F489814
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1087 | 535 | 988 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300047317|Ga0495604_0372664|Ga0495604_0372664_150_623 |
| Length | 157 |
| Sequence | MWRQADPEPGACRRIPIGKESSDMSLDVSPDLLARAEAGEITDEEFAACVRTSLPYAWQMVSDLATLFHVDGGGETGFVDNRTPPPDEQARGQLLRALASDSIRGCLERYFGVRLAFQNCHRVAVFPKDPSQYSDSYRSFTSVRAQLLNQSPELRDC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090003 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN | Metagenome | Rhizosphere |
| 2 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 3 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 4 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 5 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 6 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 7 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 8 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 9 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 10 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 11 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 12 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 13 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 14 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 15 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 16 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 17 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 18 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 19 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 20 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 21 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 22 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 23 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 24 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 25 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 26 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 27 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 28 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 29 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 30 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 31 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 32 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 33 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 34 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 35 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 36 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 37 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 38 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 39 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 40 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 41 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 42 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 43 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 44 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 45 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 46 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 47 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 48 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 49 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 50 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 51 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 52 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 53 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 54 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 55 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 56 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 57 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 58 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 59 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 60 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 61 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 62 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 63 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 64 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 65 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 66 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 67 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 68 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 69 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 70 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 71 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 72 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 73 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 74 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 75 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 76 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 77 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 78 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 79 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 80 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 81 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 82 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 83 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 84 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 86 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 87 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 88 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 89 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 90 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 91 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 92 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 93 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 94 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 95 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 98 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 110 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 115 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 117 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 118 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 119 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 120 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 121 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 122 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 123 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 124 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 126 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 127 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 128 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 129 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 132 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 133 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 147 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 154 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 163 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 170 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 171 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300028019 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 | Metagenome | Unclassified |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300029282 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 | Metatranscriptome | Rhizosphere |
| 219 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 220 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 222 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 223 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 224 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 225 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 226 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 227 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 228 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 229 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 230 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 231 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 232 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 233 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 234 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 238 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 243 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 246 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 256 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 257 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 258 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 259 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 260 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 261 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 263 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 265 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 266 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 267 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 268 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 269 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 270 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 271 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 272 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 273 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 274 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 275 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 276 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 277 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 278 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 279 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 280 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 281 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 282 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 283 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 284 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 285 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 286 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 287 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 288 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 289 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 290 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 291 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 292 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 293 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 294 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 295 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 296 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 299 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 300 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 301 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 302 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 303 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 304 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 305 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 306 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 307 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 308 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 309 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 398 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 399 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 400 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 401 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 403 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 404 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 405 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 441 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 442 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 447 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 448 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 452 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 453 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 454 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 455 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 459 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 461 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 463 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 464 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 465 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 466 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 467 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 468 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 469 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 470 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 471 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 472 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 473 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 474 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 475 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 476 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 477 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 478 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 479 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 480 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 481 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 482 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 483 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 484 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 485 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 486 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 487 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 488 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 489 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 490 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 491 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 492 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 494 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 510 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 511 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 514 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 515 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 516 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 517 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 518 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 519 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 520 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 521 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 522 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 523 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 524 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 525 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 526 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 527 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 528 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 529 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 530 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 531 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 532 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 533 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 534 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 535 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.61 |
| Metatranscriptomes | 8.28 |
| Isolates | 9.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.8 |
| Nodule | 0.55 |
| Rhizoplane | 1.38 |
| Rhizosphere | 81.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJN_F6ESG4R02HG44S | 2088090003 | Bacteria | 505 |
| 2 | JGI24737J22298_10094530 | 3300001990 | Bacteria | 886 |
| 3 | JGI24735J21928_10057026 | 3300002067 | Bacteria | 1124 |
| 4 | JGI24738J21930_10027978 | 3300002075 | Bacteria | 1154 |
| 5 | Ga0006759J45824_1023985 | 3300003163 | Bacteria | 556 |
| 6 | JGI25406J46586_10008092 | 3300003203 | Bacteria | 4774 |
| 7 | Ga0006777J48905_1041869 | 3300003308 | Bacteria | 603 |
| 8 | Ga0006777J48905_1052988 | 3300003308 | Bacteria | 554 |
| 9 | rootH2_10038439 | 3300003320 | Bacteria | 1601 |
| 10 | rootH2_10038440 | 3300003320 | Bacteria | 1529 |
| 11 | rootH2_10115779 | 3300003320 | Bacteria | 1726 |
| 12 | rootH2_10134987 | 3300003320 | Bacteria | 1371 |
| 13 | rootL2_10015814 | 3300003322 | Bacteria | 1699 |
| 14 | rootL2_10015815 | 3300003322 | Bacteria | 2035 |
| 15 | rootH1_10005533 | 3300003323 | Bacteria | 1777 |
| 16 | rootH1_10005534 | 3300003323 | Bacteria | 1916 |
| 17 | JGI25160J50197_1029327 | 3300003354 | Bacteria | 1457 |
| 18 | Ga0007427J51700_128208 | 3300003559 | Bacteria | 570 |
| 19 | Ga0007410J51695_1021724 | 3300003574 | Bacteria | 541 |
| 20 | Ga0007409J51694_1026987 | 3300003575 | Bacteria | 580 |
| 21 | Ga0006562J51391_1014857 | 3300003578 | Bacteria | 736 |
| 22 | Ga0007429J51699_1037609 | 3300003579 | Bacteria | 541 |
| 23 | Ga0032354_1040524 | 3300003693 | Bacteria | 586 |
| 24 | Ga0058863_11440945 | 3300004799 | Bacteria | 514 |
| 25 | Ga0058863_11726019 | 3300004799 | Bacteria | 600 |
| 26 | Ga0058862_12758211 | 3300004803 | Bacteria | 536 |
| 27 | Ga0070683_100632655 | 3300005329 | Bacteria | 1024 |
| 28 | Ga0070666_10823944 | 3300005335 | Bacteria | 684 |
| 29 | Ga0070660_100196781 | 3300005339 | Bacteria | 1634 |
| 30 | Ga0070660_101897774 | 3300005339 | Bacteria | 508 |
| 31 | Ga0070667_100030080 | 3300005367 | Bacteria | 4529 |
| 32 | Ga0070667_100481019 | 3300005367 | Bacteria | 1137 |
| 33 | Ga0070709_10155399 | 3300005434 | Bacteria | 1585 |
| 34 | Ga0070709_10904676 | 3300005434 | Bacteria | 698 |
| 35 | Ga0070714_100007466 | 3300005435 | Bacteria | 8513 |
| 36 | Ga0070714_100398704 | 3300005435 | Bacteria | 1300 |
| 37 | Ga0070714_100474817 | 3300005435 | Bacteria | 1190 |
| 38 | Ga0070714_100652588 | 3300005435 | Bacteria | 1013 |
| 39 | Ga0070714_100761519 | 3300005435 | Bacteria | 936 |
| 40 | Ga0070714_102133102 | 3300005435 | Unclassified | 546 |
| 41 | Ga0070713_100109119 | 3300005436 | Bacteria | 2410 |
| 42 | Ga0070713_100285818 | 3300005436 | Bacteria | 1514 |
| 43 | Ga0070713_101282585 | 3300005436 | Bacteria | 710 |
| 44 | Ga0070710_11266586 | 3300005437 | Bacteria | 547 |
| 45 | Ga0070711_100727525 | 3300005439 | Bacteria | 837 |
| 46 | Ga0070711_101507223 | 3300005439 | Bacteria | 587 |
| 47 | Ga0070708_100001822 | 3300005445 | Bacteria | 16341 |
| 48 | Ga0070708_100318666 | 3300005445 | Bacteria | 1465 |
| 49 | Ga0070708_100853808 | 3300005445 | Bacteria | 855 |
| 50 | Ga0070663_100300651 | 3300005455 | Bacteria | 1284 |
| 51 | Ga0070681_10053792 | 3300005458 | Bacteria | 4011 |
| 52 | Ga0070706_100021707 | 3300005467 | Bacteria | 5913 |
| 53 | Ga0070706_100133047 | 3300005467 | Bacteria | 2321 |
| 54 | Ga0070706_100507703 | 3300005467 | Bacteria | 1122 |
| 55 | Ga0070706_100780091 | 3300005467 | Bacteria | 885 |
| 56 | Ga0070707_100535360 | 3300005468 | Bacteria | 1133 |
| 57 | Ga0070698_100044076 | 3300005471 | Bacteria | 4570 |
| 58 | Ga0070698_100045313 | 3300005471 | Bacteria | 4502 |
| 59 | Ga0070698_100250027 | 3300005471 | Bacteria | 1706 |
| 60 | Ga0070698_100594151 | 3300005471 | Bacteria | 1047 |
| 61 | Ga0070699_100412515 | 3300005518 | Bacteria | 1222 |
