_1062_1454 128
908 3300049579 Ga0501043_0290415 Ga0501043_0290415_839_1231 128
909 3300049579 Ga0501043_0299692 Ga0501043_0299692_462_854 128
910 3300049579 Ga0501043_0822591 Ga0501043_0822591_99_491 128
911 3300049580 Ga0501046_0005490 Ga0501046_0005490_9434_9826 128
912 3300049580 Ga0501046_0042485 Ga0501046_0042485_2692_3084 128
913 3300049580 Ga0501046_0095304 Ga0501046_0095304_1516_1908 128
914 3300049580 Ga0501046_0281545 Ga0501046_0281545_556_948 128
915 3300049580 Ga0501046_0295582 Ga0501046_0295582_693_1085 128
916 3300049581 Ga0501047_0005878 Ga0501047_0005878_10693_11085 128
917 3300049581 Ga0501047_0013772 Ga0501047_0013772_3880_4272 128
918 3300049581 Ga0501047_0017015 Ga0501047_0017015_852_1244 128
919 3300049581 Ga0501047_0023366 Ga0501047_0023366_3431_3823 128
920 3300049581 Ga0501047_0023815 Ga0501047_0023815_403_795 128
921 3300049581 Ga0501047_0041485 Ga0501047_0041485_3480_3872 128
922 3300049581 Ga0501047_0051699 Ga0501047_0051699_2458_2850 128
923 3300049581 Ga0501047_0071007 Ga0501047_0071007_2401_2790 128
924 3300049581 Ga0501047_0346521 Ga0501047_0346521_694_1086 128
925 3300049582 Ga0501048_0002755 Ga0501048_0002755_4591_4983 128
926 3300049582 Ga0501048_0025711 Ga0501048_0025711_2707_3099 128
927 3300049582 Ga0501048_0291714 Ga0501048_0291714_309_701 128
928 3300049582 Ga0501048_0357085 Ga0501048_0357085_165_557 128
929 3300049582 Ga0501048_0412883 Ga0501048_0412883_19_411 128
930 3300049582 Ga0501048_0494157 Ga0501048_0494157_256_648 128
931 3300049582 Ga0501048_0750068 Ga0501048_0750068_48_440 128
932 3300049583 Ga0501067_0007326 Ga0501067_0007326_4726_5118 128
933 3300049583 Ga0501067_0711021 Ga0501067_0711021_157_549 128
934 3300049584 Ga0501068_0062071 Ga0501068_0062071_398_790 128
935 3300049584 Ga0501068_0108969 Ga0501068_0108969_71_463 128
936 3300049585 Ga0501069_0038843 Ga0501069_0038843_735_1127 128
937 3300049585 Ga0501069_0111469 Ga0501069_0111469_114_506 128
938 3300049586 Ga0501070_0000903 Ga0501070_0000903_13718_14110 128
939 3300049586 Ga0501070_0188761 Ga0501070_0188761_719_1111 128
940 3300049586 Ga0501070_0272252 Ga0501070_0272252_800_1192 128
941 3300049586 Ga0501070_0420523 Ga0501070_0420523_294_686 128
942 3300049586 Ga0501070_0599222 Ga0501070_0599222_305_697 128
943 3300049587 Ga0501071_0001385 Ga0501071_0001385_2183_2575 128
944 3300049587 Ga0501071_0152106 Ga0501071_0152106_1262_1654 128
945 3300049587 Ga0501071_0999195 Ga0501071_0999195_67_459 128
946 3300049587 Ga0501071_1085438 Ga0501071_1085438_76_468 128
947 3300049588 Ga0501072_0017666 Ga0501072_0017666_5029_5421 128
948 3300049588 Ga0501072_0379948 Ga0501072_0379948_471_863 128
949 3300049588 Ga0501072_1194013 Ga0501072_1194013_159_551 128
950 3300049589 Ga0501073_0154658 Ga0501073_0154658_335_727 128
951 3300049589 Ga0501073_0401518 Ga0501073_0401518_390_782 128
952 3300049589 Ga0501073_1272372 Ga0501073_1272372_80_472 128
953 3300049590 Ga0501074_0000685 Ga0501074_0000685_20615_21007 128
954 3300049590 Ga0501074_0206939 Ga0501074_0206939_605_997 128
955 3300049590 Ga0501074_0210669 Ga0501074_0210669_928_1320 128
956 3300049590 Ga0501074_0513327 Ga0501074_0513327_421_813 128
957 3300049591 Ga0501075_0640712 Ga0501075_0640712_55_447 128
958 3300049592 Ga0501076_0016555 Ga0501076_0016555_848_1240 128
959 3300049592 Ga0501076_0312388 Ga0501076_0312388_387_779 128
960 3300049593 Ga0501077_0081465 Ga0501077_0081465_37_429 128
961 3300049593 Ga0501077_0094327 Ga0501077_0094327_615_1007 128
962 3300049593 Ga0501077_0400452 Ga0501077_0400452_106_498 128
963 3300049652 Ga0501202_057607 Ga0501202_057607_235_627 128
964 3300049663 Ga0501223_076749 Ga0501223_076749_159_551 128
965 3300049741 Ga0501079_0032385 Ga0501079_0032385_1501_1893 128
966 3300049741 Ga0501079_0425238 Ga0501079_0425238_222_614 128
967 3300049742 Ga0501080_0107698 Ga0501080_0107698_456_848 128
968 3300049742 Ga0501080_0861550 Ga0501080_0861550_65_457 128
