F489797

General Info

Members Datasets Scaffolds Average Seq Length
1087 438 2174 127

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100351705|Ga0070679_1003517052
Length 140
Sequence MRVVMHALTGFVRGSGILGFMTDSVARLYDAVIAARGADPAKSRTARLLRAGKLAEEAVEVVNDAMHGQPEAVVRESADLLYNLVVLWVHAGVHPEDVWSEMRRRELMFGIAEKVPKDLVQGGSRRKVVALETRRIRKRR

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
21 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
128 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
216 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
217 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
218 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
219 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
220 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
221 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
222 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
228 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
229 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
232 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
235 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
236 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
237 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
238 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
239 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
240 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
241 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
242 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
243 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
244 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
245 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
246 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
247 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
248 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
249 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
250 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
255 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
256 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
257 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
258 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
259 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
260 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
261 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
262 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
263 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
266 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
267 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
268 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
270 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
272 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
273 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
280 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
281 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
282 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
283 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
284 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
285 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
286 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
287 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
288 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
289 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
290 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
291 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
292 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
293 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
294 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
295 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
296 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
300 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
301 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
302 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
303 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
304 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
305 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
308 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
309 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
310 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
311 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
312 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
313 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
314 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
315 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
316 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
317 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
318 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
319 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
320 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
321 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
324 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
325 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
326 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
327 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
328 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
329 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
330 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
335 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
336 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
337 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
338 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
339 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
340 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
341 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
342 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
343 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
344 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
345 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
346 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
347 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
348 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
356 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
357 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
358 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
359 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
360 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
361 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
362 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
363 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
364 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
365 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
366 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
367 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
368 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
369 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
370 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
371 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
372 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
373 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
374 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
375 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
376 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
377 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
378 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
379 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
380 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
381 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
382 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
383 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
384 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
385 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
386 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
387 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
388 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
401 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
402 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
403 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
404 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
405 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
406 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
407 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
408 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
409 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
410 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
411 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
412 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
414 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
415 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
416 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
417 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
418 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
419 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
420 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
421 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
422 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
423 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
424 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
425 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
426 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
427 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
428 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
429 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
430 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
431 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
432 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
433 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
434 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
435 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
436 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
437 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
438 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 0
Rhizoplane 6.62
Rhizosphere 90.62
Stem 0
Stem Tuber 0
Unclassified 5.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100351705 3300005530 Bacteria 1421
2 JGI24741J21665_1011317 3300001915 Bacteria 1563
3 JGI24752J21851_1004034 3300001976 Bacteria 1928
4 JGI24746J21847_1003951 3300001977 Bacteria 2343
5 JGI24739J22299_10004113 3300001989 Bacteria 5564
6 JGI24739J22299_10068188 3300001989 Bacteria 1111
7 JGI24737J22298_10001610 3300001990 Bacteria 8031
8 JGI24743J22301_10004729 3300001991 Bacteria 2236
9 JGI24735J21928_10044950 3300002067 Bacteria 1283
10 JGI24750J21931_1000047 3300002070 Bacteria 16414
11 JGI24745J21846_1001071 3300002073 Bacteria 2585
12 JGI24748J21848_1005915 3300002074 Bacteria 1425
13 JGI24738J21930_10011556 3300002075 Bacteria 1939
14 JGI24749J21850_1006539 3300002076 Bacteria 1624
15 JGI24749J21850_1008897 3300002076 Bacteria 1401
16 JGI24744J21845_10002333 3300002077 Bacteria 3872
17 JGI24035J26624_1000692 3300002126 Bacteria 3128