| 62 | Ga0068853_100047259 | 3300005539 | Bacteria | 3693 |
| 63 | Ga0068853_100054346 | 3300005539 | Bacteria | 3451 |
| 64 | Ga0070665_100014993 | 3300005548 | Bacteria | 7779 |
| 65 | Ga0070665_100179347 | 3300005548 | Bacteria | 2119 |
| 66 | Ga0070665_100471533 | 3300005548 | Bacteria | 1266 |
| 67 | Ga0068855_100013371 | 3300005563 | Bacteria | 9899 |
| 68 | Ga0068855_102443224 | 3300005563 | Bacteria | 521 |
| 69 | Ga0068854_100058685 | 3300005578 | Bacteria | 2779 |
| 70 | Ga0068856_100142964 | 3300005614 | Bacteria | 2400 |
| 71 | Ga0068856_100546987 | 3300005614 | Bacteria | 1179 |
| 72 | Ga0068852_100071678 | 3300005616 | Bacteria | 3043 |
| 73 | Ga0068860_101389325 | 3300005843 | Bacteria | 723 |
| 74 | Ga0081455_10074548 | 3300005937 | Bacteria | 2802 |
| 75 | Ga0081538_10000602 | 3300005981 | Bacteria | 39838 |
| 76 | Ga0081539_10000177 | 3300005985 | Bacteria | 149939 |
| 77 | Ga0070717_10457761 | 3300006028 | Bacteria | 1150 |
| 78 | Ga0070717_11450355 | 3300006028 | Bacteria | 623 |
| 79 | Ga0075365_10413876 | 3300006038 | Bacteria | 952 |
| 80 | Ga0075365_10959514 | 3300006038 | Bacteria | 603 |
| 81 | Ga0075365_11261057 | 3300006038 | Bacteria | 520 |
| 82 | Ga0075368_10011789 | 3300006042 | Bacteria | 3188 |
| 83 | Ga0075363_100013133 | 3300006048 | Bacteria | 4005 |
| 84 | Ga0075363_100418568 | 3300006048 | Bacteria | 789 |
| 85 | Ga0075363_100657769 | 3300006048 | Bacteria | 631 |
| 86 | Ga0075364_10920925 | 3300006051 | Bacteria | 595 |
| 87 | Ga0070715_10011216 | 3300006163 | Bacteria | 3221 |
| 88 | Ga0070715_10265494 | 3300006163 | Bacteria | 903 |
| 89 | Ga0070712_100103005 | 3300006175 | Bacteria | 2115 |
| 90 | Ga0070712_100263361 | 3300006175 | Bacteria | 1382 |
| 91 | Ga0070712_101296475 | 3300006175 | Unclassified | 635 |
| 92 | Ga0075367_10011939 | 3300006178 | Bacteria | 4615 |
| 93 | Ga0099826_10090081 | 3300006948 | Bacteria | 1879 |
| 94 | Ga0105251_10011572 | 3300009011 | Bacteria | 5034 |
| 95 | Ga0105244_10074219 | 3300009036 | Bacteria | 1692 |
| 96 | Ga0105244_10448287 | 3300009036 | Bacteria | 594 |
| 97 | Ga0105250_10119467 | 3300009092 | Bacteria | 1082 |
| 98 | Ga0105240_10029108 | 3300009093 | Bacteria | 7202 |
| 99 | Ga0105245_10120323 | 3300009098 | Bacteria | 2452 |
| 100 | Ga0105245_10743002 | 3300009098 | Bacteria | 1017 |
| 101 | Ga0105245_11586482 | 3300009098 | Bacteria | 706 |
| 102 | Ga0105243_10178280 | 3300009148 | Bacteria | 1846 |
| 103 | Ga0105241_10004696 | 3300009174 | Bacteria | 10088 |
| 104 | Ga0105242_11310203 | 3300009176 | Bacteria | 748 |
| 105 | Ga0105242_12280952 | 3300009176 | Bacteria | 587 |
| 106 | Ga0105248_11865327 | 3300009177 | Bacteria | 682 |
| 107 | Ga0105237_10034889 | 3300009545 | Bacteria | 5091 |
| 108 | Ga0105237_11387945 | 3300009545 | Bacteria | 709 |
| 109 | Ga0105237_12051727 | 3300009545 | Bacteria | 581 |
| 110 | Ga0105238_10015709 | 3300009551 | Bacteria | 7664 |
| 111 | Ga0105239_10106549 | 3300010375 | Bacteria | 3105 |
| 112 | Ga0105239_10151882 | 3300010375 | Bacteria | 2585 |
| 113 | Ga0105239_10387042 | 3300010375 | Unclassified | 1581 |
| 114 | Ga0105239_11234579 | 3300010375 | Bacteria | 862 |
| 115 | Ga0105246_10256826 | 3300011119 | Bacteria | 1390 |
| 116 | Ga0105246_10335098 | 3300011119 | Bacteria | 1234 |
| 117 | Ga0105246_10534636 | 3300011119 | Bacteria | 1002 |
| 118 | Ga0157322_1006037 | 3300012490 | Bacteria | 853 |
| 119 | Ga0154016_120640 | 3300013045 | Bacteria | 751 |
| 120 | Ga0154012_105953 | 3300013059 | Bacteria | 875 |
| 121 | Ga0157369_10259557 | 3300013105 | Bacteria | 1812 |
| 122 | Ga0157369_10354398 | 3300013105 | Bacteria | 1524 |
| 123 | Ga0157369_10571963 | 3300013105 | Bacteria | 1167 |
| 124 | Ga0157374_10075017 | 3300013296 | Bacteria | 3196 |
| 125 | Ga0157372_10465578 | 3300013307 | Bacteria | 1473 |
| 126 | Ga0157372_10700796 | 3300013307 | Bacteria | 1178 |
| 127 | Ga0157375_11201230 | 3300013308 | Bacteria | 890 |
| 128 | Ga0182008_10003296 | 3300014497 | Bacteria | 9827 |
| 129 | Ga0182006_1049148 | 3300015261 | Bacteria | 1629 |
| 130 | Ga0182007_10021380 | 3300015262 | Bacteria | 2299 |
| 131 | Ga0182005_1049193 | 3300015265 | Bacteria | 1146 |
| 132 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 133 | Ga0163161_10337773 | 3300017792 | Bacteria | 1194 |
| 134 | Ga0197907_10200592 | 3300020069 | Bacteria | 756 |
| 135 | Ga0197907_10230676 | 3300020069 | Bacteria | 770 |
| 136 | Ga0197907_10704798 | 3300020069 | Bacteria | 725 |
| 137 | Ga0197907_10708005 | 3300020069 | Bacteria | 766 |
| 138 | Ga0206356_11000058 | 3300020070 | Bacteria | 823 |
| 139 | Ga0206356_11607154 | 3300020070 | Bacteria | 623 |
| 140 | Ga0206349_1011289 | 3300020075 | Bacteria | 656 |
| 141 | Ga0206349_1353168 | 3300020075 | Bacteria | 785 |
| 142 | Ga0206355_1522735 | 3300020076 | Bacteria | 755 |
| 143 | Ga0206355_1634198 | 3300020076 | Bacteria | 720 |
| 144 | Ga0206351_10011824 | 3300020077 | Bacteria | 730 |
| 145 | Ga0206351_10405507 | 3300020077 | Bacteria | 598 |
| 146 | Ga0206351_10415879 | 3300020077 | Bacteria | 596 |
| 147 | Ga0206351_10965487 | 3300020077 | Unclassified | 548 |
| 148 | Ga0206352_10222767 | 3300020078 | Bacteria | 710 |
| 149 | Ga0206352_10338841 | 3300020078 | Bacteria | 716 |
| 150 | Ga0206352_10427184 | 3300020078 | Unclassified | 764 |
| 151 | Ga0206352_10962197 | 3300020078 | Bacteria | 924 |
| 152 | Ga0206352_11212980 | 3300020078 | Bacteria | 754 |
| 153 | Ga0206352_11223151 | 3300020078 | Bacteria | 916 |
| 154 | Ga0206352_11302190 | 3300020078 | Bacteria | 516 |
| 155 | Ga0206350_10496801 | 3300020080 | Bacteria | 810 |
| 156 | Ga0206350_10617434 | 3300020080 | Bacteria | 1434 |
| 157 | Ga0206350_10854241 | 3300020080 | Bacteria | 761 |
| 158 | Ga0206350_11643667 | 3300020080 | Bacteria | 723 |
| 159 | Ga0206354_10598026 | 3300020081 | Bacteria | 590 |
| 160 | Ga0206354_10676087 | 3300020081 | Bacteria | 904 |
| 161 | Ga0206354_10967460 | 3300020081 | Bacteria | 535 |
| 162 | Ga0206354_11241012 | 3300020081 | Bacteria | 632 |
| 163 | Ga0206353_10176331 | 3300020082 | Bacteria | 568 |
| 164 | Ga0206353_10412605 | 3300020082 | Bacteria | 722 |
| 165 | Ga0206353_10584668 | 3300020082 | Bacteria | 548 |
| 166 | Ga0206353_10786963 | 3300020082 | Bacteria | 1278 |
| 167 | Ga0206353_11078754 | 3300020082 | Bacteria | 816 |
| 168 | Ga0154015_1053415 | 3300020610 | Bacteria | 675 |
| 169 | Ga0213874_10054940 | 3300021377 | Unclassified | 1232 |
| 170 | Ga0213875_10001996 | 3300021388 | Bacteria | 12603 |
| 171 | Ga0224712_10121282 | 3300022467 | Bacteria | 1132 |
| 172 | Ga0224712_10238402 | 3300022467 | Bacteria | 837 |
| 173 | Ga0224712_10253202 | 3300022467 | Bacteria | 814 |
| 174 | Ga0224712_10598646 | 3300022467 | Bacteria | 538 |
| 175 | Ga0224712_10617934 | 3300022467 | Bacteria | 530 |
| 176 | Ga0224712_10640531 | 3300022467 | Bacteria | 521 |
| 177 | Ga0209673_1070969 | 3300025273 | Bacteria | 829 |
| 178 | Ga0209758_1008145 | 3300025297 | Bacteria | 6889 |
| 179 | Ga0207426_1001450 | 3300025302 | Bacteria | 19608 |
| 180 | Ga0207426_1025097 | 3300025302 | Bacteria | 2011 |
| 181 | Ga0207426_1034160 | 3300025302 | Bacteria | 1633 |
| 182 | Ga0207426_1038839 | 3300025302 | Bacteria | 1496 |
| 183 | Ga0207656_10729185 | 3300025321 | Bacteria | 508 |
| 184 | Ga0207696_1064574 | 3300025711 | Bacteria | 1025 |
| 185 | Ga0207713_1054939 | 3300025735 | Bacteria | 1557 |
| 186 | Ga0207688_10373228 | 3300025901 | Bacteria | 882 |
| 187 | Ga0207680_10691276 | 3300025903 | Bacteria | 731 |
| 188 | Ga0207647_10003737 | 3300025904 | Bacteria | 11380 |
| 189 | Ga0207647_10015250 | 3300025904 | Bacteria | 5275 |
| 190 | Ga0207685_10115157 | 3300025905 | Bacteria | 1171 |
| 191 | Ga0207699_10134114 | 3300025906 | Bacteria | 1619 |
| 192 | Ga0207643_10753530 | 3300025908 | Bacteria | 630 |
| 193 | Ga0207684_10047679 | 3300025910 | Bacteria | 3634 |
| 194 | Ga0207684_10112199 | 3300025910 | Bacteria | 2334 |
| 195 | Ga0207654_10039292 | 3300025911 | Bacteria | 2661 |
| 196 | Ga0207707_10012054 | 3300025912 | Bacteria | 7518 |
| 197 | Ga0207695_10010754 | 3300025913 | Bacteria | 11164 |
| 198 | Ga0207671_10004875 | 3300025914 | Bacteria | 12621 |
| 199 | Ga0207671_10673415 | 3300025914 | Bacteria | 823 |
| 200 | Ga0207671_11563059 | 3300025914 | Bacteria | 508 |
| 201 | Ga0207693_10250350 | 3300025915 | Bacteria | 1390 |
| 202 | Ga0207693_10336397 | 3300025915 | Bacteria | 1182 |
| 203 | Ga0207657_10418932 | 3300025919 | Bacteria | 1053 |
| 204 | Ga0207657_11074365 | 3300025919 | Bacteria | 616 |
| 205 | Ga0207646_10413441 | 3300025922 | Bacteria | 1218 |
| 206 | Ga0207694_10007071 | 3300025924 | Bacteria | 8522 |
| 207 | Ga0207694_10428848 | 3300025924 | Bacteria | 1102 |
| 208 | Ga0207687_10073268 | 3300025927 | Bacteria | 2452 |
| 209 | Ga0207687_10514744 | 3300025927 | Bacteria | 1000 |
| 210 | Ga0207687_11359671 | 3300025927 | Bacteria | 610 |
| 211 | Ga0207700_10027338 | 3300025928 | Bacteria | 3993 |
| 212 | Ga0207700_10030939 | 3300025928 | Bacteria | 3797 |
| 213 | Ga0207700_10211518 | 3300025928 | Bacteria | 1640 |
| 214 | Ga0207700_10265550 | 3300025928 | Bacteria | 1471 |
| 215 | Ga0207700_10696906 | 3300025928 | Bacteria | 906 |
| 216 | Ga0207664_10004838 | 3300025929 | Bacteria | 9154 |
| 217 | Ga0207664_10020227 | 3300025929 | Bacteria | 4931 |
| 218 | Ga0207664_10149837 | 3300025929 | Bacteria | 1981 |
| 219 | Ga0207664_10788458 | 3300025929 | Unclassified | 855 |
| 220 | Ga0207664_10893585 | 3300025929 | Bacteria | 798 |
| 221 | Ga0207686_10811076 | 3300025934 | Bacteria | 751 |
| 222 | Ga0207709_10139376 | 3300025935 | Bacteria | 1665 |
| 223 | Ga0207691_10176268 | 3300025940 | Bacteria | 1870 |
| 224 | Ga0207711_11138999 | 3300025941 | Bacteria | 721 |
| 225 | Ga0207661_10669176 | 3300025944 | Bacteria | 954 |
| 226 | Ga0207667_11316262 | 3300025949 | Bacteria | 698 |
| 227 | Ga0207668_11311363 | 3300025972 | Bacteria | 652 |
| 228 | Ga0207640_10043405 | 3300025981 | Bacteria | 2873 |
| 229 | Ga0207640_10908081 | 3300025981 | Bacteria | 770 |
| 230 | Ga0207658_10020850 | 3300025986 | Bacteria | 4541 |
| 231 | Ga0207639_10051086 | 3300026041 | Bacteria | 3143 |
| 232 | Ga0207639_10784360 | 3300026041 | Bacteria | 887 |
| 233 | Ga0207639_11156113 | 3300026041 | Bacteria | 726 |
| 234 | Ga0207678_10035603 | 3300026067 | Bacteria | 4333 |
| 235 | Ga0207702_10259524 | 3300026078 | Bacteria | 1635 |
| 236 | Ga0207702_11630333 | 3300026078 | Bacteria | 638 |
| 237 | Ga0207683_11473167 | 3300026121 | Bacteria | 629 |
| 238 | Ga0209371_1007342 | 3300027312 | Bacteria | 3858 |
| 239 | Ga0209371_1041852 | 3300027312 | Bacteria | 925 |
| 240 | Ga0209282_1328291 | 3300027666 | Bacteria | 637 |
| 241 | Ga0209813_10027116 | 3300027866 | Bacteria | 1661 |
| 242 | Ga0224573_1014732 | 3300028019 | Bacteria | 606 |
| 243 | Ga0268266_10135758 | 3300028379 | Bacteria | 2203 |
| 244 | Ga0268266_11379203 | 3300028379 | Bacteria | 680 |
| 245 | Ga0268264_11202145 | 3300028381 | Bacteria | 767 |
| 246 | Ga0307517_10003614 | 3300028786 | Bacteria | 24021 |
| 247 | Ga0307517_10018520 | 3300028786 | Bacteria | 9000 |
| 248 | Ga0307517_10367052 | 3300028786 | Bacteria | 775 |
| 249 | Ga0307515_10004012 | 3300028794 | Bacteria | 30728 |
| 250 | Ga0307515_10160116 | 3300028794 | Bacteria | 2301 |
| 251 | Ga0307515_10301566 | 3300028794 | Bacteria | 1286 |
| 252 | Ga0265338_10826467 | 3300028800 | Bacteria | 634 |
| 253 | Ga0311003_121122 | 3300029282 | Bacteria | 526 |
| 254 | Ga0310981_1089018 | 3300029285 | Bacteria | 523 |
| 255 | Ga0310981_1096449 | 3300029285 | Bacteria | 636 |
| 256 | Ga0265324_10070180 | 3300029957 | Bacteria | 1194 |
| 257 | Ga0268256_1007098 | 3300030500 | Bacteria | 4053 |
| 258 | Ga0268256_1047445 | 3300030500 | Bacteria | 925 |
| 259 | Ga0268256_1059971 | 3300030500 | Bacteria | 767 |
| 260 | Ga0307511_10062864 | 3300030521 | Bacteria | 2812 |
| 261 | Ga0307512_10002762 | 3300030522 | Bacteria | 21451 |
| 262 | Ga0307512_10016900 | 3300030522 | Bacteria | 6718 |
| 263 | Ga0307512_10027864 | 3300030522 | Bacteria | 4963 |
| 264 | Ga0307512_10060614 | 3300030522 | Bacteria | 2923 |
| 265 | Ga0316177_1141283 | 3300030731 | Bacteria | 771 |
| 266 | Ga0316176_1011376 | 3300030732 | Bacteria | 943 |
| 267 | Ga0314311_1203010 | 3300030733 | Bacteria | 647 |
| 268 | Ga0316178_1060430 | 3300030735 | Bacteria | 1287 |
| 269 | Ga0316180_1105364 | 3300030736 | Bacteria | 810 |
| 270 | Ga0316183_1196293 | 3300030742 | Bacteria | 1296 |
| 271 | Ga0316181_1206647 | 3300030744 | Bacteria | 1609 |
| 272 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 273 | Ga0307513_10006763 | 3300031456 | Bacteria | 14959 |
| 274 | Ga0307513_10013386 | 3300031456 | Bacteria | 10069 |
| 275 | Ga0307513_10021476 | 3300031456 | Bacteria | 7621 |
| 276 | Ga0307513_10063901 | 3300031456 | Bacteria | 3882 |
| 277 | Ga0307509_10151820 | 3300031507 | Bacteria | 2230 |
| 278 | Ga0307509_10444491 | 3300031507 | Bacteria | 992 |
| 279 | Ga0307508_10013541 | 3300031616 | Bacteria | 7454 |
| 280 | Ga0307508_10021854 | 3300031616 | Bacteria | 5821 |
| 281 | Ga0307508_10047272 | 3300031616 | Bacteria | 3839 |
| 282 | Ga0307508_10102787 | 3300031616 | Bacteria | 2454 |
| 283 | Ga0307508_10137600 | 3300031616 | Bacteria | 2045 |
| 284 | Ga0307508_10461738 | 3300031616 | Bacteria | 863 |
| 285 | Ga0307514_10009038 | 3300031649 | Bacteria | 8415 |
| 286 | Ga0307514_10068734 | 3300031649 | Bacteria | 2669 |
| 287 | Ga0307514_10069439 | 3300031649 | Bacteria | 2651 |
| 288 | Ga0307514_10072409 | 3300031649 | Bacteria | 2581 |
| 289 | Ga0307514_10194055 | 3300031649 | Bacteria | 1288 |
| 290 | Ga0307514_10541582 | 3300031649 | Bacteria | 540 |
| 291 | Ga0307516_10011933 | 3300031730 | Bacteria | 9398 |
| 292 | Ga0307516_10073687 | 3300031730 | Bacteria | 3271 |
| 293 | Ga0307516_10085486 | 3300031730 | Bacteria | 2992 |
| 294 | Ga0307516_10471169 | 3300031730 | Bacteria | 911 |
| 295 | Ga0307516_10671228 | 3300031730 | Bacteria | 692 |
| 296 | Ga0307405_11161838 | 3300031731 | Bacteria | 666 |
| 297 | Ga0307413_10181917 | 3300031824 | Bacteria | 1500 |
| 298 | Ga0307518_10625368 | 3300031838 | Bacteria | 506 |
| 299 | Ga0307410_10112499 | 3300031852 | Bacteria | 1972 |
| 300 | Ga0307412_10749149 | 3300031911 | Bacteria | 843 |
| 301 | Ga0307416_101136349 | 3300032002 | Bacteria | 886 |
| 302 | Ga0307416_101320259 | 3300032002 | Bacteria | 827 |
| 303 | Ga0307416_102933116 | 3300032002 | Unclassified | 571 |
| 304 | Ga0307411_10019959 | 3300032005 | Bacteria | 3885 |
| 305 | Ga0307507_10000024 | 3300033179 | Bacteria | 212340 |
| 306 | Ga0307507_10045345 | 3300033179 | Bacteria | 4327 |
| 307 | Ga0307507_10046672 | 3300033179 | Bacteria | 4242 |
| 308 | Ga0307507_10347002 | 3300033179 | Bacteria | 875 |
| 309 | Ga0307510_10012527 | 3300033180 | Bacteria | 10058 |
| 310 | Ga0307510_10042716 | 3300033180 | Bacteria | 4936 |
| 311 | Ga0307510_10406050 | 3300033180 | Bacteria | 805 |
| 312 | Ga0307510_10483010 | 3300033180 | Bacteria | 680 |
| 313 | Ga0316214_1065596 | 3300033545 | Bacteria | 533 |
| 314 | Ga0373933_0014212 | 3300035724 | Bacteria | 4422 |
| 315 | Ga0373933_0032249 | 3300035724 | Unclassified | 3044 |
| 316 | Ga0373933_0424616 | 3300035724 | Unclassified | 868 |
| 317 | Ga0373925_0000348 | 3300037068 | Bacteria | 48026 |
| 318 | Ga0395899_0106055 | 3300037312 | Bacteria | 2024 |
| 319 | Ga0395900_0473095 | 3300037418 | Bacteria | 1206 |
| 320 | Ga0395898_0029604 | 3300037466 | Bacteria | 5481 |
| 321 | Ga0395898_0310377 | 3300037466 | Bacteria | 1504 |
| 322 | Ga0395905_0101042 | 3300037471 | Bacteria | 2708 |
| 323 | Ga0436364_0162507 | 3300037853 | Bacteria | 90260 |
| 324 | Ga0436364_0268454 | 3300037853 | Bacteria | 2309 |
| 325 | Ga0395901_0014818 | 3300038443 | Bacteria | 7921 |
| 326 | Ga0395901_0505392 | 3300038443 | Bacteria | 1230 |
| 327 | Ga0436365_0220139 | 3300039437 | Bacteria | 562 |
| 328 | Ga0436365_0654894 | 3300039437 | Unclassified | 951 |
| 329 | Ga0436363_0115510 | 3300039450 | Bacteria | 533 |
| 330 | Ga0436363_0671136 | 3300039450 | Bacteria | 720 |
| 331 | Ga0436363_1105319 | 3300039450 | Bacteria | 2081 |
| 332 | Ga0439436_0003937 | 3300041404 | Bacteria | 4555 |
| 333 | Ga0439436_0010487 | 3300041404 | Bacteria | 2824 |
| 334 | Ga0439436_0040854 | 3300041404 | Bacteria | 1328 |
| 335 | Ga0439439_0002096 | 3300041406 | Bacteria | 4162 |
| 336 | Ga0439439_0004871 | 3300041406 | Bacteria | 3041 |
| 337 | Ga0439439_0099970 | 3300041406 | Bacteria | 798 |
| 338 | Ga0439466_0060717 | 3300041411 | Bacteria | 1218 |
| 339 | Ga0439465_0241022 | 3300041413 | Bacteria | 667 |
| 340 | Ga0451790_05773 | 3300041444 | Bacteria | 523 |
| 341 | Ga0451802_0862397 | 3300041460 | Bacteria | 2427 |
| 342 | Ga0451805_108507 | 3300041461 | Bacteria | 523 |
| 343 | Ga0451804_0235254 | 3300041463 | Unclassified | 544 |
| 344 | Ga0451804_0942079 | 3300041463 | Bacteria | 585 |
| 345 | Ga0451837_0921921 | 3300041494 | Bacteria | 3498 |
| 346 | Ga0451839_0641366 | 3300041496 | Bacteria | 1244 |
| 347 | Ga0451841_0721461 | 3300041498 | Bacteria | 1014 |
| 348 | Ga0451845_0441870 | 3300041501 | Bacteria | 1388 |
| 349 | Ga0451846_16207 | 3300041502 | Bacteria | 546 |
| 350 | Ga0451850_26095 | 3300041506 | Bacteria | 559 |
| 351 | Ga0451851_0375984 | 3300041507 | Bacteria | 1406 |
| 352 | Ga0451843_0606551 | 3300041509 | Bacteria | 2138 |
| 353 | Ga0451854_32235 | 3300041510 | Bacteria | 658 |
| 354 | Ga0451853_2612288 | 3300041512 | Bacteria | 2806 |
| 355 | Ga0439431_0068049 | 3300041997 | Bacteria | 945 |
| 356 | Ga0439433_0000632 | 3300041999 | Bacteria | 6730 |
| 357 | Ga0439433_0021444 | 3300041999 | Bacteria | 1445 |
| 358 | Ga0439442_006630 | 3300042002 | Bacteria | 2325 |
| 359 | Ga0439442_069300 | 3300042002 | Bacteria | 750 |
| 360 | Ga0439448_0036930 | 3300042005 | Bacteria | 1568 |
| 361 | Ga0439448_0049286 | 3300042005 | Bacteria | 1376 |
| 362 | Ga0439449_0001150 | 3300042007 | Bacteria | 10383 |
| 363 | Ga0439449_0002175 | 3300042007 | Bacteria | 7704 |
| 364 | Ga0439449_0012546 | 3300042007 | Bacteria | 3187 |
| 365 | Ga0439449_0175661 | 3300042007 | Bacteria | 800 |
| 366 | Ga0439450_026846 | 3300042008 | Bacteria | 1272 |
| 367 | Ga0439454_006489 | 3300042011 | Bacteria | 1441 |
| 368 | Ga0439455_0002135 | 3300042012 | Bacteria | 3535 |
| 369 | Ga0439457_000481 | 3300042014 | Bacteria | 11518 |
| 370 | Ga0439457_003831 | 3300042014 | Bacteria | 4032 |
| 371 | Ga0439457_062779 | 3300042014 | Bacteria | 843 |
| 372 | Ga0439457_098290 | 3300042014 | Bacteria | 681 |
| 373 | Ga0439457_174325 | 3300042014 | Bacteria | 523 |
| 374 | Ga0450920_032484 | 3300042122 | Bacteria | 1030 |
| 375 | Ga0450894_000022 | 3300042131 | Bacteria | 21795 |
| 376 | Ga0450896_001115 | 3300042133 | Bacteria | 3188 |
| 377 | Ga0450898_073904 | 3300042134 | Bacteria | 686 |
| 378 | Ga0450899_000954 | 3300042135 | Bacteria | 3282 |
| 379 | Ga0450900_028781 | 3300042136 | Bacteria | 801 |
| 380 | Ga0450903_000614 | 3300042138 | Bacteria | 7198 |
| 381 | Ga0450906_012450 | 3300042145 | Bacteria | 1576 |
| 382 | Ga0439458_0003368 | 3300042157 | Bacteria | 3747 |
| 383 | Ga0439434_0225600 | 3300042435 | Bacteria | 637 |
| 384 | Ga0439459_0220617 | 3300042438 | Bacteria | 525 |
| 385 | Ga0466969_0000400 | 3300044656 | Bacteria | 23837 |
| 386 | Ga0466969_0001309 | 3300044656 | Bacteria | 13412 |
| 387 | Ga0466969_0005724 | 3300044656 | Bacteria | 6607 |