969 3300049743 Ga0501081_0100340 Ga0501081_0100340_831_1223 128
970 3300049744 Ga0501083_0211714 Ga0501083_0211714_72_464 128
971 3300049744 Ga0501083_0290317 Ga0501083_0290317_373_765 128
972 3300049761 Ga0501264_020435 Ga0501264_020435_90_482 128
973 3300049778 Ga0501282_013501 Ga0501282_013501_458_850 128
974 3300049822 Ga0501035_0002519 Ga0501035_0002519_11638_12030 128
975 3300049822 Ga0501035_0004257 Ga0501035_0004257_4009_4401 128
976 3300049822 Ga0501035_0022434 Ga0501035_0022434_201_593 128
977 3300049822 Ga0501035_0029012 Ga0501035_0029012_454_846 128
978 3300049822 Ga0501035_0032276 Ga0501035_0032276_3696_4088 128
979 3300049822 Ga0501035_0105598 Ga0501035_0105598_473_865 128
980 3300049822 Ga0501035_0131465 Ga0501035_0131465_1265_1657 128
981 3300049822 Ga0501035_0205013 Ga0501035_0205013_482_874 128
982 3300049822 Ga0501035_0256618 Ga0501035_0256618_268_660 128
983 3300049822 Ga0501035_0789146 Ga0501035_0789146_103_495 128
984 3300049823 Ga0501044_0007347 Ga0501044_0007347_1004_1396 128
985 3300049823 Ga0501044_0009230 Ga0501044_0009230_20_412 128
986 3300049823 Ga0501044_0012456 Ga0501044_0012456_3771_4160 128
987 3300049823 Ga0501044_0021769 Ga0501044_0021769_4046_4438 128
988 3300049823 Ga0501044_0023137 Ga0501044_0023137_4591_4983 128
989 3300049823 Ga0501044_0038017 Ga0501044_0038017_3913_4305 128
990 3300049823 Ga0501044_0080660 Ga0501044_0080660_2510_2902 128
991 3300049823 Ga0501044_0282609 Ga0501044_0282609_407_799 128
992 3300049824 Ga0501045_0015881 Ga0501045_0015881_3865_4257 128
993 3300049824 Ga0501045_0048873 Ga0501045_0048873_2474_2866 128
994 3300049824 Ga0501045_0303559 Ga0501045_0303559_314_706 128
995 3300049824 Ga0501045_0338954 Ga0501045_0338954_132_524 128
996 3300050492 nmdc:mga0yw44_606416_c1 nmdc:mga0yw44_606416_c1_224_616 128
997 3300050492 nmdc:mga0yw44_996525_c1 nmdc:mga0yw44_996525_c1_51_443 128
998 3300050494 nmdc:mga06z11_759715_c1 nmdc:mga06z11_759715_c1_16_408 128
999 3300050494 nmdc:mga06z11_8290_c1 nmdc:mga06z11_8290_c1_2593_2985 128
1000 3300050495 nmdc:mga04h51_28168_c1 nmdc:mga04h51_28168_c1_1214_1606 128
1001 3300050496 nmdc:mga07m45_415360_c1 nmdc:mga07m45_415360_c1_64_456 128
1002 3300050514 nmdc:mga08x19_512198_c1 nmdc:mga08x19_512198_c1_95_499 128
1003 3300053077 Ga0495601_0012919 Ga0495601_0012919_709_1113 128
1004 3300053077 Ga0495601_0222963 Ga0495601_0222963_556_960 128
1005 3300053077 Ga0495601_0530919 Ga0495601_0530919_319_711 128
1006 3300053078 Ga0495612_0003333 Ga0495612_0003333_1116_1520 128
1007 3300053078 Ga0495612_0011773 Ga0495612_0011773_101_505 128
1008 3300053078 Ga0495612_0522533 Ga0495612_0522533_52_444 128
1009 3300053079 Ga0500610_0232357 Ga0500610_0232357_430_822 128
1010 3300053085 Ga0495619_0122367 Ga0495619_0122367_798_1202 128
1011 3300053085 Ga0495619_0211454 Ga0495619_0211454_629_1033 128
1012 3300053085 Ga0495619_0693378 Ga0495619_0693378_156_548 128
1013 3300053086 Ga0500578_0137294 Ga0500578_0137294_885_1277 128
1014 3300053088 Ga0500644_0014989 Ga0500644_0014989_545_964 128
1015 3300053088 Ga0500644_0019832 Ga0500644_0019832_977_1369 128
1016 3300053092 Ga0500583_0495849 Ga0500583_0495849_133_525 128
1017 3300053094 Ga0500566_0047067 Ga0500566_0047067_59_451 128
1018 3300053095 Ga0500640_006196 Ga0500640_006196_2891_3283 128
1019 3300053098 Ga0500650_0099354 Ga0500650_0099354_290_682 128
1020 3300053099 Ga0500654_088991 Ga0500654_088991_61_453 128
1021 3300053100 Ga0500660_241757 Ga0500660_241757_32_424 128
1022 3300053104 Ga0500556_0054793 Ga0500556_0054793_70_462 128
1023 3300053106 Ga0500558_121645 Ga0500558_121645_370_762 128
1024 3300053107 Ga0500560_005308 Ga0500560_005308_983_1375 128
1025 3300053109 Ga0500569_002482 Ga0500569_002482_2337_2729 128
1026 3300053121 Ga0500607_093798 Ga0500607_093798_40_429 128
1027 3300053123 Ga0500614_014576 Ga0500614_014576_907_1299 128