18 JGI24033J26618_1000780 3300002155 Bacteria 3033
19 JGI24034J26672_10001282 3300002239 Bacteria 3307
20 JGI24742J22300_10000108 3300002244 Bacteria 11825
21 JGI24751J29686_10015732 3300002459 Bacteria 1560
22 JGI26145J50221_1002138 3300003371 Bacteria 1553
23 JGI25405J52794_10005075 3300003911 Bacteria 2363
24 Ga0065715_10000365 3300005293 Bacteria 15182
25 Ga0065715_10000449 3300005293 Bacteria 15495
26 Ga0070658_10077465 3300005327 Bacteria 2727
27 Ga0070658_10134776 3300005327 Bacteria 2059
28 Ga0070658_10293425 3300005327 Bacteria 1386
29 Ga0070676_10005804 3300005328 Bacteria 6581
30 Ga0070683_100027713 3300005329 Bacteria 5112
31 Ga0070683_100275485 3300005329 Bacteria 1601
32 Ga0070683_100408101 3300005329 Bacteria 1296
33 Ga0070690_100003335 3300005330 Bacteria 8755
34 Ga0070690_100013679 3300005330 Bacteria 4802
35 Ga0070690_100093275 3300005330 Bacteria 1986
36 Ga0070670_100019704 3300005331 Bacteria 5792
37 Ga0070670_100020956 3300005331 Bacteria 5621
38 Ga0070677_10000823 3300005333 Bacteria 10187
39 Ga0068869_100004243 3300005334 Bacteria 8893
40 Ga0068869_100189633 3300005334 Bacteria 1616
41 Ga0070666_10004766 3300005335 Bacteria 8287
42 Ga0070680_100007952 3300005336 Bacteria 8093
43 Ga0070680_100011474 3300005336 Bacteria 6855
44 Ga0070680_100111122 3300005336 Bacteria 2281
45 Ga0070680_100221240 3300005336 Bacteria 1598
46 Ga0070680_100417469 3300005336 Bacteria 1144
47 Ga0070680_100515319 3300005336 Bacteria 1024
48 Ga0070680_101149991 3300005336 Unclassified 671
49 Ga0070682_100031542 3300005337 Bacteria 3205
50 Ga0068868_100007863 3300005338 Bacteria 7612
51 Ga0068868_100117520 3300005338 Bacteria 2166
52 Ga0068868_101049558 3300005338 Bacteria 748
53 Ga0068868_101727891 3300005338 Unclassified 590
54 Ga0070660_100000419 3300005339 Bacteria 28331
55 Ga0070689_100000784 3300005340 Bacteria 19512
56 Ga0070689_100345386 3300005340 Bacteria 1247
57 Ga0070691_10006949 3300005341 Bacteria 5182
58 Ga0070691_10044077 3300005341 Bacteria 2115
59 Ga0070691_10053380 3300005341 Bacteria 1934
60 Ga0070691_10192924 3300005341 Bacteria 1066
61 Ga0070691_10219092 3300005341 Bacteria 1008
62 Ga0070687_100004162 3300005343 Bacteria 5729
63 Ga0070687_100084021 3300005343 Bacteria 1744
64 Ga0070687_100164990 3300005343 Bacteria 1313
65 Ga0070661_100005802 3300005344 Bacteria 8492
66 Ga0070661_100548180 3300005344 Unclassified 930
67 Ga0070692_10000927 3300005345 Bacteria 9932
68 Ga0070668_100016262 3300005347 Bacteria 5565
69 Ga0070668_100772738 3300005347 Unclassified 852
70 Ga0070669_100010373 3300005353 Bacteria 6616
71 Ga0070675_100019626 3300005354 Bacteria 5387
72 Ga0070675_100050814 3300005354 Bacteria 3405
73 Ga0070675_100585896 3300005354 Unclassified 1011
74 Ga0070671_100340998 3300005355 Bacteria 1278
75 Ga0070671_100482294 3300005355 Bacteria 1065
76 Ga0070674_100004604 3300005356 Bacteria 7881
77 Ga0070674_100150354 3300005356 Unclassified 1757
78 Ga0070674_100497457 3300005356 Bacteria 1015
79 Ga0070673_100010441 3300005364 Bacteria 6287
80 Ga0070673_100013492 3300005364 Bacteria 5656
81 Ga0070673_100077593 3300005364 Unclassified 2685
82 Ga0070688_100000956 3300005365 Bacteria 14425
83 Ga0070688_100010878 3300005365 Bacteria 5035
84 Ga0070659_100023866 3300005366 Bacteria 4684
85 Ga0070659_100063256 3300005366 Bacteria 2927
86 Ga0070659_101006776 3300005366 Bacteria 732
87 Ga0070667_100003581 3300005367 Bacteria 13221
88 Ga0070667_100141277 3300005367 Bacteria 2109
89 Ga0070667_100291441 3300005367 Bacteria 1468
90 Ga0070703_10002961 3300005406 Bacteria 4852
91 Ga0070709_10000959 3300005434 Bacteria 16036
92 Ga0070709_10070122 3300005434 Bacteria 2259
93 Ga0070709_10181050 3300005434 Bacteria 1480
94 Ga0070709_10259764 3300005434 Bacteria 1254
95 Ga0070714_100082526 3300005435 Bacteria 2801
96 Ga0070714_100190392 3300005435 Bacteria 1872
97 Ga0070714_100543241 3300005435 Bacteria 1112
98 Ga0070713_100010662 3300005436 Bacteria 6652
99 Ga0070713_100013123 3300005436 Bacteria 6106
100 Ga0070713_100022631 3300005436 Bacteria 4859
101 Ga0070713_100713209 3300005436 Bacteria 958
102 Ga0070710_10002603 3300005437 Bacteria 8574
103 Ga0070710_10008826 3300005437 Bacteria 4918
104 Ga0070710_10359419 3300005437 Bacteria 966
105 Ga0070710_10600219 3300005437 Bacteria 766
106 Ga0070701_10001072 3300005438 Bacteria 10001
107 Ga0070711_100009109 3300005439 Bacteria 6101
108 Ga0070711_100360114 3300005439 Bacteria 1171
109 Ga0070711_100587830 3300005439 Bacteria 927
110 Ga0070705_100004361 3300005440 Bacteria 6887
111 Ga0070705_100115495 3300005440 Unclassified 1723
112 Ga0070700_100005661 3300005441 Bacteria 6629
113 Ga0070694_100003415 3300005444 Bacteria 9518
114 Ga0070694_101115998 3300005444 Bacteria 658
115 Ga0070708_100395300 3300005445 Bacteria 1303
116 Ga0070663_100015502 3300005455 Bacteria 4923
117 Ga0070663_100022520 3300005455 Bacteria 4214
118 Ga0070663_100028982 3300005455 Bacteria 3776
119 Ga0070663_100030908 3300005455 Bacteria 3674
120 Ga0070678_100010190 3300005456 Bacteria 5729
121 Ga0070678_100011179 3300005456 Bacteria 5526
122 Ga0070678_100101916 3300005456 Bacteria 2226
123 Ga0070662_100023224 3300005457 Bacteria 4258
124 Ga0070662_100107164 3300005457 Bacteria 2124
125 Ga0070662_100900873 3300005457 Bacteria 755
126 Ga0070681_10001622 3300005458 Bacteria 20041
127 Ga0070681_10016579 3300005458 Bacteria 7356
128 Ga0070681_10062985 3300005458 Bacteria 3681
129 Ga0070681_10499329 3300005458 Bacteria 1130
130 Ga0070681_10650651 3300005458 Bacteria 969
131 Ga0070681_11516973 3300005458 Unclassified 595
132 Ga0070681_11651251 3300005458 Unclassified 567
133 Ga0068867_100018127 3300005459 Bacteria 5002
134 Ga0068867_100569322 3300005459 Bacteria 984
135 Ga0068867_100671701 3300005459 Bacteria 911
136 Ga0070685_10006135 3300005466 Bacteria 6119
137 Ga0070685_10008365 3300005466 Bacteria 5312
138 Ga0070685_10140704 3300005466 Bacteria 1519
139 Ga0070707_100229177 3300005468 Unclassified 1809
140 Ga0070707_100902897 3300005468 Unclassified 848
141 Ga0070699_100182991 3300005518 Bacteria 1860
142 Ga0070679_100018168 3300005530 Bacteria 6818
143 Ga0070679_100074050 3300005530 Bacteria 3396
144 Ga0070679_100103127 3300005530 Bacteria 2839
145 Ga0070679_100497050 3300005530 Bacteria 1164
146 Ga0070679_100539612 3300005530 Bacteria 1110
147 Ga0070679_100763948 3300005530 Bacteria 909
148 Ga0070679_101311459 3300005530 Bacteria 670
149 Ga0070679_101821276 3300005530 Unclassified 557
150 Ga0070684_100007664 3300005535 Bacteria 8417
151 Ga0070684_100136515 3300005535 Bacteria 2216
152 Ga0070697_101028174 3300005536 Bacteria 733
153 Ga0068853_100009267 3300005539 Bacteria 7938
154 Ga0068853_100714236 3300005539 Bacteria 957
155 Ga0070686_100003330 3300005544 Bacteria 8806
156 Ga0070686_100009318 3300005544 Bacteria 5514
157 Ga0070686_100061657 3300005544 Bacteria 2424
158 Ga0070695_100007284 3300005545 Bacteria 6559
159 Ga0070695_100062036 3300005545 Bacteria 2427
160 Ga0070696_100009140 3300005546 Bacteria 6635
161 Ga0070696_100028902 3300005546 Bacteria 3785
162 Ga0070693_100009938 3300005547 Bacteria 4751
163 Ga0070665_100122566 3300005548 Bacteria 2601
164 Ga0070704_100000799 3300005549 Bacteria 15589
165 Ga0070704_100029063 3300005549 Bacteria 3685
166 Ga0068855_100231552 3300005563 Bacteria 2068
167 Ga0068855_100713392 3300005563 Bacteria 1072
168 Ga0068855_100762992 3300005563 Bacteria 1030
169 Ga0068855_101035280 3300005563 Bacteria 861
170 Ga0070664_100061274 3300005564 Bacteria 3206
171 Ga0070664_100150393 3300005564 Bacteria 2055
172 Ga0070664_100190826 3300005564 Bacteria 1825
173 Ga0070664_100502627 3300005564 Bacteria 1117
174 Ga0070664_100562882 3300005564 Bacteria 1055
175 Ga0068854_100000702 3300005578 Bacteria 19795
176 Ga0068854_100134727 3300005578 Bacteria 1890
177 Ga0068856_100053436 3300005614 Bacteria 3982
178 Ga0068856_101177549 3300005614 Bacteria 783
179 Ga0068856_101189361 3300005614 Bacteria 779
180 Ga0070702_100004763 3300005615 Bacteria 6233
181 Ga0070702_100048350 3300005615 Bacteria 2421
182 Ga0068852_100002168 3300005616 Bacteria 13456
183 Ga0068852_100142940 3300005616 Bacteria 2216
184 Ga0068859_100066290 3300005617 Bacteria 3646
185 Ga0068859_100394915 3300005617 Bacteria 1479
186 Ga0068866_10133151 3300005718 Bacteria 1417
187 Ga0068861_100143197 3300005719 Bacteria 1953
188 Ga0068863_100710284 3300005841 Bacteria 999
189 Ga0068863_101494468 3300005841 Bacteria 684
190 Ga0068863_101732598 3300005841 Unclassified 634
191 Ga0068858_100000657 3300005842 Bacteria 36147
192 Ga0068858_100177384 3300005842 Bacteria 2011
193 Ga0068858_101258818 3300005842 Bacteria 728
194 Ga0068860_100039959 3300005843 Bacteria 4485
195 Ga0068860_100125999 3300005843 Bacteria 2455
196 Ga0068860_100331967 3300005843 Bacteria 1494
197 Ga0068862_100096723 3300005844 Bacteria 2577
198 Ga0068862_100366129 3300005844 Bacteria 1341
199 Ga0070717_10000720 3300006028 Bacteria 21477
200 Ga0070717_10264413 3300006028 Bacteria 1523
201 Ga0075365_10171872 3300006038 Bacteria 1513
202 Ga0075368_10203879 3300006042 Unclassified 837
203 Ga0075363_100131669 3300006048 Bacteria 1403
204 Ga0075363_100752716 3300006048 Bacteria 590
205 Ga0075364_10630249 3300006051 Bacteria 732
206 Ga0075364_10822761 3300006051 Bacteria 633
207 Ga0070715_10000434 3300006163 Bacteria 10705
208 Ga0070716_100022246 3300006173 Bacteria 3348
209 Ga0070712_100062335 3300006175 Bacteria 2636
210 Ga0070712_100274528 3300006175 Unclassified 1356
211 Ga0075362_10202996 3300006177 Bacteria 965
212 Ga0075427_10000902 3300006194 Bacteria 3653
213 Ga0097621_100000078 3300006237 Bacteria 50983
214 Ga0097621_100013381 3300006237 Bacteria 6116
215 Ga0097621_100025587 3300006237 Bacteria 4619
216 Ga0075370_10100460 3300006353 Bacteria 1674
217 Ga0068871_100049791 3300006358 Bacteria 3387
218 Ga0068871_100108912 3300006358 Bacteria 2329
219 Ga0075428_100001638 3300006844 Bacteria 23879
220 Ga0075431_100001119 3300006847 Bacteria 24014
221 Ga0075431_100504567 3300006847 Bacteria 1200
222 Ga0075434_100003370 3300006871 Bacteria 14305
223 Ga0075434_100043579 3300006871 Bacteria 4450
224 Ga0075434_100265934 3300006871 Bacteria 1734
225 Ga0075434_100353360 3300006871 Unclassified 1491
226 Ga0075434_100596772 3300006871 Bacteria 1123
227 Ga0075429_100002649 3300006880 Bacteria 15053
228 Ga0068865_100000155 3300006881 Bacteria 37357
229 Ga0068865_100060317 3300006881 Bacteria 2656
230 Ga0075436_100012844 3300006914 Bacteria 5741
231 Ga0075436_100040929 3300006914 Bacteria 3197
232 Ga0075436_101117334 3300006914 Bacteria 593
233 Ga0097620_100066295 3300006931 Bacteria 3646
234 Ga0097620_100394916 3300006931 Bacteria 1479
235 Ga0075435_100000970 3300007076 Bacteria 18126
236 Ga0075435_100008956 3300007076 Bacteria 7216
237 Ga0075435_100015334 3300007076 Bacteria 5758
238 Ga0105251_10058512 3300009011 Bacteria 1820
239 Ga0105251_10161613 3300009011 Bacteria 1010
240 Ga0105250_10036768 3300009092 Bacteria 1965
241 Ga0105240_10084806 3300009093 Bacteria 3883
242 Ga0105240_10154758 3300009093 Bacteria 2728
243 Ga0105240_10349069 3300009093 Bacteria 1679
244 Ga0105240_10996763 3300009093 Bacteria 896
245 Ga0105240_11521840 3300009093 Bacteria 701
246 Ga0111539_10010049 3300009094 Bacteria 11929
247 Ga0111539_10161211 3300009094 Bacteria 2623
248 Ga0111539_10383332 3300009094 Bacteria 1637
249 Ga0111539_11035230 3300009094 Unclassified 954