| 388 | Ga0466969_0016641 | 3300044656 | Bacteria | 3846 |
| 389 | Ga0466969_0030439 | 3300044656 | Bacteria | 2750 |
| 390 | Ga0466969_0045691 | 3300044656 | Bacteria | 2173 |
| 391 | Ga0466969_0062623 | 3300044656 | Bacteria | 1804 |
| 392 | Ga0466969_0207428 | 3300044656 | Bacteria | 893 |
| 393 | Ga0466969_0296867 | 3300044656 | Bacteria | 731 |
| 394 | Ga0466972_0004075 | 3300044658 | Bacteria | 7297 |
| 395 | Ga0466972_0005652 | 3300044658 | Bacteria | 6274 |
| 396 | Ga0466972_0006093 | 3300044658 | Bacteria | 6056 |
| 397 | Ga0466972_0034156 | 3300044658 | Bacteria | 2493 |
| 398 | Ga0466972_0096600 | 3300044658 | Unclassified | 1399 |
| 399 | Ga0466972_0126891 | 3300044658 | Bacteria | 1202 |
| 400 | Ga0466972_0394132 | 3300044658 | Bacteria | 649 |
| 401 | Ga0466965_0000907 | 3300044683 | Bacteria | 11336 |
| 402 | Ga0466965_0090009 | 3300044683 | Bacteria | 1560 |
| 403 | Ga0466965_0608063 | 3300044683 | Bacteria | 621 |
| 404 | Ga0466965_0947458 | 3300044683 | Bacteria | 504 |
| 405 | Ga0466966_0000534 | 3300044684 | Bacteria | 24194 |
| 406 | Ga0466966_0002876 | 3300044684 | Bacteria | 11337 |
| 407 | Ga0466966_0018275 | 3300044684 | Bacteria | 4625 |
| 408 | Ga0466966_0021345 | 3300044684 | Bacteria | 4252 |
| 409 | Ga0466966_0038389 | 3300044684 | Bacteria | 3086 |
| 410 | Ga0466966_0111153 | 3300044684 | Bacteria | 1689 |
| 411 | Ga0466966_0119917 | 3300044684 | Bacteria | 1616 |
| 412 | Ga0466966_0162762 | 3300044684 | Bacteria | 1358 |
| 413 | Ga0466966_0260761 | 3300044684 | Bacteria | 1044 |
| 414 | Ga0466961_0000308 | 3300044693 | Bacteria | 32406 |
| 415 | Ga0466961_0002104 | 3300044693 | Bacteria | 12391 |
| 416 | Ga0466961_0011811 | 3300044693 | Bacteria | 5582 |
| 417 | Ga0466961_0013999 | 3300044693 | Bacteria | 5142 |
| 418 | Ga0466961_0031962 | 3300044693 | Bacteria | 3382 |
| 419 | Ga0466961_0106941 | 3300044693 | Bacteria | 1761 |
| 420 | Ga0466961_0123710 | 3300044693 | Bacteria | 1623 |
| 421 | Ga0466961_0134222 | 3300044693 | Unclassified | 1551 |
| 422 | Ga0466961_0259370 | 3300044693 | Bacteria | 1066 |
| 423 | Ga0466961_0520584 | 3300044693 | Bacteria | 717 |
| 424 | Ga0466963_0067775 | 3300044694 | Bacteria | 2395 |
| 425 | Ga0466963_0318208 | 3300044694 | Bacteria | 1095 |
| 426 | Ga0466964_0029133 | 3300044706 | Bacteria | 2178 |
| 427 | Ga0466964_0076919 | 3300044706 | Bacteria | 1424 |
| 428 | Ga0466971_0000332 | 3300044719 | Bacteria | 18072 |
| 429 | Ga0466971_0000463 | 3300044719 | Bacteria | 15866 |
| 430 | Ga0466971_0048653 | 3300044719 | Bacteria | 1906 |
| 431 | Ga0466971_0093045 | 3300044719 | Bacteria | 1381 |
| 432 | Ga0466971_0218186 | 3300044719 | Bacteria | 903 |
| 433 | Ga0466968_0000051 | 3300044735 | Bacteria | 33313 |
| 434 | Ga0466968_0014055 | 3300044735 | Bacteria | 3158 |
| 435 | Ga0466968_0476928 | 3300044735 | Bacteria | 619 |
| 436 | Ga0466968_0514955 | 3300044735 | Bacteria | 597 |
| 437 | Ga0466968_0535518 | 3300044735 | Bacteria | 586 |
| 438 | Ga0466970_0000145 | 3300044765 | Bacteria | 32723 |
| 439 | Ga0466970_0004998 | 3300044765 | Bacteria | 6550 |
| 440 | Ga0466970_0014443 | 3300044765 | Bacteria | 4055 |
| 441 | Ga0466970_0044429 | 3300044765 | Bacteria | 2365 |
| 442 | Ga0466970_0080766 | 3300044765 | Bacteria | 1757 |
| 443 | Ga0466970_0254963 | 3300044765 | Unclassified | 983 |
| 444 | Ga0466970_0265705 | 3300044765 | Bacteria | 963 |
| 445 | Ga0466970_0397530 | 3300044765 | Bacteria | 786 |
| 446 | Ga0466970_0418366 | 3300044765 | Bacteria | 766 |
| 447 | Ga0466970_0593999 | 3300044765 | Unclassified | 642 |
| 448 | Ga0466970_0635632 | 3300044765 | Bacteria | 620 |
| 449 | Ga0466957_0006604 | 3300044842 | Bacteria | 6560 |
| 450 | Ga0466957_0121381 | 3300044842 | Bacteria | 1666 |
| 451 | Ga0466957_0205918 | 3300044842 | Bacteria | 1294 |
| 452 | Ga0466957_0295524 | 3300044842 | Bacteria | 1087 |
| 453 | Ga0466957_0368705 | 3300044842 | Bacteria | 977 |
| 454 | Ga0466957_0521283 | 3300044842 | Bacteria | 826 |
| 455 | Ga0466957_1165670 | 3300044842 | Bacteria | 557 |
| 456 | Ga0466957_1281957 | 3300044842 | Bacteria | 531 |
| 457 | Ga0466960_0013352 | 3300044901 | Bacteria | 3487 |
| 458 | Ga0466960_0242572 | 3300044901 | Bacteria | 998 |
| 459 | Ga0466959_0000668 | 3300045049 | Bacteria | 20018 |
| 460 | Ga0466959_0002190 | 3300045049 | Bacteria | 12428 |
| 461 | Ga0466959_0004032 | 3300045049 | Bacteria | 9762 |
| 462 | Ga0466959_0015896 | 3300045049 | Bacteria | 5491 |
| 463 | Ga0466959_0030947 | 3300045049 | Bacteria | 3962 |
| 464 | Ga0466959_0046010 | 3300045049 | Bacteria | 3212 |
| 465 | Ga0466959_0084983 | 3300045049 | Bacteria | 2278 |
| 466 | Ga0466959_0200536 | 3300045049 | Bacteria | 1389 |
| 467 | Ga0466959_0446168 | 3300045049 | Bacteria | 877 |
| 468 | Ga0466958_0000773 | 3300045836 | Bacteria | 14072 |
| 469 | Ga0466958_0103073 | 3300045836 | Bacteria | 1776 |
| 470 | Ga0466958_0165811 | 3300045836 | Bacteria | 1397 |
| 471 | Ga0466958_0310163 | 3300045836 | Bacteria | 1013 |
| 472 | Ga0466958_0689249 | 3300045836 | Bacteria | 665 |
| 473 | Ga0466967_0038433 | 3300045976 | Bacteria | 4105 |
| 474 | Ga0466967_0040073 | 3300045976 | Bacteria | 4031 |
| 475 | Ga0466967_0061682 | 3300045976 | Bacteria | 3327 |
| 476 | Ga0466967_0516550 | 3300045976 | Bacteria | 1173 |
| 477 | Ga0466967_1091721 | 3300045976 | Bacteria | 795 |
| 478 | Ga0495617_024406 | 3300046452 | Bacteria | 2040 |
| 479 | Ga0495627_044002 | 3300046453 | Bacteria | 1364 |
| 480 | Ga0495592_0048333 | 3300046454 | Bacteria | 3165 |
| 481 | Ga0495592_0060598 | 3300046454 | Bacteria | 2783 |
| 482 | Ga0495592_0087256 | 3300046454 | Bacteria | 2245 |
| 483 | Ga0495592_0225487 | 3300046454 | Bacteria | 1250 |
| 484 | Ga0495603_0000638 | 3300046455 | Bacteria | 19717 |
| 485 | Ga0495603_0001879 | 3300046455 | Bacteria | 12388 |
| 486 | Ga0495603_0005158 | 3300046455 | Bacteria | 7803 |
| 487 | Ga0495603_0023079 | 3300046455 | Bacteria | 3766 |
| 488 | Ga0495603_0026665 | 3300046455 | Bacteria | 3490 |
| 489 | Ga0495603_0063291 | 3300046455 | Bacteria | 2182 |
| 490 | Ga0495590_0308109 | 3300046457 | Bacteria | 596 |
| 491 | Ga0495629_0001217 | 3300046459 | Bacteria | 20212 |
| 492 | Ga0495629_0003212 | 3300046459 | Bacteria | 12366 |
| 493 | Ga0495629_0007463 | 3300046459 | Bacteria | 8056 |
| 494 | Ga0495629_0019525 | 3300046459 | Bacteria | 4840 |
| 495 | Ga0495629_0050969 | 3300046459 | Bacteria | 2897 |
| 496 | Ga0495629_0073348 | 3300046459 | Bacteria | 2390 |
| 497 | Ga0495629_0111160 | 3300046459 | Bacteria | 1910 |
| 498 | Ga0495629_1093796 | 3300046459 | Bacteria | 515 |
| 499 | Ga0495638_0020561 | 3300046460 | Bacteria | 4360 |
| 500 | Ga0495638_0049586 | 3300046460 | Bacteria | 2625 |
| 501 | Ga0495638_0180924 | 3300046460 | Bacteria | 1203 |
| 502 | Ga0495638_0216315 | 3300046460 | Bacteria | 1073 |
| 503 | Ga0495638_0234738 | 3300046460 | Bacteria | 1018 |
| 504 | Ga0495641_0159489 | 3300046461 | Bacteria | 1009 |
| 505 | Ga0495651_0000752 | 3300046462 | Bacteria | 25055 |
| 506 | Ga0495651_0000989 | 3300046462 | Bacteria | 22069 |
| 507 | Ga0495651_0001909 | 3300046462 | Bacteria | 16139 |
| 508 | Ga0495651_0187091 | 3300046462 | Bacteria | 1460 |
| 509 | Ga0495651_0741986 | 3300046462 | Bacteria | 609 |
| 510 | Ga0495653_0101896 | 3300046463 | Bacteria | 2079 |
| 511 | Ga0495582_0137865 | 3300046473 | Bacteria | 1381 |
| 512 | Ga0495582_0286255 | 3300046473 | Bacteria | 947 |
| 513 | Ga0495605_0016690 | 3300046474 | Bacteria | 3970 |
| 514 | Ga0495662_0000804 | 3300046476 | Bacteria | 15227 |
| 515 | Ga0495662_0018436 | 3300046476 | Bacteria | 3378 |
| 516 | Ga0495664_0001534 | 3300046477 | Bacteria | 12218 |
| 517 | Ga0495664_0054271 | 3300046477 | Bacteria | 2383 |
| 518 | Ga0495664_0763251 | 3300046477 | Bacteria | 569 |
| 519 | Ga0495584_0024076 | 3300046491 | Bacteria | 3087 |
| 520 | Ga0495585_0010037 | 3300046492 | Bacteria | 5656 |
| 521 | Ga0495585_0056404 | 3300046492 | Bacteria | 2169 |
| 522 | Ga0495585_0057137 | 3300046492 | Bacteria | 2154 |
| 523 | Ga0495585_0114767 | 3300046492 | Bacteria | 1429 |
| 524 | Ga0495585_0183403 | 3300046492 | Bacteria | 1075 |
| 525 | Ga0495594_0001615 | 3300046499 | Bacteria | 11732 |
| 526 | Ga0495594_0038933 | 3300046499 | Bacteria | 2597 |
| 527 | Ga0495594_0053658 | 3300046499 | Bacteria | 2220 |
| 528 | Ga0495594_0108551 | 3300046499 | Bacteria | 1564 |
| 529 | Ga0495596_0097190 | 3300046500 | Bacteria | 1143 |
| 530 | Ga0495596_0137373 | 3300046500 | Bacteria | 949 |
| 531 | Ga0495607_0035092 | 3300046501 | Bacteria | 3037 |
| 532 | Ga0495607_0073669 | 3300046501 | Bacteria | 1897 |
| 533 | Ga0495583_0121650 | 3300046506 | Bacteria | 1098 |
| 534 | Ga0495583_0178411 | 3300046506 | Bacteria | 870 |
| 535 | Ga0495606_0021860 | 3300046507 | Bacteria | 4678 |
| 536 | Ga0495608_0280901 | 3300046511 | Bacteria | 1033 |
| 537 | Ga0495610_0050106 | 3300046512 | Bacteria | 2040 |
| 538 | Ga0495616_0003394 | 3300046513 | Bacteria | 10209 |
| 539 | Ga0495620_0011476 | 3300046515 | Bacteria | 4621 |
| 540 | Ga0495628_0001200 | 3300046516 | Bacteria | 23680 |
| 541 | Ga0495628_0183377 | 3300046516 | Bacteria | 1582 |
| 542 | Ga0495628_0369201 | 3300046516 | Bacteria | 1052 |
| 543 | Ga0495628_0885675 | 3300046516 | Bacteria | 620 |
| 544 | Ga0495630_0005265 | 3300046517 | Bacteria | 9127 |
| 545 | Ga0495630_0225832 | 3300046517 | Bacteria | 1430 |
| 546 | Ga0495630_0254616 | 3300046517 | Bacteria | 1341 |
| 547 | Ga0495631_0046728 | 3300046518 | Bacteria | 1902 |
| 548 | Ga0495631_0058036 | 3300046518 | Bacteria | 1683 |
| 549 | Ga0495631_0145178 | 3300046518 | Bacteria | 1018 |
| 550 | Ga0495631_0331775 | 3300046518 | Bacteria | 647 |
| 551 | Ga0495632_0329541 | 3300046519 | Bacteria | 673 |
| 552 | Ga0495637_0034789 | 3300046520 | Bacteria | 2204 |
| 553 | Ga0495637_0112670 | 3300046520 | Bacteria | 1053 |
| 554 | Ga0495643_0001610 | 3300046522 | Bacteria | 19994 |
| 555 | Ga0495643_0002300 | 3300046522 | Bacteria | 15428 |
| 556 | Ga0495643_0305890 | 3300046522 | Bacteria | 723 |
| 557 | Ga0495644_0091979 | 3300046523 | Bacteria | 1145 |
| 558 | Ga0495644_0121416 | 3300046523 | Bacteria | 994 |
| 559 | Ga0495648_0066584 | 3300046524 | Bacteria | 2111 |
| 560 | Ga0495648_0192116 | 3300046524 | Bacteria | 1029 |
| 561 | Ga0495666_0047319 | 3300046526 | Bacteria | 2071 |
| 562 | Ga0495666_0162104 | 3300046526 | Bacteria | 1037 |
| 563 | Ga0495666_0176513 | 3300046526 | Bacteria | 987 |
| 564 | Ga0495642_0048827 | 3300046528 | Bacteria | 1737 |
| 565 | Ga0495652_0000586 | 3300046529 | Bacteria | 42555 |
| 566 | Ga0495652_0002867 | 3300046529 | Bacteria | 17391 |
| 567 | Ga0495652_0020630 | 3300046529 | Bacteria | 5857 |
| 568 | Ga0495652_0239473 | 3300046529 | Bacteria | 1351 |
| 569 | Ga0495652_0429479 | 3300046529 | Bacteria | 929 |
| 570 | Ga0495654_0033076 | 3300046530 | Bacteria | 2618 |
| 571 | Ga0495640_0005552 | 3300046533 | Bacteria | 10028 |
| 572 | Ga0495640_0010404 | 3300046533 | Bacteria | 7195 |
| 573 | Ga0495640_0035007 | 3300046533 | Bacteria | 3556 |
| 574 | Ga0495586_0147133 | 3300046535 | Bacteria | 1324 |
| 575 | Ga0495587_0001229 | 3300046536 | Bacteria | 16979 |
| 576 | Ga0495587_0106106 | 3300046536 | Bacteria | 1616 |
| 577 | Ga0495609_0012628 | 3300046538 | Bacteria | 4005 |
| 578 | Ga0495609_0144931 | 3300046538 | Bacteria | 1012 |
| 579 | Ga0495597_0014194 | 3300046542 | Bacteria | 3796 |
| 580 | Ga0495597_0040776 | 3300046542 | Bacteria | 2075 |
| 581 | Ga0495645_0005253 | 3300046543 | Bacteria | 8866 |
| 582 | Ga0495645_0014240 | 3300046543 | Bacteria | 5640 |
| 583 | Ga0495645_0055025 | 3300046543 | Bacteria | 2890 |
| 584 | Ga0495645_0081590 | 3300046543 | Bacteria | 2320 |
| 585 | Ga0495622_0064679 | 3300046557 | Bacteria | 1691 |
| 586 | Ga0495622_0065555 | 3300046557 | Bacteria | 1679 |
| 587 | Ga0495622_0120786 | 3300046557 | Bacteria | 1196 |
| 588 | Ga0495622_0125871 | 3300046557 | Bacteria | 1168 |
| 589 | Ga0495622_0183450 | 3300046557 | Bacteria | 938 |
| 590 | Ga0495622_0335613 | 3300046557 | Bacteria | 655 |
| 591 | Ga0495633_0008493 | 3300046558 | Bacteria | 5776 |
| 592 | Ga0495633_0133167 | 3300046558 | Bacteria | 1150 |
| 593 | Ga0495633_0304652 | 3300046558 | Bacteria | 724 |
| 594 | Ga0495667_0350488 | 3300046559 | Bacteria | 932 |
| 595 | Ga0495668_0042882 | 3300046616 | Bacteria | 2518 |
| 596 | Ga0495668_0137291 | 3300046616 | Bacteria | 1338 |
| 597 | Ga0495634_0001818 | 3300046642 | Bacteria | 18414 |
| 598 | Ga0495634_0045317 | 3300046642 | Bacteria | 2974 |
| 599 | Ga0495634_0088769 | 3300046642 | Bacteria | 2010 |
| 600 | Ga0495611_0013050 | 3300046648 | Bacteria | 3533 |
| 601 | Ga0495611_0036490 | 3300046648 | Bacteria | 2181 |
| 602 | Ga0495611_0053131 | 3300046648 | Bacteria | 1828 |
| 603 | Ga0495625_0021558 | 3300046660 | Bacteria | 4958 |
| 604 | Ga0495625_0035084 | 3300046660 | Bacteria | 3698 |
| 605 | Ga0495625_0152743 | 3300046660 | Bacteria | 1551 |
| 606 | Ga0495625_0744739 | 3300046660 | Bacteria | 575 |
| 607 | Ga0495635_0000586 | 3300046663 | Bacteria | 23438 |
| 608 | Ga0495635_0003044 | 3300046663 | Bacteria | 11523 |
| 609 | Ga0495635_0098026 | 3300046663 | Bacteria | 2004 |
| 610 | Ga0495659_0304416 | 3300046664 | Bacteria | 674 |
| 611 | Ga0495661_0017649 | 3300046665 | Bacteria | 4709 |
| 612 | Ga0495661_0302359 | 3300046665 | Bacteria | 800 |
| 613 | Ga0495588_0013636 | 3300046674 | Bacteria | 3873 |
| 614 | Ga0495588_0016192 | 3300046674 | Bacteria | 3600 |
| 615 | Ga0495588_0031500 | 3300046674 | Bacteria | 2669 |
| 616 | Ga0495588_0188139 | 3300046674 | Bacteria | 1090 |
| 617 | Ga0495657_0000796 | 3300046675 | Bacteria | 28012 |
| 618 | Ga0495657_0023246 | 3300046675 | Bacteria | 4430 |
| 619 | Ga0495657_0237580 | 3300046675 | Bacteria | 1100 |
| 620 | Ga0495657_0693902 | 3300046675 | Bacteria | 585 |
| 621 | Ga0495599_0112865 | 3300046678 | Bacteria | 1692 |
| 622 | Ga0495599_0262766 | 3300046678 | Bacteria | 1048 |
| 623 | Ga0495623_0029613 | 3300046679 | Bacteria | 3523 |
| 624 | Ga0495623_0205831 | 3300046679 | Bacteria | 1129 |
| 625 | Ga0495623_0298730 | 3300046679 | Bacteria | 890 |
| 626 | Ga0495646_0002293 | 3300046680 | Bacteria | 11696 |
| 627 | Ga0495646_0027540 | 3300046680 | Bacteria | 3565 |
| 628 | Ga0495646_0201664 | 3300046680 | Bacteria | 1083 |
| 629 | Ga0495646_0306774 | 3300046680 | Bacteria | 838 |
| 630 | Ga0495658_0049798 | 3300046683 | Bacteria | 2367 |
| 631 | Ga0495658_0057579 | 3300046683 | Bacteria | 2220 |
| 632 | Ga0495613_0002324 | 3300046689 | Bacteria | 14400 |
| 633 | Ga0495613_0025321 | 3300046689 | Bacteria | 4421 |
| 634 | Ga0495613_0079557 | 3300046689 | Bacteria | 2383 |
| 635 | Ga0495613_0120711 | 3300046689 | Bacteria | 1882 |
| 636 | Ga0495613_0171071 | 3300046689 | Bacteria | 1542 |
| 637 | Ga0495613_0234335 | 3300046689 | Bacteria | 1285 |
| 638 | Ga0495624_0088479 | 3300046690 | Bacteria | 1912 |
| 639 | Ga0495624_0104000 | 3300046690 | Bacteria | 1747 |
| 640 | Ga0495670_0039497 | 3300046691 | Bacteria | 2354 |
| 641 | Ga0495670_0165579 | 3300046691 | Bacteria | 1163 |
| 642 | Ga0495670_0361067 | 3300046691 | Bacteria | 782 |
| 643 | Ga0495671_0003815 | 3300046692 | Bacteria | 9165 |
| 644 | Ga0495649_0054498 | 3300046694 | Bacteria | 2162 |
| 645 | Ga0495649_0110071 | 3300046694 | Bacteria | 1461 |
| 646 | Ga0495589_0006450 | 3300046794 | Bacteria | 6186 |
| 647 | Ga0495589_0033221 | 3300046794 | Bacteria | 2592 |
| 648 | Ga0495589_0048666 | 3300046794 | Bacteria | 2098 |
| 649 | Ga0495589_0078242 | 3300046794 | Bacteria | 1610 |
| 650 | Ga0495600_0001390 | 3300046809 | Bacteria | 13370 |
| 651 | Ga0495600_0003691 | 3300046809 | Bacteria | 9041 |
| 652 | Ga0495600_0006527 | 3300046809 | Bacteria | 7099 |
| 653 | Ga0495600_0043331 | 3300046809 | Bacteria | 2935 |
| 654 | Ga0495600_0052676 | 3300046809 | Bacteria | 2657 |
| 655 | Ga0495660_0035201 | 3300046810 | Bacteria | 2799 |
| 656 | Ga0495581_0004218 | 3300047315 | Bacteria | 8283 |
| 657 | Ga0495581_0051070 | 3300047315 | Bacteria | 2388 |
| 658 | Ga0495581_0106775 | 3300047315 | Bacteria | 1627 |
| 659 | Ga0495581_0180188 | 3300047315 | Bacteria | 1235 |
| 660 | Ga0495604_0000695 | 3300047317 | Bacteria | 28567 |
| 661 | Ga0495604_0004263 | 3300047317 | Bacteria | 11322 |
| 662 | Ga0495604_0031309 | 3300047317 | Bacteria | 4220 |
| 663 | Ga0495604_0079704 | 3300047317 | Bacteria | 2455 |
| 664 | Ga0495604_0372664 | 3300047317 | Bacteria | 945 |
| 665 | Ga0495636_0002781 | 3300047318 | Bacteria | 6752 |
| 666 | Ga0495636_0007046 | 3300047318 | Bacteria | 4422 |
| 667 | Ga0495636_0022839 | 3300047318 | Bacteria | 2531 |
| 668 | Ga0495636_0045118 | 3300047318 | Bacteria | 1837 |
| 669 | Ga0495636_0065687 | 3300047318 | Bacteria | 1541 |
| 670 | Ga0495674_0256906 | 3300047319 | Bacteria | 1436 |
| 671 | Ga0495672_0028599 | 3300047320 | Bacteria | 3523 |
| 672 | Ga0495676_0007640 | 3300047321 | Bacteria | 9915 |
| 673 | Ga0495676_0009942 | 3300047321 | Bacteria | 8642 |
| 674 | Ga0495676_0028414 | 3300047321 | Bacteria | 4775 |
| 675 | Ga0495680_0096193 | 3300047322 | Bacteria | 2212 |
| 676 | Ga0495683_0019687 | 3300047323 | Bacteria | 3483 |
| 677 | Ga0495683_0083660 | 3300047323 | Bacteria | 1553 |
| 678 | Ga0495683_0090897 | 3300047323 | Bacteria | 1479 |
| 679 | Ga0495687_003278 | 3300047443 | Bacteria | 11919 |
| 680 | Ga0495687_005559 | 3300047443 | Bacteria | 7993 |
| 681 | Ga0495687_019035 | 3300047443 | Bacteria | 3379 |
| 682 | Ga0495687_020827 | 3300047443 | Bacteria | 3188 |
| 683 | Ga0495675_0068124 | 3300047444 | Bacteria | 2248 |
| 684 | Ga0495675_0366072 | 3300047444 | Bacteria | 845 |
| 685 | Ga0495675_0550835 | 3300047444 | Bacteria | 658 |
| 686 | Ga0495677_0068192 | 3300047445 | Bacteria | 1324 |
| 687 | Ga0495677_0304151 | 3300047445 | Bacteria | 627 |
| 688 | Ga0495679_036338 | 3300047446 | Bacteria | 1556 |
| 689 | Ga0495679_045759 | 3300047446 | Bacteria | 1335 |
| 690 | Ga0495685_001698 | 3300047447 | Bacteria | 6783 |
| 691 | Ga0495685_007252 | 3300047447 | Bacteria | 3656 |
| 692 | Ga0495685_007505 | 3300047447 | Bacteria | 3602 |
| 693 | Ga0495685_010371 | 3300047447 | Bacteria | 3123 |
| 694 | Ga0495685_012966 | 3300047447 | Bacteria | 2826 |
| 695 | Ga0495673_0130076 | 3300047469 | Bacteria | 990 |
| 696 | Ga0495681_0000484 | 3300047470 | Bacteria | 30579 |
| 697 | Ga0495681_0362849 | 3300047470 | Bacteria | 548 |
| 698 | Ga0495684_0017005 | 3300047471 | Bacteria | 5604 |
| 699 | Ga0495684_0316784 | 3300047471 | Bacteria | 1116 |
| 700 | Ga0495686_0012981 | 3300047472 | Bacteria | 5804 |
| 701 | Ga0495686_0017187 | 3300047472 | Bacteria | 4881 |
| 702 | Ga0495686_0058569 | 3300047472 | Bacteria | 2401 |
| 703 | Ga0495593_0001318 | 3300047673 | Bacteria | 14549 |
| 704 | Ga0495593_0033161 | 3300047673 | Bacteria | 2813 |
| 705 | Ga0495602_0048486 | 3300048088 | Bacteria | 3816 |
| 706 | Ga0495602_0741135 | 3300048088 | Bacteria | 664 |
| 707 | Ga0495614_0000529 | 3300048089 | Bacteria | 15758 |
| 708 | Ga0495614_0001808 | 3300048089 | Bacteria | 9365 |
| 709 | Ga0495614_0059165 | 3300048089 | Bacteria | 1646 |
| 710 | Ga0495614_0318058 | 3300048089 | Bacteria | 721 |
| 711 | Ga0495614_0580472 | 3300048089 | Bacteria | 537 |
| 712 | Ga0495626_0063393 | 3300048091 | Bacteria | 1677 |
| 713 | Ga0496102_0833904 | 3300048905 | Bacteria | 844 |
| 714 | Ga0496104_0344186 | 3300048907 | Bacteria | 1404 |
| 715 | Ga0496104_1718297 | 3300048907 | Bacteria | 530 |