1028 3300053126 Ga0500621_104158 Ga0500621_104158_312_704 128
1029 3300053129 Ga0500628_048126 Ga0500628_048126_317_709 128
1030 3300053131 Ga0500652_009284 Ga0500652_009284_2010_2402 128
1031 3300053131 Ga0500652_282806 Ga0500652_282806_52_444 128
1032 3300053134 Ga0500658_0003289 Ga0500658_0003289_4579_4971 128
1033 3300053136 Ga0500559_0144810 Ga0500559_0144810_507_899 128
1034 3300053136 Ga0500559_0381026 Ga0500559_0381026_188_580 128
1035 3300053137 Ga0500561_0000719 Ga0500561_0000719_1288_1680 128
1036 3300053140 Ga0500573_0004777 Ga0500573_0004777_6381_6773 128
1037 3300053140 Ga0500573_0025166 Ga0500573_0025166_2653_3045 128
1038 3300053140 Ga0500573_0143800 Ga0500573_0143800_307_699 128
1039 3300053142 Ga0500577_0167810 Ga0500577_0167810_296_715 128
1040 3300053143 Ga0500579_033415 Ga0500579_033415_1903_2295 128
1041 3300053149 Ga0500600_0022644 Ga0500600_0022644_1477_1869 128
1042 3300053149 Ga0500600_0193322 Ga0500600_0193322_467_859 128
1043 3300053150 Ga0500603_159476 Ga0500603_159476_272_664 128
1044 3300053153 Ga0500616_0019242 Ga0500616_0019242_1981_2373 128
1045 3300053160 Ga0500633_0000323 Ga0500633_0000323_5230_5622 128
1046 3300053160 Ga0500633_0167843 Ga0500633_0167843_101_520 128
1047 3300053161 Ga0500634_0050684 Ga0500634_0050684_138_530 128
1048 3300053177 Ga0500636_0491563 Ga0500636_0491563_110_502 128
1049 3300053178 Ga0500637_0417640 Ga0500637_0417640_22_411 128
1050 3300053732 Ga0500656_001749 Ga0500656_001749_1088_1480 128
1051 3300053739 Ga0500587_005962 Ga0500587_005962_917_1309 128
1052 3300054114 Ga0501084_0020844 Ga0501084_0020844_1322_1714 128
1053 3300054114 Ga0501084_0085233 Ga0501084_0085233_642_1034 128
1054 3300059424 Ga0590075_029891 Ga0590075_029891_544_936 128
1055 3300059492 Ga0587073_0157947 Ga0587073_0157947_85_477 128
1056 3300059508 Ga0587088_135006 Ga0587088_135006_90_482 128
1057 3300059509 Ga0587089_114224 Ga0587089_114224_92_484 128
1058 3300059511 Ga0587091_236711 Ga0587091_236711_90_482 128
1059 3300059512 Ga0587092_086480 Ga0587092_086480_65_457 128
1060 3300059604 Ga0587098_064776 Ga0587098_064776_94_486 128
1061 3300059605 Ga0587106_008852 Ga0587106_008852_761_1153 128
1062 3300059605 Ga0587106_071356 Ga0587106_071356_145_537 128
1063 3300059607 Ga0587125_065590 Ga0587125_065590_73_465 128
1064 3300059626 Ga0587115_117074 Ga0587115_117074_41_433 128
1065 3300059628 Ga0587122_022878 Ga0587122_022878_47_439 128
1066 3300059639 Ga0587062_073449 Ga0587062_073449_145_576 128
1067 3300059640 Ga0587067_055686 Ga0587067_055686_59_451 128
1068 3300059641 Ga0587068_142120 Ga0587068_142120_93_485 128
1069 3300059643 Ga0587072_184510 Ga0587072_184510_77_469 128
1070 3300059644 Ga0587075_152803 Ga0587075_152803_39_431 128
1071 3300059652 Ga0587107_102603 Ga0587107_102603_93_485 128
1072 3300059653 Ga0587108_031698 Ga0587108_031698_101_493 128
1073 3300060346 Ga0587111_0124372 Ga0587111_0124372_192_584 128
1074 3300060346 Ga0587111_0182248 Ga0587111_0182248_96_488 128
1075 3300060353 Ga0501082_0014461 Ga0501082_0014461_1383_1775 128
1076 3300060353 Ga0501082_0153158 Ga0501082_0153158_632_1024 128
1077 3300061719 Ga0466962_0000572 Ga0466962_0000572_13348_13752 128
1078 3300061719 Ga0466962_0000635 Ga0466962_0000635_4758_5150 128
1079 3300061719 Ga0466962_0052208 Ga0466962_0052208_1283_1675 128
1080 3300061719 Ga0466962_0055762 Ga0466962_0055762_604_996 128
1081 3300061719 Ga0466962_0132716 Ga0466962_0132716_16_420 128
1082 3300061719 Ga0466962_0220632 Ga0466962_0220632_519_908 128
1083 3300061719 Ga0466962_0236502 Ga0466962_0236502_360_749 128
1084 3300061719 Ga0466962_0266643 Ga0466962_0266643_407_811 128
1085 3300061734 Ga0530510_0030267 Ga0530510_0030267_3284_3682 128
1086 3300061734 Ga0530510_0187467 Ga0530510_0187467_1081_1473 128
1087 3300061734 Ga0530510_0382341 Ga0530510_0382341_454_846 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20704