250 Ga0111539_11723268 3300009094 Bacteria 727
251 Ga0105245_10005766 3300009098 Bacteria 10865
252 Ga0105245_10030396 3300009098 Bacteria 4776
253 Ga0105245_10045065 3300009098 Bacteria 3937
254 Ga0105245_11957796 3300009098 Bacteria 639
255 Ga0105247_10002157 3300009101 Bacteria 13579
256 Ga0105247_10018587 3300009101 Bacteria 4171
257 Ga0105247_10019956 3300009101 Bacteria 4026
258 Ga0105247_10119319 3300009101 Bacteria 1707
259 Ga0114129_10006926 3300009147 Bacteria 16126
260 Ga0114129_10022324 3300009147 Bacteria 8983
261 Ga0105243_10007171 3300009148 Bacteria 8571
262 Ga0105243_10043547 3300009148 Bacteria 3518
263 Ga0105243_10050124 3300009148 Bacteria 3297
264 Ga0105241_10008937 3300009174 Bacteria 7368
265 Ga0105241_10130906 3300009174 Unclassified 2031
266 Ga0105241_10652218 3300009174 Bacteria 956
267 Ga0105241_11260244 3300009174 Unclassified 702
268 Ga0105242_10004516 3300009176 Bacteria 10807
269 Ga0105242_10008202 3300009176 Bacteria 8025
270 Ga0105242_10369258 3300009176 Bacteria 1330
271 Ga0105248_10004213 3300009177 Bacteria 15908
272 Ga0105248_10014034 3300009177 Bacteria 8815
273 Ga0105248_10050815 3300009177 Bacteria 4651
274 Ga0105237_10012499 3300009545 Bacteria 8944
275 Ga0105237_10141573 3300009545 Bacteria 2399
276 Ga0105237_10152802 3300009545 Bacteria 2305
277 Ga0105238_10277489 3300009551 Bacteria 1657
278 Ga0105238_10703760 3300009551 Bacteria 1022
279 Ga0105238_10917172 3300009551 Bacteria 895
280 Ga0105238_11002414 3300009551 Bacteria 856
281 Ga0105238_13029066 3300009551 Bacteria 504
282 Ga0105249_10031751 3300009553 Bacteria 4778
283 Ga0105249_10512897 3300009553 Bacteria 1245
284 Ga0105239_10062241 3300010375 Bacteria 4096
285 Ga0105239_10071125 3300010375 Bacteria 3822
286 Ga0105239_10324428 3300010375 Bacteria 1737
287 Ga0105246_10016930 3300011119 Bacteria 4627
288 Ga0105246_10053493 3300011119 Bacteria 2778
289 Ga0105246_10068024 3300011119 Bacteria 2497
290 Ga0105246_10115022 3300011119 Bacteria 1983
291 Ga0157337_1001327 3300012483 Bacteria 1260
292 Ga0157322_1019911 3300012490 Unclassified 638
293 Ga0157373_10040872 3300013100 Bacteria 3318
294 Ga0157373_10209706 3300013100 Bacteria 1374
295 Ga0157373_10258185 3300013100 Bacteria 1233
296 Ga0157373_10682808 3300013100 Bacteria 751
297 Ga0157371_10004410 3300013102 Bacteria 12300
298 Ga0157371_10056650 3300013102 Bacteria 2780
299 Ga0157371_11184194 3300013102 Bacteria 588
300 Ga0157370_10031648 3300013104 Bacteria 5173
301 Ga0157370_10480050 3300013104 Bacteria 1142
302 Ga0157370_10755511 3300013104 Bacteria 886
303 Ga0157369_10086258 3300013105 Bacteria 3353
304 Ga0157369_10508418 3300013105 Bacteria 1246
305 Ga0157369_10825812 3300013105 Bacteria 952
306 Ga0157369_11020478 3300013105 Bacteria 847
307 Ga0157374_10035360 3300013296 Bacteria 4570
308 Ga0157374_10182533 3300013296 Bacteria 2050
309 Ga0157374_10201751 3300013296 Bacteria 1948
310 Ga0157374_10316041 3300013296 Bacteria 1547
311 Ga0157378_10004404 3300013297 Bacteria 12398
312 Ga0157378_10053633 3300013297 Bacteria 3590
313 Ga0157378_10155903 3300013297 Bacteria 2132
314 Ga0157378_11187199 3300013297 Bacteria 802
315 Ga0163162_10053663 3300013306 Bacteria 4052
316 Ga0163162_10220284 3300013306 Bacteria 2027
317 Ga0163162_11519017 3300013306 Bacteria 763
318 Ga0157372_10012919 3300013307 Bacteria 8900
319 Ga0157372_10068346 3300013307 Bacteria 3994
320 Ga0157372_10319154 3300013307 Bacteria 1809
321 Ga0157372_10758855 3300013307 Bacteria 1128
322 Ga0157372_11351125 3300013307 Bacteria 822
323 Ga0157372_11682640 3300013307 Bacteria 730
324 Ga0157375_10023952 3300013308 Bacteria 5641
325 Ga0157375_12381496 3300013308 Bacteria 632
326 Ga0163163_10002553 3300014325 Bacteria 15424
327 Ga0163163_10063209 3300014325 Bacteria 3670
328 Ga0163163_10135570 3300014325 Bacteria 2503
329 Ga0163163_10185607 3300014325 Bacteria 2127
330 Ga0157380_10153380 3300014326 Bacteria 1994
331 Ga0157380_10323259 3300014326 Bacteria 1431
332 Ga0182008_10339428 3300014497 Unclassified 794
333 Ga0157377_10011447 3300014745 Bacteria 4428
334 Ga0157377_10071860 3300014745 Unclassified 2002
335 Ga0157379_10000539 3300014968 Bacteria 30568
336 Ga0157379_10011925 3300014968 Bacteria 7594
337 Ga0157379_10041604 3300014968 Bacteria 4103
338 Ga0157379_10254918 3300014968 Bacteria 1593
339 Ga0157376_10035583 3300014969 Bacteria 4029
340 Ga0157376_10429982 3300014969 Bacteria 1283
341 Ga0157376_10896274 3300014969 Bacteria 905
342 Ga0163161_10156427 3300017792 Bacteria 1736
343 Ga0163161_10294116 3300017792 Bacteria 1277
344 Ga0206356_11650372 3300020070 Bacteria 3311
345 Ga0206354_11487445 3300020081 Unclassified 912
346 Ga0213876_10069391 3300021384 Bacteria 1862
347 Ga0213876_10121321 3300021384 Bacteria 1388
348 Ga0207666_1000522 3300025271 Bacteria 4700
349 Ga0207697_10004732 3300025315 Bacteria 6449
350 Ga0207656_10438672 3300025321 Unclassified 659
351 Ga0207653_10002374 3300025885 Bacteria 6005
352 Ga0207692_10031568 3300025898 Bacteria 2538
353 Ga0207692_10068011 3300025898 Bacteria 1866
354 Ga0207692_10216566 3300025898 Bacteria 1133
355 Ga0207692_11004208 3300025898 Bacteria 551
356 Ga0207642_10083253 3300025899 Bacteria 1559
357 Ga0207710_10524713 3300025900 Bacteria 616
358 Ga0207688_10011771 3300025901 Bacteria 4759
359 Ga0207680_10010419 3300025903 Bacteria 4649
360 Ga0207680_10268720 3300025903 Bacteria 1182
361 Ga0207647_10007623 3300025904 Bacteria 7799
362 Ga0207685_10006002 3300025905 Bacteria 3266
363 Ga0207699_10005253 3300025906 Bacteria 6198
364 Ga0207699_10110016 3300025906 Bacteria 1764
365 Ga0207705_10375929 3300025909 Bacteria 1097
366 Ga0207705_10415933 3300025909 Bacteria 1040
367 Ga0207705_11280599 3300025909 Unclassified 560
368 Ga0207707_10028853 3300025912 Bacteria 4849
369 Ga0207707_10066726 3300025912 Bacteria 3133
370 Ga0207707_10253050 3300025912 Bacteria 1530
371 Ga0207707_10393736 3300025912 Bacteria 1190
372 Ga0207707_11652340 3300025912 Unclassified 503
373 Ga0207695_10034276 3300025913 Bacteria 5524
374 Ga0207695_10849137 3300025913 Bacteria 793
375 Ga0207671_10513123 3300025914 Bacteria 956
376 Ga0207693_10031101 3300025915 Bacteria 4217
377 Ga0207693_10101956 3300025915 Bacteria 2251
378 Ga0207693_10367682 3300025915 Unclassified 1125
379 Ga0207693_11184597 3300025915 Unclassified 577
380 Ga0207663_10083400 3300025916 Bacteria 2099
381 Ga0207663_10105872 3300025916 Bacteria 1899
382 Ga0207663_10172873 3300025916 Bacteria 1536
383 Ga0207663_11069084 3300025916 Unclassified 648
384 Ga0207660_10094332 3300025917 Bacteria 2224
385 Ga0207660_10241643 3300025917 Bacteria 1423
386 Ga0207660_10479820 3300025917 Bacteria 1007
387 Ga0207660_10481916 3300025917 Bacteria 1005
388 Ga0207660_11315965 3300025917 Bacteria 587
389 Ga0207657_10722561 3300025919 Unclassified 773
390 Ga0207657_10946503 3300025919 Bacteria 662
391 Ga0207649_10183004 3300025920 Bacteria 1468
392 Ga0207649_10443418 3300025920 Unclassified 978
393 Ga0207652_10025519 3300025921 Bacteria 4915
394 Ga0207652_10054252 3300025921 Bacteria 3445
395 Ga0207652_10123726 3300025921 Bacteria 2303
396 Ga0207652_10139752 3300025921 Bacteria 2165
397 Ga0207646_10518065 3300025922 Bacteria 1074
398 Ga0207694_10099036 3300025924 Bacteria 2309
399 Ga0207694_10534586 3300025924 Bacteria 983
400 Ga0207694_10740513 3300025924 Bacteria 829
401 Ga0207694_11521679 3300025924 Unclassified 565
402 Ga0207650_10045297 3300025925 Bacteria 3236
403 Ga0207659_10011825 3300025926 Bacteria 5527
404 Ga0207659_10521539 3300025926 Unclassified 1007
405 Ga0207687_10033774 3300025927 Bacteria 3471
406 Ga0207687_10962425 3300025927 Bacteria 732
407 Ga0207687_11652759 3300025927 Bacteria 549
408 Ga0207700_10003137 3300025928 Bacteria 9542
409 Ga0207700_10011504 3300025928 Bacteria 5646
410 Ga0207700_10122195 3300025928 Bacteria 2113
411 Ga0207664_10233160 3300025929 Bacteria 1600
412 Ga0207644_10006166 3300025931 Bacteria 7816
413 Ga0207706_10010270 3300025933 Bacteria 8560
414 Ga0207706_10020507 3300025933 Bacteria 5941
415 Ga0207706_10037101 3300025933 Bacteria 4328
416 Ga0207686_10047722 3300025934 Bacteria 2649
417 Ga0207709_10005421 3300025935 Bacteria 7251
418 Ga0207709_10024667 3300025935 Bacteria 3436
419 Ga0207709_10086990 3300025935 Bacteria 2031
420 Ga0207670_10057666 3300025936 Bacteria 2634
421 Ga0207669_10405325 3300025937 Bacteria 1069
422 Ga0207704_10012530 3300025938 Bacteria 4211
423 Ga0207704_10361079 3300025938 Bacteria 1134
424 Ga0207665_10001296 3300025939 Bacteria 16883
425 Ga0207665_10135073 3300025939 Bacteria 1755
426 Ga0207665_10234006 3300025939 Bacteria 1351
427 Ga0207691_10022732 3300025940 Bacteria 5911
428 Ga0207711_10022254 3300025941 Bacteria 5300
429 Ga0207711_10035620 3300025941 Bacteria 4220
430 Ga0207689_10000503 3300025942 Bacteria 36892
431 Ga0207689_10597414 3300025942 Bacteria 928
432 Ga0207661_10206126 3300025944 Bacteria 1731
433 Ga0207661_10436359 3300025944 Bacteria 1191
434 Ga0207661_11802428 3300025944 Bacteria 557
435 Ga0207679_10110505 3300025945 Bacteria 2169
436 Ga0207679_10216184 3300025945 Bacteria 1610
437 Ga0207667_10005613 3300025949 Bacteria 15307
438 Ga0207667_10054142 3300025949 Bacteria 4220
439 Ga0207667_10500724 3300025949 Bacteria 1232
440 Ga0207667_11061334 3300025949 Bacteria 795
441 Ga0207667_12193796 3300025949 Bacteria 509
442 Ga0207712_10005771 3300025961 Bacteria 7799
443 Ga0207712_10020865 3300025961 Bacteria 4297
444 Ga0207640_10105047 3300025981 Bacteria 1989
445 Ga0207640_11078160 3300025981 Unclassified 710
446 Ga0207658_10309801 3300025986 Bacteria 1363
447 Ga0207658_10544610 3300025986 Bacteria 1038
448 Ga0207677_10209966 3300026023 Bacteria 1554
449 Ga0207677_10711149 3300026023 Bacteria 892
450 Ga0207703_10025900 3300026035 Bacteria 4615
451 Ga0207703_11092390 3300026035 Bacteria 766
452 Ga0207703_11230866 3300026035 Bacteria 720
453 Ga0207639_10141075 3300026041 Bacteria 2008
454 Ga0207639_10380899 3300026041 Bacteria 1267
455 Ga0207678_10045454 3300026067 Bacteria 3797
456 Ga0207678_10050320 3300026067 Bacteria 3600
457 Ga0207708_10075664 3300026075 Unclassified 2582
458 Ga0207702_10136832 3300026078 Bacteria 2211
459 Ga0207702_10147378 3300026078 Bacteria 2137
460 Ga0207702_11000602 3300026078 Bacteria 829
461 Ga0207702_11309932 3300026078 Bacteria 718
462 Ga0207648_10143054 3300026089 Bacteria 2109
463 Ga0207676_12056059 3300026095 Bacteria 570
464 Ga0207683_10000069 3300026121 Bacteria 78741
465 Ga0207683_10010482 3300026121 Bacteria 7907
466 Ga0207683_12058167 3300026121 Unclassified 519
467 Ga0207698_10104588 3300026142 Bacteria 2356
468 Ga0207698_11877715 3300026142 Bacteria 614
469 Ga0209968_1017344 3300027526 Bacteria 1148
470 Ga0209999_1018733 3300027543 Bacteria 1268
471 Ga0209971_1009614 3300027682 Bacteria 2291
472 Ga0209966_1000576 3300027695 Bacteria 8921
473 Ga0209998_10002030 3300027717 Bacteria 4745
474 Ga0209998_10024511 3300027717 Bacteria 1309
475 Ga0209813_10148679 3300027866 Unclassified 837
476 Ga0209974_10030337 3300027876 Bacteria 1792
477 Ga0207428_10000908 3300027907 Bacteria 33083
478 Ga0207428_10187035 3300027907 Bacteria 1562
479 Ga0268266_10023731 3300028379 Bacteria 5220
480 Ga0268266_10300327 3300028379 Bacteria 1498
481 Ga0268265_10120394 3300028380 Bacteria 2161
482 Ga0268265_11636935 3300028380 Bacteria 649
483 Ga0268264_10023011 3300028381 Bacteria 5084