| 716 | Ga0496105_0482043 | 3300048908 | Bacteria | 976 |
| 717 | Ga0496106_0339334 | 3300048909 | Bacteria | 1207 |
| 718 | Ga0496108_0077340 | 3300048911 | Bacteria | 2814 |
| 719 | Ga0496111_0185931 | 3300048914 | Bacteria | 1545 |
| 720 | Ga0496113_0200630 | 3300048916 | Bacteria | 1586 |
| 721 | Ga0496113_1404487 | 3300048916 | Bacteria | 541 |
| 722 | Ga0496126_0030170 | 3300048929 | Bacteria | 5141 |
| 723 | Ga0496126_1038570 | 3300048929 | Bacteria | 612 |
| 724 | Ga0501306_051309 | 3300049127 | Bacteria | 662 |
| 725 | Ga0501308_038226 | 3300049128 | Bacteria | 668 |
| 726 | Ga0501309_099916 | 3300049129 | Bacteria | 502 |
| 727 | Ga0501304_023281 | 3300049160 | Bacteria | 626 |
| 728 | Ga0501305_106765 | 3300049161 | Bacteria | 526 |
| 729 | Ga0501307_063577 | 3300049162 | Bacteria | 577 |
| 730 | Ga0495678_056769 | 3300049459 | Bacteria | 1486 |
| 731 | Ga0495682_0065758 | 3300049460 | Bacteria | 1307 |
| 732 | Ga0501315_069559 | 3300049531 | Bacteria | 582 |
| 733 | Ga0501031_0007283 | 3300049568 | Bacteria | 7221 |
| 734 | Ga0501031_0021237 | 3300049568 | Bacteria | 4233 |
| 735 | Ga0501031_0033610 | 3300049568 | Bacteria | 3346 |
| 736 | Ga0501031_0168019 | 3300049568 | Bacteria | 1433 |
| 737 | Ga0501031_0419558 | 3300049568 | Bacteria | 865 |
| 738 | Ga0501032_0001990 | 3300049569 | Bacteria | 16091 |
| 739 | Ga0501032_0039760 | 3300049569 | Bacteria | 3198 |
| 740 | Ga0501032_0042190 | 3300049569 | Bacteria | 3095 |
| 741 | Ga0501032_0046767 | 3300049569 | Bacteria | 2924 |
| 742 | Ga0501032_0098405 | 3300049569 | Bacteria | 1938 |
| 743 | Ga0501032_0292053 | 3300049569 | Bacteria | 1055 |
| 744 | Ga0501032_0330186 | 3300049569 | Bacteria | 983 |
| 745 | Ga0501033_0009919 | 3300049570 | Bacteria | 7312 |
| 746 | Ga0501033_0030574 | 3300049570 | Bacteria | 4046 |
| 747 | Ga0501033_0092653 | 3300049570 | Bacteria | 2209 |
| 748 | Ga0501033_0152049 | 3300049570 | Bacteria | 1669 |
| 749 | Ga0501033_0174966 | 3300049570 | Bacteria | 1540 |
| 750 | Ga0501033_0240627 | 3300049570 | Bacteria | 1284 |
| 751 | Ga0501033_0444803 | 3300049570 | Bacteria | 901 |
| 752 | Ga0501034_0005363 | 3300049571 | Bacteria | 14038 |
| 753 | Ga0501034_0005698 | 3300049571 | Bacteria | 13538 |
| 754 | Ga0501034_0018502 | 3300049571 | Bacteria | 7143 |
| 755 | Ga0501034_0060680 | 3300049571 | Bacteria | 3798 |
| 756 | Ga0501034_0089866 | 3300049571 | Bacteria | 3069 |
| 757 | Ga0501034_0097780 | 3300049571 | Bacteria | 2931 |
| 758 | Ga0501034_0151625 | 3300049571 | Bacteria | 2293 |
| 759 | Ga0501034_0510163 | 3300049571 | Bacteria | 1115 |
| 760 | Ga0501034_0959366 | 3300049571 | Bacteria | 740 |
| 761 | Ga0501034_1089096 | 3300049571 | Bacteria | 680 |
| 762 | Ga0501036_0000553 | 3300049572 | Bacteria | 26858 |
| 763 | Ga0501036_0010697 | 3300049572 | Bacteria | 7584 |
| 764 | Ga0501036_0023104 | 3300049572 | Bacteria | 5234 |
| 765 | Ga0501036_0032873 | 3300049572 | Bacteria | 4386 |
| 766 | Ga0501036_0051941 | 3300049572 | Bacteria | 3471 |
| 767 | Ga0501036_0087173 | 3300049572 | Bacteria | 2639 |
| 768 | Ga0501036_0298239 | 3300049572 | Bacteria | 1348 |
| 769 | Ga0501036_0557796 | 3300049572 | Bacteria | 951 |
| 770 | Ga0501037_0002550 | 3300049573 | Bacteria | 13171 |
| 771 | Ga0501037_0030551 | 3300049573 | Bacteria | 3981 |
| 772 | Ga0501037_0050338 | 3300049573 | Bacteria | 3049 |
| 773 | Ga0501037_0072793 | 3300049573 | Unclassified | 2499 |
| 774 | Ga0501037_0155175 | 3300049573 | Bacteria | 1634 |
| 775 | Ga0501037_0217993 | 3300049573 | Bacteria | 1343 |
| 776 | Ga0501037_0228775 | 3300049573 | Bacteria | 1306 |
| 777 | Ga0501038_0002207 | 3300049574 | Bacteria | 18105 |
| 778 | Ga0501038_0005677 | 3300049574 | Bacteria | 11575 |
| 779 | Ga0501038_0014436 | 3300049574 | Bacteria | 7200 |
| 780 | Ga0501038_0014677 | 3300049574 | Bacteria | 7139 |
| 781 | Ga0501038_0061328 | 3300049574 | Bacteria | 3216 |
| 782 | Ga0501038_0070220 | 3300049574 | Bacteria | 2974 |
| 783 | Ga0501038_0149106 | 3300049574 | Bacteria | 1908 |
| 784 | Ga0501038_0390960 | 3300049574 | Bacteria | 1077 |
| 785 | Ga0501038_0393492 | 3300049574 | Bacteria | 1073 |
| 786 | Ga0501039_0002645 | 3300049575 | Bacteria | 13380 |
| 787 | Ga0501039_0015464 | 3300049575 | Bacteria | 5842 |
| 788 | Ga0501039_0032315 | 3300049575 | Bacteria | 4034 |
| 789 | Ga0501039_0830449 | 3300049575 | Bacteria | 720 |
| 790 | Ga0501039_1356548 | 3300049575 | Bacteria | 548 |
| 791 | Ga0501040_0040801 | 3300049576 | Bacteria | 3159 |
| 792 | Ga0501040_0890790 | 3300049576 | Bacteria | 644 |
| 793 | Ga0501040_0929819 | 3300049576 | Bacteria | 630 |
| 794 | Ga0501041_0000849 | 3300049577 | Bacteria | 16447 |
| 795 | Ga0501041_0561274 | 3300049577 | Bacteria | 728 |
| 796 | Ga0501042_0001880 | 3300049578 | Bacteria | 12601 |
| 797 | Ga0501042_0028160 | 3300049578 | Bacteria | 3955 |
| 798 | Ga0501042_0196332 | 3300049578 | Bacteria | 1455 |
| 799 | Ga0501042_0391904 | 3300049578 | Bacteria | 1006 |
| 800 | Ga0501042_1201338 | 3300049578 | Bacteria | 553 |
| 801 | Ga0501043_0005890 | 3300049579 | Bacteria | 9861 |
| 802 | Ga0501043_0009787 | 3300049579 | Bacteria | 7513 |
| 803 | Ga0501043_0020943 | 3300049579 | Bacteria | 5127 |
| 804 | Ga0501043_0119835 | 3300049579 | Bacteria | 2063 |
| 805 | Ga0501043_0146961 | 3300049579 | Bacteria | 1845 |
| 806 | Ga0501043_0290415 | 3300049579 | Bacteria | 1252 |
| 807 | Ga0501043_0299692 | 3300049579 | Bacteria | 1228 |
| 808 | Ga0501043_0822591 | 3300049579 | Bacteria | 670 |
| 809 | Ga0501046_0005490 | 3300049580 | Bacteria | 11326 |
| 810 | Ga0501046_0042485 | 3300049580 | Bacteria | 3624 |
| 811 | Ga0501046_0095304 | 3300049580 | Bacteria | 2286 |
| 812 | Ga0501046_0281545 | 3300049580 | Bacteria | 1218 |
| 813 | Ga0501046_0295582 | 3300049580 | Bacteria | 1184 |
| 814 | Ga0501047_0005878 | 3300049581 | Bacteria | 11545 |
| 815 | Ga0501047_0013772 | 3300049581 | Bacteria | 7681 |
| 816 | Ga0501047_0017015 | 3300049581 | Bacteria | 6951 |
| 817 | Ga0501047_0023366 | 3300049581 | Bacteria | 5936 |
| 818 | Ga0501047_0023815 | 3300049581 | Bacteria | 5878 |
| 819 | Ga0501047_0041485 | 3300049581 | Bacteria | 4447 |
| 820 | Ga0501047_0051699 | 3300049581 | Bacteria | 3971 |
| 821 | Ga0501047_0071007 | 3300049581 | Bacteria | 3352 |
| 822 | Ga0501047_0150227 | 3300049581 | Bacteria | 2206 |
| 823 | Ga0501047_0346521 | 3300049581 | Bacteria | 1322 |
| 824 | Ga0501047_1164544 | 3300049581 | Bacteria | 584 |
| 825 | Ga0501048_0002755 | 3300049582 | Bacteria | 13406 |
| 826 | Ga0501048_0025711 | 3300049582 | Bacteria | 4288 |
| 827 | Ga0501048_0291714 | 3300049582 | Bacteria | 1160 |
| 828 | Ga0501048_0357085 | 3300049582 | Bacteria | 1042 |
| 829 | Ga0501048_0412883 | 3300049582 | Bacteria | 965 |
| 830 | Ga0501048_0494157 | 3300049582 | Bacteria | 877 |
| 831 | Ga0501048_0750068 | 3300049582 | Bacteria | 701 |
| 832 | Ga0501067_0007326 | 3300049583 | Bacteria | 6128 |
| 833 | Ga0501067_0711021 | 3300049583 | Bacteria | 565 |
| 834 | Ga0501068_0062071 | 3300049584 | Bacteria | 2271 |
| 835 | Ga0501068_0108969 | 3300049584 | Bacteria | 1721 |
| 836 | Ga0501069_0038843 | 3300049585 | Bacteria | 2628 |
| 837 | Ga0501069_0111469 | 3300049585 | Bacteria | 1558 |
| 838 | Ga0501070_0000903 | 3300049586 | Bacteria | 27034 |
| 839 | Ga0501070_0188761 | 3300049586 | Bacteria | 1694 |
| 840 | Ga0501070_0272252 | 3300049586 | Bacteria | 1382 |
| 841 | Ga0501070_0420523 | 3300049586 | Bacteria | 1079 |
| 842 | Ga0501070_0599222 | 3300049586 | Bacteria | 878 |
| 843 | Ga0501071_0001385 | 3300049587 | Bacteria | 13892 |
| 844 | Ga0501071_0152106 | 3300049587 | Bacteria | 1727 |
| 845 | Ga0501071_0999195 | 3300049587 | Bacteria | 646 |
| 846 | Ga0501071_1085438 | 3300049587 | Bacteria | 618 |
| 847 | Ga0501072_0017666 | 3300049588 | Bacteria | 5485 |
| 848 | Ga0501072_0379948 | 3300049588 | Bacteria | 1121 |
| 849 | Ga0501072_1194013 | 3300049588 | Bacteria | 591 |
| 850 | Ga0501073_0154658 | 3300049589 | Bacteria | 1589 |
| 851 | Ga0501073_0401518 | 3300049589 | Bacteria | 947 |
| 852 | Ga0501073_1272372 | 3300049589 | Bacteria | 504 |
| 853 | Ga0501074_0000685 | 3300049590 | Bacteria | 21150 |
| 854 | Ga0501074_0206939 | 3300049590 | Bacteria | 1398 |
| 855 | Ga0501074_0210669 | 3300049590 | Bacteria | 1384 |
| 856 | Ga0501074_0513327 | 3300049590 | Bacteria | 849 |
| 857 | Ga0501075_0640712 | 3300049591 | Bacteria | 810 |
| 858 | Ga0501076_0016555 | 3300049592 | Bacteria | 5589 |
| 859 | Ga0501076_0312388 | 3300049592 | Bacteria | 1289 |
| 860 | Ga0501077_0081465 | 3300049593 | Bacteria | 2050 |
| 861 | Ga0501077_0094327 | 3300049593 | Bacteria | 1897 |
| 862 | Ga0501077_0400452 | 3300049593 | Bacteria | 877 |
| 863 | Ga0501202_057607 | 3300049652 | Bacteria | 872 |
| 864 | Ga0501223_076749 | 3300049663 | Bacteria | 665 |
| 865 | Ga0501079_0032385 | 3300049741 | Bacteria | 4018 |
| 866 | Ga0501079_0425238 | 3300049741 | Bacteria | 1043 |
| 867 | Ga0501080_0107698 | 3300049742 | Bacteria | 2583 |
| 868 | Ga0501080_0861550 | 3300049742 | Bacteria | 791 |
| 869 | Ga0501081_0100340 | 3300049743 | Bacteria | 2046 |
| 870 | Ga0501083_0211714 | 3300049744 | Bacteria | 1263 |
| 871 | Ga0501083_0290317 | 3300049744 | Bacteria | 1064 |
| 872 | Ga0501264_020435 | 3300049761 | Bacteria | 700 |
| 873 | Ga0501282_013501 | 3300049778 | Bacteria | 885 |
| 874 | Ga0501035_0002519 | 3300049822 | Bacteria | 17915 |
| 875 | Ga0501035_0004257 | 3300049822 | Bacteria | 13582 |
| 876 | Ga0501035_0022434 | 3300049822 | Bacteria | 5797 |
| 877 | Ga0501035_0029012 | 3300049822 | Bacteria | 5047 |
| 878 | Ga0501035_0032276 | 3300049822 | Bacteria | 4765 |
| 879 | Ga0501035_0105598 | 3300049822 | Bacteria | 2469 |
| 880 | Ga0501035_0131465 | 3300049822 | Bacteria | 2182 |
| 881 | Ga0501035_0205013 | 3300049822 | Bacteria | 1689 |
| 882 | Ga0501035_0256618 | 3300049822 | Bacteria | 1483 |
| 883 | Ga0501035_0789146 | 3300049822 | Bacteria | 759 |
| 884 | Ga0501044_0007347 | 3300049823 | Bacteria | 12111 |
| 885 | Ga0501044_0009230 | 3300049823 | Bacteria | 10770 |
| 886 | Ga0501044_0012456 | 3300049823 | Bacteria | 9210 |
| 887 | Ga0501044_0021769 | 3300049823 | Bacteria | 6836 |
| 888 | Ga0501044_0023137 | 3300049823 | Bacteria | 6613 |
| 889 | Ga0501044_0038017 | 3300049823 | Bacteria | 5027 |
| 890 | Ga0501044_0080660 | 3300049823 | Bacteria | 3295 |
| 891 | Ga0501044_0282609 | 3300049823 | Bacteria | 1592 |
| 892 | Ga0501044_0667963 | 3300049823 | Bacteria | 927 |
| 893 | Ga0501045_0015881 | 3300049824 | Bacteria | 5340 |
| 894 | Ga0501045_0048873 | 3300049824 | Bacteria | 3083 |
| 895 | Ga0501045_0303559 | 3300049824 | Bacteria | 1188 |
| 896 | Ga0501045_0338954 | 3300049824 | Bacteria | 1119 |
| 897 | nmdc:mga0yw44_606416_c1 | 3300050492 | Bacteria | 744 |
| 898 | nmdc:mga0yw44_996525_c1 | 3300050492 | Bacteria | 567 |
| 899 | nmdc:mga06z11_759715_c1 | 3300050494 | Bacteria | 591 |
| 900 | nmdc:mga06z11_8290_c1 | 3300050494 | Bacteria | 4325 |
| 901 | nmdc:mga04h51_28168_c1 | 3300050495 | Bacteria | 1751 |
| 902 | nmdc:mga07m45_415360_c1 | 3300050496 | Bacteria | 781 |
| 903 | nmdc:mga08x19_512198_c1 | 3300050514 | Bacteria | 847 |
| 904 | Ga0495601_0012919 | 3300053077 | Bacteria | 5014 |
| 905 | Ga0495601_0222963 | 3300053077 | Bacteria | 1231 |
| 906 | Ga0495601_0530919 | 3300053077 | Bacteria | 758 |
| 907 | Ga0495612_0003333 | 3300053078 | Bacteria | 6657 |
| 908 | Ga0495612_0011773 | 3300053078 | Bacteria | 3525 |
| 909 | Ga0495612_0522533 | 3300053078 | Bacteria | 545 |
| 910 | Ga0500610_0232357 | 3300053079 | Bacteria | 864 |
| 911 | Ga0495619_0122367 | 3300053085 | Bacteria | 1784 |
| 912 | Ga0495619_0211454 | 3300053085 | Bacteria | 1343 |
| 913 | Ga0495619_0693378 | 3300053085 | Bacteria | 693 |
| 914 | Ga0500578_0137294 | 3300053086 | Bacteria | 1530 |
| 915 | Ga0500644_0014989 | 3300053088 | Bacteria | 2199 |
| 916 | Ga0500644_0019832 | 3300053088 | Bacteria | 1990 |
| 917 | Ga0500583_0495849 | 3300053092 | Bacteria | 574 |
| 918 | Ga0500566_0047067 | 3300053094 | Bacteria | 2476 |
| 919 | Ga0500640_006196 | 3300053095 | Bacteria | 4541 |
| 920 | Ga0500650_0099354 | 3300053098 | Bacteria | 1362 |
| 921 | Ga0500654_088991 | 3300053099 | Bacteria | 1388 |
| 922 | Ga0500660_241757 | 3300053100 | Bacteria | 566 |
| 923 | Ga0500556_0054793 | 3300053104 | Bacteria | 1453 |
| 924 | Ga0500558_121645 | 3300053106 | Bacteria | 1010 |
| 925 | Ga0500560_005308 | 3300053107 | Bacteria | 2840 |
| 926 | Ga0500569_002482 | 3300053109 | Bacteria | 3641 |
| 927 | Ga0500607_093798 | 3300053121 | Bacteria | 1505 |
| 928 | Ga0500614_014576 | 3300053123 | Bacteria | 1743 |
| 929 | Ga0500621_104158 | 3300053126 | Bacteria | 1116 |
| 930 | Ga0500628_048126 | 3300053129 | Bacteria | 1001 |
| 931 | Ga0500652_009284 | 3300053131 | Bacteria | 3319 |
| 932 | Ga0500652_282806 | 3300053131 | Bacteria | 647 |
| 933 | Ga0500658_0003289 | 3300053134 | Bacteria | 6131 |
| 934 | Ga0500559_0144810 | 3300053136 | Bacteria | 1114 |
| 935 | Ga0500559_0381026 | 3300053136 | Bacteria | 658 |
| 936 | Ga0500561_0000719 | 3300053137 | Bacteria | 5258 |
| 937 | Ga0500573_0004777 | 3300053140 | Bacteria | 7175 |
| 938 | Ga0500573_0025166 | 3300053140 | Bacteria | 3422 |
| 939 | Ga0500573_0143800 | 3300053140 | Bacteria | 1311 |
| 940 | Ga0500577_0167810 | 3300053142 | Bacteria | 937 |
| 941 | Ga0500579_033415 | 3300053143 | Bacteria | 3289 |
| 942 | Ga0500600_0022644 | 3300053149 | Bacteria | 3759 |
| 943 | Ga0500600_0193322 | 3300053149 | Bacteria | 966 |
| 944 | Ga0500603_159476 | 3300053150 | Bacteria | 703 |
| 945 | Ga0500616_0019242 | 3300053153 | Bacteria | 3849 |
| 946 | Ga0500633_0000323 | 3300053160 | Bacteria | 7116 |
| 947 | Ga0500633_0167843 | 3300053160 | Bacteria | 824 |
| 948 | Ga0500634_0050684 | 3300053161 | Bacteria | 2235 |
| 949 | Ga0500636_0491563 | 3300053177 | Bacteria | 544 |
| 950 | Ga0500637_0417640 | 3300053178 | Unclassified | 691 |
| 951 | Ga0500656_001749 | 3300053732 | Bacteria | 1904 |
| 952 | Ga0500587_005962 | 3300053739 | Bacteria | 1628 |
| 953 | Ga0501084_0020844 | 3300054114 | Bacteria | 5466 |
| 954 | Ga0501084_0085233 | 3300054114 | Bacteria | 2652 |
| 955 | Ga0590075_029891 | 3300059424 | Bacteria | 1379 |
| 956 | Ga0587073_0157947 | 3300059492 | Bacteria | 647 |
| 957 | Ga0587088_135006 | 3300059508 | Bacteria | 584 |
| 958 | Ga0587089_114224 | 3300059509 | Bacteria | 501 |
| 959 | Ga0587091_236711 | 3300059511 | Bacteria | 506 |
| 960 | Ga0587092_086480 | 3300059512 | Bacteria | 627 |
| 961 | Ga0587098_064776 | 3300059604 | Bacteria | 581 |
| 962 | Ga0587106_008852 | 3300059605 | Bacteria | 1266 |
| 963 | Ga0587106_071356 | 3300059605 | Bacteria | 658 |
| 964 | Ga0587125_065590 | 3300059607 | Bacteria | 539 |
| 965 | Ga0587115_117074 | 3300059626 | Bacteria | 509 |
| 966 | Ga0587122_022878 | 3300059628 | Bacteria | 692 |
| 967 | Ga0587062_073449 | 3300059639 | Bacteria | 623 |
| 968 | Ga0587067_055686 | 3300059640 | Bacteria | 814 |
| 969 | Ga0587068_142120 | 3300059641 | Bacteria | 537 |
| 970 | Ga0587072_184510 | 3300059643 | Bacteria | 522 |
| 971 | Ga0587075_152803 | 3300059644 | Bacteria | 501 |
| 972 | Ga0587107_102603 | 3300059652 | Bacteria | 568 |
| 973 | Ga0587108_031698 | 3300059653 | Bacteria | 542 |
| 974 | Ga0587111_0124372 | 3300060346 | Bacteria | 668 |
| 975 | Ga0587111_0182248 | 3300060346 | Bacteria | 585 |
| 976 | Ga0501082_0014461 | 3300060353 | Bacteria | 6793 |
| 977 | Ga0501082_0153158 | 3300060353 | Bacteria | 2003 |
| 978 | Ga0466962_0000572 | 3300061719 | Bacteria | 16176 |
| 979 | Ga0466962_0000635 | 3300061719 | Bacteria | 15613 |
| 980 | Ga0466962_0052208 | 3300061719 | Bacteria | 1954 |
| 981 | Ga0466962_0055762 | 3300061719 | Bacteria | 1888 |
| 982 | Ga0466962_0132716 | 3300061719 | Bacteria | 1204 |
| 983 | Ga0466962_0220632 | 3300061719 | Archaea | 929 |
| 984 | Ga0466962_0236502 | 3300061719 | Bacteria | 896 |
| 985 | Ga0466962_0266643 | 3300061719 | Bacteria | 843 |
| 986 | Ga0530510_0030267 | 3300061734 | Bacteria | 3888 |
| 987 | Ga0530510_0187467 | 3300061734 | Bacteria | 1535 |
| 988 | Ga0530510_0382341 | 3300061734 | Bacteria | 1060 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044656 | Ga0466969_0062623 | Ga0466969_0062623_466_804 | 111 |
| 2 | 3300044684 | Ga0466966_0119917 | Ga0466966_0119917_908_1246 | 111 |
| 3 | 3300044693 | Ga0466961_0013999 | Ga0466961_0013999_2681_3019 | 111 |
| 4 | 3300044765 | Ga0466970_0254963 | Ga0466970_0254963_188_526 | 111 |
| 5 | 3300045049 | Ga0466959_0004032 | Ga0466959_0004032_1094_1432 | 111 |
| 6 | 3300045836 | Ga0466958_0310163 | Ga0466958_0310163_415_753 | 111 |
| 7 | 3300006175 | Ga0070712_101296475 | Ga0070712_1012964752 | 115 |
| 8 | 3300046558 | Ga0495633_0304652 | Ga0495633_0304652_144_497 | 115 |
| 9 | 3300047323 | Ga0495683_0090897 | Ga0495683_0090897_1092_1457 | 119 |
| 10 | 3300005435 | Ga0070714_100652588 | Ga0070714_1006525882 | 120 |
| 11 | 3300025929 | Ga0207664_10893585 | Ga0207664_108935852 | 120 |
| 12 | iso_pu_bacteria | 3002998708 | 3003007422 | 122 |
| 13 | iso_pu_bacteria | 2547132111 | 2547408389 | 124 |
| 14 | iso_pu_bacteria | 2582581312 | 2585296615 | 124 |
| 15 | iso_pu_bacteria | 2582581313 | 2585309058 | 124 |
| 16 | iso_pu_bacteria | 2582581314 | 2585319248 | 124 |
| 17 | iso_pu_bacteria | 2616644814 | 2616697300 | 124 |
| 18 | iso_pu_bacteria | 2616644941 | 2616903244 | 124 |
| 19 | iso_pu_bacteria | 2643221548 | 2643764022 | 124 |
| 20 | iso_pu_bacteria | 2643221578 | 2643902257 | 124 |
| 21 | iso_pu_bacteria | 2643221587 | 2643943916 | 124 |
| 22 | iso_pu_bacteria | 2643221647 | 2644265806 | 124 |
| 23 | iso_pu_bacteria | 2643221670 | 2644386900 | 124 |
| 24 | iso_pu_bacteria | 2643221673 | 2644403828 | 124 |
| 25 | iso_pu_bacteria | 2643221677 | 2644434653 | 124 |
| 26 | iso_pu_bacteria | 2643221678 | 2644440053 | 124 |
| 27 | iso_pu_bacteria | 2643221682 | 2644461545 | 124 |
| 28 | iso_pu_bacteria | 2643221714 | 2644632622 | 124 |
| 29 | iso_pu_bacteria | 2784132148 | 2784590416 | 124 |
| 30 | iso_pu_bacteria | 2784746763 | 2785341199 | 124 |
| 31 | iso_pu_bacteria | 2784746768 | 2785371504 | 124 |
| 32 | iso_pu_bacteria | 2786546132 | 2786672662 | 124 |
| 33 | iso_pu_bacteria | 2791355406 | 2793985230 | 124 |
| 34 | iso_pu_bacteria | 2802429296 | 2804847905 | 124 |
| 35 | iso_pu_bacteria | 2808606359 | 2808844031 | 124 |
| 36 | iso_pu_bacteria | 2808606375 | 2808913627 | 124 |
| 37 | iso_pu_bacteria | 2808606448 | 2809234089 | 124 |
| 38 | iso_pu_bacteria | 2808606982 | 2811844410 | 124 |
| 39 | iso_pu_bacteria | 2811994879 | 2812355940 | 124 |
| 40 | iso_pu_bacteria | 2811994917 | 2812478749 | 124 |
| 41 | iso_pu_bacteria | 2818991463 | 2819694626 | 124 |
| 42 | iso_pu_bacteria | 2852635781 | 2852641024 | 124 |
| 43 | iso_pu_bacteria | 2862178590 | 2862186415 | 124 |
| 44 | iso_pu_bacteria | 2862281513 | 2862284744 | 124 |
| 45 | iso_pu_bacteria | 2862290372 | 2862293496 | 124 |
| 46 | iso_pu_bacteria | 2862382967 | 2862390430 | 124 |
| 47 | iso_pu_bacteria | 2862507626 | 2862512675 | 124 |
| 48 | iso_pu_bacteria | 2862574272 | 2862577505 | 124 |
| 49 | iso_pu_bacteria | 2862705112 | 2862710925 | 124 |
| 50 | iso_pu_bacteria | 2863404153 | 2863408619 | 124 |
| 51 | iso_pu_bacteria | 2867346516 | 2867349163 | 124 |
| 52 | iso_pu_bacteria | 2867369537 | 2867373873 | 124 |
| 53 | iso_pu_bacteria | 2867428634 | 2867436324 | 124 |
| 54 | iso_pu_bacteria | 2867475112 | 2867476800 | 124 |