NucS_shadow

NucS shadow ORF

24

157

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6scs-assembly1.cif.gz_B cell division protein sepf in complex with c-terminal domain of ftsz 0.5945 36 102
2e3u-assembly1.cif.gz_A crystal structure analysis of dim2p from pyrococcus horikoshii ot3 0.5871 50 120
3p04-assembly1.cif.gz_B crystal structure of the bcr protein from corynebacterium glutamicum. northeast structural genomics consortium target cgr8 0.5691 36 102
3dnp-assembly1.cif.gz_A-2 crystal structure of stress response protein yhax from bacillus subtilis 0.5557 76 103
3u1k-assembly1.cif.gz_A crystal structure of human pnpase 0.549 52 112
ID Description Score Start End Superfamily
af_Q9V9X7_601_667_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.5893 52 110 3.30.1370.10
af_A0A1D6KQA2_168_268_3.30.110.60 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;YhbY-like 0.5868 36 103 3.30.110.60
af_Q965N3_575_638_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.584 52 108 3.30.1370.10
af_I1N5X8_128_222_3.30.110.60 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;YhbY-like 0.5806 39 103 3.30.110.60
3niwA02 Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2; 0.5737 51 102 3.30.1240.10
ID Description Score Start End GO Terms
AF-A0A5P9Z4B8-F1-model_v4 merged 0.9926 1 128
AF-A0A1H3UHL4-F1-model_v4 Uncharacterized protein 0.9884 1 128
AF-A0A429AYY8-F1-model_v4 Uncharacterized protein 0.9865 1 128
AF-A0A6G2RZC3-F1-model_v4 Uncharacterized protein 0.9848 1 128
AF-A0A1V9KFX3-F1-model_v4 Uncharacterized protein 0.9843 1 128

Feature Viewer

pLDDT pTM Quality
95.1 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map