484 Ga0268264_10282408 3300028381 Bacteria 1556
485 Ga0268264_10484029 3300028381 Bacteria 1204
486 Ga0265337_1002835 3300028556 Bacteria 7749
487 Ga0265326_10095687 3300028558 Bacteria 842
488 Ga0265334_10098678 3300028573 Bacteria 1059
489 Ga0265336_10021931 3300028666 Bacteria 2037
490 Ga0265338_10050343 3300028800 Bacteria 3766
491 Ga0265338_10091302 3300028800 Bacteria 2517
492 Ga0265338_10668293 3300028800 Bacteria 719
493 Ga0265332_10174674 3300031238 Bacteria 896
494 Ga0265332_10273513 3300031238 Bacteria 698
495 Ga0265325_10003859 3300031241 Bacteria 9628
496 Ga0265325_10005573 3300031241 Bacteria 7766
497 Ga0265325_10029752 3300031241 Bacteria 2933
498 Ga0265329_10143255 3300031242 Bacteria 772
499 Ga0265340_10014118 3300031247 Bacteria 4181
500 Ga0265340_10056702 3300031247 Bacteria 1884
501 Ga0265339_10004140 3300031249 Bacteria 9989
502 Ga0265339_10074226 3300031249 Bacteria 1807
503 Ga0265331_10082424 3300031250 Bacteria 1492
504 Ga0265316_10114851 3300031344 Bacteria 2036
505 Ga0265316_10816179 3300031344 Bacteria 654
506 Ga0307408_100486467 3300031548 Bacteria 1078
507 Ga0265313_10000176 3300031595 Bacteria 68037
508 Ga0265313_10002253 3300031595 Bacteria 16951
509 Ga0265313_10014273 3300031595 Bacteria 4705
510 Ga0265313_10163158 3300031595 Bacteria 945
511 Ga0265313_10215928 3300031595 Bacteria 792
512 Ga0316579_10167313 3300031691 Bacteria 1062
513 Ga0265314_10002100 3300031711 Bacteria 20973
514 Ga0265342_10005459 3300031712 Bacteria 9682
515 Ga0307405_10482444 3300031731 Bacteria 990
516 Ga0307405_10797507 3300031731 Bacteria 791
517 Ga0307410_10739151 3300031852 Bacteria 832
518 Ga0326468_10089776 3300031889 Bacteria 547
519 Ga0307406_10285833 3300031901 Bacteria 1260
520 Ga0307409_100496611 3300031995 Bacteria 1187
521 Ga0307409_101102091 3300031995 Bacteria 815
522 Ga0307414_10634363 3300032004 Bacteria 962
523 Ga0373930_0037693 3300034816 Bacteria 1018
524 Ga0373950_0001194 3300034818 Bacteria 3345
525 Ga0373950_0059277 3300034818 Unclassified 766
526 Ga0373958_0022229 3300034819 Bacteria 1183
527 Ga0373959_0015987 3300034820 Bacteria 1385
528 Ga0373938_0009995 3300034957 Bacteria 1731
529 Ga0373938_0050346 3300034957 Bacteria 950
530 Ga0373926_0008736 3300035083 Bacteria 3373
531 Ga0373926_0015201 3300035083 Bacteria 2623
532 Ga0373928_0003734 3300035084 Bacteria 2904
533 Ga0373929_0029716 3300035085 Bacteria 1161
534 Ga0373934_0040577 3300035086 Bacteria 1836
535 Ga0373934_0166821 3300035086 Bacteria 904
536 Ga0373934_0395284 3300035086 Unclassified 577
537 Ga0373944_0001606 3300035089 Bacteria 5716
538 Ga0373944_0131808 3300035089 Bacteria 869
539 Ga0373949_0005414 3300035090 Bacteria 2849
540 Ga0373951_0010287 3300035091 Bacteria 2100
541 Ga0373951_0066138 3300035091 Unclassified 913
542 Ga0373952_0001423 3300035092 Bacteria 4369
543 Ga0373952_0002309 3300035092 Bacteria 3435
544 Ga0373923_0002777 3300035111 Bacteria 5475
545 Ga0373923_0072262 3300035111 Bacteria 1483
546 Ga0373932_0021345 3300035112 Bacteria 1709
547 Ga0373936_0012971 3300035113 Bacteria 3177
548 Ga0373936_0101539 3300035113 Bacteria 1214
549 Ga0373939_0003721 3300035114 Bacteria 3591
550 Ga0373939_0003841 3300035114 Bacteria 3537
551 Ga0373941_0001156 3300035115 Bacteria 5502
552 Ga0373945_0004846 3300035116 Bacteria 4285
553 Ga0373945_0024843 3300035116 Bacteria 2078
554 Ga0373945_0169817 3300035116 Unclassified 893
555 Ga0373953_0002682 3300035117 Bacteria 5395
556 Ga0373953_0023138 3300035117 Bacteria 2350
557 Ga0373953_0041143 3300035117 Bacteria 1838
558 Ga0373953_0217037 3300035117 Bacteria 828
559 Ga0373954_0009519 3300035118 Bacteria 4274
560 Ga0373954_0022029 3300035118 Bacteria 2889
561 Ga0373954_0039070 3300035118 Bacteria 2209
562 Ga0373954_0051526 3300035118 Bacteria 1933
563 Ga0373954_0655818 3300035118 Bacteria 520
564 Ga0373956_0008662 3300035119 Bacteria 4118
565 Ga0373956_0047792 3300035119 Bacteria 1915
566 Ga0373956_0359740 3300035119 Bacteria 694
567 Ga0373957_0007212 3300035120 Bacteria 3548
568 Ga0373957_0022723 3300035120 Unclassified 2236
569 Ga0373957_0055364 3300035120 Bacteria 1525
570 Ga0373957_0160814 3300035120 Bacteria 925
571 Ga0373957_0246082 3300035120 Bacteria 752
572 Ga0373957_0305953 3300035120 Bacteria 675
573 Ga0373960_0013894 3300035121 Bacteria 2028
574 Ga0373943_0067957 3300035170 Bacteria 1798
575 Ga0373943_0073111 3300035170 Bacteria 1740
576 Ga0373946_0002576 3300035171 Bacteria 6412
577 Ga0373946_0010115 3300035171 Bacteria 3488
578 Ga0373946_0046646 3300035171 Bacteria 1796
579 Ga0373955_0003855 3300035172 Bacteria 6614
580 Ga0373955_0004998 3300035172 Bacteria 5924
581 Ga0373955_0014019 3300035172 Bacteria 3891
582 Ga0373955_0207324 3300035172 Bacteria 1168
583 Ga0373955_0210402 3300035172 Bacteria 1159
584 Ga0373955_0585994 3300035172 Unclassified 683
585 Ga0373942_0001355 3300035207 Bacteria 6342
586 Ga0373961_0014826 3300035241 Bacteria 1984
587 Ga0373961_0050761 3300035241 Bacteria 1229
588 Ga0373961_0216948 3300035241 Bacteria 681
589 Ga0373962_0000166 3300035242 Bacteria 14061
590 Ga0373962_0048164 3300035242 Bacteria 1221
591 Ga0373962_0130938 3300035242 Bacteria 808
592 Ga0373924_0002225 3300035410 Bacteria 6501
593 Ga0373924_0010364 3300035410 Bacteria 3432
594 Ga0373924_0109631 3300035410 Bacteria 1192
595 Ga0373924_0268905 3300035410 Bacteria 756
596 Ga0373931_0007472 3300035691 Bacteria 5148
597 Ga0373931_0644954 3300035691 Unclassified 695
598 Ga0373935_0012906 3300035692 Bacteria 5033
599 Ga0373935_0499727 3300035692 Bacteria 883
600 Ga0373927_0006775 3300035695 Bacteria 7796
601 Ga0373927_0007569 3300035695 Bacteria 7349
602 Ga0373927_0088737 3300035695 Bacteria 2007
603 Ga0373927_1148481 3300035695 Bacteria 512
604 Ga0373933_0001315 3300035724 Bacteria 14607
605 Ga0373933_0017514 3300035724 Bacteria 4019
606 Ga0373933_0034589 3300035724 Bacteria 2945
607 Ga0373933_0167902 3300035724 Bacteria 1395
608 Ga0373933_0468519 3300035724 Bacteria 825
609 Ga0373933_0483350 3300035724 Unclassified 811
610 Ga0373947_0003183 3300035725 Bacteria 9764
611 Ga0373947_0061133 3300035725 Bacteria 2288
612 Ga0373937_0001948 3300036401 Bacteria 17286
613 Ga0373937_0004646 3300036401 Bacteria 11661
614 Ga0373937_0005491 3300036401 Bacteria 10863
615 Ga0373937_0010388 3300036401 Bacteria 8130
616 Ga0373937_0019993 3300036401 Bacteria 5998
617 Ga0373937_0226570 3300036401 Bacteria 1760
618 Ga0373937_0376696 3300036401 Bacteria 1346
619 Ga0373937_0427662 3300036401 Bacteria 1257
620 Ga0373937_1107503 3300036401 Bacteria 740
621 Ga0373937_1555402 3300036401 Bacteria 609
622 Ga0316582_0137188 3300036647 Bacteria 1647
623 Ga0373925_0004198 3300037068 Bacteria 10934
624 Ga0373925_0051762 3300037068 Bacteria 3066
625 Ga0373925_0052206 3300037068 Bacteria 3054
626 Ga0395899_0036297 3300037312 Bacteria 3698
627 Ga0395899_0286870 3300037312 Bacteria 1118
628 Ga0395900_0002100 3300037418 Bacteria 22308
629 Ga0395900_0017672 3300037418 Bacteria 7279
630 Ga0395898_0043461 3300037466 Bacteria 4427
631 Ga0395898_0081163 3300037466 Bacteria 3127
632 Ga0395898_0231014 3300037466 Bacteria 1764
633 Ga0395901_0009830 3300038443 Bacteria 9698
634 Ga0395901_0266230 3300038443 Bacteria 1783
635 Ga0395901_0554734 3300038443 Bacteria 1164
636 Ga0395901_0755820 3300038443 Bacteria 965
637 Ga0436365_0134733 3300039437 Bacteria 5028
638 Ga0436365_0725591 3300039437 Bacteria 2920
639 Ga0436365_1517860 3300039437 Bacteria 530
640 Ga0451791_1740671 3300041451 Bacteria 564
641 Ga0451841_0412571 3300041498 Bacteria 562
642 Ga0451853_3541983 3300041512 Unclassified 518
643 Ga0439448_0097514 3300042005 Bacteria 997
644 Ga0439448_0142853 3300042005 Bacteria 829
645 Ga0439448_0180167 3300042005 Bacteria 738
646 Ga0439450_019932 3300042008 Bacteria 1426
647 Ga0439455_0013508 3300042012 Bacteria 1850
648 Ga0439456_049853 3300042013 Bacteria 914
649 Ga0439463_014054 3300042016 Bacteria 1973
650 Ga0439463_108239 3300042016 Unclassified 717
651 Ga0439458_0042380 3300042157 Bacteria 1108
652 Ga0439435_0147665 3300042436 Bacteria 752
653 Ga0439444_0040634 3300042437 Bacteria 912
654 Ga0439444_0188226 3300042437 Bacteria 515
655 Ga0439464_0021635 3300042439 Bacteria 1766
656 Ga0439440_0016866 3300042993 Bacteria 1604
657 Ga0453683_0409132 3300044673 Bacteria 875
658 Ga0466965_0311279 3300044683 Bacteria 856
659 Ga0466966_0033677 3300044684 Bacteria 3316
660 Ga0466961_0048682 3300044693 Bacteria 2709
661 Ga0466963_0011092 3300044694 Bacteria 5480
662 Ga0466963_0062318 3300044694 Bacteria 2495
663 Ga0466963_0195957 3300044694 Bacteria 1412
664 Ga0466963_0236917 3300044694 Bacteria 1279
665 Ga0466963_0244750 3300044694 Bacteria 1258
666 Ga0466963_0798831 3300044694 Unclassified 665
667 Ga0466971_0384545 3300044719 Bacteria 682
668 Ga0466971_0562414 3300044719 Unclassified 566
669 Ga0466957_0003449 3300044842 Bacteria 8672
670 Ga0466957_0033443 3300044842 Bacteria 3085
671 Ga0466957_0578932 3300044842 Bacteria 784
672 Ga0466959_0016488 3300045049 Bacteria 5399
673 Ga0466959_0273282 3300045049 Bacteria 1161
674 Ga0466958_0025916 3300045836 Bacteria 3461
675 Ga0466958_0033391 3300045836 Bacteria 3066
676 Ga0466958_0164319 3300045836 Bacteria 1404
677 Ga0466958_0203098 3300045836 Bacteria 1262
678 Ga0466958_0362882 3300045836 Bacteria 933
679 Ga0466967_0003827 3300045976 Bacteria 9960
680 Ga0466967_0022912 3300045976 Bacteria 5107
681 Ga0466967_0361817 3300045976 Bacteria 1406
682 Ga0495617_009204 3300046452 Bacteria 3394
683 Ga0495592_0001659 3300046454 Bacteria 15603
684 Ga0495592_0002844 3300046454 Bacteria 12281
685 Ga0495592_0002937 3300046454 Bacteria 12135
686 Ga0495592_0091752 3300046454 Bacteria 2178
687 Ga0495592_0134271 3300046454 Bacteria 1728
688 Ga0495592_0509116 3300046454 Bacteria 746
689 Ga0495603_0017650 3300046455 Bacteria 4320
690 Ga0495603_0021917 3300046455 Bacteria 3867
691 Ga0495603_0046482 3300046455 Bacteria 2586
692 Ga0495629_0000820 3300046459 Bacteria 25209
693 Ga0495629_0054204 3300046459 Bacteria 2804
694 Ga0495629_0125985 3300046459 Bacteria 1784
695 Ga0495629_0249468 3300046459 Bacteria 1221
696 Ga0495629_0512068 3300046459 Bacteria 808
697 Ga0495641_0019209 3300046461 Bacteria 3504
698 Ga0495641_0042047 3300046461 Bacteria 2120
699 Ga0495651_0001330 3300046462 Bacteria 19146
700 Ga0495651_0002388 3300046462 Bacteria 14492
701 Ga0495651_0008754 3300046462 Bacteria 7763
702 Ga0495651_0061982 3300046462 Bacteria 2862
703 Ga0495651_0067691 3300046462 Bacteria 2724
704 Ga0495651_0433583 3300046462 Bacteria 852
705 Ga0495653_0010963 3300046463 Bacteria 7419
706 Ga0495653_0014755 3300046463 Bacteria 6372
707 Ga0495653_0024736 3300046463 Bacteria 4834
708 Ga0495653_0061019 3300046463 Bacteria 2854
709 Ga0495580_0007477 3300046472 Bacteria 8779
710 Ga0495580_0145193 3300046472 Bacteria 1644
711 Ga0495582_0002118 3300046473 Bacteria 11108
712 Ga0495582_0065823 3300046473 Bacteria 2002
713 Ga0495582_0082183 3300046473 Bacteria 1789
714 Ga0495605_0166319 3300046474 Bacteria 977
715 Ga0495639_0004776 3300046475 Bacteria 5825
716 Ga0495639_0024628 3300046475 Bacteria 2650
717 Ga0495639_0043030 3300046475 Bacteria 2039
718 Ga0495662_0049089 3300046476 Bacteria 2037
719 Ga0495662_0104000 3300046476 Bacteria 1389
720 Ga0495664_0003775 3300046477 Bacteria 8262
721 Ga0495664_0005939 3300046477 Bacteria 6724
722 Ga0495664_0030892 3300046477 Bacteria 3139