| 55 | iso_pu_bacteria | 2873151551 | 2873154051 | 124 |
| 56 | iso_pu_bacteria | 2875391855 | 2875396696 | 124 |
| 57 | iso_pu_bacteria | 2877676314 | 2877679102 | 124 |
| 58 | iso_pu_bacteria | 2912715099 | 2912717614 | 124 |
| 59 | iso_pu_bacteria | 2912723979 | 2912730154 | 124 |
| 60 | iso_pu_bacteria | 2912757875 | 2912762755 | 124 |
| 61 | iso_pu_bacteria | 2918501144 | 2918506509 | 124 |
| 62 | iso_pu_bacteria | 2919468124 | 2919471736 | 124 |
| 63 | iso_pu_bacteria | 2935390628 | 2935395078 | 124 |
| 64 | iso_pu_bacteria | 2946045630 | 2946047856 | 124 |
| 65 | iso_pu_bacteria | 2946064051 | 2946069847 | 124 |
| 66 | iso_pu_bacteria | 2946072368 | 2946077764 | 124 |
| 67 | iso_pu_bacteria | 2947224130 | 2947226952 | 124 |
| 68 | iso_pu_bacteria | 2954002825 | 2954005471 | 124 |
| 69 | iso_pu_bacteria | 2954380949 | 2954384006 | 124 |
| 70 | iso_pu_bacteria | 2954673503 | 2954678955 | 124 |
| 71 | iso_pu_bacteria | 2954682443 | 2954685197 | 124 |
| 72 | iso_pu_bacteria | 2954691527 | 2954694805 | 124 |
| 73 | iso_pu_bacteria | 2954701450 | 2954710007 | 124 |
| 74 | iso_pu_bacteria | 2954711539 | 2954714314 | 124 |
| 75 | iso_pu_bacteria | 2954721474 | 2954724263 | 124 |
| 76 | iso_pu_bacteria | 2954731030 | 2954737577 | 124 |
| 77 | iso_pu_bacteria | 2954740390 | 2954743160 | 124 |
| 78 | iso_pu_bacteria | 2954749733 | 2954756410 | 124 |
| 79 | iso_pu_bacteria | 2954759201 | 2954762118 | 124 |
| 80 | iso_pu_bacteria | 2966598605 | 2966600860 | 124 |
| 81 | iso_pu_bacteria | 2990044586 | 2990046174 | 124 |
| 82 | iso_pu_bacteria | 2990059506 | 2990062946 | 124 |
| 83 | iso_pu_bacteria | 2990088156 | 2990089790 | 124 |
| 84 | iso_pu_bacteria | 2997451912 | 2997452867 | 124 |
| 85 | iso_pu_bacteria | 2997600082 | 2997606048 | 124 |
| 86 | iso_pu_bacteria | 3006321560 | 3006322589 | 124 |
| 87 | iso_pu_bacteria | 3006425503 | 3006429893 | 124 |
| 88 | iso_pu_bacteria | 3006486233 | 3006490328 | 124 |
| 89 | iso_pu_bacteria | 3006493962 | 3006500124 | 124 |
| 90 | iso_pu_bacteria | 8002784119 | 8002789007 | 124 |
| 91 | iso_pu_bacteria | 8008485437 | 8008491540 | 124 |
| 92 | iso_pu_bacteria | 8008558824 | 8008562790 | 124 |
| 93 | iso_pu_bacteria | 8008574985 | 8008577164 | 124 |
| 94 | iso_pu_bacteria | 8023623736 | 8023627196 | 124 |
| 95 | iso_pu_bacteria | 8025413630 | 8025419413 | 124 |
| 96 | iso_pu_bacteria | 8025524527 | 8025524596 | 124 |
| 97 | iso_pu_bacteria | 8025530807 | 8025531303 | 124 |
| 98 | iso_pu_bacteria | 8033684223 | 8033686500 | 124 |
| 99 | iso_pu_bacteria | 8047893842 | 8047896101 | 124 |
| 100 | iso_pu_bacteria | 8048127548 | 8048132262 | 124 |
| 101 | iso_pu_bacteria | 8048356638 | 8048362834 | 124 |
| 102 | iso_pu_bacteria | 8048369669 | 8048373126 | 124 |
| 103 | iso_pu_bacteria | 8048379754 | 8048382059 | 124 |
| 104 | iso_pu_bacteria | 8048406513 | 8048411661 | 124 |
| 105 | iso_pu_bacteria | 8053945823 | 8053952302 | 124 |
| 106 | iso_pu_bacteria | 8054160619 | 8054163303 | 124 |
| 107 | iso_pu_bacteria | 8055172936 | 8055181082 | 124 |
| 108 | iso_pu_bacteria | 8056054917 | 8056055097 | 124 |
| 109 | iso_pu_bacteria | 8056447290 | 8056453799 | 124 |
| 110 | iso_pu_bacteria | 8056829672 | 8056832204 | 124 |
| 111 | 3300005367 | Ga0070667_100030080 | Ga0070667_1000300808 | 126 |
| 112 | 3300005843 | Ga0068860_101389325 | Ga0068860_1013893251 | 126 |
| 113 | 3300006163 | Ga0070715_10011216 | Ga0070715_100112163 | 126 |
| 114 | 3300025986 | Ga0207658_10020850 | Ga0207658_100208508 | 126 |
| 115 | 3300028381 | Ga0268264_11202145 | Ga0268264_112021451 | 126 |
| 116 | 3300031507 | Ga0307509_10444491 | Ga0307509_104444911 | 126 |
| 117 | 3300044684 | Ga0466966_0018275 | Ga0466966_0018275_3530_3916 | 126 |
| 118 | 3300044765 | Ga0466970_0635632 | Ga0466970_0635632_113_499 | 126 |
| 119 | 3300045049 | Ga0466959_0200536 | Ga0466959_0200536_860_1246 | 126 |
| 120 | 3300046543 | Ga0495645_0014240 | Ga0495645_0014240_2092_2493 | 126 |
| 121 | 3300049571 | Ga0501034_1089096 | Ga0501034_1089096_248_634 | 126 |
| 122 | 3300049581 | Ga0501047_0150227 | Ga0501047_0150227_121_507 | 126 |
| 123 | 3300049581 | Ga0501047_1164544 | Ga0501047_1164544_71_457 | 126 |
| 124 | 3300049823 | Ga0501044_0667963 | Ga0501044_0667963_143_529 | 126 |
| 125 | 3300003559 | Ga0007427J51700_128208 | Ga0007427J51700_1282081 | 127 |
| 126 | 3300006175 | Ga0070712_100103005 | Ga0070712_1001030052 | 127 |
| 127 | 3300025915 | Ga0207693_10336397 | Ga0207693_103363971 | 127 |
| 128 | 3300025928 | Ga0207700_10265550 | Ga0207700_102655502 | 127 |
| 129 | 2088090003 | LJN_F6ESG4R02HG44S | LJN_02150030 | 128 |
| 130 | 3300001990 | JGI24737J22298_10094530 | JGI24737J22298_100945302 | 128 |
| 131 | 3300002067 | JGI24735J21928_10057026 | JGI24735J21928_100570261 | 128 |
| 132 | 3300002075 | JGI24738J21930_10027978 | JGI24738J21930_100279782 | 128 |
| 133 | 3300003163 | Ga0006759J45824_1023985 | Ga0006759J45824_10239851 | 128 |
| 134 | 3300003203 | JGI25406J46586_10008092 | JGI25406J46586_100080923 | 128 |
| 135 | 3300003308 | Ga0006777J48905_1041869 | Ga0006777J48905_10418691 | 128 |
| 136 | 3300003308 | Ga0006777J48905_1052988 | Ga0006777J48905_10529881 | 128 |
| 137 | 3300003320 | rootH2_10038439 | rootH2_100384392 | 128 |
| 138 | 3300003320 | rootH2_10038440 | rootH2_100384402 | 128 |
| 139 | 3300003320 | rootH2_10115779 | rootH2_101157793 | 128 |
| 140 | 3300003320 | rootH2_10134987 | rootH2_101349872 | 128 |
| 141 | 3300003322 | rootL2_10015814 | rootL2_100158142 | 128 |
| 142 | 3300003322 | rootL2_10015815 | rootL2_100158152 | 128 |
| 143 | 3300003323 | rootH1_10005533 | rootH1_100055332 | 128 |
| 144 | 3300003323 | rootH1_10005534 | rootH1_100055342 | 128 |
| 145 | 3300003354 | JGI25160J50197_1029327 | JGI25160J50197_10293272 | 128 |
| 146 | 3300003574 | Ga0007410J51695_1021724 | Ga0007410J51695_10217241 | 128 |
| 147 | 3300003575 | Ga0007409J51694_1026987 | Ga0007409J51694_10269871 | 128 |
| 148 | 3300003578 | Ga0006562J51391_1014857 | Ga0006562J51391_10148571 | 128 |
| 149 | 3300003579 | Ga0007429J51699_1037609 | Ga0007429J51699_10376091 | 128 |
| 150 | 3300003693 | Ga0032354_1040524 | Ga0032354_10405241 | 128 |
| 151 | 3300004799 | Ga0058863_11440945 | Ga0058863_114409451 | 128 |
| 152 | 3300004799 | Ga0058863_11726019 | Ga0058863_117260191 | 128 |
| 153 | 3300004803 | Ga0058862_12758211 | Ga0058862_127582111 | 128 |
| 154 | 3300005329 | Ga0070683_100632655 | Ga0070683_1006326551 | 128 |
| 155 | 3300005335 | Ga0070666_10823944 | Ga0070666_108239441 | 128 |
| 156 | 3300005339 | Ga0070660_100196781 | Ga0070660_1001967812 | 128 |
| 157 | 3300005339 | Ga0070660_101897774 | Ga0070660_1018977741 | 128 |
| 158 | 3300005367 | Ga0070667_100481019 | Ga0070667_1004810191 | 128 |
| 159 | 3300005434 | Ga0070709_10155399 | Ga0070709_101553991 | 128 |
| 160 | 3300005434 | Ga0070709_10904676 | Ga0070709_109046761 | 128 |
| 161 | 3300005435 | Ga0070714_100007466 | Ga0070714_1000074663 | 128 |
| 162 | 3300005435 | Ga0070714_100398704 | Ga0070714_1003987041 | 128 |
| 163 | 3300005435 | Ga0070714_100474817 | Ga0070714_1004748173 | 128 |
| 164 | 3300005435 | Ga0070714_100761519 | Ga0070714_1007615191 | 128 |
| 165 | 3300005435 | Ga0070714_102133102 | Ga0070714_1021331021 | 128 |
| 166 | 3300005436 | Ga0070713_100109119 | Ga0070713_1001091193 | 128 |
| 167 | 3300005436 | Ga0070713_100285818 | Ga0070713_1002858182 | 128 |
| 168 | 3300005436 | Ga0070713_101282585 | Ga0070713_1012825852 | 128 |
| 169 | 3300005437 | Ga0070710_11266586 | Ga0070710_112665861 | 128 |
| 170 | 3300005439 | Ga0070711_100727525 | Ga0070711_1007275251 | 128 |
| 171 | 3300005439 | Ga0070711_101507223 | Ga0070711_1015072231 | 128 |
| 172 | 3300005445 | Ga0070708_100001822 | Ga0070708_10000182215 | 128 |
| 173 | 3300005445 | Ga0070708_100318666 | Ga0070708_1003186662 | 128 |
| 174 | 3300005445 | Ga0070708_100853808 | Ga0070708_1008538081 | 128 |
| 175 | 3300005455 | Ga0070663_100300651 | Ga0070663_1003006512 | 128 |
| 176 | 3300005458 | Ga0070681_10053792 | Ga0070681_100537924 | 128 |
| 177 | 3300005467 | Ga0070706_100021707 | Ga0070706_1000217077 | 128 |
| 178 | 3300005467 | Ga0070706_100133047 | Ga0070706_1001330472 | 128 |
| 179 | 3300005467 | Ga0070706_100507703 | Ga0070706_1005077032 | 128 |
| 180 | 3300005467 | Ga0070706_100780091 | Ga0070706_1007800911 | 128 |
| 181 | 3300005468 | Ga0070707_100535360 | Ga0070707_1005353601 | 128 |
| 182 | 3300005471 | Ga0070698_100044076 | Ga0070698_1000440762 | 128 |
| 183 | 3300005471 | Ga0070698_100045313 | Ga0070698_1000453135 | 128 |
| 184 | 3300005471 | Ga0070698_100250027 | Ga0070698_1002500272 | 128 |
| 185 | 3300005471 | Ga0070698_100594151 | Ga0070698_1005941512 | 128 |
| 186 | 3300005518 | Ga0070699_100412515 | Ga0070699_1004125152 | 128 |
| 187 | 3300005539 | Ga0068853_100047259 | Ga0068853_1000472593 | 128 |
| 188 | 3300005539 | Ga0068853_100054346 | Ga0068853_1000543463 | 128 |
| 189 | 3300005548 | Ga0070665_100014993 | Ga0070665_1000149932 | 128 |
| 190 | 3300005548 | Ga0070665_100179347 | Ga0070665_1001793473 | 128 |
| 191 | 3300005548 | Ga0070665_100471533 | Ga0070665_1004715332 | 128 |
| 192 | 3300005563 | Ga0068855_100013371 | Ga0068855_1000133713 | 128 |
| 193 | 3300005563 | Ga0068855_102443224 | Ga0068855_1024432241 | 128 |
| 194 | 3300005578 | Ga0068854_100058685 | Ga0068854_1000586853 | 128 |
| 195 | 3300005614 | Ga0068856_100142964 | Ga0068856_1001429641 | 128 |
| 196 | 3300005614 | Ga0068856_100546987 | Ga0068856_1005469872 | 128 |
| 197 | 3300005616 | Ga0068852_100071678 | Ga0068852_1000716783 | 128 |
| 198 | 3300005937 | Ga0081455_10074548 | Ga0081455_100745482 | 128 |
| 199 | 3300005981 | Ga0081538_10000602 | Ga0081538_1000060222 | 128 |
| 200 | 3300005985 | Ga0081539_10000177 | Ga0081539_10000177158 | 128 |
| 201 | 3300006028 | Ga0070717_10457761 | Ga0070717_104577612 | 128 |
| 202 | 3300006028 | Ga0070717_11450355 | Ga0070717_114503551 | 128 |
| 203 | 3300006038 | Ga0075365_10413876 | Ga0075365_104138761 | 128 |
| 204 | 3300006038 | Ga0075365_10959514 | Ga0075365_109595141 | 128 |
| 205 | 3300006038 | Ga0075365_11261057 | Ga0075365_112610571 | 128 |
| 206 | 3300006042 | Ga0075368_10011789 | Ga0075368_100117891 | 128 |
| 207 | 3300006048 | Ga0075363_100013133 | Ga0075363_1000131333 | 128 |
| 208 | 3300006048 | Ga0075363_100418568 | Ga0075363_1004185681 | 128 |
| 209 | 3300006048 | Ga0075363_100657769 | Ga0075363_1006577691 | 128 |
| 210 | 3300006051 | Ga0075364_10920925 | Ga0075364_109209251 | 128 |
| 211 | 3300006163 | Ga0070715_10265494 | Ga0070715_102654941 | 128 |
| 212 | 3300006175 | Ga0070712_100263361 | Ga0070712_1002633612 | 128 |
| 213 | 3300006178 | Ga0075367_10011939 | Ga0075367_100119393 | 128 |
| 214 | 3300006948 | Ga0099826_10090081 | Ga0099826_100900812 | 128 |
| 215 | 3300009011 | Ga0105251_10011572 | Ga0105251_100115724 | 128 |
| 216 | 3300009036 | Ga0105244_10074219 | Ga0105244_100742192 | 128 |
| 217 | 3300009036 | Ga0105244_10448287 | Ga0105244_104482871 | 128 |
| 218 | 3300009092 | Ga0105250_10119467 | Ga0105250_101194672 | 128 |
| 219 | 3300009093 | Ga0105240_10029108 | Ga0105240_100291083 | 128 |
| 220 | 3300009098 | Ga0105245_10120323 | Ga0105245_101203232 | 128 |
| 221 | 3300009098 | Ga0105245_10743002 | Ga0105245_107430022 | 128 |
| 222 | 3300009098 | Ga0105245_11586482 | Ga0105245_115864821 | 128 |
| 223 | 3300009148 | Ga0105243_10178280 | Ga0105243_101782803 | 128 |
| 224 | 3300009174 | Ga0105241_10004696 | Ga0105241_100046966 | 128 |
| 225 | 3300009176 | Ga0105242_11310203 | Ga0105242_113102031 | 128 |
| 226 | 3300009176 | Ga0105242_12280952 | Ga0105242_122809521 | 128 |
| 227 | 3300009177 | Ga0105248_11865327 | Ga0105248_118653271 | 128 |
| 228 | 3300009545 | Ga0105237_10034889 | Ga0105237_100348893 | 128 |
| 229 | 3300009545 | Ga0105237_11387945 | Ga0105237_113879451 | 128 |
| 230 | 3300009545 | Ga0105237_12051727 | Ga0105237_120517271 | 128 |
| 231 | 3300009551 | Ga0105238_10015709 | Ga0105238_100157093 | 128 |
| 232 | 3300010375 | Ga0105239_10106549 | Ga0105239_101065493 | 128 |
| 233 | 3300010375 | Ga0105239_10151882 | Ga0105239_101518823 | 128 |
| 234 | 3300010375 | Ga0105239_10387042 | Ga0105239_103870422 | 128 |
| 235 | 3300010375 | Ga0105239_11234579 | Ga0105239_112345791 | 128 |
| 236 | 3300011119 | Ga0105246_10256826 | Ga0105246_102568262 | 128 |
| 237 | 3300011119 | Ga0105246_10335098 | Ga0105246_103350982 | 128 |
| 238 | 3300011119 | Ga0105246_10534636 | Ga0105246_105346361 | 128 |
| 239 | 3300012490 | Ga0157322_1006037 | Ga0157322_10060371 | 128 |
| 240 | 3300013045 | Ga0154016_120640 | Ga0154016_1206401 | 128 |
| 241 | 3300013059 | Ga0154012_105953 | Ga0154012_1059531 | 128 |
| 242 | 3300013105 | Ga0157369_10259557 | Ga0157369_102595572 | 128 |
| 243 | 3300013105 | Ga0157369_10354398 | Ga0157369_103543982 | 128 |
| 244 | 3300013105 | Ga0157369_10571963 | Ga0157369_105719631 | 128 |
| 245 | 3300013296 | Ga0157374_10075017 | Ga0157374_100750173 | 128 |
| 246 | 3300013307 | Ga0157372_10465578 | Ga0157372_104655782 | 128 |
| 247 | 3300013307 | Ga0157372_10700796 | Ga0157372_107007962 | 128 |
| 248 | 3300013308 | Ga0157375_11201230 | Ga0157375_112012301 | 128 |
| 249 | 3300014497 | Ga0182008_10003296 | Ga0182008_100032969 | 128 |
| 250 | 3300015261 | Ga0182006_1049148 | Ga0182006_10491483 | 128 |
| 251 | 3300015262 | Ga0182007_10021380 | Ga0182007_100213803 | 128 |
| 252 | 3300015265 | Ga0182005_1049193 | Ga0182005_10491932 | 128 |
| 253 | 3300015688 | Ga0183367_1002 | Ga0183367_100266 | 128 |
| 254 | 3300017792 | Ga0163161_10337773 | Ga0163161_103377732 | 128 |
| 255 | 3300020069 | Ga0197907_10200592 | Ga0197907_102005921 | 128 |
| 256 | 3300020069 | Ga0197907_10230676 | Ga0197907_102306761 | 128 |
| 257 | 3300020069 | Ga0197907_10704798 | Ga0197907_107047981 | 128 |
| 258 | 3300020069 | Ga0197907_10708005 | Ga0197907_107080051 | 128 |
| 259 | 3300020070 | Ga0206356_11000058 | Ga0206356_110000581 | 128 |
| 260 | 3300020070 | Ga0206356_11607154 | Ga0206356_116071541 | 128 |
| 261 | 3300020075 | Ga0206349_1011289 | Ga0206349_10112891 | 128 |
| 262 | 3300020075 | Ga0206349_1353168 | Ga0206349_13531682 | 128 |
| 263 | 3300020076 | Ga0206355_1522735 | Ga0206355_15227351 | 128 |
| 264 | 3300020076 | Ga0206355_1634198 | Ga0206355_16341981 | 128 |
| 265 | 3300020077 | Ga0206351_10011824 | Ga0206351_100118241 | 128 |
| 266 | 3300020077 | Ga0206351_10405507 | Ga0206351_104055071 | 128 |
| 267 | 3300020077 | Ga0206351_10415879 | Ga0206351_104158791 | 128 |
| 268 | 3300020077 | Ga0206351_10965487 | Ga0206351_109654871 | 128 |
| 269 | 3300020078 | Ga0206352_10222767 | Ga0206352_102227671 | 128 |
| 270 | 3300020078 | Ga0206352_10338841 | Ga0206352_103388411 | 128 |
| 271 | 3300020078 | Ga0206352_10427184 | Ga0206352_104271841 | 128 |
| 272 | 3300020078 | Ga0206352_10962197 | Ga0206352_109621972 | 128 |
| 273 | 3300020078 | Ga0206352_11212980 | Ga0206352_112129801 | 128 |
| 274 | 3300020078 | Ga0206352_11223151 | Ga0206352_112231512 | 128 |
| 275 | 3300020078 | Ga0206352_11302190 | Ga0206352_113021901 | 128 |
| 276 | 3300020080 | Ga0206350_10496801 | Ga0206350_104968011 | 128 |
| 277 | 3300020080 | Ga0206350_10617434 | Ga0206350_106174341 | 128 |
| 278 | 3300020080 | Ga0206350_10854241 | Ga0206350_108542411 | 128 |
| 279 | 3300020080 | Ga0206350_11643667 | Ga0206350_116436671 | 128 |
| 280 | 3300020081 | Ga0206354_10598026 | Ga0206354_105980261 | 128 |
| 281 | 3300020081 | Ga0206354_10676087 | Ga0206354_106760871 | 128 |
| 282 | 3300020081 | Ga0206354_10967460 | Ga0206354_109674601 | 128 |
| 283 | 3300020081 | Ga0206354_11241012 | Ga0206354_112410121 | 128 |
| 284 | 3300020082 | Ga0206353_10176331 | Ga0206353_101763311 | 128 |
| 285 | 3300020082 | Ga0206353_10412605 | Ga0206353_104126051 | 128 |
| 286 | 3300020082 | Ga0206353_10584668 | Ga0206353_105846681 | 128 |
| 287 | 3300020082 | Ga0206353_10786963 | Ga0206353_107869632 | 128 |
| 288 | 3300020082 | Ga0206353_11078754 | Ga0206353_110787541 | 128 |
| 289 | 3300020610 | Ga0154015_1053415 | Ga0154015_10534151 | 128 |
| 290 | 3300021377 | Ga0213874_10054940 | Ga0213874_100549402 | 128 |
| 291 | 3300021388 | Ga0213875_10001996 | Ga0213875_100019969 | 128 |
| 292 | 3300022467 | Ga0224712_10121282 | Ga0224712_101212821 | 128 |
| 293 | 3300022467 | Ga0224712_10238402 | Ga0224712_102384021 | 128 |
| 294 | 3300022467 | Ga0224712_10253202 | Ga0224712_102532021 | 128 |
| 295 | 3300022467 | Ga0224712_10598646 | Ga0224712_105986461 | 128 |
| 296 | 3300022467 | Ga0224712_10617934 | Ga0224712_106179341 | 128 |
| 297 | 3300022467 | Ga0224712_10640531 | Ga0224712_106405311 | 128 |
| 298 | 3300025273 | Ga0209673_1070969 | Ga0209673_10709692 | 128 |
| 299 | 3300025297 | Ga0209758_1008145 | Ga0209758_10081452 | 128 |
| 300 | 3300025302 | Ga0207426_1001450 | Ga0207426_10014508 | 128 |
| 301 | 3300025302 | Ga0207426_1025097 | Ga0207426_10250972 | 128 |
| 302 | 3300025302 | Ga0207426_1034160 | Ga0207426_10341602 | 128 |
| 303 | 3300025302 | Ga0207426_1038839 | Ga0207426_10388392 | 128 |
| 304 | 3300025321 | Ga0207656_10729185 | Ga0207656_107291851 | 128 |
| 305 | 3300025711 | Ga0207696_1064574 | Ga0207696_10645742 | 128 |
| 306 | 3300025735 | Ga0207713_1054939 | Ga0207713_10549392 | 128 |
| 307 | 3300025901 | Ga0207688_10373228 | Ga0207688_103732281 | 128 |
| 308 | 3300025903 | Ga0207680_10691276 | Ga0207680_106912761 | 128 |
| 309 | 3300025904 | Ga0207647_10003737 | Ga0207647_100037378 | 128 |
| 310 | 3300025904 | Ga0207647_10015250 | Ga0207647_100152505 | 128 |
| 311 | 3300025905 | Ga0207685_10115157 | Ga0207685_101151572 | 128 |
| 312 | 3300025906 | Ga0207699_10134114 | Ga0207699_101341143 | 128 |
| 313 | 3300025908 | Ga0207643_10753530 | Ga0207643_107535301 | 128 |
| 314 | 3300025910 | Ga0207684_10047679 | Ga0207684_100476791 | 128 |
| 315 | 3300025910 | Ga0207684_10112199 | Ga0207684_101121992 | 128 |
| 316 | 3300025911 | Ga0207654_10039292 | Ga0207654_100392923 | 128 |
| 317 | 3300025912 | Ga0207707_10012054 | Ga0207707_100120548 | 128 |
| 318 | 3300025913 | Ga0207695_10010754 | Ga0207695_100107547 | 128 |
| 319 | 3300025914 | Ga0207671_10004875 | Ga0207671_100048757 | 128 |
| 320 | 3300025914 | Ga0207671_10673415 | Ga0207671_106734151 | 128 |
| 321 | 3300025914 | Ga0207671_11563059 | Ga0207671_115630591 | 128 |
| 322 | 3300025915 | Ga0207693_10250350 | Ga0207693_102503502 | 128 |
| 323 | 3300025919 | Ga0207657_10418932 | Ga0207657_104189321 | 128 |
| 324 | 3300025919 | Ga0207657_11074365 | Ga0207657_110743651 | 128 |
| 325 | 3300025922 | Ga0207646_10413441 | Ga0207646_104134411 | 128 |
| 326 | 3300025924 | Ga0207694_10007071 | Ga0207694_100070715 | 128 |
| 327 | 3300025924 | Ga0207694_10428848 | Ga0207694_104288481 | 128 |
| 328 | 3300025927 | Ga0207687_10073268 | Ga0207687_100732683 | 128 |
| 329 | 3300025927 | Ga0207687_10514744 | Ga0207687_105147441 | 128 |
| 330 | 3300025927 | Ga0207687_11359671 | Ga0207687_113596711 | 128 |
| 331 | 3300025928 | Ga0207700_10027338 | Ga0207700_100273384 | 128 |
| 332 | 3300025928 | Ga0207700_10030939 | Ga0207700_100309392 | 128 |
| 333 | 3300025928 | Ga0207700_10211518 | Ga0207700_102115182 | 128 |
| 334 | 3300025928 | Ga0207700_10696906 | Ga0207700_106969061 | 128 |
| 335 | 3300025929 | Ga0207664_10004838 | Ga0207664_100048389 | 128 |
| 336 | 3300025929 | Ga0207664_10020227 | Ga0207664_100202273 | 128 |
| 337 | 3300025929 | Ga0207664_10149837 | Ga0207664_101498372 | 128 |
| 338 | 3300025929 | Ga0207664_10788458 | Ga0207664_107884582 | 128 |
| 339 | 3300025934 | Ga0207686_10811076 | Ga0207686_108110761 | 128 |
| 340 | 3300025935 | Ga0207709_10139376 | Ga0207709_101393762 | 128 |
| 341 | 3300025940 | Ga0207691_10176268 | Ga0207691_101762682 | 128 |
| 342 | 3300025941 | Ga0207711_11138999 | Ga0207711_111389991 | 128 |
| 343 | 3300025944 | Ga0207661_10669176 | Ga0207661_106691762 | 128 |
| 344 | 3300025949 | Ga0207667_11316262 | Ga0207667_113162622 | 128 |
| 345 | 3300025972 | Ga0207668_11311363 | Ga0207668_113113631 | 128 |
| 346 | 3300025981 | Ga0207640_10043405 | Ga0207640_100434053 | 128 |
| 347 | 3300025981 | Ga0207640_10908081 | Ga0207640_109080811 | 128 |
| 348 | 3300026041 | Ga0207639_10051086 | Ga0207639_100510864 | 128 |
| 349 | 3300026041 | Ga0207639_10784360 | Ga0207639_107843602 | 128 |
| 350 | 3300026041 | Ga0207639_11156113 | Ga0207639_111561131 | 128 |
| 351 | 3300026067 | Ga0207678_10035603 | Ga0207678_100356033 | 128 |
| 352 | 3300026078 | Ga0207702_10259524 | Ga0207702_102595242 | 128 |
| 353 | 3300026078 | Ga0207702_11630333 | Ga0207702_116303331 | 128 |
| 354 | 3300026121 | Ga0207683_11473167 | Ga0207683_114731671 | 128 |
| 355 | 3300027312 | Ga0209371_1007342 | Ga0209371_10073425 | 128 |
| 356 | 3300027312 | Ga0209371_1041852 | Ga0209371_10418522 | 128 |
| 357 | 3300027666 | Ga0209282_1328291 | Ga0209282_13282911 | 128 |
| 358 | 3300027866 | Ga0209813_10027116 | Ga0209813_100271161 | 128 |
| 359 | 3300028019 | Ga0224573_1014732 | Ga0224573_10147321 | 128 |
| 360 | 3300028379 | Ga0268266_10135758 | Ga0268266_101357581 | 128 |
| 361 | 3300028379 | Ga0268266_11379203 | Ga0268266_113792031 | 128 |
| 362 | 3300028786 | Ga0307517_10003614 | Ga0307517_1000361415 | 128 |
| 363 | 3300028786 | Ga0307517_10018520 | Ga0307517_100185209 | 128 |
| 364 | 3300028786 | Ga0307517_10367052 | Ga0307517_103670521 | 128 |
| 365 | 3300028794 | Ga0307515_10004012 | Ga0307515_1000401224 | 128 |
| 366 | 3300028794 | Ga0307515_10160116 | Ga0307515_101601162 | 128 |
| 367 | 3300028794 | Ga0307515_10301566 | Ga0307515_103015662 | 128 |
| 368 | 3300028800 | Ga0265338_10826467 | Ga0265338_108264672 | 128 |
| 369 | 3300029282 | Ga0311003_121122 | Ga0311003_1211221 | 128 |
| 370 | 3300029285 | Ga0310981_1089018 | Ga0310981_10890181 | 128 |
| 371 | 3300029285 | Ga0310981_1096449 | Ga0310981_10964491 | 128 |
| 372 | 3300029957 | Ga0265324_10070180 | Ga0265324_100701802 | 128 |
| 373 | 3300030500 | Ga0268256_1007098 | Ga0268256_10070982 | 128 |
| 374 | 3300030500 | Ga0268256_1047445 | Ga0268256_10474451 | 128 |
| 375 | 3300030500 | Ga0268256_1059971 | Ga0268256_10599711 | 128 |
| 376 | 3300030521 | Ga0307511_10062864 | Ga0307511_100628642 | 128 |
| 377 | 3300030522 | Ga0307512_10002762 | Ga0307512_100027624 | 128 |
| 378 | 3300030522 | Ga0307512_10016900 | Ga0307512_100169002 | 128 |
| 379 | 3300030522 | Ga0307512_10027864 | Ga0307512_100278642 | 128 |
| 380 | 3300030522 | Ga0307512_10060614 | Ga0307512_100606143 | 128 |
| 381 | 3300030731 | Ga0316177_1141283 | Ga0316177_11412832 | 128 |
| 382 | 3300030732 | Ga0316176_1011376 | Ga0316176_10113761 | 128 |
| 383 | 3300030733 | Ga0314311_1203010 | Ga0314311_12030101 | 128 |
| 384 | 3300030735 | Ga0316178_1060430 | Ga0316178_10604302 | 128 |
| 385 | 3300030736 | Ga0316180_1105364 | Ga0316180_11053642 | 128 |
| 386 | 3300030742 | Ga0316183_1196293 | Ga0316183_11962932 | 128 |
| 387 | 3300030744 | Ga0316181_1206647 | Ga0316181_12066472 | 128 |
| 388 | 3300031456 | Ga0307513_10000001 | Ga0307513_100000011345 | 128 |
| 389 | 3300031456 | Ga0307513_10006763 | Ga0307513_100067635 | 128 |
| 390 | 3300031456 | Ga0307513_10013386 | Ga0307513_100133869 | 128 |
| 391 | 3300031456 | Ga0307513_10021476 | Ga0307513_100214765 | 128 |
| 392 | 3300031456 | Ga0307513_10063901 | Ga0307513_100639013 | 128 |
| 393 | 3300031507 | Ga0307509_10151820 | Ga0307509_101518202 | 128 |
| 394 | 3300031616 | Ga0307508_10013541 | Ga0307508_100135416 | 128 |
| 395 | 3300031616 | Ga0307508_10021854 | Ga0307508_100218541 | 128 |
| 396 | 3300031616 | Ga0307508_10047272 | Ga0307508_100472724 | 128 |
| 397 | 3300031616 | Ga0307508_10102787 | Ga0307508_101027872 | 128 |
| 398 | 3300031616 | Ga0307508_10137600 | Ga0307508_101376002 | 128 |
| 399 | 3300031616 | Ga0307508_10461738 | Ga0307508_104617382 | 128 |
| 400 | 3300031649 | Ga0307514_10009038 | Ga0307514_100090386 | 128 |
| 401 | 3300031649 | Ga0307514_10068734 | Ga0307514_100687341 | 128 |
| 402 | 3300031649 | Ga0307514_10069439 | Ga0307514_100694392 | 128 |
| 403 | 3300031649 | Ga0307514_10072409 | Ga0307514_100724092 | 128 |
| 404 | 3300031649 | Ga0307514_10194055 | Ga0307514_101940552 | 128 |
| 405 | 3300031649 | Ga0307514_10541582 | Ga0307514_105415821 | 128 |
| 406 | 3300031730 | Ga0307516_10011933 | Ga0307516_100119335 | 128 |
| 407 | 3300031730 | Ga0307516_10073687 | Ga0307516_100736873 | 128 |
| 408 | 3300031730 | Ga0307516_10085486 | Ga0307516_100854862 | 128 |
| 409 | 3300031730 | Ga0307516_10471169 | Ga0307516_104711692 | 128 |
| 410 | 3300031730 | Ga0307516_10671228 | Ga0307516_106712281 | 128 |
| 411 | 3300031731 | Ga0307405_11161838 | Ga0307405_111618382 | 128 |
| 412 | 3300031824 | Ga0307413_10181917 | Ga0307413_101819172 | 128 |
| 413 | 3300031838 | Ga0307518_10625368 | Ga0307518_106253681 | 128 |
| 414 | 3300031852 | Ga0307410_10112499 | Ga0307410_101124992 | 128 |
| 415 | 3300031911 | Ga0307412_10749149 | Ga0307412_107491491 | 128 |
| 416 | 3300032002 | Ga0307416_101136349 | Ga0307416_1011363491 | 128 |
| 417 | 3300032002 | Ga0307416_101320259 | Ga0307416_1013202592 | 128 |
| 418 | 3300032002 | Ga0307416_102933116 | Ga0307416_1029331161 | 128 |
| 419 | 3300032005 | Ga0307411_10019959 | Ga0307411_100199595 | 128 |
| 420 | 3300033179 | Ga0307507_10000024 | Ga0307507_1000002487 | 128 |
| 421 | 3300033179 | Ga0307507_10045345 | Ga0307507_100453452 | 128 |
| 422 | 3300033179 | Ga0307507_10046672 | Ga0307507_100466722 | 128 |
| 423 | 3300033179 | Ga0307507_10347002 | Ga0307507_103470021 | 128 |
| 424 | 3300033180 | Ga0307510_10012527 | Ga0307510_100125274 | 128 |
| 425 | 3300033180 | Ga0307510_10042716 | Ga0307510_100427165 | 128 |
| 426 | 3300033180 | Ga0307510_10406050 | Ga0307510_104060502 | 128 |
| 427 | 3300033180 | Ga0307510_10483010 | Ga0307510_104830101 | 128 |
| 428 | 3300033545 | Ga0316214_1065596 | Ga0316214_10655961 | 128 |
| 429 | 3300035724 | Ga0373933_0014212 | Ga0373933_0014212_3810_4217 | 128 |
| 430 | 3300035724 | Ga0373933_0032249 | Ga0373933_0032249_1306_1695 | 128 |
| 431 | 3300035724 | Ga0373933_0424616 | Ga0373933_0424616_11_400 | 128 |
| 432 | 3300037068 | Ga0373925_0000348 | Ga0373925_0000348_8946_9332 | 128 |
| 433 | 3300037312 | Ga0395899_0106055 | Ga0395899_0106055_214_606 | 128 |
| 434 | 3300037418 | Ga0395900_0473095 | Ga0395900_0473095_767_1159 | 128 |
| 435 | 3300037466 | Ga0395898_0029604 | Ga0395898_0029604_4424_4816 | 128 |
| 436 | 3300037466 | Ga0395898_0310377 | Ga0395898_0310377_215_607 | 128 |
| 437 | 3300037471 | Ga0395905_0101042 | Ga0395905_0101042_1122_1514 | 128 |
| 438 | 3300037853 | Ga0436364_0162507 | Ga0436364_0162507_70062_70448 | 128 |
| 439 | 3300037853 | Ga0436364_0268454 | Ga0436364_0268454_198_590 | 128 |
| 440 | 3300038443 | Ga0395901_0014818 | Ga0395901_0014818_6904_7296 | 128 |
| 441 | 3300038443 | Ga0395901_0505392 | Ga0395901_0505392_658_1050 | 128 |
| 442 | 3300039437 | Ga0436365_0220139 | Ga0436365_0220139_80_472 | 128 |
| 443 | 3300039437 | Ga0436365_0654894 | Ga0436365_0654894_134_523 | 128 |
| 444 | 3300039450 | Ga0436363_0115510 | Ga0436363_0115510_51_461 | 128 |
| 445 | 3300039450 | Ga0436363_0671136 | Ga0436363_0671136_46_435 | 128 |
| 446 | 3300039450 | Ga0436363_1105319 | Ga0436363_1105319_257_646 | 128 |
| 447 | 3300041404 | Ga0439436_0003937 | Ga0439436_0003937_532_924 | 128 |
| 448 | 3300041404 | Ga0439436_0010487 | Ga0439436_0010487_1075_1485 | 128 |
| 449 | 3300041404 | Ga0439436_0040854 | Ga0439436_0040854_759_1151 | 128 |
| 450 | 3300041406 | Ga0439439_0002096 | Ga0439439_0002096_849_1259 | 128 |
| 451 | 3300041406 | Ga0439439_0004871 | Ga0439439_0004871_1973_2365 | 128 |
| 452 | 3300041406 | Ga0439439_0099970 | Ga0439439_0099970_28_420 | 128 |
| 453 | 3300041411 | Ga0439466_0060717 | Ga0439466_0060717_141_551 | 128 |
| 454 | 3300041413 | Ga0439465_0241022 | Ga0439465_0241022_221_613 | 128 |
| 455 | 3300041444 | Ga0451790_05773 | Ga0451790_05773_42_434 | 128 |
| 456 | 3300041460 | Ga0451802_0862397 | Ga0451802_0862397_576_968 | 128 |
| 457 | 3300041461 | Ga0451805_108507 | Ga0451805_108507_91_483 | 128 |
| 458 | 3300041463 | Ga0451804_0235254 | Ga0451804_0235254_60_452 | 128 |
| 459 | 3300041463 | Ga0451804_0942079 | Ga0451804_0942079_76_468 | 128 |
| 460 | 3300041494 | Ga0451837_0921921 | Ga0451837_0921921_1474_1866 | 128 |
| 461 | 3300041496 | Ga0451839_0641366 | Ga0451839_0641366_820_1212 | 128 |
| 462 | 3300041498 | Ga0451841_0721461 | Ga0451841_0721461_395_787 | 128 |
| 463 | 3300041501 | Ga0451845_0441870 | Ga0451845_0441870_260_652 | 128 |
| 464 | 3300041502 | Ga0451846_16207 | Ga0451846_16207_66_458 | 128 |
| 465 | 3300041506 | Ga0451850_26095 | Ga0451850_26095_154_546 | 128 |
| 466 | 3300041507 | Ga0451851_0375984 | Ga0451851_0375984_740_1132 | 128 |
| 467 | 3300041509 | Ga0451843_0606551 | Ga0451843_0606551_1068_1460 | 128 |
| 468 | 3300041510 | Ga0451854_32235 | Ga0451854_32235_175_567 | 128 |
| 469 | 3300041512 | Ga0451853_2612288 | Ga0451853_2612288_1679_2071 | 128 |
| 470 | 3300041997 | Ga0439431_0068049 | Ga0439431_0068049_152_544 | 128 |
| 471 | 3300041999 | Ga0439433_0000632 | Ga0439433_0000632_5189_5581 | 128 |
| 472 | 3300041999 | Ga0439433_0021444 | Ga0439433_0021444_876_1268 | 128 |
| 473 | 3300042002 | Ga0439442_006630 | Ga0439442_006630_1720_2112 | 128 |
| 474 | 3300042002 | Ga0439442_069300 | Ga0439442_069300_108_500 | 128 |
| 475 | 3300042005 | Ga0439448_0036930 | Ga0439448_0036930_467_859 | 128 |
| 476 | 3300042005 | Ga0439448_0049286 | Ga0439448_0049286_177_569 | 128 |
| 477 | 3300042007 | Ga0439449_0001150 | Ga0439449_0001150_173_565 | 128 |
| 478 | 3300042007 | Ga0439449_0002175 | Ga0439449_0002175_1667_2077 | 128 |
| 479 | 3300042007 | Ga0439449_0012546 | Ga0439449_0012546_2605_3015 | 128 |
| 480 | 3300042007 | Ga0439449_0175661 | Ga0439449_0175661_309_701 | 128 |
| 481 | 3300042008 | Ga0439450_026846 | Ga0439450_026846_630_1022 | 128 |
| 482 | 3300042011 | Ga0439454_006489 | Ga0439454_006489_967_1359 | 128 |
| 483 | 3300042012 | Ga0439455_0002135 | Ga0439455_0002135_2517_2909 | 128 |
| 484 | 3300042014 | Ga0439457_000481 | Ga0439457_000481_4770_5162 | 128 |
| 485 | 3300042014 | Ga0439457_003831 | Ga0439457_003831_1697_2089 | 128 |
| 486 | 3300042014 | Ga0439457_062779 | Ga0439457_062779_19_429 | 128 |
| 487 | 3300042014 | Ga0439457_098290 | Ga0439457_098290_255_665 | 128 |
| 488 | 3300042014 | Ga0439457_174325 | Ga0439457_174325_90_482 | 128 |
| 489 | 3300042122 | Ga0450920_032484 | Ga0450920_032484_405_797 | 128 |
| 490 | 3300042131 | Ga0450894_000022 | Ga0450894_000022_14912_15304 | 128 |
| 491 | 3300042133 | Ga0450896_001115 | Ga0450896_001115_833_1225 | 128 |
| 492 | 3300042134 | Ga0450898_073904 | Ga0450898_073904_273_665 | 128 |
| 493 | 3300042135 | Ga0450899_000954 | Ga0450899_000954_1186_1578 | 128 |
| 494 | 3300042136 | Ga0450900_028781 | Ga0450900_028781_257_649 | 128 |
| 495 | 3300042138 | Ga0450903_000614 | Ga0450903_000614_4108_4500 | 128 |
| 496 | 3300042145 | Ga0450906_012450 | Ga0450906_012450_533_925 | 128 |
| 497 | 3300042157 | Ga0439458_0003368 | Ga0439458_0003368_318_710 | 128 |
| 498 | 3300042435 | Ga0439434_0225600 | Ga0439434_0225600_53_445 | 128 |
| 499 | 3300042438 | Ga0439459_0220617 | Ga0439459_0220617_31_423 | 128 |
| 500 | 3300044656 | Ga0466969_0000400 | Ga0466969_0000400_10450_10839 | 128 |
| 501 | 3300044656 | Ga0466969_0001309 | Ga0466969_0001309_11483_11887 | 128 |
| 502 | 3300044656 | Ga0466969_0005724 | Ga0466969_0005724_4659_5051 | 128 |
| 503 | 3300044656 | Ga0466969_0016641 | Ga0466969_0016641_2185_2589 | 128 |
| 504 | 3300044656 | Ga0466969_0030439 | Ga0466969_0030439_514_918 | 128 |
| 505 | 3300044656 | Ga0466969_0045691 | Ga0466969_0045691_1030_1422 | 128 |
| 506 | 3300044656 | Ga0466969_0207428 | Ga0466969_0207428_301_687 | 128 |
| 507 | 3300044656 | Ga0466969_0296867 | Ga0466969_0296867_28_432 | 128 |
| 508 | 3300044658 | Ga0466972_0004075 | Ga0466972_0004075_4654_5046 | 128 |
| 509 | 3300044658 | Ga0466972_0005652 | Ga0466972_0005652_3108_3497 | 128 |
| 510 | 3300044658 | Ga0466972_0006093 | Ga0466972_0006093_462_854 | 128 |
| 511 | 3300044658 | Ga0466972_0034156 | Ga0466972_0034156_819_1211 | 128 |
| 512 | 3300044658 | Ga0466972_0096600 | Ga0466972_0096600_772_1161 | 128 |
| 513 | 3300044658 | Ga0466972_0126891 | Ga0466972_0126891_472_864 | 128 |
| 514 | 3300044658 | Ga0466972_0394132 | Ga0466972_0394132_68_457 | 128 |
| 515 | 3300044683 | Ga0466965_0000907 | Ga0466965_0000907_9291_9683 | 128 |
| 516 | 3300044683 | Ga0466965_0090009 | Ga0466965_0090009_1106_1498 | 128 |
| 517 | 3300044683 | Ga0466965_0608063 | Ga0466965_0608063_193_585 | 128 |
| 518 | 3300044683 | Ga0466965_0947458 | Ga0466965_0947458_82_486 | 128 |
| 519 | 3300044684 | Ga0466966_0000534 | Ga0466966_0000534_10480_10869 | 128 |
| 520 | 3300044684 | Ga0466966_0002876 | Ga0466966_0002876_9157_9549 | 128 |
| 521 | 3300044684 | Ga0466966_0021345 | Ga0466966_0021345_3637_4041 | 128 |
| 522 | 3300044684 | Ga0466966_0038389 | Ga0466966_0038389_2536_2928 | 128 |
| 523 | 3300044684 | Ga0466966_0111153 | Ga0466966_0111153_711_1103 | 128 |
| 524 | 3300044684 | Ga0466966_0162762 | Ga0466966_0162762_54_458 | 128 |
| 525 | 3300044684 | Ga0466966_0260761 | Ga0466966_0260761_440_844 | 128 |
| 526 | 3300044693 | Ga0466961_0000308 | Ga0466961_0000308_29324_29716 | 128 |
| 527 | 3300044693 | Ga0466961_0002104 | Ga0466961_0002104_3046_3450 | 128 |
| 528 | 3300044693 | Ga0466961_0011811 | Ga0466961_0011811_1096_1488 | 128 |
| 529 | 3300044693 | Ga0466961_0031962 | Ga0466961_0031962_1906_2310 | 128 |
| 530 | 3300044693 | Ga0466961_0106941 | Ga0466961_0106941_219_623 | 128 |
| 531 | 3300044693 | Ga0466961_0123710 | Ga0466961_0123710_266_670 | 128 |
| 532 | 3300044693 | Ga0466961_0134222 | Ga0466961_0134222_526_915 | 128 |
| 533 | 3300044693 | Ga0466961_0259370 | Ga0466961_0259370_421_825 | 128 |
| 534 | 3300044693 | Ga0466961_0520584 | Ga0466961_0520584_258_662 | 128 |
| 535 | 3300044694 | Ga0466963_0067775 | Ga0466963_0067775_638_1030 | 128 |
| 536 | 3300044694 | Ga0466963_0318208 | Ga0466963_0318208_254_661 | 128 |
| 537 | 3300044706 | Ga0466964_0029133 | Ga0466964_0029133_752_1144 | 128 |
| 538 | 3300044706 | Ga0466964_0076919 | Ga0466964_0076919_334_726 | 128 |
| 539 | 3300044719 | Ga0466971_0000332 | Ga0466971_0000332_11563_11955 | 128 |
| 540 | 3300044719 | Ga0466971_0000463 | Ga0466971_0000463_1664_2068 | 128 |
| 541 | 3300044719 | Ga0466971_0048653 | Ga0466971_0048653_1108_1500 | 128 |
| 542 | 3300044719 | Ga0466971_0093045 | Ga0466971_0093045_33_437 | 128 |
| 543 | 3300044719 | Ga0466971_0218186 | Ga0466971_0218186_208_612 | 128 |
| 544 | 3300044735 | Ga0466968_0000051 | Ga0466968_0000051_11085_11474 | 128 |
| 545 | 3300044735 | Ga0466968_0014055 | Ga0466968_0014055_1273_1665 | 128 |
| 546 | 3300044735 | Ga0466968_0476928 | Ga0466968_0476928_145_537 | 128 |
| 547 | 3300044735 | Ga0466968_0514955 | Ga0466968_0514955_162_554 | 128 |
| 548 | 3300044735 | Ga0466968_0535518 | Ga0466968_0535518_106_504 | 128 |
| 549 | 3300044765 | Ga0466970_0000145 | Ga0466970_0000145_10459_10848 | 128 |
| 550 | 3300044765 | Ga0466970_0004998 | Ga0466970_0004998_1021_1413 | 128 |
| 551 | 3300044765 | Ga0466970_0014443 | Ga0466970_0014443_2560_2952 | 128 |
| 552 | 3300044765 | Ga0466970_0044429 | Ga0466970_0044429_269_661 | 128 |
| 553 | 3300044765 | Ga0466970_0080766 | Ga0466970_0080766_723_1127 | 128 |
| 554 | 3300044765 | Ga0466970_0265705 | Ga0466970_0265705_204_608 | 128 |
| 555 | 3300044765 | Ga0466970_0397530 | Ga0466970_0397530_116_520 | 128 |
| 556 | 3300044765 | Ga0466970_0418366 | Ga0466970_0418366_56_460 | 128 |
| 557 | 3300044765 | Ga0466970_0593999 | Ga0466970_0593999_55_444 | 128 |
| 558 | 3300044842 | Ga0466957_0006604 | Ga0466957_0006604_5137_5529 | 128 |
| 559 | 3300044842 | Ga0466957_0121381 | Ga0466957_0121381_910_1302 | 128 |
| 560 | 3300044842 | Ga0466957_0205918 | Ga0466957_0205918_754_1143 | 128 |
| 561 | 3300044842 | Ga0466957_0295524 | Ga0466957_0295524_162_566 | 128 |
| 562 | 3300044842 | Ga0466957_0368705 | Ga0466957_0368705_378_782 | 128 |
| 563 | 3300044842 | Ga0466957_0521283 | Ga0466957_0521283_360_746 | 128 |
| 564 | 3300044842 | Ga0466957_1165670 | Ga0466957_1165670_143_532 | 128 |
| 565 | 3300044842 | Ga0466957_1281957 | Ga0466957_1281957_130_516 | 128 |
| 566 | 3300044901 | Ga0466960_0013352 | Ga0466960_0013352_803_1195 | 128 |
| 567 | 3300044901 | Ga0466960_0242572 | Ga0466960_0242572_89_481 | 128 |
| 568 | 3300045049 | Ga0466959_0000668 | Ga0466959_0000668_9899_10291 | 128 |
| 569 | 3300045049 | Ga0466959_0002190 | Ga0466959_0002190_9083_9487 | 128 |
| 570 | 3300045049 | Ga0466959_0015896 | Ga0466959_0015896_3573_3977 | 128 |
| 571 | 3300045049 | Ga0466959_0030947 | Ga0466959_0030947_2739_3128 | 128 |
| 572 | 3300045049 | Ga0466959_0046010 | Ga0466959_0046010_1125_1517 | 128 |
| 573 | 3300045049 | Ga0466959_0084983 | Ga0466959_0084983_1764_2150 | 128 |
| 574 | 3300045049 | Ga0466959_0446168 | Ga0466959_0446168_416_802 | 128 |
| 575 | 3300045836 | Ga0466958_0000773 | Ga0466958_0000773_2725_3117 | 128 |
| 576 | 3300045836 | Ga0466958_0103073 | Ga0466958_0103073_1343_1747 | 128 |
| 577 | 3300045836 | Ga0466958_0165811 | Ga0466958_0165811_101_505 | 128 |
| 578 | 3300045836 | Ga0466958_0689249 | Ga0466958_0689249_44_433 | 128 |
| 579 | 3300045976 | Ga0466967_0038433 | Ga0466967_0038433_2647_3039 | 128 |
| 580 | 3300045976 | Ga0466967_0040073 | Ga0466967_0040073_1401_1793 | 128 |
| 581 | 3300045976 | Ga0466967_0061682 | Ga0466967_0061682_99_491 | 128 |
| 582 | 3300045976 | Ga0466967_0516550 | Ga0466967_0516550_200_592 | 128 |
| 583 | 3300045976 | Ga0466967_1091721 | Ga0466967_1091721_107_499 | 128 |
| 584 | 3300046452 | Ga0495617_024406 | Ga0495617_024406_207_599 | 128 |
| 585 | 3300046453 | Ga0495627_044002 | Ga0495627_044002_894_1286 | 128 |
| 586 | 3300046454 | Ga0495592_0048333 | Ga0495592_0048333_1681_2085 | 128 |
| 587 | 3300046454 | Ga0495592_0060598 | Ga0495592_0060598_1405_1797 | 128 |
| 588 | 3300046454 | Ga0495592_0087256 | Ga0495592_0087256_44_448 | 128 |
| 589 | 3300046454 | Ga0495592_0225487 | Ga0495592_0225487_341_733 | 128 |
| 590 | 3300046455 | Ga0495603_0000638 | Ga0495603_0000638_12575_12967 | 128 |
| 591 | 3300046455 | Ga0495603_0001879 | Ga0495603_0001879_6699_7091 | 128 |
| 592 | 3300046455 | Ga0495603_0005158 | Ga0495603_0005158_4341_4733 | 128 |
| 593 | 3300046455 | Ga0495603_0023079 | Ga0495603_0023079_82_474 | 128 |
| 594 | 3300046455 | Ga0495603_0026665 | Ga0495603_0026665_2371_2763 | 128 |
| 595 | 3300046455 | Ga0495603_0063291 | Ga0495603_0063291_814_1206 | 128 |
| 596 | 3300046457 | Ga0495590_0308109 | Ga0495590_0308109_99_491 | 128 |
| 597 | 3300046459 | Ga0495629_0001217 | Ga0495629_0001217_6722_7114 | 128 |
| 598 | 3300046459 | Ga0495629_0003212 | Ga0495629_0003212_7174_7566 | 128 |
| 599 | 3300046459 | Ga0495629_0007463 | Ga0495629_0007463_4363_4755 | 128 |
| 600 | 3300046459 | Ga0495629_0019525 | Ga0495629_0019525_1570_1962 | 128 |
| 601 | 3300046459 | Ga0495629_0050969 | Ga0495629_0050969_678_1070 | 128 |