723 Ga0495584_0099329 3300046491 Bacteria 1471
724 Ga0495584_0118693 3300046491 Bacteria 1339
725 Ga0495585_0001819 3300046492 Bacteria 16149
726 Ga0495594_0060760 3300046499 Bacteria 2090
727 Ga0495594_0070027 3300046499 Bacteria 1949
728 Ga0495607_0026222 3300046501 Bacteria 3618
729 Ga0495608_0000456 3300046511 Bacteria 28492
730 Ga0495608_0026720 3300046511 Bacteria 3934
731 Ga0495608_0028820 3300046511 Bacteria 3773
732 Ga0495608_0046466 3300046511 Bacteria 2889
733 Ga0495608_0192177 3300046511 Bacteria 1288
734 Ga0495616_0178855 3300046513 Bacteria 944
735 Ga0495618_0004121 3300046514 Bacteria 8969
736 Ga0495618_0004633 3300046514 Bacteria 8421
737 Ga0495628_0001503 3300046516 Bacteria 21373
738 Ga0495628_0014563 3300046516 Bacteria 6587
739 Ga0495628_0070676 3300046516 Unclassified 2721
740 Ga0495628_0287345 3300046516 Bacteria 1220
741 Ga0495630_0030356 3300046517 Bacteria 4020
742 Ga0495630_0273897 3300046517 Bacteria 1289
743 Ga0495637_0066348 3300046520 Bacteria 1467
744 Ga0495644_0030671 3300046523 Bacteria 2030
745 Ga0495663_0019820 3300046525 Bacteria 1928
746 Ga0495666_0003570 3300046526 Bacteria 7862
747 Ga0495652_0002402 3300046529 Bacteria 19345
748 Ga0495652_0007617 3300046529 Bacteria 9974
749 Ga0495652_0090695 3300046529 Bacteria 2500
750 Ga0495652_0121999 3300046529 Bacteria 2076
751 Ga0495652_0127148 3300046529 Bacteria 2023
752 Ga0495652_0497044 3300046529 Bacteria 846
753 Ga0495665_0008032 3300046531 Bacteria 5723
754 Ga0495640_0009310 3300046533 Bacteria 7652
755 Ga0495640_0017560 3300046533 Bacteria 5329
756 Ga0495640_0081980 3300046533 Bacteria 2143
757 Ga0495640_0155249 3300046533 Bacteria 1469
758 Ga0495640_0179755 3300046533 Bacteria 1348
759 Ga0495640_0850710 3300046533 Bacteria 542
760 Ga0495586_0000868 3300046535 Bacteria 17317
761 Ga0495586_0062998 3300046535 Bacteria 2019
762 Ga0495587_0018735 3300046536 Bacteria 4292
763 Ga0495587_0036933 3300046536 Bacteria 2936
764 Ga0495587_0077278 3300046536 Bacteria 1933
765 Ga0495587_0190812 3300046536 Bacteria 1160
766 Ga0495587_0499532 3300046536 Bacteria 672
767 Ga0495598_0221759 3300046537 Bacteria 690
768 Ga0495609_0024222 3300046538 Bacteria 2786
769 Ga0495609_0231874 3300046538 Bacteria 764
770 Ga0495645_0000399 3300046543 Bacteria 30028
771 Ga0495645_0034116 3300046543 Bacteria 3713
772 Ga0495645_0053488 3300046543 Bacteria 2935
773 Ga0495645_0161493 3300046543 Bacteria 1549
774 Ga0495645_0278035 3300046543 Bacteria 1102
775 Ga0495645_0340636 3300046543 Bacteria 968
776 Ga0495622_0001874 3300046557 Bacteria 10356
777 Ga0495622_0037383 3300046557 Bacteria 2262
778 Ga0495633_0005540 3300046558 Bacteria 7667
779 Ga0495667_0000832 3300046559 Bacteria 19943
780 Ga0495667_0005478 3300046559 Bacteria 8574
781 Ga0495667_0012581 3300046559 Bacteria 5738
782 Ga0495667_0014107 3300046559 Bacteria 5392
783 Ga0495667_0042353 3300046559 Bacteria 3019
784 Ga0495656_0006330 3300046615 Bacteria 4149
785 Ga0495634_0025861 3300046642 Bacteria 4100
786 Ga0495634_0055623 3300046642 Bacteria 2645
787 Ga0495634_0069998 3300046642 Bacteria 2313
788 Ga0495635_0002323 3300046663 Bacteria 12923
789 Ga0495635_0017866 3300046663 Bacteria 4953
790 Ga0495635_0021281 3300046663 Bacteria 4520
791 Ga0495635_0519840 3300046663 Bacteria 782
792 Ga0495635_0632532 3300046663 Bacteria 697
793 Ga0495659_0001022 3300046664 Bacteria 9791
794 Ga0495661_0021555 3300046665 Bacteria 4201
795 Ga0495588_0000486 3300046674 Bacteria 19669
796 Ga0495588_0029502 3300046674 Bacteria 2752
797 Ga0495588_0069692 3300046674 Bacteria 1828
798 Ga0495657_0008710 3300046675 Bacteria 7742
799 Ga0495657_0067045 3300046675 Bacteria 2357
800 Ga0495657_0199268 3300046675 Bacteria 1221
801 Ga0495657_0200963 3300046675 Bacteria 1215
802 Ga0495657_0362815 3300046675 Bacteria 856
803 Ga0495599_0004419 3300046678 Bacteria 8316
804 Ga0495599_0012733 3300046678 Bacteria 5188
805 Ga0495599_0013002 3300046678 Bacteria 5137
806 Ga0495623_0022383 3300046679 Bacteria 4083
807 Ga0495623_0216416 3300046679 Bacteria 1094
808 Ga0495646_0001728 3300046680 Bacteria 13099
809 Ga0495646_0001784 3300046680 Bacteria 12938
810 Ga0495646_0581084 3300046680 Bacteria 570
811 Ga0495647_0000847 3300046681 Bacteria 9158
812 Ga0495647_0009297 3300046681 Bacteria 3325
813 Ga0495647_0010230 3300046681 Bacteria 3192
814 Ga0495658_0000479 3300046683 Bacteria 22023
815 Ga0495658_0039147 3300046683 Bacteria 2629
816 Ga0495658_0046752 3300046683 Bacteria 2434
817 Ga0495658_0059534 3300046683 Bacteria 2187
818 Ga0495613_0010280 3300046689 Bacteria 6951
819 Ga0495613_0225454 3300046689 Bacteria 1314
820 Ga0495613_0351421 3300046689 Bacteria 1012
821 Ga0495624_0014088 3300046690 Bacteria 5437
822 Ga0495670_0013284 3300046691 Bacteria 4050
823 Ga0495589_0123449 3300046794 Bacteria 1246
824 Ga0495600_0001355 3300046809 Bacteria 13523
825 Ga0495600_0025982 3300046809 Bacteria 3776
826 Ga0495600_0032548 3300046809 Bacteria 3384
827 Ga0495600_0055458 3300046809 Bacteria 2588
828 Ga0495600_0260156 3300046809 Bacteria 1102
829 Ga0495581_0011814 3300047315 Bacteria 5055
830 Ga0495581_0026198 3300047315 Bacteria 3382
831 Ga0495581_0065595 3300047315 Bacteria 2099
832 Ga0495581_0386507 3300047315 Bacteria 817
833 Ga0495604_0001255 3300047317 Bacteria 20785
834 Ga0495604_0003178 3300047317 Bacteria 13125
835 Ga0495604_0012787 3300047317 Bacteria 6683
836 Ga0495604_0062533 3300047317 Bacteria 2843
837 Ga0495604_0862465 3300047317 Unclassified 567
838 Ga0495636_0366710 3300047318 Unclassified 682
839 Ga0495674_0010576 3300047319 Bacteria 8733
840 Ga0495674_0017131 3300047319 Bacteria 6748
841 Ga0495674_0033805 3300047319 Bacteria 4628
842 Ga0495674_0061051 3300047319 Bacteria 3287
843 Ga0495674_0555985 3300047319 Bacteria 913
844 Ga0495676_0042894 3300047321 Bacteria 3708
845 Ga0495676_0132622 3300047321 Bacteria 1796
846 Ga0495676_0272713 3300047321 Bacteria 1147
847 Ga0495680_0002523 3300047322 Bacteria 18717
848 Ga0495680_0006821 3300047322 Bacteria 10546
849 Ga0495680_0027186 3300047322 Bacteria 4704
850 Ga0495680_0037048 3300047322 Bacteria 3909
851 Ga0495680_0037795 3300047322 Bacteria 3866
852 Ga0495680_0039673 3300047322 Bacteria 3754
853 Ga0495680_0450118 3300047322 Bacteria 881
854 Ga0495675_0000731 3300047444 Bacteria 20534
855 Ga0495675_0008665 3300047444 Bacteria 6310
856 Ga0495675_0021234 3300047444 Bacteria 4134
857 Ga0495675_0162683 3300047444 Bacteria 1374
858 Ga0495677_0054128 3300047445 Bacteria 1480
859 Ga0495684_0009500 3300047471 Bacteria 7503
860 Ga0495684_0010490 3300047471 Bacteria 7166
861 Ga0495684_0190316 3300047471 Bacteria 1517
862 Ga0495593_0021876 3300047673 Bacteria 3568
863 Ga0495593_0032629 3300047673 Bacteria 2837
864 Ga0495593_0098042 3300047673 Bacteria 1505
865 Ga0495602_0001314 3300048088 Bacteria 24503
866 Ga0495602_0015855 3300048088 Bacteria 7590
867 Ga0495602_0228318 3300048088 Bacteria 1400
868 Ga0495602_0644417 3300048088 Unclassified 724
869 Ga0495614_0056720 3300048089 Bacteria 1681
870 Ga0496100_0000894 3300048903 Bacteria 14217
871 Ga0496100_0051780 3300048903 Bacteria 2666
872 Ga0496100_0056803 3300048903 Bacteria 2561
873 Ga0496101_0008463 3300048904 Bacteria 6721
874 Ga0496101_0017913 3300048904 Bacteria 4807
875 Ga0496101_0043614 3300048904 Bacteria 3206
876 Ga0496101_0080643 3300048904 Bacteria 2404
877 Ga0496101_0723507 3300048904 Bacteria 786
878 Ga0496101_1020323 3300048904 Bacteria 650
879 Ga0496101_1615351 3300048904 Bacteria 503
880 Ga0496102_0017100 3300048905 Bacteria 6349
881 Ga0496102_0098605 3300048905 Bacteria 2711
882 Ga0496102_0131897 3300048905 Bacteria 2339
883 Ga0496103_0014513 3300048906 Bacteria 4676
884 Ga0496103_0031284 3300048906 Bacteria 3241
885 Ga0496103_0031726 3300048906 Bacteria 3221
886 Ga0496103_0107695 3300048906 Bacteria 1768
887 Ga0496104_0000061 3300048907 Bacteria 117394
888 Ga0496104_0010521 3300048907 Bacteria 8265
889 Ga0496104_0028757 3300048907 Bacteria 5151
890 Ga0496104_0180633 3300048907 Bacteria 2020
891 Ga0496105_0000365 3300048908 Bacteria 30018
892 Ga0496105_0002920 3300048908 Bacteria 12546
893 Ga0496105_0042986 3300048908 Bacteria 3726
894 Ga0496105_0061594 3300048908 Bacteria 3096
895 Ga0496106_0012105 3300048909 Bacteria 6367
896 Ga0496106_0043121 3300048909 Bacteria 3384
897 Ga0496106_0084133 3300048909 Bacteria 2447
898 Ga0496106_0227779 3300048909 Bacteria 1487
899 Ga0496106_0988095 3300048909 Bacteria 662
900 Ga0496107_0045843 3300048910 Bacteria 3146
901 Ga0496107_0052267 3300048910 Bacteria 2947
902 Ga0496107_0222105 3300048910 Bacteria 1405
903 Ga0496107_0347702 3300048910 Bacteria 1103
904 Ga0496107_0493370 3300048910 Bacteria 908
905 Ga0496108_0033735 3300048911 Bacteria 4251
906 Ga0496108_0051476 3300048911 Bacteria 3450
907 Ga0496108_0073073 3300048911 Bacteria 2896
908 Ga0496108_0124609 3300048911 Bacteria 2211
909 Ga0496108_0176488 3300048911 Bacteria 1849
910 Ga0496109_0009059 3300048912 Bacteria 8476
911 Ga0496109_0030539 3300048912 Bacteria 4829
912 Ga0496109_0041283 3300048912 Bacteria 4179
913 Ga0496109_0046125 3300048912 Bacteria 3957
914 Ga0496109_0354784 3300048912 Bacteria 1385
915 Ga0496110_0004230 3300048913 Bacteria 11109
916 Ga0496110_0041642 3300048913 Bacteria 4008
917 Ga0496110_0049100 3300048913 Bacteria 3700
918 Ga0496110_0330286 3300048913 Bacteria 1389
919 Ga0496111_0026546 3300048914 Bacteria 4090
920 Ga0496111_0036602 3300048914 Bacteria 3510
921 Ga0496111_0058838 3300048914 Bacteria 2783
922 Ga0496111_0749418 3300048914 Bacteria 708
923 Ga0496112_0043963 3300048915 Bacteria 4374
924 Ga0496112_0060837 3300048915 Bacteria 3721
925 Ga0496112_0067713 3300048915 Bacteria 3524
926 Ga0496112_0523281 3300048915 Bacteria 1121
927 Ga0496112_0552516 3300048915 Bacteria 1085
928 Ga0496113_0011409 3300048916 Bacteria 5924
929 Ga0496113_0035424 3300048916 Bacteria 3650
930 Ga0496113_0088091 3300048916 Bacteria 2388
931 Ga0496113_0336066 3300048916 Bacteria 1211
932 Ga0496113_0563437 3300048916 Bacteria 913
933 Ga0496114_0067528 3300048917 Bacteria 2999
934 Ga0496114_0105965 3300048917 Bacteria 2405
935 Ga0496114_0111012 3300048917 Bacteria 2349
936 Ga0496114_0426066 3300048917 Bacteria 1175
937 Ga0496115_0013508 3300048918 Bacteria 6178
938 Ga0496115_0070030 3300048918 Bacteria 2842
939 Ga0496115_0080712 3300048918 Bacteria 2648
940 Ga0496115_0225835 3300048918 Bacteria 1544
941 Ga0496117_0082112 3300048920 Bacteria 2112
942 Ga0496126_0255518 3300048929 Bacteria 1459
943 Ga0501031_0003092 3300049568 Bacteria 10652
944 Ga0501032_0040473 3300049569 Bacteria 3168
945 Ga0501032_0114003 3300049569 Bacteria 1788
946 Ga0501032_0200808 3300049569 Bacteria 1301
947 Ga0501034_0000319 3300049571 Bacteria 84488
948 Ga0501034_0034953 3300049571 Bacteria 5097
949 Ga0501034_0098231 3300049571 Bacteria 2924
950 Ga0501034_0100449 3300049571 Bacteria 2887
951 Ga0501034_0131062 3300049571 Bacteria 2490
952 Ga0501034_0986100 3300049571 Bacteria 727
953 Ga0501036_0032290 3300049572 Bacteria 4423
954 Ga0501036_0107597 3300049572 Bacteria 2357
955 Ga0501037_0016416 3300049573 Bacteria 5450
956 Ga0501037_0024154 3300049573 Bacteria 4494
957 Ga0501038_0038170 3300049574 Bacteria 4207
958 Ga0501038_0072363 3300049574 Bacteria 2921
959 Ga0501038_0078514 3300049574 Bacteria 2785
960 Ga0501039_0011266 3300049575 Bacteria 6811
961 Ga0501039_0087087 3300049575 Bacteria 2433
962 Ga0501043_0430364 3300049579 Bacteria 994
963 Ga0501043_0542870 3300049579 Bacteria 864
964 Ga0501043_1278373 3300049579 Bacteria 513
965 Ga0501046_0351594 3300049580 Bacteria 1070
966 Ga0501047_0014222 3300049581 Bacteria 7564
967 Ga0501047_0015912 3300049581 Bacteria 7170
968 Ga0501047_0177639 3300049581 Bacteria 1996
969 Ga0501047_0869609 3300049581 Bacteria 715
970 Ga0501048_0388011 3300049582 Bacteria 997
971 Ga0501067_0733343 3300049583 Bacteria 556
972 Ga0501068_0051234 3300049584 Bacteria 2497
973 Ga0501068_0352365 3300049584 Bacteria 946
974 Ga0501068_0724864 3300049584 Bacteria 650
975 Ga0501069_0005809 3300049585 Bacteria 6425
976 Ga0501069_0304209 3300049585 Bacteria 935
977 Ga0501069_1000148 3300049585 Unclassified 511
978 Ga0501070_0006119 3300049586 Bacteria 10254
979 Ga0501070_0031535 3300049586 Bacteria 4441
980 Ga0501070_0129327 3300049586 Bacteria 2086
981 Ga0501070_0154649 3300049586 Bacteria 1891
982 Ga0501070_0157268 3300049586 Bacteria 1874
983 Ga0501071_0185755 3300049587 Bacteria 1558
984 Ga0501071_0354516 3300049587 Bacteria 1117
985 Ga0501072_0141766 3300049588 Bacteria 1916
986 Ga0501072_0250417 3300049588 Bacteria 1411
987 Ga0501072_0302617 3300049588 Bacteria 1271
988 Ga0501072_0440660 3300049588 Bacteria 1032
989 Ga0501073_0125088 3300049589 Bacteria 1782
990 Ga0501073_0465500 3300049589 Bacteria 874
991 Ga0501073_0583372 3300049589 Bacteria 772
992 Ga0501074_0050037 3300049590 Bacteria 3016
993 Ga0501074_0119253 3300049590 Bacteria 1886
994 Ga0501074_0185649 3300049590 Bacteria 1483
995 Ga0501077_0056351 3300049593 Bacteria 2494
996 Ga0501079_0210125 3300049741 Bacteria 1520
997 Ga0501080_0101172 3300049742 Bacteria 2673
998 Ga0501080_0219478 3300049742 Bacteria 1740
999 Ga0501080_0609936 3300049742 Bacteria 968
1000 Ga0501080_1375413 3300049742 Unclassified 603
1001 Ga0501083_0028527 3300049744 Bacteria 3845
1002 Ga0501083_0152007 3300049744 Bacteria 1516
1003 Ga0501083_0273462 3300049744 Bacteria 1099
1004 Ga0501035_0001800 3300049822 Bacteria 21664
1005 Ga0501035_0029127 3300049822 Bacteria 5036
1006 Ga0501035_0235247 3300049822 Bacteria 1560
1007 Ga0501035_0371930 3300049822 Bacteria 1193
1008 Ga0501044_0320652 3300049823 Bacteria 1474
1009 Ga0501044_0483764 3300049823 Bacteria 1141
1010 Ga0501044_0537985 3300049823 Bacteria 1066
1011 Ga0501044_0917441 3300049823 Bacteria 750
1012 nmdc:mga03683_631823_c1 3300050489 Bacteria 526
1013 nmdc:mga03n38_217424_c1 3300050490 Bacteria 996
1014 nmdc:mga03n38_74518_c1 3300050490 Bacteria 1579
1015 nmdc:mga00v17_848946_c1 3300050491 Bacteria 580
1016 nmdc:mga0yw44_1034339_c1 3300050492 Bacteria 556
1017 nmdc:mga0yw44_344087_c1 3300050492 Bacteria 1003
1018 nmdc:mga06z11_36082_c1 3300050494 Bacteria 2438
1019 nmdc:mga04h51_210116_c1 3300050495 Unclassified 768
1020 nmdc:mga07m45_138606_c1 3300050496 Bacteria 1409
1021 nmdc:mga07m45_93737_c1 3300050496 Bacteria 1721
1022 nmdc:mga05p37_1242_c1 3300050507 Bacteria 29598
1023 nmdc:mga05p37_7606_c1 3300050507 Bacteria 12784
1024 nmdc:mga09592_480_c1 3300050508 Bacteria 29887
1025 nmdc:mga0qj67_514_c1 3300050509 Bacteria 26446
1026 nmdc:mga06r32_1472165_c1 3300050510 Bacteria 621
1027 nmdc:mga06r32_19785_c1 3300050510 Bacteria 6187
1028 nmdc:mga06r32_633464_c1 3300050510 Bacteria 1038
1029 nmdc:mga08y16_1532_c1 3300050511 Bacteria 23233
1030 nmdc:mga08y16_2506_c1 3300050511 Bacteria 18888
1031 nmdc:mga08y16_313418_c1 3300050511 Bacteria 1616
1032 nmdc:mga0n895_1152_c1 3300050512 Bacteria 19359
1033 nmdc:mga0n895_1592656_c1 3300050512 Bacteria 618
1034 nmdc:mga0n895_2804_c1 3300050512 Bacteria 13777
1035 nmdc:mga0n895_353560_c1 3300050512 Bacteria 1488
1036 nmdc:mga0n895_377944_c1 3300050512 Bacteria 1434
1037 nmdc:mga0n895_58640_c1 3300050512 Bacteria 3796
1038 nmdc:mga0rr50_317889_c1 3300050513 Unclassified 1305
1039 nmdc:mga0rr50_43930_c1 3300050513 Bacteria 3274
1040 nmdc:mga0rr50_609103_c1 3300050513 Bacteria 931
1041 nmdc:mga0rr50_77620_c1 3300050513 Bacteria 2553
1042 nmdc:mga08x19_115137_c1 3300050514 Bacteria 1797
1043 nmdc:mga08x19_164205_c1 3300050514 Bacteria 1061
1044 nmdc:mga08x19_551906_c1 3300050514 Bacteria 815
1045 nmdc:mga08x19_758606_c1 3300050514 Unclassified 689
1046 nmdc:mga08x19_815033_c1 3300050514 Bacteria 663
1047 nmdc:mga08x19_850206_c1 3300050514 Bacteria 648
1048 nmdc:mga0a205_10123_c1 3300050515 Bacteria 8655
1049 nmdc:mga0a205_1257_c1 3300050515 Bacteria 21275
1050 nmdc:mga0a205_19977_c1 3300050515 Bacteria 6320
1051 Ga0495601_0000095 3300053077 Bacteria 48556
1052 Ga0495601_0000316 3300053077 Bacteria 25622
1053 Ga0495601_0006189 3300053077 Bacteria 6987
1054 Ga0495601_0015389 3300053077 Bacteria 4623
1055 Ga0495601_0041044 3300053077 Bacteria 2900
1056 Ga0495601_0060341 3300053077 Bacteria 2407
1057 Ga0495612_0000812 3300053078 Bacteria 12723
1058 Ga0495612_0002682 3300053078 Bacteria 7351
1059 Ga0495612_0003848 3300053078 Bacteria 6229
1060 Ga0495612_0011752 3300053078 Bacteria 3529
1061 Ga0495612_0018121 3300053078 Bacteria 2818
1062 Ga0495612_0113492 3300053078 Bacteria 1161
1063 Ga0495612_0126893 3300053078 Bacteria 1100
1064 Ga0495612_0342705 3300053078 Unclassified 674
1065 Ga0495595_0000261 3300053084 Bacteria 20962
1066 Ga0495595_0002995 3300053084 Bacteria 6673
1067 Ga0495595_0005688 3300053084 Bacteria 5047
1068 Ga0495595_0016442 3300053084 Bacteria 3165
1069 Ga0495595_0089650 3300053084 Bacteria 1474
1070 Ga0495595_0313707 3300053084 Bacteria 789
1071 Ga0495595_0749205 3300053084 Unclassified 501
1072 Ga0495619_0000056 3300053085 Bacteria 95385
1073 Ga0495619_0000498 3300053085 Bacteria 26335
1074 Ga0495619_0003320 3300053085 Bacteria 10401
1075 Ga0495619_0006134 3300053085 Bacteria 7614
1076 Ga0495619_0076645 3300053085 Bacteria 2245
1077 Ga0495619_0204791 3300053085 Bacteria 1366
1078 Ga0495619_0816050 3300053085 Bacteria 630
1079 Ga0495619_0847812 3300053085 Bacteria 616
1080 Ga0500566_0414660 3300053094 Unclassified 599
1081 Ga0500650_0188568 3300053098 Bacteria 942
1082 Ga0501084_0112385 3300054114 Bacteria 2289
1083 Ga0501082_0116952 3300060353 Bacteria 2309
1084 Ga0501082_0312747 3300060353 Bacteria 1368
1085 Ga0501082_0415173 3300060353 Bacteria 1175
1086 Ga0501082_0735425 3300060353 Bacteria 863
1087 Ga0466962_0092014 3300061719 Bacteria 1454
1088 Ga0070679_100351705
1089 JGI24741J21665_1011317
1090 JGI24752J21851_1004034
1091 JGI24746J21847_1003951
1092 JGI24739J22299_10004113
1093 JGI24739J22299_10068188
1094 JGI24737J22298_10001610
1095 JGI24743J22301_10004729
1096 JGI24735J21928_10044950
1097 JGI24750J21931_1000047
1098 JGI24745J21846_1001071
1099 JGI24748J21848_1005915
1100 JGI24738J21930_10011556
1101 JGI24749J21850_1006539
1102 JGI24749J21850_1008897
1103 JGI24744J21845_10002333
1104 JGI24035J26624_1000692
1105 JGI24033J26618_1000780
1106 JGI24034J26672_10001282
1107 JGI24742J22300_10000108
1108 JGI24751J29686_10015732
1109 JGI26145J50221_1002138
1110 JGI25405J52794_10005075
1111 Ga0065715_10000365
1112 Ga0065715_10000449
1113 Ga0070658_10077465
1114 Ga0070658_10134776
1115 Ga0070658_10293425
1116 Ga0070676_10005804
1117 Ga0070683_100027713
1118 Ga0070683_100275485
1119 Ga0070683_100408101
1120 Ga0070690_100003335
1121 Ga0070690_100013679
1122 Ga0070690_100093275
1123 Ga0070670_100019704
1124 Ga0070670_100020956
1125 Ga0070677_10000823
1126 Ga0068869_100004243
1127 Ga0068869_100189633
1128 Ga0070666_10004766
1129 Ga0070680_100007952
1130 Ga0070680_100011474
1131 Ga0070680_100111122
1132 Ga0070680_100221240
1133 Ga0070680_100417469
1134 Ga0070680_100515319
1135 Ga0070680_101149991
1136 Ga0070682_100031542
1137 Ga0068868_100007863
1138 Ga0068868_100117520
1139 Ga0068868_101049558
1140 Ga0068868_101727891
1141 Ga0070660_100000419
1142 Ga0070689_100000784
1143 Ga0070689_100345386
1144 Ga0070691_10006949
1145 Ga0070691_10044077
1146 Ga0070691_10053380
1147 Ga0070691_10192924
1148 Ga0070691_10219092
1149 Ga0070687_100004162
1150 Ga0070687_100084021
1151 Ga0070687_100164990
1152 Ga0070661_100005802
1153 Ga0070661_100548180
1154 Ga0070692_10000927
1155 Ga0070668_100016262
1156 Ga0070668_100772738
1157 Ga0070669_100010373
1158 Ga0070675_100019626
1159 Ga0070675_100050814
1160 Ga0070675_100585896
1161 Ga0070671_100340998
1162 Ga0070671_100482294
1163 Ga0070674_100004604
1164 Ga0070674_100150354
1165 Ga0070674_100497457
1166 Ga0070673_100010441
1167 Ga0070673_100013492
1168 Ga0070673_100077593
1169 Ga0070688_100000956
1170 Ga0070688_100010878
1171 Ga0070659_100023866
1172 Ga0070659_100063256
1173 Ga0070659_101006776
1174 Ga0070667_100003581
1175 Ga0070667_100141277
1176 Ga0070667_100291441
1177 Ga0070703_10002961
1178 Ga0070709_10000959
1179 Ga0070709_10070122
1180 Ga0070709_10181050
1181 Ga0070709_10259764
1182 Ga0070714_100082526
1183 Ga0070714_100190392
1184 Ga0070714_100543241
1185 Ga0070713_100010662
1186 Ga0070713_100013123
1187 Ga0070713_100022631
1188 Ga0070713_100713209
1189 Ga0070710_10002603
1190 Ga0070710_10008826
1191 Ga0070710_10359419
1192 Ga0070710_10600219
1193 Ga0070701_10001072
1194 Ga0070711_100009109
1195 Ga0070711_100360114
1196 Ga0070711_100587830
1197 Ga0070705_100004361
1198 Ga0070705_100115495
1199 Ga0070700_100005661
1200 Ga0070694_100003415
1201 Ga0070694_101115998
1202 Ga0070708_100395300
1203 Ga0070663_100015502
1204 Ga0070663_100022520
1205 Ga0070663_100028982
1206 Ga0070663_100030908
1207 Ga0070678_100010190
1208 Ga0070678_100011179
1209 Ga0070678_100101916
1210 Ga0070662_100023224
1211 Ga0070662_100107164
1212 Ga0070662_100900873
1213 Ga0070681_10001622
1214 Ga0070681_10016579
1215 Ga0070681_10062985
1216 Ga0070681_10499329
1217 Ga0070681_10650651
1218 Ga0070681_11516973
1219 Ga0070681_11651251
1220 Ga0068867_100018127
1221 Ga0068867_100569322
1222 Ga0068867_100671701
1223 Ga0070685_10006135
1224 Ga0070685_10008365
1225 Ga0070685_10140704
1226 Ga0070707_100229177
1227 Ga0070707_100902897
1228 Ga0070699_100182991
1229 Ga0070679_100018168
1230 Ga0070679_100074050
1231 Ga0070679_100103127
1232 Ga0070679_100497050
1233 Ga0070679_100539612
1234 Ga0070679_100763948
1235 Ga0070679_101311459
1236 Ga0070679_101821276
1237 Ga0070684_100007664
1238 Ga0070684_100136515
1239 Ga0070697_101028174
1240 Ga0068853_100009267
1241 Ga0068853_100714236
1242 Ga0070686_100003330
1243 Ga0070686_100009318
1244 Ga0070686_100061657
1245 Ga0070695_100007284
1246 Ga0070695_100062036
1247 Ga0070696_100009140
1248 Ga0070696_100028902
1249 Ga0070693_100009938
1250 Ga0070665_100122566
1251 Ga0070704_100000799
1252 Ga0070704_100029063
1253 Ga0068855_100231552
1254 Ga0068855_100713392
1255 Ga0068855_100762992
1256 Ga0068855_101035280
1257 Ga0070664_100061274
1258 Ga0070664_100150393
1259 Ga0070664_100190826
1260 Ga0070664_100502627
1261 Ga0070664_100562882
1262 Ga0068854_100000702
1263 Ga0068854_100134727
1264 Ga0068856_100053436
1265 Ga0068856_101177549
1266 Ga0068856_101189361
1267 Ga0070702_100004763
1268 Ga0070702_100048350
1269 Ga0068852_100002168
1270 Ga0068852_100142940
1271 Ga0068859_100066290
1272 Ga0068859_100394915
1273 Ga0068866_10133151
1274 Ga0068861_100143197
1275 Ga0068863_100710284
1276 Ga0068863_101494468
1277 Ga0068863_101732598
1278 Ga0068858_100000657
1279 Ga0068858_100177384
1280 Ga0068858_101258818
1281 Ga0068860_100039959
1282 Ga0068860_100125999
1283 Ga0068860_100331967
1284 Ga0068862_100096723
1285 Ga0068862_100366129
1286 Ga0070717_10000720
1287 Ga0070717_10264413
1288 Ga0075365_10171872
1289 Ga0075368_10203879
1290 Ga0075363_100131669
1291 Ga0075363_100752716
1292 Ga0075364_10630249
1293 Ga0075364_10822761
1294 Ga0070715_10000434
1295 Ga0070716_100022246
1296 Ga0070712_100062335
1297 Ga0070712_100274528
1298 Ga0075362_10202996
1299 Ga0075427_10000902
1300 Ga0097621_100000078
1301 Ga0097621_100013381
1302 Ga0097621_100025587
1303 Ga0075370_10100460
1304 Ga0068871_100049791
1305 Ga0068871_100108912
1306 Ga0075428_100001638
1307 Ga0075431_100001119
1308 Ga0075431_100504567
1309 Ga0075434_100003370
1310 Ga0075434_100043579
1311 Ga0075434_100265934
1312 Ga0075434_100353360
1313 Ga0075434_100596772
1314 Ga0075429_100002649
1315 Ga0068865_100000155
1316 Ga0068865_100060317
1317 Ga0075436_100012844
1318 Ga0075436_100040929
1319 Ga0075436_101117334
1320 Ga0097620_100066295
1321 Ga0097620_100394916
1322 Ga0075435_100000970
1323 Ga0075435_100008956
1324 Ga0075435_100015334
1325 Ga0105251_10058512
1326 Ga0105251_10161613
1327 Ga0105250_10036768
1328 Ga0105240_10084806
1329 Ga0105240_10154758
1330 Ga0105240_10349069
1331 Ga0105240_10996763
1332 Ga0105240_11521840
1333 Ga0111539_10010049
1334 Ga0111539_10161211
1335 Ga0111539_10383332
1336 Ga0111539_11035230
1337 Ga0111539_11723268
1338 Ga0105245_10005766
1339 Ga0105245_10030396
1340 Ga0105245_10045065
1341 Ga0105245_11957796
1342 Ga0105247_10002157
1343 Ga0105247_10018587
1344 Ga0105247_10019956
1345 Ga0105247_10119319
1346 Ga0114129_10006926
1347 Ga0114129_10022324
1348 Ga0105243_10007171
1349 Ga0105243_10043547
1350 Ga0105243_10050124
1351 Ga0105241_10008937
1352 Ga0105241_10130906
1353 Ga0105241_10652218
1354 Ga0105241_11260244
1355 Ga0105242_10004516
1356 Ga0105242_10008202
1357 Ga0105242_10369258
1358 Ga0105248_10004213
1359 Ga0105248_10014034
1360 Ga0105248_10050815
1361 Ga0105237_10012499
1362 Ga0105237_10141573
1363 Ga0105237_10152802
1364 Ga0105238_10277489
1365 Ga0105238_10703760
1366 Ga0105238_10917172
1367 Ga0105238_11002414
1368 Ga0105238_13029066
1369 Ga0105249_10031751
1370 Ga0105249_10512897
1371 Ga0105239_10062241
1372 Ga0105239_10071125
1373 Ga0105239_10324428
1374 Ga0105246_10016930
1375 Ga0105246_10053493
1376 Ga0105246_10068024
1377 Ga0105246_10115022
1378 Ga0157337_1001327
1379 Ga0157322_1019911
1380 Ga0157373_10040872
1381 Ga0157373_10209706
1382 Ga0157373_10258185
1383 Ga0157373_10682808
1384 Ga0157371_10004410
1385 Ga0157371_10056650
1386 Ga0157371_11184194
1387 Ga0157370_10031648
1388 Ga0157370_10480050
1389 Ga0157370_10755511
1390 Ga0157369_10086258
1391 Ga0157369_10508418
1392 Ga0157369_10825812
1393 Ga0157369_11020478
1394 Ga0157374_10035360
1395 Ga0157374_10182533
1396 Ga0157374_10201751
1397 Ga0157374_10316041
1398 Ga0157378_10004404
1399 Ga0157378_10053633
1400 Ga0157378_10155903
1401 Ga0157378_11187199
1402 Ga0163162_10053663
1403 Ga0163162_10220284
1404 Ga0163162_11519017
1405 Ga0157372_10012919
1406 Ga0157372_10068346
1407 Ga0157372_10319154
1408 Ga0157372_10758855
1409 Ga0157372_11351125
1410 Ga0157372_11682640
1411 Ga0157375_10023952
1412 Ga0157375_12381496
1413 Ga0163163_10002553
1414 Ga0163163_10063209
1415 Ga0163163_10135570
1416 Ga0163163_10185607
1417 Ga0157380_10153380
1418 Ga0157380_10323259
1419 Ga0182008_10339428
1420 Ga0157377_10011447
1421 Ga0157377_10071860
1422 Ga0157379_10000539
1423 Ga0157379_10011925
1424 Ga0157379_10041604
1425 Ga0157379_10254918
1426 Ga0157376_10035583
1427 Ga0157376_10429982
1428 Ga0157376_10896274
1429 Ga0163161_10156427
1430 Ga0163161_10294116
1431 Ga0206356_11650372
1432 Ga0206354_11487445
1433 Ga0213876_10069391
1434 Ga0213876_10121321
1435 Ga0207666_1000522
1436 Ga0207697_10004732
1437 Ga0207656_10438672
1438 Ga0207653_10002374
1439 Ga0207692_10031568
1440 Ga0207692_10068011
1441 Ga0207692_10216566
1442 Ga0207692_11004208
1443 Ga0207642_10083253
1444 Ga0207710_10524713
1445 Ga0207688_10011771
1446 Ga0207680_10010419
1447 Ga0207680_10268720
1448 Ga0207647_10007623
1449 Ga0207685_10006002
1450 Ga0207699_10005253
1451 Ga0207699_10110016
1452 Ga0207705_10375929
1453 Ga0207705_10415933
1454 Ga0207705_11280599
1455 Ga0207707_10028853
1456 Ga0207707_10066726
1457 Ga0207707_10253050
1458 Ga0207707_10393736
1459 Ga0207707_11652340
1460 Ga0207695_10034276
1461 Ga0207695_10849137
1462 Ga0207671_10513123
1463 Ga0207693_10031101
1464 Ga0207693_10101956
1465 Ga0207693_10367682
1466 Ga0207693_11184597
1467 Ga0207663_10083400
1468 Ga0207663_10105872
1469 Ga0207663_10172873
1470 Ga0207663_11069084
1471 Ga0207660_10094332
1472 Ga0207660_10241643
1473 Ga0207660_10479820
1474 Ga0207660_10481916
1475 Ga0207660_11315965
1476 Ga0207657_10722561
1477 Ga0207657_10946503
1478 Ga0207649_10183004
1479 Ga0207649_10443418
1480 Ga0207652_10025519
1481 Ga0207652_10054252
1482 Ga0207652_10123726
1483 Ga0207652_10139752
1484 Ga0207646_10518065
1485 Ga0207694_10099036
1486 Ga0207694_10534586
1487 Ga0207694_10740513
1488 Ga0207694_11521679
1489 Ga0207650_10045297
1490 Ga0207659_10011825
1491 Ga0207659_10521539
1492 Ga0207687_10033774
1493 Ga0207687_10962425
1494 Ga0207687_11652759
1495 Ga0207700_10003137
1496 Ga0207700_10011504
1497 Ga0207700_10122195
1498 Ga0207664_10233160
1499 Ga0207644_10006166
1500 Ga0207706_10010270
1501 Ga0207706_10020507
1502 Ga0207706_10037101
1503 Ga0207686_10047722
1504 Ga0207709_10005421
1505 Ga0207709_10024667
1506 Ga0207709_10086990
1507 Ga0207670_10057666
1508 Ga0207669_10405325
1509 Ga0207704_10012530
1510 Ga0207704_10361079
1511 Ga0207665_10001296
1512 Ga0207665_10135073
1513 Ga0207665_10234006
1514 Ga0207691_10022732
1515 Ga0207711_10022254
1516 Ga0207711_10035620
1517 Ga0207689_10000503
1518 Ga0207689_10597414
1519 Ga0207661_10206126
1520 Ga0207661_10436359
1521 Ga0207661_11802428
1522 Ga0207679_10110505
1523 Ga0207679_10216184
1524 Ga0207667_10005613
1525 Ga0207667_10054142
1526 Ga0207667_10500724
1527 Ga0207667_11061334
1528 Ga0207667_12193796
1529 Ga0207712_10005771
1530 Ga0207712_10020865
1531 Ga0207640_10105047
1532 Ga0207640_11078160
1533 Ga0207658_10309801
1534 Ga0207658_10544610
1535 Ga0207677_10209966
1536 Ga0207677_10711149
1537 Ga0207703_10025900
1538 Ga0207703_11092390
1539 Ga0207703_11230866
1540 Ga0207639_10141075
1541 Ga0207639_10380899
1542 Ga0207678_10045454
1543 Ga0207678_10050320
1544 Ga0207708_10075664
1545 Ga0207702_10136832
1546 Ga0207702_10147378
1547 Ga0207702_11000602
1548 Ga0207702_11309932
1549 Ga0207648_10143054
1550 Ga0207676_12056059
1551 Ga0207683_10000069
1552 Ga0207683_10010482
1553 Ga0207683_12058167
1554 Ga0207698_10104588
1555 Ga0207698_11877715
1556 Ga0209968_1017344
1557 Ga0209999_1018733
1558 Ga0209971_1009614
1559 Ga0209966_1000576
1560 Ga0209998_10002030
1561 Ga0209998_10024511
1562 Ga0209813_10148679
1563 Ga0209974_10030337
1564 Ga0207428_10000908
1565 Ga0207428_10187035
1566 Ga0268266_10023731
1567 Ga0268266_10300327
1568 Ga0268265_10120394
1569 Ga0268265_11636935
1570 Ga0268264_10023011
1571 Ga0268264_10282408
1572 Ga0268264_10484029
1573 Ga0265337_1002835
1574 Ga0265326_10095687
1575 Ga0265334_10098678
1576 Ga0265336_10021931
1577 Ga0265338_10050343
1578 Ga0265338_10091302
1579 Ga0265338_10668293
1580 Ga0265332_10174674
1581 Ga0265332_10273513
1582 Ga0265325_10003859
1583 Ga0265325_10005573
1584 Ga0265325_10029752
1585 Ga0265329_10143255
1586 Ga0265340_10014118
1587 Ga0265340_10056702
1588 Ga0265339_10004140
1589 Ga0265339_10074226
1590 Ga0265331_10082424
1591 Ga0265316_10114851
1592 Ga0265316_10816179
1593 Ga0307408_100486467
1594 Ga0265313_10000176
1595 Ga0265313_10002253
1596 Ga0265313_10014273
1597 Ga0265313_10163158
1598 Ga0265313_10215928
1599 Ga0316579_10167313
1600 Ga0265314_10002100
1601 Ga0265342_10005459
1602 Ga0307405_10482444
1603 Ga0307405_10797507
1604 Ga0307410_10739151
1605 Ga0326468_10089776
1606 Ga0307406_10285833
1607 Ga0307409_100496611
1608 Ga0307409_101102091
1609 Ga0307414_10634363
1610 Ga0373930_0037693
1611 Ga0373950_0001194
1612 Ga0373950_0059277
1613 Ga0373958_0022229
1614 Ga0373959_0015987
1615 Ga0373938_0009995
1616 Ga0373938_0050346
1617 Ga0373926_0008736
1618 Ga0373926_0015201
1619 Ga0373928_0003734
1620 Ga0373929_0029716
1621 Ga0373934_0040577
1622 Ga0373934_0166821
1623 Ga0373934_0395284
1624 Ga0373944_0001606
1625 Ga0373944_0131808
1626 Ga0373949_0005414
1627 Ga0373951_0010287
1628 Ga0373951_0066138
1629 Ga0373952_0001423
1630 Ga0373952_0002309
1631 Ga0373923_0002777
1632 Ga0373923_0072262
1633 Ga0373932_0021345
1634 Ga0373936_0012971
1635 Ga0373936_0101539
1636 Ga0373939_0003721
1637 Ga0373939_0003841
1638 Ga0373941_0001156
1639 Ga0373945_0004846
1640 Ga0373945_0024843
1641 Ga0373945_0169817
1642 Ga0373953_0002682
1643 Ga0373953_0023138
1644 Ga0373953_0041143
1645 Ga0373953_0217037
1646 Ga0373954_0009519
1647 Ga0373954_0022029
1648 Ga0373954_0039070
1649 Ga0373954_0051526
1650 Ga0373954_0655818
1651 Ga0373956_0008662
1652 Ga0373956_0047792
1653 Ga0373956_0359740
1654 Ga0373957_0007212
1655 Ga0373957_0022723
1656 Ga0373957_0055364
1657 Ga0373957_0160814
1658 Ga0373957_0246082
1659 Ga0373957_0305953
1660 Ga0373960_0013894
1661 Ga0373943_0067957
1662 Ga0373943_0073111
1663 Ga0373946_0002576
1664 Ga0373946_0010115
1665 Ga0373946_0046646
1666 Ga0373955_0003855
1667 Ga0373955_0004998
1668 Ga0373955_0014019
1669 Ga0373955_0207324
1670 Ga0373955_0210402
1671 Ga0373955_0585994
1672 Ga0373942_0001355
1673 Ga0373961_0014826
1674 Ga0373961_0050761
1675 Ga0373961_0216948
1676 Ga0373962_0000166
1677 Ga0373962_0048164
1678 Ga0373962_0130938
1679 Ga0373924_0002225
1680 Ga0373924_0010364
1681 Ga0373924_0109631
1682 Ga0373924_0268905
1683 Ga0373931_0007472
1684 Ga0373931_0644954
1685 Ga0373935_0012906
1686 Ga0373935_0499727
1687 Ga0373927_0006775
1688 Ga0373927_0007569
1689 Ga0373927_0088737
1690 Ga0373927_1148481
1691 Ga0373933_0001315
1692 Ga0373933_0017514
1693 Ga0373933_0034589
1694 Ga0373933_0167902
1695 Ga0373933_0468519
1696 Ga0373933_0483350
1697 Ga0373947_0003183
1698 Ga0373947_0061133
1699 Ga0373937_0001948
1700 Ga0373937_0004646
1701 Ga0373937_0005491
1702 Ga0373937_0010388
1703 Ga0373937_0019993
1704 Ga0373937_0226570
1705 Ga0373937_0376696
1706 Ga0373937_0427662
1707 Ga0373937_1107503
1708 Ga0373937_1555402
1709 Ga0316582_0137188
1710 Ga0373925_0004198
1711 Ga0373925_0051762
1712 Ga0373925_0052206
1713 Ga0395899_0036297
1714 Ga0395899_0286870
1715 Ga0395900_0002100
1716 Ga0395900_0017672
1717 Ga0395898_0043461
1718 Ga0395898_0081163
1719 Ga0395898_0231014
1720 Ga0395901_0009830
1721 Ga0395901_0266230
1722 Ga0395901_0554734
1723 Ga0395901_0755820
1724 Ga0436365_0134733
1725 Ga0436365_0725591
1726 Ga0436365_1517860
1727 Ga0451791_1740671
1728 Ga0451841_0412571
1729 Ga0451853_3541983
1730 Ga0439448_0097514
1731 Ga0439448_0142853
1732 Ga0439448_0180167
1733 Ga0439450_019932
1734 Ga0439455_0013508
1735 Ga0439456_049853
1736 Ga0439463_014054
1737 Ga0439463_108239
1738 Ga0439458_0042380
1739 Ga0439435_0147665
1740 Ga0439444_0040634
1741 Ga0439444_0188226
1742 Ga0439464_0021635
1743 Ga0439440_0016866
1744 Ga0453683_0409132
1745 Ga0466965_0311279
1746 Ga0466966_0033677
1747 Ga0466961_0048682
1748 Ga0466963_0011092
1749 Ga0466963_0062318
1750 Ga0466963_0195957
1751 Ga0466963_0236917
1752 Ga0466963_0244750
1753 Ga0466963_0798831
1754 Ga0466971_0384545
1755 Ga0466971_0562414
1756 Ga0466957_0003449
1757 Ga0466957_0033443
1758 Ga0466957_0578932
1759 Ga0466959_0016488
1760 Ga0466959_0273282
1761 Ga0466958_0025916
1762 Ga0466958_0033391
1763 Ga0466958_0164319
1764 Ga0466958_0203098
1765 Ga0466958_0362882
1766 Ga0466967_0003827
1767 Ga0466967_0022912
1768 Ga0466967_0361817
1769 Ga0495617_009204
1770 Ga0495592_0001659
1771 Ga0495592_0002844
1772 Ga0495592_0002937
1773 Ga0495592_0091752
1774 Ga0495592_0134271
1775 Ga0495592_0509116
1776 Ga0495603_0017650
1777 Ga0495603_0021917
1778 Ga0495603_0046482
1779 Ga0495629_0000820
1780 Ga0495629_0054204
1781 Ga0495629_0125985
1782 Ga0495629_0249468
1783 Ga0495629_0512068
1784 Ga0495641_0019209
1785 Ga0495641_0042047
1786 Ga0495651_0001330
1787 Ga0495651_0002388
1788 Ga0495651_0008754
1789 Ga0495651_0061982
1790 Ga0495651_0067691
1791 Ga0495651_0433583
1792 Ga0495653_0010963
1793 Ga0495653_0014755
1794 Ga0495653_0024736
1795 Ga0495653_0061019
1796 Ga0495580_0007477
1797 Ga0495580_0145193
1798 Ga0495582_0002118
1799 Ga0495582_0065823
1800 Ga0495582_0082183
1801 Ga0495605_0166319
1802 Ga0495639_0004776
1803 Ga0495639_0024628
1804 Ga0495639_0043030
1805 Ga0495662_0049089
1806 Ga0495662_0104000
1807 Ga0495664_0003775
1808 Ga0495664_0005939
1809 Ga0495664_0030892
1810 Ga0495584_0099329
1811 Ga0495584_0118693
1812 Ga0495585_0001819
1813 Ga0495594_0060760
1814 Ga0495594_0070027
1815 Ga0495607_0026222
1816 Ga0495608_0000456
1817 Ga0495608_0026720
1818 Ga0495608_0028820
1819 Ga0495608_0046466
1820 Ga0495608_0192177
1821 Ga0495616_0178855
1822 Ga0495618_0004121
1823 Ga0495618_0004633
1824 Ga0495628_0001503
1825 Ga0495628_0014563
1826 Ga0495628_0070676
1827 Ga0495628_0287345
1828 Ga0495630_0030356
1829 Ga0495630_0273897
1830 Ga0495637_0066348
1831 Ga0495644_0030671
1832 Ga0495663_0019820
1833 Ga0495666_0003570
1834 Ga0495652_0002402
1835 Ga0495652_0007617
1836 Ga0495652_0090695
1837 Ga0495652_0121999
1838 Ga0495652_0127148
1839 Ga0495652_0497044
1840 Ga0495665_0008032
1841 Ga0495640_0009310
1842 Ga0495640_0017560
1843 Ga0495640_0081980
1844 Ga0495640_0155249
1845 Ga0495640_0179755
1846 Ga0495640_0850710
1847 Ga0495586_0000868
1848 Ga0495586_0062998
1849 Ga0495587_0018735
1850 Ga0495587_0036933
1851 Ga0495587_0077278
1852 Ga0495587_0190812
1853 Ga0495587_0499532
1854 Ga0495598_0221759
1855 Ga0495609_0024222
1856 Ga0495609_0231874
1857 Ga0495645_0000399
1858 Ga0495645_0034116
1859 Ga0495645_0053488
1860 Ga0495645_0161493
1861 Ga0495645_0278035
1862 Ga0495645_0340636
1863 Ga0495622_0001874
1864 Ga0495622_0037383
1865 Ga0495633_0005540
1866 Ga0495667_0000832
1867 Ga0495667_0005478
1868 Ga0495667_0012581
1869 Ga0495667_0014107
1870 Ga0495667_0042353
1871 Ga0495656_0006330
1872 Ga0495634_0025861
1873 Ga0495634_0055623
1874 Ga0495634_0069998
1875 Ga0495635_0002323
1876 Ga0495635_0017866
1877 Ga0495635_0021281
1878 Ga0495635_0519840
1879 Ga0495635_0632532
1880 Ga0495659_0001022
1881 Ga0495661_0021555
1882 Ga0495588_0000486
1883 Ga0495588_0029502
1884 Ga0495588_0069692
1885 Ga0495657_0008710
1886 Ga0495657_0067045
1887 Ga0495657_0199268
1888 Ga0495657_0200963
1889 Ga0495657_0362815
1890 Ga0495599_0004419
1891 Ga0495599_0012733
1892 Ga0495599_0013002
1893 Ga0495623_0022383
1894 Ga0495623_0216416
1895 Ga0495646_0001728
1896 Ga0495646_0001784
1897 Ga0495646_0581084
1898 Ga0495647_0000847
1899 Ga0495647_0009297
1900 Ga0495647_0010230
1901 Ga0495658_0000479
1902 Ga0495658_0039147
1903 Ga0495658_0046752
1904 Ga0495658_0059534
1905 Ga0495613_0010280
1906 Ga0495613_0225454
1907 Ga0495613_0351421
1908 Ga0495624_0014088
1909 Ga0495670_0013284
1910 Ga0495589_0123449
1911 Ga0495600_0001355
1912 Ga0495600_0025982
1913 Ga0495600_0032548
1914 Ga0495600_0055458
1915 Ga0495600_0260156
1916 Ga0495581_0011814
1917 Ga0495581_0026198
1918 Ga0495581_0065595
1919 Ga0495581_0386507
1920 Ga0495604_0001255
1921 Ga0495604_0003178
1922 Ga0495604_0012787
1923 Ga0495604_0062533
1924 Ga0495604_0862465
1925 Ga0495636_0366710
1926 Ga0495674_0010576
1927 Ga0495674_0017131
1928 Ga0495674_0033805
1929 Ga0495674_0061051
1930 Ga0495674_0555985
1931 Ga0495676_0042894
1932 Ga0495676_0132622
1933 Ga0495676_0272713
1934 Ga0495680_0002523
1935 Ga0495680_0006821
1936 Ga0495680_0027186
1937 Ga0495680_0037048
1938 Ga0495680_0037795
1939 Ga0495680_0039673
1940 Ga0495680_0450118
1941 Ga0495675_0000731
1942 Ga0495675_0008665
1943 Ga0495675_0021234
1944 Ga0495675_0162683
1945 Ga0495677_0054128
1946 Ga0495684_0009500
1947 Ga0495684_0010490
1948 Ga0495684_0190316
1949 Ga0495593_0021876
1950 Ga0495593_0032629
1951 Ga0495593_0098042
1952 Ga0495602_0001314
1953 Ga0495602_0015855
1954 Ga0495602_0228318
1955 Ga0495602_0644417
1956 Ga0495614_0056720
1957 Ga0496100_0000894
1958 Ga0496100_0051780
1959 Ga0496100_0056803
1960 Ga0496101_0008463
1961 Ga0496101_0017913
1962 Ga0496101_0043614
1963 Ga0496101_0080643
1964 Ga0496101_0723507
1965 Ga0496101_1020323
1966 Ga0496101_1615351
1967 Ga0496102_0017100
1968 Ga0496102_0098605
1969 Ga0496102_0131897
1970 Ga0496103_0014513
1971 Ga0496103_0031284
1972 Ga0496103_0031726
1973 Ga0496103_0107695
1974 Ga0496104_0000061
1975 Ga0496104_0010521
1976 Ga0496104_0028757
1977 Ga0496104_0180633
1978 Ga0496105_0000365
1979 Ga0496105_0002920
1980 Ga0496105_0042986
1981 Ga0496105_0061594
1982 Ga0496106_0012105
1983 Ga0496106_0043121
1984 Ga0496106_0084133
1985 Ga0496106_0227779
1986 Ga0496106_0988095
1987 Ga0496107_0045843
1988 Ga0496107_0052267
1989 Ga0496107_0222105
1990 Ga0496107_0347702
1991 Ga0496107_0493370
1992 Ga0496108_0033735
1993 Ga0496108_0051476
1994 Ga0496108_0073073
1995 Ga0496108_0124609
1996 Ga0496108_0176488
1997 Ga0496109_0009059
1998 Ga0496109_0030539
1999 Ga0496109_0041283
2000 Ga0496109_0046125
2001 Ga0496109_0354784
2002 Ga0496110_0004230
2003 Ga0496110_0041642
2004 Ga0496110_0049100
2005 Ga0496110_0330286
2006 Ga0496111_0026546
2007 Ga0496111_0036602
2008 Ga0496111_0058838
2009 Ga0496111_0749418
2010 Ga0496112_0043963
2011 Ga0496112_0060837
2012 Ga0496112_0067713
2013 Ga0496112_0523281
2014 Ga0496112_0552516
2015 Ga0496113_0011409
2016 Ga0496113_0035424
2017 Ga0496113_0088091
2018 Ga0496113_0336066
2019 Ga0496113_0563437
2020 Ga0496114_0067528
2021 Ga0496114_0105965
2022 Ga0496114_0111012
2023 Ga0496114_0426066
2024 Ga0496115_0013508
2025 Ga0496115_0070030
2026 Ga0496115_0080712
2027 Ga0496115_0225835
2028 Ga0496117_0082112
2029 Ga0496126_0255518
2030 Ga0501031_0003092
2031 Ga0501032_0040473
2032 Ga0501032_0114003
2033 Ga0501032_0200808
2034 Ga0501034_0000319
2035 Ga0501034_0034953
2036 Ga0501034_0098231
2037 Ga0501034_0100449
2038 Ga0501034_0131062
2039 Ga0501034_0986100
2040 Ga0501036_0032290
2041 Ga0501036_0107597
2042 Ga0501037_0016416
2043 Ga0501037_0024154
2044 Ga0501038_0038170
2045 Ga0501038_0072363
2046 Ga0501038_0078514
2047 Ga0501039_0011266
2048 Ga0501039_0087087
2049 Ga0501043_0430364
2050 Ga0501043_0542870
2051 Ga0501043_1278373
2052 Ga0501046_0351594
2053 Ga0501047_0014222
2054 Ga0501047_0015912
2055 Ga0501047_0177639
2056 Ga0501047_0869609
2057 Ga0501048_0388011
2058 Ga0501067_0733343
2059 Ga0501068_0051234
2060 Ga0501068_0352365
2061 Ga0501068_0724864
2062 Ga0501069_0005809
2063 Ga0501069_0304209
2064 Ga0501069_1000148
2065 Ga0501070_0006119
2066 Ga0501070_0031535
2067 Ga0501070_0129327
2068 Ga0501070_0154649
2069 Ga0501070_0157268
2070 Ga0501071_0185755
2071 Ga0501071_0354516
2072 Ga0501072_0141766
2073 Ga0501072_0250417
2074 Ga0501072_0302617
2075 Ga0501072_0440660
2076 Ga0501073_0125088
2077 Ga0501073_0465500
2078 Ga0501073_0583372
2079 Ga0501074_0050037
2080 Ga0501074_0119253
2081 Ga0501074_0185649
2082 Ga0501077_0056351
2083 Ga0501079_0210125
2084 Ga0501080_0101172
2085 Ga0501080_0219478
2086 Ga0501080_0609936
2087 Ga0501080_1375413
2088 Ga0501083_0028527
2089 Ga0501083_0152007
2090 Ga0501083_0273462
2091 Ga0501035_0001800
2092 Ga0501035_0029127
2093 Ga0501035_0235247
2094 Ga0501035_0371930
2095 Ga0501044_0320652
2096 Ga0501044_0483764
2097 Ga0501044_0537985
2098 Ga0501044_0917441
2099 nmdc:mga03683_631823_c1
2100 nmdc:mga03n38_217424_c1
2101 nmdc:mga03n38_74518_c1
2102 nmdc:mga00v17_848946_c1
2103 nmdc:mga0yw44_1034339_c1
2104 nmdc:mga0yw44_344087_c1
2105 nmdc:mga06z11_36082_c1
2106 nmdc:mga04h51_210116_c1
2107 nmdc:mga07m45_138606_c1
2108 nmdc:mga07m45_93737_c1
2109 nmdc:mga05p37_1242_c1
2110 nmdc:mga05p37_7606_c1
2111 nmdc:mga09592_480_c1
2112 nmdc:mga0qj67_514_c1
2113 nmdc:mga06r32_1472165_c1
2114 nmdc:mga06r32_19785_c1
2115 nmdc:mga06r32_633464_c1
2116 nmdc:mga08y16_1532_c1
2117 nmdc:mga08y16_2506_c1
2118 nmdc:mga08y16_313418_c1
2119 nmdc:mga0n895_1152_c1
2120 nmdc:mga0n895_1592656_c1
2121 nmdc:mga0n895_2804_c1
2122 nmdc:mga0n895_353560_c1
2123 nmdc:mga0n895_377944_c1
2124 nmdc:mga0n895_58640_c1
2125 nmdc:mga0rr50_317889_c1
2126 nmdc:mga0rr50_43930_c1
2127 nmdc:mga0rr50_609103_c1
2128 nmdc:mga0rr50_77620_c1
2129 nmdc:mga08x19_115137_c1
2130 nmdc:mga08x19_164205_c1
2131 nmdc:mga08x19_551906_c1
2132 nmdc:mga08x19_758606_c1
2133 nmdc:mga08x19_815033_c1
2134 nmdc:mga08x19_850206_c1
2135 nmdc:mga0a205_10123_c1
2136 nmdc:mga0a205_1257_c1
2137 nmdc:mga0a205_19977_c1
2138 Ga0495601_0000095
2139 Ga0495601_0000316
2140 Ga0495601_0006189
2141 Ga0495601_0015389
2142 Ga0495601_0041044
2143 Ga0495601_0060341
2144 Ga0495612_0000812
2145 Ga0495612_0002682
2146 Ga0495612_0003848
2147 Ga0495612_0011752
2148 Ga0495612_0018121
2149 Ga0495612_0113492
2150 Ga0495612_0126893
2151 Ga0495612_0342705
2152 Ga0495595_0000261
2153 Ga0495595_0002995
2154 Ga0495595_0005688
2155 Ga0495595_0016442
2156 Ga0495595_0089650
2157 Ga0495595_0313707
2158 Ga0495595_0749205
2159 Ga0495619_0000056
2160 Ga0495619_0000498
2161 Ga0495619_0003320
2162 Ga0495619_0006134
2163 Ga0495619_0076645
2164 Ga0495619_0204791
2165 Ga0495619_0816050
2166 Ga0495619_0847812
2167 Ga0500566_0414660
2168 Ga0500650_0188568
2169 Ga0501084_0112385
2170 Ga0501082_0116952
2171 Ga0501082_0312747
2172 Ga0501082_0415173
2173 Ga0501082_0735425
2174 Ga0466962_0092014

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

25

106

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j2l-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.9625 5 91
6j22-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.9623 5 91
6j22-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.945 5 91
6j2l-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9366 5 91
2a7w-assembly1.cif.gz_A crystal structure of phosphoribosyl-atp pyrophosphatase from chromobacterium violaceum (atcc 12472). nesg target cvr7 0.9235 4 92
ID Description Score Start End Superfamily
af_P06989_113_203_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9517 5 92 1.10.287.1080
af_Q2FUU3_358_449_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9367 5 92 1.10.287.1080
af_P06989_113_203_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.912 5 92 1.10.287.1080
af_P9WMM9_1_93_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9046 5 87 1.10.287.1080
3c90A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9042 5 87 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A2E5L437-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9764 1 92 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A523FMD8-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.9757 3 85 GO:0000105
GO:0004636
GO:0005524
AF-A0A2A5IJP4-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.9743 5 76 GO:0000105
GO:0004636
GO:0005524
AF-A0A7J7IQH8-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.9713 3 92 GO:0000105
GO:0004636
GO:0005524
GO:0008685
GO:0016114
AF-A0A061QKU7-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.971 3 92 GO:0000105
GO:0004636
GO:0005524
GO:0005737

Map