| 602 | 3300046459 | Ga0495629_0073348 | Ga0495629_0073348_441_833 | 128 |
| 603 | 3300046459 | Ga0495629_0111160 | Ga0495629_0111160_537_929 | 128 |
| 604 | 3300046459 | Ga0495629_1093796 | Ga0495629_1093796_57_449 | 128 |
| 605 | 3300046460 | Ga0495638_0020561 | Ga0495638_0020561_3007_3399 | 128 |
| 606 | 3300046460 | Ga0495638_0049586 | Ga0495638_0049586_624_1016 | 128 |
| 607 | 3300046460 | Ga0495638_0180924 | Ga0495638_0180924_786_1178 | 128 |
| 608 | 3300046460 | Ga0495638_0216315 | Ga0495638_0216315_461_853 | 128 |
| 609 | 3300046460 | Ga0495638_0234738 | Ga0495638_0234738_602_994 | 128 |
| 610 | 3300046461 | Ga0495641_0159489 | Ga0495641_0159489_431_823 | 128 |
| 611 | 3300046462 | Ga0495651_0000752 | Ga0495651_0000752_7970_8374 | 128 |
| 612 | 3300046462 | Ga0495651_0000989 | Ga0495651_0000989_9736_10128 | 128 |
| 613 | 3300046462 | Ga0495651_0001909 | Ga0495651_0001909_12338_12742 | 128 |
| 614 | 3300046462 | Ga0495651_0187091 | Ga0495651_0187091_967_1359 | 128 |
| 615 | 3300046462 | Ga0495651_0741986 | Ga0495651_0741986_160_564 | 128 |
| 616 | 3300046463 | Ga0495653_0101896 | Ga0495653_0101896_1177_1569 | 128 |
| 617 | 3300046473 | Ga0495582_0137865 | Ga0495582_0137865_725_1117 | 128 |
| 618 | 3300046473 | Ga0495582_0286255 | Ga0495582_0286255_493_885 | 128 |
| 619 | 3300046474 | Ga0495605_0016690 | Ga0495605_0016690_2225_2617 | 128 |
| 620 | 3300046476 | Ga0495662_0000804 | Ga0495662_0000804_4685_5077 | 128 |
| 621 | 3300046476 | Ga0495662_0018436 | Ga0495662_0018436_2636_3028 | 128 |
| 622 | 3300046477 | Ga0495664_0001534 | Ga0495664_0001534_10236_10628 | 128 |
| 623 | 3300046477 | Ga0495664_0054271 | Ga0495664_0054271_675_1079 | 128 |
| 624 | 3300046477 | Ga0495664_0763251 | Ga0495664_0763251_150_542 | 128 |
| 625 | 3300046491 | Ga0495584_0024076 | Ga0495584_0024076_1145_1537 | 128 |
| 626 | 3300046492 | Ga0495585_0010037 | Ga0495585_0010037_1736_2128 | 128 |
| 627 | 3300046492 | Ga0495585_0056404 | Ga0495585_0056404_969_1361 | 128 |
| 628 | 3300046492 | Ga0495585_0057137 | Ga0495585_0057137_954_1346 | 128 |
| 629 | 3300046492 | Ga0495585_0114767 | Ga0495585_0114767_194_586 | 128 |
| 630 | 3300046492 | Ga0495585_0183403 | Ga0495585_0183403_197_589 | 128 |
| 631 | 3300046499 | Ga0495594_0001615 | Ga0495594_0001615_6223_6615 | 128 |
| 632 | 3300046499 | Ga0495594_0038933 | Ga0495594_0038933_1271_1663 | 128 |
| 633 | 3300046499 | Ga0495594_0053658 | Ga0495594_0053658_663_1055 | 128 |
| 634 | 3300046499 | Ga0495594_0108551 | Ga0495594_0108551_716_1108 | 128 |
| 635 | 3300046500 | Ga0495596_0097190 | Ga0495596_0097190_297_689 | 128 |
| 636 | 3300046500 | Ga0495596_0137373 | Ga0495596_0137373_284_676 | 128 |
| 637 | 3300046501 | Ga0495607_0035092 | Ga0495607_0035092_2036_2428 | 128 |
| 638 | 3300046501 | Ga0495607_0073669 | Ga0495607_0073669_626_1018 | 128 |
| 639 | 3300046506 | Ga0495583_0121650 | Ga0495583_0121650_213_605 | 128 |
| 640 | 3300046506 | Ga0495583_0178411 | Ga0495583_0178411_412_804 | 128 |
| 641 | 3300046507 | Ga0495606_0021860 | Ga0495606_0021860_96_488 | 128 |
| 642 | 3300046511 | Ga0495608_0280901 | Ga0495608_0280901_550_942 | 128 |
| 643 | 3300046512 | Ga0495610_0050106 | Ga0495610_0050106_715_1107 | 128 |
| 644 | 3300046513 | Ga0495616_0003394 | Ga0495616_0003394_6948_7340 | 128 |
| 645 | 3300046515 | Ga0495620_0011476 | Ga0495620_0011476_412_804 | 128 |
| 646 | 3300046516 | Ga0495628_0001200 | Ga0495628_0001200_13344_13748 | 128 |
| 647 | 3300046516 | Ga0495628_0183377 | Ga0495628_0183377_210_602 | 128 |
| 648 | 3300046516 | Ga0495628_0369201 | Ga0495628_0369201_411_815 | 128 |
| 649 | 3300046516 | Ga0495628_0885675 | Ga0495628_0885675_34_426 | 128 |
| 650 | 3300046517 | Ga0495630_0005265 | Ga0495630_0005265_2970_3362 | 128 |
| 651 | 3300046517 | Ga0495630_0225832 | Ga0495630_0225832_859_1251 | 128 |
| 652 | 3300046517 | Ga0495630_0254616 | Ga0495630_0254616_533_925 | 128 |
| 653 | 3300046518 | Ga0495631_0046728 | Ga0495631_0046728_1149_1541 | 128 |
| 654 | 3300046518 | Ga0495631_0058036 | Ga0495631_0058036_312_704 | 128 |
| 655 | 3300046518 | Ga0495631_0145178 | Ga0495631_0145178_406_798 | 128 |
| 656 | 3300046518 | Ga0495631_0331775 | Ga0495631_0331775_31_423 | 128 |
| 657 | 3300046519 | Ga0495632_0329541 | Ga0495632_0329541_183_575 | 128 |
| 658 | 3300046520 | Ga0495637_0034789 | Ga0495637_0034789_937_1329 | 128 |
| 659 | 3300046520 | Ga0495637_0112670 | Ga0495637_0112670_132_524 | 128 |
| 660 | 3300046522 | Ga0495643_0001610 | Ga0495643_0001610_1395_1787 | 128 |
| 661 | 3300046522 | Ga0495643_0002300 | Ga0495643_0002300_1661_2053 | 128 |
| 662 | 3300046522 | Ga0495643_0305890 | Ga0495643_0305890_41_433 | 128 |
| 663 | 3300046523 | Ga0495644_0091979 | Ga0495644_0091979_527_919 | 128 |
| 664 | 3300046523 | Ga0495644_0121416 | Ga0495644_0121416_592_984 | 128 |
| 665 | 3300046524 | Ga0495648_0066584 | Ga0495648_0066584_700_1092 | 128 |
| 666 | 3300046524 | Ga0495648_0192116 | Ga0495648_0192116_597_989 | 128 |
| 667 | 3300046526 | Ga0495666_0047319 | Ga0495666_0047319_1149_1541 | 128 |
| 668 | 3300046526 | Ga0495666_0162104 | Ga0495666_0162104_358_750 | 128 |
| 669 | 3300046526 | Ga0495666_0176513 | Ga0495666_0176513_281_673 | 128 |
| 670 | 3300046528 | Ga0495642_0048827 | Ga0495642_0048827_793_1185 | 128 |
| 671 | 3300046529 | Ga0495652_0000586 | Ga0495652_0000586_16047_16451 | 128 |
| 672 | 3300046529 | Ga0495652_0002867 | Ga0495652_0002867_3759_4163 | 128 |
| 673 | 3300046529 | Ga0495652_0020630 | Ga0495652_0020630_3079_3471 | 128 |
| 674 | 3300046529 | Ga0495652_0239473 | Ga0495652_0239473_71_463 | 128 |
| 675 | 3300046529 | Ga0495652_0429479 | Ga0495652_0429479_485_889 | 128 |
| 676 | 3300046530 | Ga0495654_0033076 | Ga0495654_0033076_1078_1470 | 128 |
| 677 | 3300046533 | Ga0495640_0005552 | Ga0495640_0005552_3186_3578 | 128 |
| 678 | 3300046533 | Ga0495640_0010404 | Ga0495640_0010404_6633_7025 | 128 |
| 679 | 3300046533 | Ga0495640_0035007 | Ga0495640_0035007_2502_2894 | 128 |
| 680 | 3300046535 | Ga0495586_0147133 | Ga0495586_0147133_247_651 | 128 |
| 681 | 3300046536 | Ga0495587_0001229 | Ga0495587_0001229_5541_5933 | 128 |
| 682 | 3300046536 | Ga0495587_0106106 | Ga0495587_0106106_762_1166 | 128 |
| 683 | 3300046538 | Ga0495609_0012628 | Ga0495609_0012628_1034_1426 | 128 |
| 684 | 3300046538 | Ga0495609_0144931 | Ga0495609_0144931_211_603 | 128 |
| 685 | 3300046542 | Ga0495597_0014194 | Ga0495597_0014194_1421_1813 | 128 |
| 686 | 3300046542 | Ga0495597_0040776 | Ga0495597_0040776_566_958 | 128 |
| 687 | 3300046543 | Ga0495645_0005253 | Ga0495645_0005253_7541_7945 | 128 |
| 688 | 3300046543 | Ga0495645_0055025 | Ga0495645_0055025_1404_1796 | 128 |
| 689 | 3300046543 | Ga0495645_0081590 | Ga0495645_0081590_895_1287 | 128 |
| 690 | 3300046557 | Ga0495622_0064679 | Ga0495622_0064679_1019_1411 | 128 |
| 691 | 3300046557 | Ga0495622_0065555 | Ga0495622_0065555_142_534 | 128 |
| 692 | 3300046557 | Ga0495622_0120786 | Ga0495622_0120786_17_421 | 128 |
| 693 | 3300046557 | Ga0495622_0125871 | Ga0495622_0125871_535_927 | 128 |
| 694 | 3300046557 | Ga0495622_0183450 | Ga0495622_0183450_256_648 | 128 |
| 695 | 3300046557 | Ga0495622_0335613 | Ga0495622_0335613_34_426 | 128 |
| 696 | 3300046558 | Ga0495633_0008493 | Ga0495633_0008493_963_1355 | 128 |
| 697 | 3300046558 | Ga0495633_0133167 | Ga0495633_0133167_336_728 | 128 |
| 698 | 3300046559 | Ga0495667_0350488 | Ga0495667_0350488_153_545 | 128 |
| 699 | 3300046616 | Ga0495668_0042882 | Ga0495668_0042882_1616_2008 | 128 |
| 700 | 3300046616 | Ga0495668_0137291 | Ga0495668_0137291_412_804 | 128 |
| 701 | 3300046642 | Ga0495634_0001818 | Ga0495634_0001818_16114_16506 | 128 |
| 702 | 3300046642 | Ga0495634_0045317 | Ga0495634_0045317_1998_2402 | 128 |
| 703 | 3300046642 | Ga0495634_0088769 | Ga0495634_0088769_1409_1801 | 128 |
| 704 | 3300046648 | Ga0495611_0013050 | Ga0495611_0013050_1098_1490 | 128 |
| 705 | 3300046648 | Ga0495611_0036490 | Ga0495611_0036490_623_1015 | 128 |
| 706 | 3300046648 | Ga0495611_0053131 | Ga0495611_0053131_436_828 | 128 |
| 707 | 3300046660 | Ga0495625_0021558 | Ga0495625_0021558_3143_3535 | 128 |
| 708 | 3300046660 | Ga0495625_0035084 | Ga0495625_0035084_3230_3622 | 128 |
| 709 | 3300046660 | Ga0495625_0152743 | Ga0495625_0152743_436_828 | 128 |
| 710 | 3300046660 | Ga0495625_0744739 | Ga0495625_0744739_149_541 | 128 |
| 711 | 3300046663 | Ga0495635_0000586 | Ga0495635_0000586_17147_17551 | 128 |
| 712 | 3300046663 | Ga0495635_0003044 | Ga0495635_0003044_6471_6863 | 128 |
| 713 | 3300046663 | Ga0495635_0098026 | Ga0495635_0098026_1544_1936 | 128 |
| 714 | 3300046664 | Ga0495659_0304416 | Ga0495659_0304416_217_609 | 128 |
| 715 | 3300046665 | Ga0495661_0017649 | Ga0495661_0017649_2904_3296 | 128 |
| 716 | 3300046665 | Ga0495661_0302359 | Ga0495661_0302359_18_410 | 128 |
| 717 | 3300046674 | Ga0495588_0013636 | Ga0495588_0013636_2374_2766 | 128 |
| 718 | 3300046674 | Ga0495588_0016192 | Ga0495588_0016192_2652_3044 | 128 |
| 719 | 3300046674 | Ga0495588_0031500 | Ga0495588_0031500_2227_2619 | 128 |
| 720 | 3300046674 | Ga0495588_0188139 | Ga0495588_0188139_180_572 | 128 |
| 721 | 3300046675 | Ga0495657_0000796 | Ga0495657_0000796_10162_10554 | 128 |
| 722 | 3300046675 | Ga0495657_0023246 | Ga0495657_0023246_1916_2308 | 128 |
| 723 | 3300046675 | Ga0495657_0237580 | Ga0495657_0237580_559_951 | 128 |
| 724 | 3300046675 | Ga0495657_0693902 | Ga0495657_0693902_127_531 | 128 |
| 725 | 3300046678 | Ga0495599_0112865 | Ga0495599_0112865_1033_1425 | 128 |
| 726 | 3300046678 | Ga0495599_0262766 | Ga0495599_0262766_630_1034 | 128 |
| 727 | 3300046679 | Ga0495623_0029613 | Ga0495623_0029613_1651_2055 | 128 |
| 728 | 3300046679 | Ga0495623_0205831 | Ga0495623_0205831_561_953 | 128 |
| 729 | 3300046679 | Ga0495623_0298730 | Ga0495623_0298730_169_561 | 128 |
| 730 | 3300046680 | Ga0495646_0002293 | Ga0495646_0002293_10517_10909 | 128 |
| 731 | 3300046680 | Ga0495646_0027540 | Ga0495646_0027540_2687_3091 | 128 |
| 732 | 3300046680 | Ga0495646_0201664 | Ga0495646_0201664_436_840 | 128 |
| 733 | 3300046680 | Ga0495646_0306774 | Ga0495646_0306774_112_504 | 128 |
| 734 | 3300046683 | Ga0495658_0049798 | Ga0495658_0049798_385_777 | 128 |
| 735 | 3300046683 | Ga0495658_0057579 | Ga0495658_0057579_1350_1742 | 128 |
| 736 | 3300046689 | Ga0495613_0002324 | Ga0495613_0002324_1542_1934 | 128 |
| 737 | 3300046689 | Ga0495613_0025321 | Ga0495613_0025321_377_769 | 128 |
| 738 | 3300046689 | Ga0495613_0079557 | Ga0495613_0079557_449_841 | 128 |
| 739 | 3300046689 | Ga0495613_0120711 | Ga0495613_0120711_103_495 | 128 |
| 740 | 3300046689 | Ga0495613_0171071 | Ga0495613_0171071_775_1167 | 128 |
| 741 | 3300046689 | Ga0495613_0234335 | Ga0495613_0234335_434_826 | 128 |
| 742 | 3300046690 | Ga0495624_0088479 | Ga0495624_0088479_547_939 | 128 |
| 743 | 3300046690 | Ga0495624_0104000 | Ga0495624_0104000_1206_1598 | 128 |
| 744 | 3300046691 | Ga0495670_0039497 | Ga0495670_0039497_1688_2080 | 128 |
| 745 | 3300046691 | Ga0495670_0165579 | Ga0495670_0165579_540_932 | 128 |
| 746 | 3300046691 | Ga0495670_0361067 | Ga0495670_0361067_342_734 | 128 |
| 747 | 3300046692 | Ga0495671_0003815 | Ga0495671_0003815_7997_8389 | 128 |
| 748 | 3300046694 | Ga0495649_0054498 | Ga0495649_0054498_925_1317 | 128 |
| 749 | 3300046694 | Ga0495649_0110071 | Ga0495649_0110071_136_528 | 128 |
| 750 | 3300046794 | Ga0495589_0006450 | Ga0495589_0006450_4711_5103 | 128 |
| 751 | 3300046794 | Ga0495589_0033221 | Ga0495589_0033221_975_1367 | 128 |
| 752 | 3300046794 | Ga0495589_0048666 | Ga0495589_0048666_1484_1876 | 128 |
| 753 | 3300046794 | Ga0495589_0078242 | Ga0495589_0078242_650_1042 | 128 |
| 754 | 3300046809 | Ga0495600_0001390 | Ga0495600_0001390_6985_7389 | 128 |
| 755 | 3300046809 | Ga0495600_0003691 | Ga0495600_0003691_1591_1983 | 128 |
| 756 | 3300046809 | Ga0495600_0006527 | Ga0495600_0006527_3572_3976 | 128 |
| 757 | 3300046809 | Ga0495600_0043331 | Ga0495600_0043331_554_946 | 128 |
| 758 | 3300046809 | Ga0495600_0052676 | Ga0495600_0052676_531_923 | 128 |
| 759 | 3300046810 | Ga0495660_0035201 | Ga0495660_0035201_1425_1817 | 128 |
| 760 | 3300047315 | Ga0495581_0004218 | Ga0495581_0004218_2552_2944 | 128 |
| 761 | 3300047315 | Ga0495581_0051070 | Ga0495581_0051070_1580_1972 | 128 |
| 762 | 3300047315 | Ga0495581_0106775 | Ga0495581_0106775_896_1288 | 128 |
| 763 | 3300047315 | Ga0495581_0180188 | Ga0495581_0180188_360_752 | 128 |
| 764 | 3300047317 | Ga0495604_0000695 | Ga0495604_0000695_4950_5342 | 128 |
| 765 | 3300047317 | Ga0495604_0004263 | Ga0495604_0004263_4400_4792 | 128 |
| 766 | 3300047317 | Ga0495604_0031309 | Ga0495604_0031309_3676_4080 | 128 |
| 767 | 3300047317 | Ga0495604_0079704 | Ga0495604_0079704_946_1338 | 128 |
| 768 | 3300047317 | Ga0495604_0372664 | Ga0495604_0372664_150_623 | 128 |
| 769 | 3300047318 | Ga0495636_0002781 | Ga0495636_0002781_4575_4967 | 128 |
| 770 | 3300047318 | Ga0495636_0007046 | Ga0495636_0007046_1051_1443 | 128 |
| 771 | 3300047318 | Ga0495636_0022839 | Ga0495636_0022839_1519_1911 | 128 |
| 772 | 3300047318 | Ga0495636_0045118 | Ga0495636_0045118_1167_1559 | 128 |
| 773 | 3300047318 | Ga0495636_0065687 | Ga0495636_0065687_230_622 | 128 |
| 774 | 3300047319 | Ga0495674_0256906 | Ga0495674_0256906_265_657 | 128 |
| 775 | 3300047320 | Ga0495672_0028599 | Ga0495672_0028599_2171_2563 | 128 |
| 776 | 3300047321 | Ga0495676_0007640 | Ga0495676_0007640_201_593 | 128 |
| 777 | 3300047321 | Ga0495676_0009942 | Ga0495676_0009942_6849_7241 | 128 |
| 778 | 3300047321 | Ga0495676_0028414 | Ga0495676_0028414_77_469 | 128 |
| 779 | 3300047322 | Ga0495680_0096193 | Ga0495680_0096193_812_1204 | 128 |
| 780 | 3300047323 | Ga0495683_0019687 | Ga0495683_0019687_597_989 | 128 |
| 781 | 3300047323 | Ga0495683_0083660 | Ga0495683_0083660_78_470 | 128 |
| 782 | 3300047443 | Ga0495687_003278 | Ga0495687_003278_2113_2505 | 128 |
| 783 | 3300047443 | Ga0495687_005559 | Ga0495687_005559_1359_1751 | 128 |
| 784 | 3300047443 | Ga0495687_019035 | Ga0495687_019035_2832_3224 | 128 |
| 785 | 3300047443 | Ga0495687_020827 | Ga0495687_020827_2059_2451 | 128 |
| 786 | 3300047444 | Ga0495675_0068124 | Ga0495675_0068124_1573_1965 | 128 |
| 787 | 3300047444 | Ga0495675_0366072 | Ga0495675_0366072_371_763 | 128 |
| 788 | 3300047444 | Ga0495675_0550835 | Ga0495675_0550835_219_623 | 128 |
| 789 | 3300047445 | Ga0495677_0068192 | Ga0495677_0068192_455_847 | 128 |
| 790 | 3300047445 | Ga0495677_0304151 | Ga0495677_0304151_97_489 | 128 |
| 791 | 3300047446 | Ga0495679_036338 | Ga0495679_036338_1033_1425 | 128 |
| 792 | 3300047446 | Ga0495679_045759 | Ga0495679_045759_530_922 | 128 |
| 793 | 3300047447 | Ga0495685_001698 | Ga0495685_001698_3091_3483 | 128 |
| 794 | 3300047447 | Ga0495685_007252 | Ga0495685_007252_961_1353 | 128 |
| 795 | 3300047447 | Ga0495685_007505 | Ga0495685_007505_1989_2381 | 128 |
| 796 | 3300047447 | Ga0495685_010371 | Ga0495685_010371_1140_1532 | 128 |
| 797 | 3300047447 | Ga0495685_012966 | Ga0495685_012966_740_1132 | 128 |
| 798 | 3300047469 | Ga0495673_0130076 | Ga0495673_0130076_245_637 | 128 |
| 799 | 3300047470 | Ga0495681_0000484 | Ga0495681_0000484_29598_29990 | 128 |
| 800 | 3300047470 | Ga0495681_0362849 | Ga0495681_0362849_11_403 | 128 |
| 801 | 3300047471 | Ga0495684_0017005 | Ga0495684_0017005_3486_3878 | 128 |
| 802 | 3300047471 | Ga0495684_0316784 | Ga0495684_0316784_255_647 | 128 |
| 803 | 3300047472 | Ga0495686_0012981 | Ga0495686_0012981_1129_1521 | 128 |
| 804 | 3300047472 | Ga0495686_0017187 | Ga0495686_0017187_3529_3921 | 128 |
| 805 | 3300047472 | Ga0495686_0058569 | Ga0495686_0058569_1514_1906 | 128 |
| 806 | 3300047673 | Ga0495593_0001318 | Ga0495593_0001318_2911_3303 | 128 |
| 807 | 3300047673 | Ga0495593_0033161 | Ga0495593_0033161_348_740 | 128 |
| 808 | 3300048088 | Ga0495602_0048486 | Ga0495602_0048486_3131_3523 | 128 |
| 809 | 3300048088 | Ga0495602_0741135 | Ga0495602_0741135_241_645 | 128 |
| 810 | 3300048089 | Ga0495614_0000529 | Ga0495614_0000529_12135_12527 | 128 |
| 811 | 3300048089 | Ga0495614_0001808 | Ga0495614_0001808_8168_8560 | 128 |
| 812 | 3300048089 | Ga0495614_0059165 | Ga0495614_0059165_836_1228 | 128 |
| 813 | 3300048089 | Ga0495614_0318058 | Ga0495614_0318058_50_442 | 128 |
| 814 | 3300048089 | Ga0495614_0580472 | Ga0495614_0580472_98_490 | 128 |
| 815 | 3300048091 | Ga0495626_0063393 | Ga0495626_0063393_986_1378 | 128 |
| 816 | 3300048905 | Ga0496102_0833904 | Ga0496102_0833904_30_422 | 128 |
| 817 | 3300048907 | Ga0496104_0344186 | Ga0496104_0344186_766_1158 | 128 |
| 818 | 3300048907 | Ga0496104_1718297 | Ga0496104_1718297_40_432 | 128 |
| 819 | 3300048908 | Ga0496105_0482043 | Ga0496105_0482043_279_671 | 128 |
| 820 | 3300048909 | Ga0496106_0339334 | Ga0496106_0339334_358_750 | 128 |
| 821 | 3300048911 | Ga0496108_0077340 | Ga0496108_0077340_1437_1829 | 128 |
| 822 | 3300048914 | Ga0496111_0185931 | Ga0496111_0185931_419_811 | 128 |
| 823 | 3300048916 | Ga0496113_0200630 | Ga0496113_0200630_519_911 | 128 |
| 824 | 3300048916 | Ga0496113_1404487 | Ga0496113_1404487_51_443 | 128 |
| 825 | 3300048929 | Ga0496126_0030170 | Ga0496126_0030170_1582_1968 | 128 |
| 826 | 3300048929 | Ga0496126_1038570 | Ga0496126_1038570_178_597 | 128 |
| 827 | 3300049127 | Ga0501306_051309 | Ga0501306_051309_177_569 | 128 |
| 828 | 3300049128 | Ga0501308_038226 | Ga0501308_038226_189_581 | 128 |
| 829 | 3300049129 | Ga0501309_099916 | Ga0501309_099916_81_473 | 128 |
| 830 | 3300049160 | Ga0501304_023281 | Ga0501304_023281_23_415 | 128 |
| 831 | 3300049161 | Ga0501305_106765 | Ga0501305_106765_48_440 | 128 |
| 832 | 3300049162 | Ga0501307_063577 | Ga0501307_063577_164_556 | 128 |
| 833 | 3300049459 | Ga0495678_056769 | Ga0495678_056769_988_1380 | 128 |
| 834 | 3300049460 | Ga0495682_0065758 | Ga0495682_0065758_225_617 | 128 |
| 835 | 3300049531 | Ga0501315_069559 | Ga0501315_069559_22_414 | 128 |
| 836 | 3300049568 | Ga0501031_0007283 | Ga0501031_0007283_6625_7017 | 128 |
| 837 | 3300049568 | Ga0501031_0021237 | Ga0501031_0021237_3376_3768 | 128 |
| 838 | 3300049568 | Ga0501031_0033610 | Ga0501031_0033610_1999_2391 | 128 |
| 839 | 3300049568 | Ga0501031_0168019 | Ga0501031_0168019_876_1268 | 128 |
| 840 | 3300049568 | Ga0501031_0419558 | Ga0501031_0419558_456_848 | 128 |
| 841 | 3300049569 | Ga0501032_0001990 | Ga0501032_0001990_11191_11583 | 128 |
| 842 | 3300049569 | Ga0501032_0039760 | Ga0501032_0039760_1876_2268 | 128 |
| 843 | 3300049569 | Ga0501032_0042190 | Ga0501032_0042190_1187_1579 | 128 |
| 844 | 3300049569 | Ga0501032_0046767 | Ga0501032_0046767_1929_2321 | 128 |
| 845 | 3300049569 | Ga0501032_0098405 | Ga0501032_0098405_972_1364 | 128 |
| 846 | 3300049569 | Ga0501032_0292053 | Ga0501032_0292053_385_777 | 128 |
| 847 | 3300049569 | Ga0501032_0330186 | Ga0501032_0330186_472_864 | 128 |
| 848 | 3300049570 | Ga0501033_0009919 | Ga0501033_0009919_3934_4326 | 128 |
| 849 | 3300049570 | Ga0501033_0030574 | Ga0501033_0030574_990_1382 | 128 |
| 850 | 3300049570 | Ga0501033_0092653 | Ga0501033_0092653_360_752 | 128 |
| 851 | 3300049570 | Ga0501033_0152049 | Ga0501033_0152049_931_1323 | 128 |
| 852 | 3300049570 | Ga0501033_0174966 | Ga0501033_0174966_1084_1476 | 128 |
| 853 | 3300049570 | Ga0501033_0240627 | Ga0501033_0240627_627_1019 | 128 |
| 854 | 3300049570 | Ga0501033_0444803 | Ga0501033_0444803_234_626 | 128 |
| 855 | 3300049571 | Ga0501034_0005363 | Ga0501034_0005363_9058_9450 | 128 |
| 856 | 3300049571 | Ga0501034_0005698 | Ga0501034_0005698_1735_2127 | 128 |
| 857 | 3300049571 | Ga0501034_0018502 | Ga0501034_0018502_3697_4089 | 128 |
| 858 | 3300049571 | Ga0501034_0060680 | Ga0501034_0060680_2671_3063 | 128 |
| 859 | 3300049571 | Ga0501034_0089866 | Ga0501034_0089866_733_1125 | 128 |
| 860 | 3300049571 | Ga0501034_0097780 | Ga0501034_0097780_1202_1594 | 128 |
| 861 | 3300049571 | Ga0501034_0151625 | Ga0501034_0151625_876_1268 | 128 |
| 862 | 3300049571 | Ga0501034_0510163 | Ga0501034_0510163_445_837 | 128 |
| 863 | 3300049571 | Ga0501034_0959366 | Ga0501034_0959366_302_694 | 128 |
| 864 | 3300049572 | Ga0501036_0000553 | Ga0501036_0000553_16493_16885 | 128 |
| 865 | 3300049572 | Ga0501036_0010697 | Ga0501036_0010697_5458_5850 | 128 |
| 866 | 3300049572 | Ga0501036_0023104 | Ga0501036_0023104_2183_2575 | 128 |
| 867 | 3300049572 | Ga0501036_0032873 | Ga0501036_0032873_772_1164 | 128 |
| 868 | 3300049572 | Ga0501036_0051941 | Ga0501036_0051941_1775_2167 | 128 |
| 869 | 3300049572 | Ga0501036_0087173 | Ga0501036_0087173_496_888 | 128 |
| 870 | 3300049572 | Ga0501036_0298239 | Ga0501036_0298239_616_1008 | 128 |
| 871 | 3300049572 | Ga0501036_0557796 | Ga0501036_0557796_446_838 | 128 |
| 872 | 3300049573 | Ga0501037_0002550 | Ga0501037_0002550_11191_11583 | 128 |
| 873 | 3300049573 | Ga0501037_0030551 | Ga0501037_0030551_137_529 | 128 |
| 874 | 3300049573 | Ga0501037_0050338 | Ga0501037_0050338_1708_2100 | 128 |
| 875 | 3300049573 | Ga0501037_0072793 | Ga0501037_0072793_1810_2199 | 128 |
| 876 | 3300049573 | Ga0501037_0155175 | Ga0501037_0155175_1102_1494 | 128 |
| 877 | 3300049573 | Ga0501037_0217993 | Ga0501037_0217993_205_597 | 128 |
| 878 | 3300049573 | Ga0501037_0228775 | Ga0501037_0228775_631_1023 | 128 |
| 879 | 3300049574 | Ga0501038_0002207 | Ga0501038_0002207_485_877 | 128 |
| 880 | 3300049574 | Ga0501038_0005677 | Ga0501038_0005677_9306_9698 | 128 |
| 881 | 3300049574 | Ga0501038_0014436 | Ga0501038_0014436_6209_6601 | 128 |
| 882 | 3300049574 | Ga0501038_0014677 | Ga0501038_0014677_1703_2095 | 128 |
| 883 | 3300049574 | Ga0501038_0061328 | Ga0501038_0061328_209_601 | 128 |
| 884 | 3300049574 | Ga0501038_0070220 | Ga0501038_0070220_46_438 | 128 |
| 885 | 3300049574 | Ga0501038_0149106 | Ga0501038_0149106_401_790 | 128 |
| 886 | 3300049574 | Ga0501038_0390960 | Ga0501038_0390960_446_838 | 128 |
| 887 | 3300049574 | Ga0501038_0393492 | Ga0501038_0393492_216_608 | 128 |
| 888 | 3300049575 | Ga0501039_0002645 | Ga0501039_0002645_11933_12325 | 128 |
| 889 | 3300049575 | Ga0501039_0015464 | Ga0501039_0015464_5244_5636 | 128 |
| 890 | 3300049575 | Ga0501039_0032315 | Ga0501039_0032315_2305_2697 | 128 |
| 891 | 3300049575 | Ga0501039_0830449 | Ga0501039_0830449_189_581 | 128 |
| 892 | 3300049575 | Ga0501039_1356548 | Ga0501039_1356548_119_511 | 128 |
| 893 | 3300049576 | Ga0501040_0040801 | Ga0501040_0040801_1812_2204 | 128 |
| 894 | 3300049576 | Ga0501040_0890790 | Ga0501040_0890790_25_417 | 128 |
| 895 | 3300049576 | Ga0501040_0929819 | Ga0501040_0929819_67_459 | 128 |
| 896 | 3300049577 | Ga0501041_0000849 | Ga0501041_0000849_4702_5094 | 128 |
| 897 | 3300049577 | Ga0501041_0561274 | Ga0501041_0561274_47_439 | 128 |
| 898 | 3300049578 | Ga0501042_0001880 | Ga0501042_0001880_1586_1978 | 128 |
| 899 | 3300049578 | Ga0501042_0028160 | Ga0501042_0028160_1014_1406 | 128 |
| 900 | 3300049578 | Ga0501042_0196332 | Ga0501042_0196332_497_889 | 128 |
| 901 | 3300049578 | Ga0501042_0391904 | Ga0501042_0391904_399_791 | 128 |
| 902 | 3300049578 | Ga0501042_1201338 | Ga0501042_1201338_25_417 | 128 |
| 903 | 3300049579 | Ga0501043_0005890 | Ga0501043_0005890_1045_1437 | 128 |
| 904 | 3300049579 | Ga0501043_0009787 | Ga0501043_0009787_303_695 | 128 |
| 905 | 3300049579 | Ga0501043_0020943 | Ga0501043_0020943_2203_2595 | 128 |
| 906 | 3300049579 | Ga0501043_0119835 | Ga0501043_0119835_660_1052 | 128 |
| 907 | 3300049579 | Ga0501043_0146961 | Ga0501043_0146961_1062_1454 | 128 |
| 908 | 3300049579 | Ga0501043_0290415 | Ga0501043_0290415_839_1231 | 128 |
| 909 | 3300049579 | Ga0501043_0299692 | Ga0501043_0299692_462_854 | 128 |
| 910 | 3300049579 | Ga0501043_0822591 | Ga0501043_0822591_99_491 | 128 |
| 911 | 3300049580 | Ga0501046_0005490 | Ga0501046_0005490_9434_9826 | 128 |
| 912 | 3300049580 | Ga0501046_0042485 | Ga0501046_0042485_2692_3084 | 128 |
| 913 | 3300049580 | Ga0501046_0095304 | Ga0501046_0095304_1516_1908 | 128 |
| 914 | 3300049580 | Ga0501046_0281545 | Ga0501046_0281545_556_948 | 128 |
| 915 | 3300049580 | Ga0501046_0295582 | Ga0501046_0295582_693_1085 | 128 |
| 916 | 3300049581 | Ga0501047_0005878 | Ga0501047_0005878_10693_11085 | 128 |
| 917 | 3300049581 | Ga0501047_0013772 | Ga0501047_0013772_3880_4272 | 128 |
| 918 | 3300049581 | Ga0501047_0017015 | Ga0501047_0017015_852_1244 | 128 |
| 919 | 3300049581 | Ga0501047_0023366 | Ga0501047_0023366_3431_3823 | 128 |
| 920 | 3300049581 | Ga0501047_0023815 | Ga0501047_0023815_403_795 | 128 |
| 921 | 3300049581 | Ga0501047_0041485 | Ga0501047_0041485_3480_3872 | 128 |
| 922 | 3300049581 | Ga0501047_0051699 | Ga0501047_0051699_2458_2850 | 128 |
| 923 | 3300049581 | Ga0501047_0071007 | Ga0501047_0071007_2401_2790 | 128 |
| 924 | 3300049581 | Ga0501047_0346521 | Ga0501047_0346521_694_1086 | 128 |
| 925 | 3300049582 | Ga0501048_0002755 | Ga0501048_0002755_4591_4983 | 128 |
| 926 | 3300049582 | Ga0501048_0025711 | Ga0501048_0025711_2707_3099 | 128 |
| 927 | 3300049582 | Ga0501048_0291714 | Ga0501048_0291714_309_701 | 128 |
| 928 | 3300049582 | Ga0501048_0357085 | Ga0501048_0357085_165_557 | 128 |
| 929 | 3300049582 | Ga0501048_0412883 | Ga0501048_0412883_19_411 | 128 |
| 930 | 3300049582 | Ga0501048_0494157 | Ga0501048_0494157_256_648 | 128 |
| 931 | 3300049582 | Ga0501048_0750068 | Ga0501048_0750068_48_440 | 128 |
| 932 | 3300049583 | Ga0501067_0007326 | Ga0501067_0007326_4726_5118 | 128 |
| 933 | 3300049583 | Ga0501067_0711021 | Ga0501067_0711021_157_549 | 128 |
| 934 | 3300049584 | Ga0501068_0062071 | Ga0501068_0062071_398_790 | 128 |
| 935 | 3300049584 | Ga0501068_0108969 | Ga0501068_0108969_71_463 | 128 |
| 936 | 3300049585 | Ga0501069_0038843 | Ga0501069_0038843_735_1127 | 128 |
| 937 | 3300049585 | Ga0501069_0111469 | Ga0501069_0111469_114_506 | 128 |
| 938 | 3300049586 | Ga0501070_0000903 | Ga0501070_0000903_13718_14110 | 128 |
| 939 | 3300049586 | Ga0501070_0188761 | Ga0501070_0188761_719_1111 | 128 |
| 940 | 3300049586 | Ga0501070_0272252 | Ga0501070_0272252_800_1192 | 128 |
| 941 | 3300049586 | Ga0501070_0420523 | Ga0501070_0420523_294_686 | 128 |
| 942 | 3300049586 | Ga0501070_0599222 | Ga0501070_0599222_305_697 | 128 |
| 943 | 3300049587 | Ga0501071_0001385 | Ga0501071_0001385_2183_2575 | 128 |
| 944 | 3300049587 | Ga0501071_0152106 | Ga0501071_0152106_1262_1654 | 128 |
| 945 | 3300049587 | Ga0501071_0999195 | Ga0501071_0999195_67_459 | 128 |
| 946 | 3300049587 | Ga0501071_1085438 | Ga0501071_1085438_76_468 | 128 |
| 947 | 3300049588 | Ga0501072_0017666 | Ga0501072_0017666_5029_5421 | 128 |
| 948 | 3300049588 | Ga0501072_0379948 | Ga0501072_0379948_471_863 | 128 |
| 949 | 3300049588 | Ga0501072_1194013 | Ga0501072_1194013_159_551 | 128 |
| 950 | 3300049589 | Ga0501073_0154658 | Ga0501073_0154658_335_727 | 128 |
| 951 | 3300049589 | Ga0501073_0401518 | Ga0501073_0401518_390_782 | 128 |
| 952 | 3300049589 | Ga0501073_1272372 | Ga0501073_1272372_80_472 | 128 |
| 953 | 3300049590 | Ga0501074_0000685 | Ga0501074_0000685_20615_21007 | 128 |
| 954 | 3300049590 | Ga0501074_0206939 | Ga0501074_0206939_605_997 | 128 |
| 955 | 3300049590 | Ga0501074_0210669 | Ga0501074_0210669_928_1320 | 128 |
| 956 | 3300049590 | Ga0501074_0513327 | Ga0501074_0513327_421_813 | 128 |
| 957 | 3300049591 | Ga0501075_0640712 | Ga0501075_0640712_55_447 | 128 |
| 958 | 3300049592 | Ga0501076_0016555 | Ga0501076_0016555_848_1240 | 128 |
| 959 | 3300049592 | Ga0501076_0312388 | Ga0501076_0312388_387_779 | 128 |
| 960 | 3300049593 | Ga0501077_0081465 | Ga0501077_0081465_37_429 | 128 |
| 961 | 3300049593 | Ga0501077_0094327 | Ga0501077_0094327_615_1007 | 128 |
| 962 | 3300049593 | Ga0501077_0400452 | Ga0501077_0400452_106_498 | 128 |
| 963 | 3300049652 | Ga0501202_057607 | Ga0501202_057607_235_627 | 128 |
| 964 | 3300049663 | Ga0501223_076749 | Ga0501223_076749_159_551 | 128 |
| 965 | 3300049741 | Ga0501079_0032385 | Ga0501079_0032385_1501_1893 | 128 |
| 966 | 3300049741 | Ga0501079_0425238 | Ga0501079_0425238_222_614 | 128 |
| 967 | 3300049742 | Ga0501080_0107698 | Ga0501080_0107698_456_848 | 128 |
| 968 | 3300049742 | Ga0501080_0861550 | Ga0501080_0861550_65_457 | 128 |
| 969 | 3300049743 | Ga0501081_0100340 | Ga0501081_0100340_831_1223 | 128 |
| 970 | 3300049744 | Ga0501083_0211714 | Ga0501083_0211714_72_464 | 128 |
| 971 | 3300049744 | Ga0501083_0290317 | Ga0501083_0290317_373_765 | 128 |
| 972 | 3300049761 | Ga0501264_020435 | Ga0501264_020435_90_482 | 128 |
| 973 | 3300049778 | Ga0501282_013501 | Ga0501282_013501_458_850 | 128 |
| 974 | 3300049822 | Ga0501035_0002519 | Ga0501035_0002519_11638_12030 | 128 |
| 975 | 3300049822 | Ga0501035_0004257 | Ga0501035_0004257_4009_4401 | 128 |
| 976 | 3300049822 | Ga0501035_0022434 | Ga0501035_0022434_201_593 | 128 |
| 977 | 3300049822 | Ga0501035_0029012 | Ga0501035_0029012_454_846 | 128 |
| 978 | 3300049822 | Ga0501035_0032276 | Ga0501035_0032276_3696_4088 | 128 |
| 979 | 3300049822 | Ga0501035_0105598 | Ga0501035_0105598_473_865 | 128 |
| 980 | 3300049822 | Ga0501035_0131465 | Ga0501035_0131465_1265_1657 | 128 |
| 981 | 3300049822 | Ga0501035_0205013 | Ga0501035_0205013_482_874 | 128 |
| 982 | 3300049822 | Ga0501035_0256618 | Ga0501035_0256618_268_660 | 128 |
| 983 | 3300049822 | Ga0501035_0789146 | Ga0501035_0789146_103_495 | 128 |
| 984 | 3300049823 | Ga0501044_0007347 | Ga0501044_0007347_1004_1396 | 128 |
| 985 | 3300049823 | Ga0501044_0009230 | Ga0501044_0009230_20_412 | 128 |
| 986 | 3300049823 | Ga0501044_0012456 | Ga0501044_0012456_3771_4160 | 128 |
| 987 | 3300049823 | Ga0501044_0021769 | Ga0501044_0021769_4046_4438 | 128 |
| 988 | 3300049823 | Ga0501044_0023137 | Ga0501044_0023137_4591_4983 | 128 |
| 989 | 3300049823 | Ga0501044_0038017 | Ga0501044_0038017_3913_4305 | 128 |
| 990 | 3300049823 | Ga0501044_0080660 | Ga0501044_0080660_2510_2902 | 128 |
| 991 | 3300049823 | Ga0501044_0282609 | Ga0501044_0282609_407_799 | 128 |
| 992 | 3300049824 | Ga0501045_0015881 | Ga0501045_0015881_3865_4257 | 128 |
| 993 | 3300049824 | Ga0501045_0048873 | Ga0501045_0048873_2474_2866 | 128 |
| 994 | 3300049824 | Ga0501045_0303559 | Ga0501045_0303559_314_706 | 128 |
| 995 | 3300049824 | Ga0501045_0338954 | Ga0501045_0338954_132_524 | 128 |
| 996 | 3300050492 | nmdc:mga0yw44_606416_c1 | nmdc:mga0yw44_606416_c1_224_616 | 128 |
| 997 | 3300050492 | nmdc:mga0yw44_996525_c1 | nmdc:mga0yw44_996525_c1_51_443 | 128 |
| 998 | 3300050494 | nmdc:mga06z11_759715_c1 | nmdc:mga06z11_759715_c1_16_408 | 128 |
| 999 | 3300050494 | nmdc:mga06z11_8290_c1 | nmdc:mga06z11_8290_c1_2593_2985 | 128 |
| 1000 | 3300050495 | nmdc:mga04h51_28168_c1 | nmdc:mga04h51_28168_c1_1214_1606 | 128 |
| 1001 | 3300050496 | nmdc:mga07m45_415360_c1 | nmdc:mga07m45_415360_c1_64_456 | 128 |
| 1002 | 3300050514 | nmdc:mga08x19_512198_c1 | nmdc:mga08x19_512198_c1_95_499 | 128 |
| 1003 | 3300053077 | Ga0495601_0012919 | Ga0495601_0012919_709_1113 | 128 |
| 1004 | 3300053077 | Ga0495601_0222963 | Ga0495601_0222963_556_960 | 128 |
| 1005 | 3300053077 | Ga0495601_0530919 | Ga0495601_0530919_319_711 | 128 |
| 1006 | 3300053078 | Ga0495612_0003333 | Ga0495612_0003333_1116_1520 | 128 |
| 1007 | 3300053078 | Ga0495612_0011773 | Ga0495612_0011773_101_505 | 128 |
| 1008 | 3300053078 | Ga0495612_0522533 | Ga0495612_0522533_52_444 | 128 |
| 1009 | 3300053079 | Ga0500610_0232357 | Ga0500610_0232357_430_822 | 128 |
| 1010 | 3300053085 | Ga0495619_0122367 | Ga0495619_0122367_798_1202 | 128 |
| 1011 | 3300053085 | Ga0495619_0211454 | Ga0495619_0211454_629_1033 | 128 |
| 1012 | 3300053085 | Ga0495619_0693378 | Ga0495619_0693378_156_548 | 128 |
| 1013 | 3300053086 | Ga0500578_0137294 | Ga0500578_0137294_885_1277 | 128 |
| 1014 | 3300053088 | Ga0500644_0014989 | Ga0500644_0014989_545_964 | 128 |
| 1015 | 3300053088 | Ga0500644_0019832 | Ga0500644_0019832_977_1369 | 128 |
| 1016 | 3300053092 | Ga0500583_0495849 | Ga0500583_0495849_133_525 | 128 |
| 1017 | 3300053094 | Ga0500566_0047067 | Ga0500566_0047067_59_451 | 128 |
| 1018 | 3300053095 | Ga0500640_006196 | Ga0500640_006196_2891_3283 | 128 |
| 1019 | 3300053098 | Ga0500650_0099354 | Ga0500650_0099354_290_682 | 128 |
| 1020 | 3300053099 | Ga0500654_088991 | Ga0500654_088991_61_453 | 128 |
| 1021 | 3300053100 | Ga0500660_241757 | Ga0500660_241757_32_424 | 128 |
| 1022 | 3300053104 | Ga0500556_0054793 | Ga0500556_0054793_70_462 | 128 |
| 1023 | 3300053106 | Ga0500558_121645 | Ga0500558_121645_370_762 | 128 |
| 1024 | 3300053107 | Ga0500560_005308 | Ga0500560_005308_983_1375 | 128 |
| 1025 | 3300053109 | Ga0500569_002482 | Ga0500569_002482_2337_2729 | 128 |
| 1026 | 3300053121 | Ga0500607_093798 | Ga0500607_093798_40_429 | 128 |
| 1027 | 3300053123 | Ga0500614_014576 | Ga0500614_014576_907_1299 | 128 |
| 1028 | 3300053126 | Ga0500621_104158 | Ga0500621_104158_312_704 | 128 |
| 1029 | 3300053129 | Ga0500628_048126 | Ga0500628_048126_317_709 | 128 |
| 1030 | 3300053131 | Ga0500652_009284 | Ga0500652_009284_2010_2402 | 128 |
| 1031 | 3300053131 | Ga0500652_282806 | Ga0500652_282806_52_444 | 128 |
| 1032 | 3300053134 | Ga0500658_0003289 | Ga0500658_0003289_4579_4971 | 128 |
| 1033 | 3300053136 | Ga0500559_0144810 | Ga0500559_0144810_507_899 | 128 |
| 1034 | 3300053136 | Ga0500559_0381026 | Ga0500559_0381026_188_580 | 128 |
| 1035 | 3300053137 | Ga0500561_0000719 | Ga0500561_0000719_1288_1680 | 128 |
| 1036 | 3300053140 | Ga0500573_0004777 | Ga0500573_0004777_6381_6773 | 128 |
| 1037 | 3300053140 | Ga0500573_0025166 | Ga0500573_0025166_2653_3045 | 128 |
| 1038 | 3300053140 | Ga0500573_0143800 | Ga0500573_0143800_307_699 | 128 |
| 1039 | 3300053142 | Ga0500577_0167810 | Ga0500577_0167810_296_715 | 128 |
| 1040 | 3300053143 | Ga0500579_033415 | Ga0500579_033415_1903_2295 | 128 |
| 1041 | 3300053149 | Ga0500600_0022644 | Ga0500600_0022644_1477_1869 | 128 |
| 1042 | 3300053149 | Ga0500600_0193322 | Ga0500600_0193322_467_859 | 128 |
| 1043 | 3300053150 | Ga0500603_159476 | Ga0500603_159476_272_664 | 128 |
| 1044 | 3300053153 | Ga0500616_0019242 | Ga0500616_0019242_1981_2373 | 128 |
| 1045 | 3300053160 | Ga0500633_0000323 | Ga0500633_0000323_5230_5622 | 128 |
| 1046 | 3300053160 | Ga0500633_0167843 | Ga0500633_0167843_101_520 | 128 |
| 1047 | 3300053161 | Ga0500634_0050684 | Ga0500634_0050684_138_530 | 128 |
| 1048 | 3300053177 | Ga0500636_0491563 | Ga0500636_0491563_110_502 | 128 |
| 1049 | 3300053178 | Ga0500637_0417640 | Ga0500637_0417640_22_411 | 128 |
| 1050 | 3300053732 | Ga0500656_001749 | Ga0500656_001749_1088_1480 | 128 |
| 1051 | 3300053739 | Ga0500587_005962 | Ga0500587_005962_917_1309 | 128 |
| 1052 | 3300054114 | Ga0501084_0020844 | Ga0501084_0020844_1322_1714 | 128 |
| 1053 | 3300054114 | Ga0501084_0085233 | Ga0501084_0085233_642_1034 | 128 |
| 1054 | 3300059424 | Ga0590075_029891 | Ga0590075_029891_544_936 | 128 |
| 1055 | 3300059492 | Ga0587073_0157947 | Ga0587073_0157947_85_477 | 128 |
| 1056 | 3300059508 | Ga0587088_135006 | Ga0587088_135006_90_482 | 128 |
| 1057 | 3300059509 | Ga0587089_114224 | Ga0587089_114224_92_484 | 128 |
| 1058 | 3300059511 | Ga0587091_236711 | Ga0587091_236711_90_482 | 128 |
| 1059 | 3300059512 | Ga0587092_086480 | Ga0587092_086480_65_457 | 128 |
| 1060 | 3300059604 | Ga0587098_064776 | Ga0587098_064776_94_486 | 128 |
| 1061 | 3300059605 | Ga0587106_008852 | Ga0587106_008852_761_1153 | 128 |
| 1062 | 3300059605 | Ga0587106_071356 | Ga0587106_071356_145_537 | 128 |
| 1063 | 3300059607 | Ga0587125_065590 | Ga0587125_065590_73_465 | 128 |
| 1064 | 3300059626 | Ga0587115_117074 | Ga0587115_117074_41_433 | 128 |
| 1065 | 3300059628 | Ga0587122_022878 | Ga0587122_022878_47_439 | 128 |
| 1066 | 3300059639 | Ga0587062_073449 | Ga0587062_073449_145_576 | 128 |
| 1067 | 3300059640 | Ga0587067_055686 | Ga0587067_055686_59_451 | 128 |
| 1068 | 3300059641 | Ga0587068_142120 | Ga0587068_142120_93_485 | 128 |
| 1069 | 3300059643 | Ga0587072_184510 | Ga0587072_184510_77_469 | 128 |
| 1070 | 3300059644 | Ga0587075_152803 | Ga0587075_152803_39_431 | 128 |
| 1071 | 3300059652 | Ga0587107_102603 | Ga0587107_102603_93_485 | 128 |
| 1072 | 3300059653 | Ga0587108_031698 | Ga0587108_031698_101_493 | 128 |
| 1073 | 3300060346 | Ga0587111_0124372 | Ga0587111_0124372_192_584 | 128 |
| 1074 | 3300060346 | Ga0587111_0182248 | Ga0587111_0182248_96_488 | 128 |
| 1075 | 3300060353 | Ga0501082_0014461 | Ga0501082_0014461_1383_1775 | 128 |
| 1076 | 3300060353 | Ga0501082_0153158 | Ga0501082_0153158_632_1024 | 128 |
| 1077 | 3300061719 | Ga0466962_0000572 | Ga0466962_0000572_13348_13752 | 128 |
| 1078 | 3300061719 | Ga0466962_0000635 | Ga0466962_0000635_4758_5150 | 128 |
| 1079 | 3300061719 | Ga0466962_0052208 | Ga0466962_0052208_1283_1675 | 128 |
| 1080 | 3300061719 | Ga0466962_0055762 | Ga0466962_0055762_604_996 | 128 |
| 1081 | 3300061719 | Ga0466962_0132716 | Ga0466962_0132716_16_420 | 128 |
| 1082 | 3300061719 | Ga0466962_0220632 | Ga0466962_0220632_519_908 | 128 |
| 1083 | 3300061719 | Ga0466962_0236502 | Ga0466962_0236502_360_749 | 128 |
| 1084 | 3300061719 | Ga0466962_0266643 | Ga0466962_0266643_407_811 | 128 |
| 1085 | 3300061734 | Ga0530510_0030267 | Ga0530510_0030267_3284_3682 | 128 |
| 1086 | 3300061734 | Ga0530510_0187467 | Ga0530510_0187467_1081_1473 | 128 |
| 1087 | 3300061734 | Ga0530510_0382341 | Ga0530510_0382341_454_846 | 128 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6scs-assembly1.cif.gz_B | cell division protein sepf in complex with c-terminal domain of ftsz | 0.5945 | 36 | 102 |
| 2e3u-assembly1.cif.gz_A | crystal structure analysis of dim2p from pyrococcus horikoshii ot3 | 0.5871 | 50 | 120 |
| 3p04-assembly1.cif.gz_B | crystal structure of the bcr protein from corynebacterium glutamicum. northeast structural genomics consortium target cgr8 | 0.5691 | 36 | 102 |
| 3dnp-assembly1.cif.gz_A-2 | crystal structure of stress response protein yhax from bacillus subtilis | 0.5557 | 76 | 103 |
| 3u1k-assembly1.cif.gz_A | crystal structure of human pnpase | 0.549 | 52 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9V9X7_601_667_3.30.1370.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 | 0.5893 | 52 | 110 | 3.30.1370.10 |
| af_A0A1D6KQA2_168_268_3.30.110.60 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;YhbY-like | 0.5868 | 36 | 103 | 3.30.110.60 |
| af_Q965N3_575_638_3.30.1370.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 | 0.584 | 52 | 108 | 3.30.1370.10 |
| af_I1N5X8_128_222_3.30.110.60 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;YhbY-like | 0.5806 | 39 | 103 | 3.30.110.60 |
| 3niwA02 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2; | 0.5737 | 51 | 102 | 3.30.1240.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5P9Z4B8-F1-model_v4 | merged | 0.9926 | 1 | 128 |
|
| AF-A0A1H3UHL4-F1-model_v4 | Uncharacterized protein | 0.9884 | 1 | 128 |
|
| AF-A0A429AYY8-F1-model_v4 | Uncharacterized protein | 0.9865 | 1 | 128 |
|
| AF-A0A6G2RZC3-F1-model_v4 | Uncharacterized protein | 0.9848 | 1 | 128 |
|
| AF-A0A1V9KFX3-F1-model_v4 | Uncharacterized protein | 0.9843 | 1 | 128 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar