F489797
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1087 | 438 | 2174 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100351705|Ga0070679_1003517052 |
| Length | 140 |
| Sequence | MRVVMHALTGFVRGSGILGFMTDSVARLYDAVIAARGADPAKSRTARLLRAGKLAEEAVEVVNDAMHGQPEAVVRESADLLYNLVVLWVHAGVHPEDVWSEMRRRELMFGIAEKVPKDLVQGGSRRKVVALETRRIRKRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 16 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 17 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 21 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 93 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 99 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 128 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 217 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 222 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 228 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 230 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 235 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 236 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 237 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 238 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 240 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 241 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 243 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 244 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 246 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 261 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 268 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 272 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 276 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 278 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 279 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 280 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 281 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 282 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 284 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 285 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 286 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 287 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 288 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 289 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 290 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 291 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 292 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 293 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 294 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 295 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 296 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 299 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 300 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 301 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 302 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 303 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 304 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 305 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 374 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 375 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 376 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 377 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 378 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 379 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 382 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 383 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 384 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 385 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 386 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 387 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 388 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 415 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 416 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 418 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 419 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 420 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 421 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 435 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 436 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.93 |
| Nodule | 0 |
| Rhizoplane | 6.62 |
| Rhizosphere | 90.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070679_100351705 | 3300005530 | Bacteria | 1421 |
| 2 | JGI24741J21665_1011317 | 3300001915 | Bacteria | 1563 |
| 3 | JGI24752J21851_1004034 | 3300001976 | Bacteria | 1928 |
| 4 | JGI24746J21847_1003951 | 3300001977 | Bacteria | 2343 |
| 5 | JGI24739J22299_10004113 | 3300001989 | Bacteria | 5564 |
| 6 | JGI24739J22299_10068188 | 3300001989 | Bacteria | 1111 |
| 7 | JGI24737J22298_10001610 | 3300001990 | Bacteria | 8031 |
| 8 | JGI24743J22301_10004729 | 3300001991 | Bacteria | 2236 |
| 9 | JGI24735J21928_10044950 | 3300002067 | Bacteria | 1283 |
| 10 | JGI24750J21931_1000047 | 3300002070 | Bacteria | 16414 |
| 11 | JGI24745J21846_1001071 | 3300002073 | Bacteria | 2585 |
| 12 | JGI24748J21848_1005915 | 3300002074 | Bacteria | 1425 |
| 13 | JGI24738J21930_10011556 | 3300002075 | Bacteria | 1939 |
| 14 | JGI24749J21850_1006539 | 3300002076 | Bacteria | 1624 |
| 15 | JGI24749J21850_1008897 | 3300002076 | Bacteria | 1401 |
| 16 | JGI24744J21845_10002333 | 3300002077 | Bacteria | 3872 |
| 17 | JGI24035J26624_1000692 | 3300002126 | Bacteria | 3128 |
| 18 | JGI24033J26618_1000780 | 3300002155 | Bacteria | 3033 |
| 19 | JGI24034J26672_10001282 | 3300002239 | Bacteria | 3307 |
| 20 | JGI24742J22300_10000108 | 3300002244 | Bacteria | 11825 |
| 21 | JGI24751J29686_10015732 | 3300002459 | Bacteria | 1560 |
| 22 | JGI26145J50221_1002138 | 3300003371 | Bacteria | 1553 |
| 23 | JGI25405J52794_10005075 | 3300003911 | Bacteria | 2363 |
| 24 | Ga0065715_10000365 | 3300005293 | Bacteria | 15182 |
| 25 | Ga0065715_10000449 | 3300005293 | Bacteria | 15495 |
| 26 | Ga0070658_10077465 | 3300005327 | Bacteria | 2727 |
| 27 | Ga0070658_10134776 | 3300005327 | Bacteria | 2059 |
| 28 | Ga0070658_10293425 | 3300005327 | Bacteria | 1386 |
| 29 | Ga0070676_10005804 | 3300005328 | Bacteria | 6581 |
| 30 | Ga0070683_100027713 | 3300005329 | Bacteria | 5112 |
| 31 | Ga0070683_100275485 | 3300005329 | Bacteria | 1601 |
| 32 | Ga0070683_100408101 | 3300005329 | Bacteria | 1296 |
| 33 | Ga0070690_100003335 | 3300005330 | Bacteria | 8755 |
| 34 | Ga0070690_100013679 | 3300005330 | Bacteria | 4802 |
| 35 | Ga0070690_100093275 | 3300005330 | Bacteria | 1986 |
| 36 | Ga0070670_100019704 | 3300005331 | Bacteria | 5792 |
| 37 | Ga0070670_100020956 | 3300005331 | Bacteria | 5621 |
| 38 | Ga0070677_10000823 | 3300005333 | Bacteria | 10187 |
| 39 | Ga0068869_100004243 | 3300005334 | Bacteria | 8893 |
| 40 | Ga0068869_100189633 | 3300005334 | Bacteria | 1616 |
| 41 | Ga0070666_10004766 | 3300005335 | Bacteria | 8287 |
| 42 | Ga0070680_100007952 | 3300005336 | Bacteria | 8093 |
| 43 | Ga0070680_100011474 | 3300005336 | Bacteria | 6855 |
| 44 | Ga0070680_100111122 | 3300005336 | Bacteria | 2281 |
| 45 | Ga0070680_100221240 | 3300005336 | Bacteria | 1598 |
| 46 | Ga0070680_100417469 | 3300005336 | Bacteria | 1144 |
| 47 | Ga0070680_100515319 | 3300005336 | Bacteria | 1024 |
| 48 | Ga0070680_101149991 | 3300005336 | Unclassified | 671 |
| 49 | Ga0070682_100031542 | 3300005337 | Bacteria | 3205 |
| 50 | Ga0068868_100007863 | 3300005338 | Bacteria | 7612 |
| 51 | Ga0068868_100117520 | 3300005338 | Bacteria | 2166 |
| 52 | Ga0068868_101049558 | 3300005338 | Bacteria | 748 |
| 53 | Ga0068868_101727891 | 3300005338 | Unclassified | 590 |
| 54 | Ga0070660_100000419 | 3300005339 | Bacteria | 28331 |
| 55 | Ga0070689_100000784 | 3300005340 | Bacteria | 19512 |
| 56 | Ga0070689_100345386 | 3300005340 | Bacteria | 1247 |
| 57 | Ga0070691_10006949 | 3300005341 | Bacteria | 5182 |
| 58 | Ga0070691_10044077 | 3300005341 | Bacteria | 2115 |
| 59 | Ga0070691_10053380 | 3300005341 | Bacteria | 1934 |
| 60 | Ga0070691_10192924 | 3300005341 | Bacteria | 1066 |
| 61 | Ga0070691_10219092 | 3300005341 | Bacteria | 1008 |
| 62 | Ga0070687_100004162 | 3300005343 | Bacteria | 5729 |
| 63 | Ga0070687_100084021 | 3300005343 | Bacteria | 1744 |
| 64 | Ga0070687_100164990 | 3300005343 | Bacteria | 1313 |
| 65 | Ga0070661_100005802 | 3300005344 | Bacteria | 8492 |
| 66 | Ga0070661_100548180 | 3300005344 | Unclassified | 930 |
| 67 | Ga0070692_10000927 | 3300005345 | Bacteria | 9932 |
| 68 | Ga0070668_100016262 | 3300005347 | Bacteria | 5565 |
| 69 | Ga0070668_100772738 | 3300005347 | Unclassified | 852 |
| 70 | Ga0070669_100010373 | 3300005353 | Bacteria | 6616 |
| 71 | Ga0070675_100019626 | 3300005354 | Bacteria | 5387 |
| 72 | Ga0070675_100050814 | 3300005354 | Bacteria | 3405 |
| 73 | Ga0070675_100585896 | 3300005354 | Unclassified | 1011 |
| 74 | Ga0070671_100340998 | 3300005355 | Bacteria | 1278 |
| 75 | Ga0070671_100482294 | 3300005355 | Bacteria | 1065 |
| 76 | Ga0070674_100004604 | 3300005356 | Bacteria | 7881 |
| 77 | Ga0070674_100150354 | 3300005356 | Unclassified | 1757 |
| 78 | Ga0070674_100497457 | 3300005356 | Bacteria | 1015 |
| 79 | Ga0070673_100010441 | 3300005364 | Bacteria | 6287 |
| 80 | Ga0070673_100013492 | 3300005364 | Bacteria | 5656 |
| 81 | Ga0070673_100077593 | 3300005364 | Unclassified | 2685 |
| 82 | Ga0070688_100000956 | 3300005365 | Bacteria | 14425 |
| 83 | Ga0070688_100010878 | 3300005365 | Bacteria | 5035 |
| 84 | Ga0070659_100023866 | 3300005366 | Bacteria | 4684 |
| 85 | Ga0070659_100063256 | 3300005366 | Bacteria | 2927 |
| 86 | Ga0070659_101006776 | 3300005366 | Bacteria | 732 |
| 87 | Ga0070667_100003581 | 3300005367 | Bacteria | 13221 |
| 88 | Ga0070667_100141277 | 3300005367 | Bacteria | 2109 |
| 89 | Ga0070667_100291441 | 3300005367 | Bacteria | 1468 |
| 90 | Ga0070703_10002961 | 3300005406 | Bacteria | 4852 |
| 91 | Ga0070709_10000959 | 3300005434 | Bacteria | 16036 |
| 92 | Ga0070709_10070122 | 3300005434 | Bacteria | 2259 |
| 93 | Ga0070709_10181050 | 3300005434 | Bacteria | 1480 |
| 94 | Ga0070709_10259764 | 3300005434 | Bacteria | 1254 |
| 95 | Ga0070714_100082526 | 3300005435 | Bacteria | 2801 |
| 96 | Ga0070714_100190392 | 3300005435 | Bacteria | 1872 |
| 97 | Ga0070714_100543241 | 3300005435 | Bacteria | 1112 |
| 98 | Ga0070713_100010662 | 3300005436 | Bacteria | 6652 |
| 99 | Ga0070713_100013123 | 3300005436 | Bacteria | 6106 |
| 100 | Ga0070713_100022631 | 3300005436 | Bacteria | 4859 |
| 101 | Ga0070713_100713209 | 3300005436 | Bacteria | 958 |
| 102 | Ga0070710_10002603 | 3300005437 | Bacteria | 8574 |
| 103 | Ga0070710_10008826 | 3300005437 | Bacteria | 4918 |
| 104 | Ga0070710_10359419 | 3300005437 | Bacteria | 966 |
| 105 | Ga0070710_10600219 | 3300005437 | Bacteria | 766 |
| 106 | Ga0070701_10001072 | 3300005438 | Bacteria | 10001 |
| 107 | Ga0070711_100009109 | 3300005439 | Bacteria | 6101 |
| 108 | Ga0070711_100360114 | 3300005439 | Bacteria | 1171 |
| 109 | Ga0070711_100587830 | 3300005439 | Bacteria | 927 |
| 110 | Ga0070705_100004361 | 3300005440 | Bacteria | 6887 |
| 111 | Ga0070705_100115495 | 3300005440 | Unclassified | 1723 |
| 112 | Ga0070700_100005661 | 3300005441 | Bacteria | 6629 |
| 113 | Ga0070694_100003415 | 3300005444 | Bacteria | 9518 |
| 114 | Ga0070694_101115998 | 3300005444 | Bacteria | 658 |
| 115 | Ga0070708_100395300 | 3300005445 | Bacteria | 1303 |
| 116 | Ga0070663_100015502 | 3300005455 | Bacteria | 4923 |
| 117 | Ga0070663_100022520 | 3300005455 | Bacteria | 4214 |
| 118 | Ga0070663_100028982 | 3300005455 | Bacteria | 3776 |
| 119 | Ga0070663_100030908 | 3300005455 | Bacteria | 3674 |
| 120 | Ga0070678_100010190 | 3300005456 | Bacteria | 5729 |
| 121 | Ga0070678_100011179 | 3300005456 | Bacteria | 5526 |
| 122 | Ga0070678_100101916 | 3300005456 | Bacteria | 2226 |
| 123 | Ga0070662_100023224 | 3300005457 | Bacteria | 4258 |
| 124 | Ga0070662_100107164 | 3300005457 | Bacteria | 2124 |
| 125 | Ga0070662_100900873 | 3300005457 | Bacteria | 755 |
| 126 | Ga0070681_10001622 | 3300005458 | Bacteria | 20041 |
| 127 | Ga0070681_10016579 | 3300005458 | Bacteria | 7356 |
| 128 | Ga0070681_10062985 | 3300005458 | Bacteria | 3681 |
| 129 | Ga0070681_10499329 | 3300005458 | Bacteria | 1130 |
| 130 | Ga0070681_10650651 | 3300005458 | Bacteria | 969 |
| 131 | Ga0070681_11516973 | 3300005458 | Unclassified | 595 |
| 132 | Ga0070681_11651251 | 3300005458 | Unclassified | 567 |
| 133 | Ga0068867_100018127 | 3300005459 | Bacteria | 5002 |
| 134 | Ga0068867_100569322 | 3300005459 | Bacteria | 984 |
| 135 | Ga0068867_100671701 | 3300005459 | Bacteria | 911 |
| 136 | Ga0070685_10006135 | 3300005466 | Bacteria | 6119 |
| 137 | Ga0070685_10008365 | 3300005466 | Bacteria | 5312 |
| 138 | Ga0070685_10140704 | 3300005466 | Bacteria | 1519 |
| 139 | Ga0070707_100229177 | 3300005468 | Unclassified | 1809 |
| 140 | Ga0070707_100902897 | 3300005468 | Unclassified | 848 |
| 141 | Ga0070699_100182991 | 3300005518 | Bacteria | 1860 |
| 142 | Ga0070679_100018168 | 3300005530 | Bacteria | 6818 |
| 143 | Ga0070679_100074050 | 3300005530 | Bacteria | 3396 |
| 144 | Ga0070679_100103127 | 3300005530 | Bacteria | 2839 |
| 145 | Ga0070679_100497050 | 3300005530 | Bacteria | 1164 |
| 146 | Ga0070679_100539612 | 3300005530 | Bacteria | 1110 |
| 147 | Ga0070679_100763948 | 3300005530 | Bacteria | 909 |
| 148 | Ga0070679_101311459 | 3300005530 | Bacteria | 670 |
| 149 | Ga0070679_101821276 | 3300005530 | Unclassified | 557 |
| 150 | Ga0070684_100007664 | 3300005535 | Bacteria | 8417 |
| 151 | Ga0070684_100136515 | 3300005535 | Bacteria | 2216 |
| 152 | Ga0070697_101028174 | 3300005536 | Bacteria | 733 |
| 153 | Ga0068853_100009267 | 3300005539 | Bacteria | 7938 |
| 154 | Ga0068853_100714236 | 3300005539 | Bacteria | 957 |
| 155 | Ga0070686_100003330 | 3300005544 | Bacteria | 8806 |
| 156 | Ga0070686_100009318 | 3300005544 | Bacteria | 5514 |
| 157 | Ga0070686_100061657 | 3300005544 | Bacteria | 2424 |
| 158 | Ga0070695_100007284 | 3300005545 | Bacteria | 6559 |
| 159 | Ga0070695_100062036 | 3300005545 | Bacteria | 2427 |
| 160 | Ga0070696_100009140 | 3300005546 | Bacteria | 6635 |
| 161 | Ga0070696_100028902 | 3300005546 | Bacteria | 3785 |
| 162 | Ga0070693_100009938 | 3300005547 | Bacteria | 4751 |
| 163 | Ga0070665_100122566 | 3300005548 | Bacteria | 2601 |
| 164 | Ga0070704_100000799 | 3300005549 | Bacteria | 15589 |
| 165 | Ga0070704_100029063 | 3300005549 | Bacteria | 3685 |
| 166 | Ga0068855_100231552 | 3300005563 | Bacteria | 2068 |
| 167 | Ga0068855_100713392 | 3300005563 | Bacteria | 1072 |
| 168 | Ga0068855_100762992 | 3300005563 | Bacteria | 1030 |
| 169 | Ga0068855_101035280 | 3300005563 | Bacteria | 861 |
| 170 | Ga0070664_100061274 | 3300005564 | Bacteria | 3206 |
| 171 | Ga0070664_100150393 | 3300005564 | Bacteria | 2055 |
| 172 | Ga0070664_100190826 | 3300005564 | Bacteria | 1825 |
| 173 | Ga0070664_100502627 | 3300005564 | Bacteria | 1117 |
| 174 | Ga0070664_100562882 | 3300005564 | Bacteria | 1055 |
| 175 | Ga0068854_100000702 | 3300005578 | Bacteria | 19795 |
| 176 | Ga0068854_100134727 | 3300005578 | Bacteria | 1890 |
| 177 | Ga0068856_100053436 | 3300005614 | Bacteria | 3982 |
| 178 | Ga0068856_101177549 | 3300005614 | Bacteria | 783 |
| 179 | Ga0068856_101189361 | 3300005614 | Bacteria | 779 |
| 180 | Ga0070702_100004763 | 3300005615 | Bacteria | 6233 |
| 181 | Ga0070702_100048350 | 3300005615 | Bacteria | 2421 |
| 182 | Ga0068852_100002168 | 3300005616 | Bacteria | 13456 |
| 183 | Ga0068852_100142940 | 3300005616 | Bacteria | 2216 |
| 184 | Ga0068859_100066290 | 3300005617 | Bacteria | 3646 |
| 185 | Ga0068859_100394915 | 3300005617 | Bacteria | 1479 |
| 186 | Ga0068866_10133151 | 3300005718 | Bacteria | 1417 |
| 187 | Ga0068861_100143197 | 3300005719 | Bacteria | 1953 |
| 188 | Ga0068863_100710284 | 3300005841 | Bacteria | 999 |
| 189 | Ga0068863_101494468 | 3300005841 | Bacteria | 684 |
| 190 | Ga0068863_101732598 | 3300005841 | Unclassified | 634 |
| 191 | Ga0068858_100000657 | 3300005842 | Bacteria | 36147 |
| 192 | Ga0068858_100177384 | 3300005842 | Bacteria | 2011 |
| 193 | Ga0068858_101258818 | 3300005842 | Bacteria | 728 |
| 194 | Ga0068860_100039959 | 3300005843 | Bacteria | 4485 |
| 195 | Ga0068860_100125999 | 3300005843 | Bacteria | 2455 |
| 196 | Ga0068860_100331967 | 3300005843 | Bacteria | 1494 |
| 197 | Ga0068862_100096723 | 3300005844 | Bacteria | 2577 |
| 198 | Ga0068862_100366129 | 3300005844 | Bacteria | 1341 |
| 199 | Ga0070717_10000720 | 3300006028 | Bacteria | 21477 |
| 200 | Ga0070717_10264413 | 3300006028 | Bacteria | 1523 |
| 201 | Ga0075365_10171872 | 3300006038 | Bacteria | 1513 |
| 202 | Ga0075368_10203879 | 3300006042 | Unclassified | 837 |
| 203 | Ga0075363_100131669 | 3300006048 | Bacteria | 1403 |
| 204 | Ga0075363_100752716 | 3300006048 | Bacteria | 590 |
| 205 | Ga0075364_10630249 | 3300006051 | Bacteria | 732 |
| 206 | Ga0075364_10822761 | 3300006051 | Bacteria | 633 |
| 207 | Ga0070715_10000434 | 3300006163 | Bacteria | 10705 |
| 208 | Ga0070716_100022246 | 3300006173 | Bacteria | 3348 |
| 209 | Ga0070712_100062335 | 3300006175 | Bacteria | 2636 |
| 210 | Ga0070712_100274528 | 3300006175 | Unclassified | 1356 |
| 211 | Ga0075362_10202996 | 3300006177 | Bacteria | 965 |
| 212 | Ga0075427_10000902 | 3300006194 | Bacteria | 3653 |
| 213 | Ga0097621_100000078 | 3300006237 | Bacteria | 50983 |
| 214 | Ga0097621_100013381 | 3300006237 | Bacteria | 6116 |
| 215 | Ga0097621_100025587 | 3300006237 | Bacteria | 4619 |
| 216 | Ga0075370_10100460 | 3300006353 | Bacteria | 1674 |
| 217 | Ga0068871_100049791 | 3300006358 | Bacteria | 3387 |
| 218 | Ga0068871_100108912 | 3300006358 | Bacteria | 2329 |
| 219 | Ga0075428_100001638 | 3300006844 | Bacteria | 23879 |
| 220 | Ga0075431_100001119 | 3300006847 | Bacteria | 24014 |
| 221 | Ga0075431_100504567 | 3300006847 | Bacteria | 1200 |
| 222 | Ga0075434_100003370 | 3300006871 | Bacteria | 14305 |
| 223 | Ga0075434_100043579 | 3300006871 | Bacteria | 4450 |
| 224 | Ga0075434_100265934 | 3300006871 | Bacteria | 1734 |
| 225 | Ga0075434_100353360 | 3300006871 | Unclassified | 1491 |
| 226 | Ga0075434_100596772 | 3300006871 | Bacteria | 1123 |
| 227 | Ga0075429_100002649 | 3300006880 | Bacteria | 15053 |
| 228 | Ga0068865_100000155 | 3300006881 | Bacteria | 37357 |
| 229 | Ga0068865_100060317 | 3300006881 | Bacteria | 2656 |
| 230 | Ga0075436_100012844 | 3300006914 | Bacteria | 5741 |
| 231 | Ga0075436_100040929 | 3300006914 | Bacteria | 3197 |
| 232 | Ga0075436_101117334 | 3300006914 | Bacteria | 593 |
| 233 | Ga0097620_100066295 | 3300006931 | Bacteria | 3646 |
| 234 | Ga0097620_100394916 | 3300006931 | Bacteria | 1479 |
| 235 | Ga0075435_100000970 | 3300007076 | Bacteria | 18126 |
| 236 | Ga0075435_100008956 | 3300007076 | Bacteria | 7216 |
| 237 | Ga0075435_100015334 | 3300007076 | Bacteria | 5758 |
| 238 | Ga0105251_10058512 | 3300009011 | Bacteria | 1820 |
| 239 | Ga0105251_10161613 | 3300009011 | Bacteria | 1010 |
| 240 | Ga0105250_10036768 | 3300009092 | Bacteria | 1965 |
| 241 | Ga0105240_10084806 | 3300009093 | Bacteria | 3883 |
| 242 | Ga0105240_10154758 | 3300009093 | Bacteria | 2728 |
| 243 | Ga0105240_10349069 | 3300009093 | Bacteria | 1679 |
| 244 | Ga0105240_10996763 | 3300009093 | Bacteria | 896 |
| 245 | Ga0105240_11521840 | 3300009093 | Bacteria | 701 |
| 246 | Ga0111539_10010049 | 3300009094 | Bacteria | 11929 |
| 247 | Ga0111539_10161211 | 3300009094 | Bacteria | 2623 |
| 248 | Ga0111539_10383332 | 3300009094 | Bacteria | 1637 |
| 249 | Ga0111539_11035230 | 3300009094 | Unclassified | 954 |
| 250 | Ga0111539_11723268 | 3300009094 | Bacteria | 727 |
| 251 | Ga0105245_10005766 | 3300009098 | Bacteria | 10865 |
| 252 | Ga0105245_10030396 | 3300009098 | Bacteria | 4776 |
| 253 | Ga0105245_10045065 | 3300009098 | Bacteria | 3937 |
| 254 | Ga0105245_11957796 | 3300009098 | Bacteria | 639 |
| 255 | Ga0105247_10002157 | 3300009101 | Bacteria | 13579 |
| 256 | Ga0105247_10018587 | 3300009101 | Bacteria | 4171 |
| 257 | Ga0105247_10019956 | 3300009101 | Bacteria | 4026 |
| 258 | Ga0105247_10119319 | 3300009101 | Bacteria | 1707 |
| 259 | Ga0114129_10006926 | 3300009147 | Bacteria | 16126 |
| 260 | Ga0114129_10022324 | 3300009147 | Bacteria | 8983 |
| 261 | Ga0105243_10007171 | 3300009148 | Bacteria | 8571 |
| 262 | Ga0105243_10043547 | 3300009148 | Bacteria | 3518 |
| 263 | Ga0105243_10050124 | 3300009148 | Bacteria | 3297 |
| 264 | Ga0105241_10008937 | 3300009174 | Bacteria | 7368 |
| 265 | Ga0105241_10130906 | 3300009174 | Unclassified | 2031 |
| 266 | Ga0105241_10652218 | 3300009174 | Bacteria | 956 |
| 267 | Ga0105241_11260244 | 3300009174 | Unclassified | 702 |
| 268 | Ga0105242_10004516 | 3300009176 | Bacteria | 10807 |
| 269 | Ga0105242_10008202 | 3300009176 | Bacteria | 8025 |
| 270 | Ga0105242_10369258 | 3300009176 | Bacteria | 1330 |
| 271 | Ga0105248_10004213 | 3300009177 | Bacteria | 15908 |
| 272 | Ga0105248_10014034 | 3300009177 | Bacteria | 8815 |
| 273 | Ga0105248_10050815 | 3300009177 | Bacteria | 4651 |
| 274 | Ga0105237_10012499 | 3300009545 | Bacteria | 8944 |
| 275 | Ga0105237_10141573 | 3300009545 | Bacteria | 2399 |
| 276 | Ga0105237_10152802 | 3300009545 | Bacteria | 2305 |
| 277 | Ga0105238_10277489 | 3300009551 | Bacteria | 1657 |
| 278 | Ga0105238_10703760 | 3300009551 | Bacteria | 1022 |
| 279 | Ga0105238_10917172 | 3300009551 | Bacteria | 895 |
| 280 | Ga0105238_11002414 | 3300009551 | Bacteria | 856 |
| 281 | Ga0105238_13029066 | 3300009551 | Bacteria | 504 |
| 282 | Ga0105249_10031751 | 3300009553 | Bacteria | 4778 |
| 283 | Ga0105249_10512897 | 3300009553 | Bacteria | 1245 |
| 284 | Ga0105239_10062241 | 3300010375 | Bacteria | 4096 |
| 285 | Ga0105239_10071125 | 3300010375 | Bacteria | 3822 |
| 286 | Ga0105239_10324428 | 3300010375 | Bacteria | 1737 |
| 287 | Ga0105246_10016930 | 3300011119 | Bacteria | 4627 |
| 288 | Ga0105246_10053493 | 3300011119 | Bacteria | 2778 |
| 289 | Ga0105246_10068024 | 3300011119 | Bacteria | 2497 |
| 290 | Ga0105246_10115022 | 3300011119 | Bacteria | 1983 |
| 291 | Ga0157337_1001327 | 3300012483 | Bacteria | 1260 |
| 292 | Ga0157322_1019911 | 3300012490 | Unclassified | 638 |
| 293 | Ga0157373_10040872 | 3300013100 | Bacteria | 3318 |
| 294 | Ga0157373_10209706 | 3300013100 | Bacteria | 1374 |
| 295 | Ga0157373_10258185 | 3300013100 | Bacteria | 1233 |
| 296 | Ga0157373_10682808 | 3300013100 | Bacteria | 751 |
| 297 | Ga0157371_10004410 | 3300013102 | Bacteria | 12300 |
| 298 | Ga0157371_10056650 | 3300013102 | Bacteria | 2780 |
| 299 | Ga0157371_11184194 | 3300013102 | Bacteria | 588 |
| 300 | Ga0157370_10031648 | 3300013104 | Bacteria | 5173 |
| 301 | Ga0157370_10480050 | 3300013104 | Bacteria | 1142 |
| 302 | Ga0157370_10755511 | 3300013104 | Bacteria | 886 |
| 303 | Ga0157369_10086258 | 3300013105 | Bacteria | 3353 |
| 304 | Ga0157369_10508418 | 3300013105 | Bacteria | 1246 |
| 305 | Ga0157369_10825812 | 3300013105 | Bacteria | 952 |
| 306 | Ga0157369_11020478 | 3300013105 | Bacteria | 847 |
| 307 | Ga0157374_10035360 | 3300013296 | Bacteria | 4570 |
| 308 | Ga0157374_10182533 | 3300013296 | Bacteria | 2050 |
| 309 | Ga0157374_10201751 | 3300013296 | Bacteria | 1948 |
| 310 | Ga0157374_10316041 | 3300013296 | Bacteria | 1547 |
| 311 | Ga0157378_10004404 | 3300013297 | Bacteria | 12398 |
| 312 | Ga0157378_10053633 | 3300013297 | Bacteria | 3590 |
| 313 | Ga0157378_10155903 | 3300013297 | Bacteria | 2132 |
| 314 | Ga0157378_11187199 | 3300013297 | Bacteria | 802 |
| 315 | Ga0163162_10053663 | 3300013306 | Bacteria | 4052 |
| 316 | Ga0163162_10220284 | 3300013306 | Bacteria | 2027 |
| 317 | Ga0163162_11519017 | 3300013306 | Bacteria | 763 |
| 318 | Ga0157372_10012919 | 3300013307 | Bacteria | 8900 |
| 319 | Ga0157372_10068346 | 3300013307 | Bacteria | 3994 |
| 320 | Ga0157372_10319154 | 3300013307 | Bacteria | 1809 |
| 321 | Ga0157372_10758855 | 3300013307 | Bacteria | 1128 |
| 322 | Ga0157372_11351125 | 3300013307 | Bacteria | 822 |
| 323 | Ga0157372_11682640 | 3300013307 | Bacteria | 730 |
| 324 | Ga0157375_10023952 | 3300013308 | Bacteria | 5641 |
| 325 | Ga0157375_12381496 | 3300013308 | Bacteria | 632 |
| 326 | Ga0163163_10002553 | 3300014325 | Bacteria | 15424 |
| 327 | Ga0163163_10063209 | 3300014325 | Bacteria | 3670 |
| 328 | Ga0163163_10135570 | 3300014325 | Bacteria | 2503 |
| 329 | Ga0163163_10185607 | 3300014325 | Bacteria | 2127 |
| 330 | Ga0157380_10153380 | 3300014326 | Bacteria | 1994 |
| 331 | Ga0157380_10323259 | 3300014326 | Bacteria | 1431 |
| 332 | Ga0182008_10339428 | 3300014497 | Unclassified | 794 |
| 333 | Ga0157377_10011447 | 3300014745 | Bacteria | 4428 |
| 334 | Ga0157377_10071860 | 3300014745 | Unclassified | 2002 |
| 335 | Ga0157379_10000539 | 3300014968 | Bacteria | 30568 |
| 336 | Ga0157379_10011925 | 3300014968 | Bacteria | 7594 |
| 337 | Ga0157379_10041604 | 3300014968 | Bacteria | 4103 |
| 338 | Ga0157379_10254918 | 3300014968 | Bacteria | 1593 |
| 339 | Ga0157376_10035583 | 3300014969 | Bacteria | 4029 |
| 340 | Ga0157376_10429982 | 3300014969 | Bacteria | 1283 |
| 341 | Ga0157376_10896274 | 3300014969 | Bacteria | 905 |
| 342 | Ga0163161_10156427 | 3300017792 | Bacteria | 1736 |
| 343 | Ga0163161_10294116 | 3300017792 | Bacteria | 1277 |
| 344 | Ga0206356_11650372 | 3300020070 | Bacteria | 3311 |
| 345 | Ga0206354_11487445 | 3300020081 | Unclassified | 912 |
| 346 | Ga0213876_10069391 | 3300021384 | Bacteria | 1862 |
| 347 | Ga0213876_10121321 | 3300021384 | Bacteria | 1388 |
| 348 | Ga0207666_1000522 | 3300025271 | Bacteria | 4700 |
| 349 | Ga0207697_10004732 | 3300025315 | Bacteria | 6449 |
| 350 | Ga0207656_10438672 | 3300025321 | Unclassified | 659 |
| 351 | Ga0207653_10002374 | 3300025885 | Bacteria | 6005 |
| 352 | Ga0207692_10031568 | 3300025898 | Bacteria | 2538 |
| 353 | Ga0207692_10068011 | 3300025898 | Bacteria | 1866 |
| 354 | Ga0207692_10216566 | 3300025898 | Bacteria | 1133 |
| 355 | Ga0207692_11004208 | 3300025898 | Bacteria | 551 |
| 356 | Ga0207642_10083253 | 3300025899 | Bacteria | 1559 |
| 357 | Ga0207710_10524713 | 3300025900 | Bacteria | 616 |
| 358 | Ga0207688_10011771 | 3300025901 | Bacteria | 4759 |
| 359 | Ga0207680_10010419 | 3300025903 | Bacteria | 4649 |
| 360 | Ga0207680_10268720 | 3300025903 | Bacteria | 1182 |
| 361 | Ga0207647_10007623 | 3300025904 | Bacteria | 7799 |
| 362 | Ga0207685_10006002 | 3300025905 | Bacteria | 3266 |
| 363 | Ga0207699_10005253 | 3300025906 | Bacteria | 6198 |
| 364 | Ga0207699_10110016 | 3300025906 | Bacteria | 1764 |
| 365 | Ga0207705_10375929 | 3300025909 | Bacteria | 1097 |
| 366 | Ga0207705_10415933 | 3300025909 | Bacteria | 1040 |
| 367 | Ga0207705_11280599 | 3300025909 | Unclassified | 560 |
| 368 | Ga0207707_10028853 | 3300025912 | Bacteria | 4849 |
| 369 | Ga0207707_10066726 | 3300025912 | Bacteria | 3133 |
| 370 | Ga0207707_10253050 | 3300025912 | Bacteria | 1530 |
| 371 | Ga0207707_10393736 | 3300025912 | Bacteria | 1190 |
| 372 | Ga0207707_11652340 | 3300025912 | Unclassified | 503 |
| 373 | Ga0207695_10034276 | 3300025913 | Bacteria | 5524 |
| 374 | Ga0207695_10849137 | 3300025913 | Bacteria | 793 |
| 375 | Ga0207671_10513123 | 3300025914 | Bacteria | 956 |
| 376 | Ga0207693_10031101 | 3300025915 | Bacteria | 4217 |
| 377 | Ga0207693_10101956 | 3300025915 | Bacteria | 2251 |
| 378 | Ga0207693_10367682 | 3300025915 | Unclassified | 1125 |
| 379 | Ga0207693_11184597 | 3300025915 | Unclassified | 577 |
| 380 | Ga0207663_10083400 | 3300025916 | Bacteria | 2099 |
| 381 | Ga0207663_10105872 | 3300025916 | Bacteria | 1899 |
| 382 | Ga0207663_10172873 | 3300025916 | Bacteria | 1536 |
| 383 | Ga0207663_11069084 | 3300025916 | Unclassified | 648 |
| 384 | Ga0207660_10094332 | 3300025917 | Bacteria | 2224 |
| 385 | Ga0207660_10241643 | 3300025917 | Bacteria | 1423 |
| 386 | Ga0207660_10479820 | 3300025917 | Bacteria | 1007 |
| 387 | Ga0207660_10481916 | 3300025917 | Bacteria | 1005 |
| 388 | Ga0207660_11315965 | 3300025917 | Bacteria | 587 |
| 389 | Ga0207657_10722561 | 3300025919 | Unclassified | 773 |
| 390 | Ga0207657_10946503 | 3300025919 | Bacteria | 662 |
| 391 | Ga0207649_10183004 | 3300025920 | Bacteria | 1468 |
| 392 | Ga0207649_10443418 | 3300025920 | Unclassified | 978 |
| 393 | Ga0207652_10025519 | 3300025921 | Bacteria | 4915 |
| 394 | Ga0207652_10054252 | 3300025921 | Bacteria | 3445 |
| 395 | Ga0207652_10123726 | 3300025921 | Bacteria | 2303 |
| 396 | Ga0207652_10139752 | 3300025921 | Bacteria | 2165 |
| 397 | Ga0207646_10518065 | 3300025922 | Bacteria | 1074 |
| 398 | Ga0207694_10099036 | 3300025924 | Bacteria | 2309 |
| 399 | Ga0207694_10534586 | 3300025924 | Bacteria | 983 |
| 400 | Ga0207694_10740513 | 3300025924 | Bacteria | 829 |
| 401 | Ga0207694_11521679 | 3300025924 | Unclassified | 565 |
| 402 | Ga0207650_10045297 | 3300025925 | Bacteria | 3236 |
| 403 | Ga0207659_10011825 | 3300025926 | Bacteria | 5527 |
| 404 | Ga0207659_10521539 | 3300025926 | Unclassified | 1007 |
| 405 | Ga0207687_10033774 | 3300025927 | Bacteria | 3471 |
| 406 | Ga0207687_10962425 | 3300025927 | Bacteria | 732 |
| 407 | Ga0207687_11652759 | 3300025927 | Bacteria | 549 |
| 408 | Ga0207700_10003137 | 3300025928 | Bacteria | 9542 |
| 409 | Ga0207700_10011504 | 3300025928 | Bacteria | 5646 |
| 410 | Ga0207700_10122195 | 3300025928 | Bacteria | 2113 |
| 411 | Ga0207664_10233160 | 3300025929 | Bacteria | 1600 |
| 412 | Ga0207644_10006166 | 3300025931 | Bacteria | 7816 |
| 413 | Ga0207706_10010270 | 3300025933 | Bacteria | 8560 |
| 414 | Ga0207706_10020507 | 3300025933 | Bacteria | 5941 |
| 415 | Ga0207706_10037101 | 3300025933 | Bacteria | 4328 |
| 416 | Ga0207686_10047722 | 3300025934 | Bacteria | 2649 |
| 417 | Ga0207709_10005421 | 3300025935 | Bacteria | 7251 |
| 418 | Ga0207709_10024667 | 3300025935 | Bacteria | 3436 |
| 419 | Ga0207709_10086990 | 3300025935 | Bacteria | 2031 |
| 420 | Ga0207670_10057666 | 3300025936 | Bacteria | 2634 |
| 421 | Ga0207669_10405325 | 3300025937 | Bacteria | 1069 |
| 422 | Ga0207704_10012530 | 3300025938 | Bacteria | 4211 |
| 423 | Ga0207704_10361079 | 3300025938 | Bacteria | 1134 |
| 424 | Ga0207665_10001296 | 3300025939 | Bacteria | 16883 |
| 425 | Ga0207665_10135073 | 3300025939 | Bacteria | 1755 |
| 426 | Ga0207665_10234006 | 3300025939 | Bacteria | 1351 |
| 427 | Ga0207691_10022732 | 3300025940 | Bacteria | 5911 |
| 428 | Ga0207711_10022254 | 3300025941 | Bacteria | 5300 |
| 429 | Ga0207711_10035620 | 3300025941 | Bacteria | 4220 |
| 430 | Ga0207689_10000503 | 3300025942 | Bacteria | 36892 |
| 431 | Ga0207689_10597414 | 3300025942 | Bacteria | 928 |
| 432 | Ga0207661_10206126 | 3300025944 | Bacteria | 1731 |
| 433 | Ga0207661_10436359 | 3300025944 | Bacteria | 1191 |
| 434 | Ga0207661_11802428 | 3300025944 | Bacteria | 557 |
| 435 | Ga0207679_10110505 | 3300025945 | Bacteria | 2169 |
| 436 | Ga0207679_10216184 | 3300025945 | Bacteria | 1610 |
| 437 | Ga0207667_10005613 | 3300025949 | Bacteria | 15307 |
| 438 | Ga0207667_10054142 | 3300025949 | Bacteria | 4220 |
| 439 | Ga0207667_10500724 | 3300025949 | Bacteria | 1232 |
| 440 | Ga0207667_11061334 | 3300025949 | Bacteria | 795 |
| 441 | Ga0207667_12193796 | 3300025949 | Bacteria | 509 |
| 442 | Ga0207712_10005771 | 3300025961 | Bacteria | 7799 |
| 443 | Ga0207712_10020865 | 3300025961 | Bacteria | 4297 |
| 444 | Ga0207640_10105047 | 3300025981 | Bacteria | 1989 |
| 445 | Ga0207640_11078160 | 3300025981 | Unclassified | 710 |
| 446 | Ga0207658_10309801 | 3300025986 | Bacteria | 1363 |
| 447 | Ga0207658_10544610 | 3300025986 | Bacteria | 1038 |
| 448 | Ga0207677_10209966 | 3300026023 | Bacteria | 1554 |
| 449 | Ga0207677_10711149 | 3300026023 | Bacteria | 892 |
| 450 | Ga0207703_10025900 | 3300026035 | Bacteria | 4615 |
| 451 | Ga0207703_11092390 | 3300026035 | Bacteria | 766 |
| 452 | Ga0207703_11230866 | 3300026035 | Bacteria | 720 |
| 453 | Ga0207639_10141075 | 3300026041 | Bacteria | 2008 |
| 454 | Ga0207639_10380899 | 3300026041 | Bacteria | 1267 |
| 455 | Ga0207678_10045454 | 3300026067 | Bacteria | 3797 |
| 456 | Ga0207678_10050320 | 3300026067 | Bacteria | 3600 |
| 457 | Ga0207708_10075664 | 3300026075 | Unclassified | 2582 |
| 458 | Ga0207702_10136832 | 3300026078 | Bacteria | 2211 |
| 459 | Ga0207702_10147378 | 3300026078 | Bacteria | 2137 |
| 460 | Ga0207702_11000602 | 3300026078 | Bacteria | 829 |
| 461 | Ga0207702_11309932 | 3300026078 | Bacteria | 718 |
| 462 | Ga0207648_10143054 | 3300026089 | Bacteria | 2109 |
| 463 | Ga0207676_12056059 | 3300026095 | Bacteria | 570 |
| 464 | Ga0207683_10000069 | 3300026121 | Bacteria | 78741 |
| 465 | Ga0207683_10010482 | 3300026121 | Bacteria | 7907 |
| 466 | Ga0207683_12058167 | 3300026121 | Unclassified | 519 |
| 467 | Ga0207698_10104588 | 3300026142 | Bacteria | 2356 |
| 468 | Ga0207698_11877715 | 3300026142 | Bacteria | 614 |
| 469 | Ga0209968_1017344 | 3300027526 | Bacteria | 1148 |
| 470 | Ga0209999_1018733 | 3300027543 | Bacteria | 1268 |
| 471 | Ga0209971_1009614 | 3300027682 | Bacteria | 2291 |
| 472 | Ga0209966_1000576 | 3300027695 | Bacteria | 8921 |
| 473 | Ga0209998_10002030 | 3300027717 | Bacteria | 4745 |
| 474 | Ga0209998_10024511 | 3300027717 | Bacteria | 1309 |
| 475 | Ga0209813_10148679 | 3300027866 | Unclassified | 837 |
| 476 | Ga0209974_10030337 | 3300027876 | Bacteria | 1792 |
| 477 | Ga0207428_10000908 | 3300027907 | Bacteria | 33083 |
| 478 | Ga0207428_10187035 | 3300027907 | Bacteria | 1562 |
| 479 | Ga0268266_10023731 | 3300028379 | Bacteria | 5220 |
| 480 | Ga0268266_10300327 | 3300028379 | Bacteria | 1498 |
| 481 | Ga0268265_10120394 | 3300028380 | Bacteria | 2161 |
| 482 | Ga0268265_11636935 | 3300028380 | Bacteria | 649 |
| 483 | Ga0268264_10023011 | 3300028381 | Bacteria | 5084 |
| 484 | Ga0268264_10282408 | 3300028381 | Bacteria | 1556 |
| 485 | Ga0268264_10484029 | 3300028381 | Bacteria | 1204 |
| 486 | Ga0265337_1002835 | 3300028556 | Bacteria | 7749 |
| 487 | Ga0265326_10095687 | 3300028558 | Bacteria | 842 |
| 488 | Ga0265334_10098678 | 3300028573 | Bacteria | 1059 |
| 489 | Ga0265336_10021931 | 3300028666 | Bacteria | 2037 |
| 490 | Ga0265338_10050343 | 3300028800 | Bacteria | 3766 |
| 491 | Ga0265338_10091302 | 3300028800 | Bacteria | 2517 |
| 492 | Ga0265338_10668293 | 3300028800 | Bacteria | 719 |
| 493 | Ga0265332_10174674 | 3300031238 | Bacteria | 896 |
| 494 | Ga0265332_10273513 | 3300031238 | Bacteria | 698 |
| 495 | Ga0265325_10003859 | 3300031241 | Bacteria | 9628 |
| 496 | Ga0265325_10005573 | 3300031241 | Bacteria | 7766 |
| 497 | Ga0265325_10029752 | 3300031241 | Bacteria | 2933 |
| 498 | Ga0265329_10143255 | 3300031242 | Bacteria | 772 |
| 499 | Ga0265340_10014118 | 3300031247 | Bacteria | 4181 |
| 500 | Ga0265340_10056702 | 3300031247 | Bacteria | 1884 |
| 501 | Ga0265339_10004140 | 3300031249 | Bacteria | 9989 |
| 502 | Ga0265339_10074226 | 3300031249 | Bacteria | 1807 |
| 503 | Ga0265331_10082424 | 3300031250 | Bacteria | 1492 |
| 504 | Ga0265316_10114851 | 3300031344 | Bacteria | 2036 |
| 505 | Ga0265316_10816179 | 3300031344 | Bacteria | 654 |
| 506 | Ga0307408_100486467 | 3300031548 | Bacteria | 1078 |
| 507 | Ga0265313_10000176 | 3300031595 | Bacteria | 68037 |
| 508 | Ga0265313_10002253 | 3300031595 | Bacteria | 16951 |
| 509 | Ga0265313_10014273 | 3300031595 | Bacteria | 4705 |
| 510 | Ga0265313_10163158 | 3300031595 | Bacteria | 945 |
| 511 | Ga0265313_10215928 | 3300031595 | Bacteria | 792 |
| 512 | Ga0316579_10167313 | 3300031691 | Bacteria | 1062 |
| 513 | Ga0265314_10002100 | 3300031711 | Bacteria | 20973 |
| 514 | Ga0265342_10005459 | 3300031712 | Bacteria | 9682 |
| 515 | Ga0307405_10482444 | 3300031731 | Bacteria | 990 |
| 516 | Ga0307405_10797507 | 3300031731 | Bacteria | 791 |
| 517 | Ga0307410_10739151 | 3300031852 | Bacteria | 832 |
| 518 | Ga0326468_10089776 | 3300031889 | Bacteria | 547 |
| 519 | Ga0307406_10285833 | 3300031901 | Bacteria | 1260 |
| 520 | Ga0307409_100496611 | 3300031995 | Bacteria | 1187 |
| 521 | Ga0307409_101102091 | 3300031995 | Bacteria | 815 |
| 522 | Ga0307414_10634363 | 3300032004 | Bacteria | 962 |
| 523 | Ga0373930_0037693 | 3300034816 | Bacteria | 1018 |
| 524 | Ga0373950_0001194 | 3300034818 | Bacteria | 3345 |
| 525 | Ga0373950_0059277 | 3300034818 | Unclassified | 766 |
| 526 | Ga0373958_0022229 | 3300034819 | Bacteria | 1183 |
| 527 | Ga0373959_0015987 | 3300034820 | Bacteria | 1385 |
| 528 | Ga0373938_0009995 | 3300034957 | Bacteria | 1731 |
| 529 | Ga0373938_0050346 | 3300034957 | Bacteria | 950 |
| 530 | Ga0373926_0008736 | 3300035083 | Bacteria | 3373 |
| 531 | Ga0373926_0015201 | 3300035083 | Bacteria | 2623 |
| 532 | Ga0373928_0003734 | 3300035084 | Bacteria | 2904 |
| 533 | Ga0373929_0029716 | 3300035085 | Bacteria | 1161 |
| 534 | Ga0373934_0040577 | 3300035086 | Bacteria | 1836 |
| 535 | Ga0373934_0166821 | 3300035086 | Bacteria | 904 |
| 536 | Ga0373934_0395284 | 3300035086 | Unclassified | 577 |
| 537 | Ga0373944_0001606 | 3300035089 | Bacteria | 5716 |
| 538 | Ga0373944_0131808 | 3300035089 | Bacteria | 869 |
| 539 | Ga0373949_0005414 | 3300035090 | Bacteria | 2849 |
| 540 | Ga0373951_0010287 | 3300035091 | Bacteria | 2100 |
| 541 | Ga0373951_0066138 | 3300035091 | Unclassified | 913 |
| 542 | Ga0373952_0001423 | 3300035092 | Bacteria | 4369 |
| 543 | Ga0373952_0002309 | 3300035092 | Bacteria | 3435 |
| 544 | Ga0373923_0002777 | 3300035111 | Bacteria | 5475 |
| 545 | Ga0373923_0072262 | 3300035111 | Bacteria | 1483 |
| 546 | Ga0373932_0021345 | 3300035112 | Bacteria | 1709 |
| 547 | Ga0373936_0012971 | 3300035113 | Bacteria | 3177 |
| 548 | Ga0373936_0101539 | 3300035113 | Bacteria | 1214 |
| 549 | Ga0373939_0003721 | 3300035114 | Bacteria | 3591 |
| 550 | Ga0373939_0003841 | 3300035114 | Bacteria | 3537 |
| 551 | Ga0373941_0001156 | 3300035115 | Bacteria | 5502 |
| 552 | Ga0373945_0004846 | 3300035116 | Bacteria | 4285 |
| 553 | Ga0373945_0024843 | 3300035116 | Bacteria | 2078 |
| 554 | Ga0373945_0169817 | 3300035116 | Unclassified | 893 |
| 555 | Ga0373953_0002682 | 3300035117 | Bacteria | 5395 |
| 556 | Ga0373953_0023138 | 3300035117 | Bacteria | 2350 |
| 557 | Ga0373953_0041143 | 3300035117 | Bacteria | 1838 |
| 558 | Ga0373953_0217037 | 3300035117 | Bacteria | 828 |
| 559 | Ga0373954_0009519 | 3300035118 | Bacteria | 4274 |
| 560 | Ga0373954_0022029 | 3300035118 | Bacteria | 2889 |
| 561 | Ga0373954_0039070 | 3300035118 | Bacteria | 2209 |
| 562 | Ga0373954_0051526 | 3300035118 | Bacteria | 1933 |
| 563 | Ga0373954_0655818 | 3300035118 | Bacteria | 520 |
| 564 | Ga0373956_0008662 | 3300035119 | Bacteria | 4118 |
| 565 | Ga0373956_0047792 | 3300035119 | Bacteria | 1915 |
| 566 | Ga0373956_0359740 | 3300035119 | Bacteria | 694 |
| 567 | Ga0373957_0007212 | 3300035120 | Bacteria | 3548 |
| 568 | Ga0373957_0022723 | 3300035120 | Unclassified | 2236 |
| 569 | Ga0373957_0055364 | 3300035120 | Bacteria | 1525 |
| 570 | Ga0373957_0160814 | 3300035120 | Bacteria | 925 |
| 571 | Ga0373957_0246082 | 3300035120 | Bacteria | 752 |
| 572 | Ga0373957_0305953 | 3300035120 | Bacteria | 675 |
| 573 | Ga0373960_0013894 | 3300035121 | Bacteria | 2028 |
| 574 | Ga0373943_0067957 | 3300035170 | Bacteria | 1798 |
| 575 | Ga0373943_0073111 | 3300035170 | Bacteria | 1740 |
| 576 | Ga0373946_0002576 | 3300035171 | Bacteria | 6412 |
| 577 | Ga0373946_0010115 | 3300035171 | Bacteria | 3488 |
| 578 | Ga0373946_0046646 | 3300035171 | Bacteria | 1796 |
| 579 | Ga0373955_0003855 | 3300035172 | Bacteria | 6614 |
| 580 | Ga0373955_0004998 | 3300035172 | Bacteria | 5924 |
| 581 | Ga0373955_0014019 | 3300035172 | Bacteria | 3891 |
| 582 | Ga0373955_0207324 | 3300035172 | Bacteria | 1168 |
| 583 | Ga0373955_0210402 | 3300035172 | Bacteria | 1159 |
| 584 | Ga0373955_0585994 | 3300035172 | Unclassified | 683 |
| 585 | Ga0373942_0001355 | 3300035207 | Bacteria | 6342 |
| 586 | Ga0373961_0014826 | 3300035241 | Bacteria | 1984 |
| 587 | Ga0373961_0050761 | 3300035241 | Bacteria | 1229 |
| 588 | Ga0373961_0216948 | 3300035241 | Bacteria | 681 |
| 589 | Ga0373962_0000166 | 3300035242 | Bacteria | 14061 |
| 590 | Ga0373962_0048164 | 3300035242 | Bacteria | 1221 |
| 591 | Ga0373962_0130938 | 3300035242 | Bacteria | 808 |
| 592 | Ga0373924_0002225 | 3300035410 | Bacteria | 6501 |
| 593 | Ga0373924_0010364 | 3300035410 | Bacteria | 3432 |
| 594 | Ga0373924_0109631 | 3300035410 | Bacteria | 1192 |
| 595 | Ga0373924_0268905 | 3300035410 | Bacteria | 756 |
| 596 | Ga0373931_0007472 | 3300035691 | Bacteria | 5148 |
| 597 | Ga0373931_0644954 | 3300035691 | Unclassified | 695 |
| 598 | Ga0373935_0012906 | 3300035692 | Bacteria | 5033 |
| 599 | Ga0373935_0499727 | 3300035692 | Bacteria | 883 |
| 600 | Ga0373927_0006775 | 3300035695 | Bacteria | 7796 |
| 601 | Ga0373927_0007569 | 3300035695 | Bacteria | 7349 |
| 602 | Ga0373927_0088737 | 3300035695 | Bacteria | 2007 |
| 603 | Ga0373927_1148481 | 3300035695 | Bacteria | 512 |
| 604 | Ga0373933_0001315 | 3300035724 | Bacteria | 14607 |
| 605 | Ga0373933_0017514 | 3300035724 | Bacteria | 4019 |
| 606 | Ga0373933_0034589 | 3300035724 | Bacteria | 2945 |
| 607 | Ga0373933_0167902 | 3300035724 | Bacteria | 1395 |
| 608 | Ga0373933_0468519 | 3300035724 | Bacteria | 825 |
| 609 | Ga0373933_0483350 | 3300035724 | Unclassified | 811 |
| 610 | Ga0373947_0003183 | 3300035725 | Bacteria | 9764 |
| 611 | Ga0373947_0061133 | 3300035725 | Bacteria | 2288 |
| 612 | Ga0373937_0001948 | 3300036401 | Bacteria | 17286 |
| 613 | Ga0373937_0004646 | 3300036401 | Bacteria | 11661 |
| 614 | Ga0373937_0005491 | 3300036401 | Bacteria | 10863 |
| 615 | Ga0373937_0010388 | 3300036401 | Bacteria | 8130 |
| 616 | Ga0373937_0019993 | 3300036401 | Bacteria | 5998 |
| 617 | Ga0373937_0226570 | 3300036401 | Bacteria | 1760 |
| 618 | Ga0373937_0376696 | 3300036401 | Bacteria | 1346 |
| 619 | Ga0373937_0427662 | 3300036401 | Bacteria | 1257 |
| 620 | Ga0373937_1107503 | 3300036401 | Bacteria | 740 |
| 621 | Ga0373937_1555402 | 3300036401 | Bacteria | 609 |
| 622 | Ga0316582_0137188 | 3300036647 | Bacteria | 1647 |
| 623 | Ga0373925_0004198 | 3300037068 | Bacteria | 10934 |
| 624 | Ga0373925_0051762 | 3300037068 | Bacteria | 3066 |
| 625 | Ga0373925_0052206 | 3300037068 | Bacteria | 3054 |
| 626 | Ga0395899_0036297 | 3300037312 | Bacteria | 3698 |
| 627 | Ga0395899_0286870 | 3300037312 | Bacteria | 1118 |
| 628 | Ga0395900_0002100 | 3300037418 | Bacteria | 22308 |
| 629 | Ga0395900_0017672 | 3300037418 | Bacteria | 7279 |
| 630 | Ga0395898_0043461 | 3300037466 | Bacteria | 4427 |
| 631 | Ga0395898_0081163 | 3300037466 | Bacteria | 3127 |
| 632 | Ga0395898_0231014 | 3300037466 | Bacteria | 1764 |
| 633 | Ga0395901_0009830 | 3300038443 | Bacteria | 9698 |
| 634 | Ga0395901_0266230 | 3300038443 | Bacteria | 1783 |
| 635 | Ga0395901_0554734 | 3300038443 | Bacteria | 1164 |
| 636 | Ga0395901_0755820 | 3300038443 | Bacteria | 965 |
| 637 | Ga0436365_0134733 | 3300039437 | Bacteria | 5028 |
| 638 | Ga0436365_0725591 | 3300039437 | Bacteria | 2920 |
| 639 | Ga0436365_1517860 | 3300039437 | Bacteria | 530 |
| 640 | Ga0451791_1740671 | 3300041451 | Bacteria | 564 |
| 641 | Ga0451841_0412571 | 3300041498 | Bacteria | 562 |
| 642 | Ga0451853_3541983 | 3300041512 | Unclassified | 518 |
| 643 | Ga0439448_0097514 | 3300042005 | Bacteria | 997 |
| 644 | Ga0439448_0142853 | 3300042005 | Bacteria | 829 |
| 645 | Ga0439448_0180167 | 3300042005 | Bacteria | 738 |
| 646 | Ga0439450_019932 | 3300042008 | Bacteria | 1426 |
| 647 | Ga0439455_0013508 | 3300042012 | Bacteria | 1850 |
| 648 | Ga0439456_049853 | 3300042013 | Bacteria | 914 |
| 649 | Ga0439463_014054 | 3300042016 | Bacteria | 1973 |
| 650 | Ga0439463_108239 | 3300042016 | Unclassified | 717 |
| 651 | Ga0439458_0042380 | 3300042157 | Bacteria | 1108 |
| 652 | Ga0439435_0147665 | 3300042436 | Bacteria | 752 |
| 653 | Ga0439444_0040634 | 3300042437 | Bacteria | 912 |
| 654 | Ga0439444_0188226 | 3300042437 | Bacteria | 515 |
| 655 | Ga0439464_0021635 | 3300042439 | Bacteria | 1766 |
| 656 | Ga0439440_0016866 | 3300042993 | Bacteria | 1604 |
| 657 | Ga0453683_0409132 | 3300044673 | Bacteria | 875 |
| 658 | Ga0466965_0311279 | 3300044683 | Bacteria | 856 |
| 659 | Ga0466966_0033677 | 3300044684 | Bacteria | 3316 |
| 660 | Ga0466961_0048682 | 3300044693 | Bacteria | 2709 |
| 661 | Ga0466963_0011092 | 3300044694 | Bacteria | 5480 |
| 662 | Ga0466963_0062318 | 3300044694 | Bacteria | 2495 |
| 663 | Ga0466963_0195957 | 3300044694 | Bacteria | 1412 |
| 664 | Ga0466963_0236917 | 3300044694 | Bacteria | 1279 |
| 665 | Ga0466963_0244750 | 3300044694 | Bacteria | 1258 |
| 666 | Ga0466963_0798831 | 3300044694 | Unclassified | 665 |
| 667 | Ga0466971_0384545 | 3300044719 | Bacteria | 682 |
| 668 | Ga0466971_0562414 | 3300044719 | Unclassified | 566 |
| 669 | Ga0466957_0003449 | 3300044842 | Bacteria | 8672 |
| 670 | Ga0466957_0033443 | 3300044842 | Bacteria | 3085 |
| 671 | Ga0466957_0578932 | 3300044842 | Bacteria | 784 |
| 672 | Ga0466959_0016488 | 3300045049 | Bacteria | 5399 |
| 673 | Ga0466959_0273282 | 3300045049 | Bacteria | 1161 |
| 674 | Ga0466958_0025916 | 3300045836 | Bacteria | 3461 |
| 675 | Ga0466958_0033391 | 3300045836 | Bacteria | 3066 |
| 676 | Ga0466958_0164319 | 3300045836 | Bacteria | 1404 |
| 677 | Ga0466958_0203098 | 3300045836 | Bacteria | 1262 |
| 678 | Ga0466958_0362882 | 3300045836 | Bacteria | 933 |
| 679 | Ga0466967_0003827 | 3300045976 | Bacteria | 9960 |
| 680 | Ga0466967_0022912 | 3300045976 | Bacteria | 5107 |
| 681 | Ga0466967_0361817 | 3300045976 | Bacteria | 1406 |
| 682 | Ga0495617_009204 | 3300046452 | Bacteria | 3394 |
| 683 | Ga0495592_0001659 | 3300046454 | Bacteria | 15603 |
| 684 | Ga0495592_0002844 | 3300046454 | Bacteria | 12281 |
| 685 | Ga0495592_0002937 | 3300046454 | Bacteria | 12135 |
| 686 | Ga0495592_0091752 | 3300046454 | Bacteria | 2178 |
| 687 | Ga0495592_0134271 | 3300046454 | Bacteria | 1728 |
| 688 | Ga0495592_0509116 | 3300046454 | Bacteria | 746 |
| 689 | Ga0495603_0017650 | 3300046455 | Bacteria | 4320 |
| 690 | Ga0495603_0021917 | 3300046455 | Bacteria | 3867 |
| 691 | Ga0495603_0046482 | 3300046455 | Bacteria | 2586 |
| 692 | Ga0495629_0000820 | 3300046459 | Bacteria | 25209 |
| 693 | Ga0495629_0054204 | 3300046459 | Bacteria | 2804 |
| 694 | Ga0495629_0125985 | 3300046459 | Bacteria | 1784 |
| 695 | Ga0495629_0249468 | 3300046459 | Bacteria | 1221 |
| 696 | Ga0495629_0512068 | 3300046459 | Bacteria | 808 |
| 697 | Ga0495641_0019209 | 3300046461 | Bacteria | 3504 |
| 698 | Ga0495641_0042047 | 3300046461 | Bacteria | 2120 |
| 699 | Ga0495651_0001330 | 3300046462 | Bacteria | 19146 |
| 700 | Ga0495651_0002388 | 3300046462 | Bacteria | 14492 |
| 701 | Ga0495651_0008754 | 3300046462 | Bacteria | 7763 |
| 702 | Ga0495651_0061982 | 3300046462 | Bacteria | 2862 |
| 703 | Ga0495651_0067691 | 3300046462 | Bacteria | 2724 |
| 704 | Ga0495651_0433583 | 3300046462 | Bacteria | 852 |
| 705 | Ga0495653_0010963 | 3300046463 | Bacteria | 7419 |
| 706 | Ga0495653_0014755 | 3300046463 | Bacteria | 6372 |
| 707 | Ga0495653_0024736 | 3300046463 | Bacteria | 4834 |
| 708 | Ga0495653_0061019 | 3300046463 | Bacteria | 2854 |
| 709 | Ga0495580_0007477 | 3300046472 | Bacteria | 8779 |
| 710 | Ga0495580_0145193 | 3300046472 | Bacteria | 1644 |
| 711 | Ga0495582_0002118 | 3300046473 | Bacteria | 11108 |
| 712 | Ga0495582_0065823 | 3300046473 | Bacteria | 2002 |
| 713 | Ga0495582_0082183 | 3300046473 | Bacteria | 1789 |
| 714 | Ga0495605_0166319 | 3300046474 | Bacteria | 977 |
| 715 | Ga0495639_0004776 | 3300046475 | Bacteria | 5825 |
| 716 | Ga0495639_0024628 | 3300046475 | Bacteria | 2650 |
| 717 | Ga0495639_0043030 | 3300046475 | Bacteria | 2039 |
| 718 | Ga0495662_0049089 | 3300046476 | Bacteria | 2037 |
| 719 | Ga0495662_0104000 | 3300046476 | Bacteria | 1389 |
| 720 | Ga0495664_0003775 | 3300046477 | Bacteria | 8262 |
| 721 | Ga0495664_0005939 | 3300046477 | Bacteria | 6724 |
| 722 | Ga0495664_0030892 | 3300046477 | Bacteria | 3139 |
| 723 | Ga0495584_0099329 | 3300046491 | Bacteria | 1471 |
| 724 | Ga0495584_0118693 | 3300046491 | Bacteria | 1339 |
| 725 | Ga0495585_0001819 | 3300046492 | Bacteria | 16149 |
| 726 | Ga0495594_0060760 | 3300046499 | Bacteria | 2090 |
| 727 | Ga0495594_0070027 | 3300046499 | Bacteria | 1949 |
| 728 | Ga0495607_0026222 | 3300046501 | Bacteria | 3618 |
| 729 | Ga0495608_0000456 | 3300046511 | Bacteria | 28492 |
| 730 | Ga0495608_0026720 | 3300046511 | Bacteria | 3934 |
| 731 | Ga0495608_0028820 | 3300046511 | Bacteria | 3773 |
| 732 | Ga0495608_0046466 | 3300046511 | Bacteria | 2889 |
| 733 | Ga0495608_0192177 | 3300046511 | Bacteria | 1288 |
| 734 | Ga0495616_0178855 | 3300046513 | Bacteria | 944 |
| 735 | Ga0495618_0004121 | 3300046514 | Bacteria | 8969 |
| 736 | Ga0495618_0004633 | 3300046514 | Bacteria | 8421 |
| 737 | Ga0495628_0001503 | 3300046516 | Bacteria | 21373 |
| 738 | Ga0495628_0014563 | 3300046516 | Bacteria | 6587 |
| 739 | Ga0495628_0070676 | 3300046516 | Unclassified | 2721 |
| 740 | Ga0495628_0287345 | 3300046516 | Bacteria | 1220 |
| 741 | Ga0495630_0030356 | 3300046517 | Bacteria | 4020 |
| 742 | Ga0495630_0273897 | 3300046517 | Bacteria | 1289 |
| 743 | Ga0495637_0066348 | 3300046520 | Bacteria | 1467 |
| 744 | Ga0495644_0030671 | 3300046523 | Bacteria | 2030 |
| 745 | Ga0495663_0019820 | 3300046525 | Bacteria | 1928 |
| 746 | Ga0495666_0003570 | 3300046526 | Bacteria | 7862 |
| 747 | Ga0495652_0002402 | 3300046529 | Bacteria | 19345 |
| 748 | Ga0495652_0007617 | 3300046529 | Bacteria | 9974 |
| 749 | Ga0495652_0090695 | 3300046529 | Bacteria | 2500 |
| 750 | Ga0495652_0121999 | 3300046529 | Bacteria | 2076 |
| 751 | Ga0495652_0127148 | 3300046529 | Bacteria | 2023 |
| 752 | Ga0495652_0497044 | 3300046529 | Bacteria | 846 |
| 753 | Ga0495665_0008032 | 3300046531 | Bacteria | 5723 |
| 754 | Ga0495640_0009310 | 3300046533 | Bacteria | 7652 |
| 755 | Ga0495640_0017560 | 3300046533 | Bacteria | 5329 |
| 756 | Ga0495640_0081980 | 3300046533 | Bacteria | 2143 |
| 757 | Ga0495640_0155249 | 3300046533 | Bacteria | 1469 |
| 758 | Ga0495640_0179755 | 3300046533 | Bacteria | 1348 |
| 759 | Ga0495640_0850710 | 3300046533 | Bacteria | 542 |
| 760 | Ga0495586_0000868 | 3300046535 | Bacteria | 17317 |
| 761 | Ga0495586_0062998 | 3300046535 | Bacteria | 2019 |
| 762 | Ga0495587_0018735 | 3300046536 | Bacteria | 4292 |
| 763 | Ga0495587_0036933 | 3300046536 | Bacteria | 2936 |
| 764 | Ga0495587_0077278 | 3300046536 | Bacteria | 1933 |
| 765 | Ga0495587_0190812 | 3300046536 | Bacteria | 1160 |
| 766 | Ga0495587_0499532 | 3300046536 | Bacteria | 672 |
| 767 | Ga0495598_0221759 | 3300046537 | Bacteria | 690 |
| 768 | Ga0495609_0024222 | 3300046538 | Bacteria | 2786 |
| 769 | Ga0495609_0231874 | 3300046538 | Bacteria | 764 |
| 770 | Ga0495645_0000399 | 3300046543 | Bacteria | 30028 |
| 771 | Ga0495645_0034116 | 3300046543 | Bacteria | 3713 |
| 772 | Ga0495645_0053488 | 3300046543 | Bacteria | 2935 |
| 773 | Ga0495645_0161493 | 3300046543 | Bacteria | 1549 |
| 774 | Ga0495645_0278035 | 3300046543 | Bacteria | 1102 |
| 775 | Ga0495645_0340636 | 3300046543 | Bacteria | 968 |
| 776 | Ga0495622_0001874 | 3300046557 | Bacteria | 10356 |
| 777 | Ga0495622_0037383 | 3300046557 | Bacteria | 2262 |
| 778 | Ga0495633_0005540 | 3300046558 | Bacteria | 7667 |
| 779 | Ga0495667_0000832 | 3300046559 | Bacteria | 19943 |
| 780 | Ga0495667_0005478 | 3300046559 | Bacteria | 8574 |
| 781 | Ga0495667_0012581 | 3300046559 | Bacteria | 5738 |
| 782 | Ga0495667_0014107 | 3300046559 | Bacteria | 5392 |
| 783 | Ga0495667_0042353 | 3300046559 | Bacteria | 3019 |
| 784 | Ga0495656_0006330 | 3300046615 | Bacteria | 4149 |
| 785 | Ga0495634_0025861 | 3300046642 | Bacteria | 4100 |
| 786 | Ga0495634_0055623 | 3300046642 | Bacteria | 2645 |
| 787 | Ga0495634_0069998 | 3300046642 | Bacteria | 2313 |
| 788 | Ga0495635_0002323 | 3300046663 | Bacteria | 12923 |
| 789 | Ga0495635_0017866 | 3300046663 | Bacteria | 4953 |
| 790 | Ga0495635_0021281 | 3300046663 | Bacteria | 4520 |
| 791 | Ga0495635_0519840 | 3300046663 | Bacteria | 782 |
| 792 | Ga0495635_0632532 | 3300046663 | Bacteria | 697 |
| 793 | Ga0495659_0001022 | 3300046664 | Bacteria | 9791 |
| 794 | Ga0495661_0021555 | 3300046665 | Bacteria | 4201 |
| 795 | Ga0495588_0000486 | 3300046674 | Bacteria | 19669 |
| 796 | Ga0495588_0029502 | 3300046674 | Bacteria | 2752 |
| 797 | Ga0495588_0069692 | 3300046674 | Bacteria | 1828 |
| 798 | Ga0495657_0008710 | 3300046675 | Bacteria | 7742 |
| 799 | Ga0495657_0067045 | 3300046675 | Bacteria | 2357 |
| 800 | Ga0495657_0199268 | 3300046675 | Bacteria | 1221 |
| 801 | Ga0495657_0200963 | 3300046675 | Bacteria | 1215 |
| 802 | Ga0495657_0362815 | 3300046675 | Bacteria | 856 |
| 803 | Ga0495599_0004419 | 3300046678 | Bacteria | 8316 |
| 804 | Ga0495599_0012733 | 3300046678 | Bacteria | 5188 |
| 805 | Ga0495599_0013002 | 3300046678 | Bacteria | 5137 |
| 806 | Ga0495623_0022383 | 3300046679 | Bacteria | 4083 |
| 807 | Ga0495623_0216416 | 3300046679 | Bacteria | 1094 |
| 808 | Ga0495646_0001728 | 3300046680 | Bacteria | 13099 |
| 809 | Ga0495646_0001784 | 3300046680 | Bacteria | 12938 |
| 810 | Ga0495646_0581084 | 3300046680 | Bacteria | 570 |
| 811 | Ga0495647_0000847 | 3300046681 | Bacteria | 9158 |
| 812 | Ga0495647_0009297 | 3300046681 | Bacteria | 3325 |
| 813 | Ga0495647_0010230 | 3300046681 | Bacteria | 3192 |
| 814 | Ga0495658_0000479 | 3300046683 | Bacteria | 22023 |
| 815 | Ga0495658_0039147 | 3300046683 | Bacteria | 2629 |
| 816 | Ga0495658_0046752 | 3300046683 | Bacteria | 2434 |
| 817 | Ga0495658_0059534 | 3300046683 | Bacteria | 2187 |
| 818 | Ga0495613_0010280 | 3300046689 | Bacteria | 6951 |
| 819 | Ga0495613_0225454 | 3300046689 | Bacteria | 1314 |
| 820 | Ga0495613_0351421 | 3300046689 | Bacteria | 1012 |
| 821 | Ga0495624_0014088 | 3300046690 | Bacteria | 5437 |
| 822 | Ga0495670_0013284 | 3300046691 | Bacteria | 4050 |
| 823 | Ga0495589_0123449 | 3300046794 | Bacteria | 1246 |
| 824 | Ga0495600_0001355 | 3300046809 | Bacteria | 13523 |
| 825 | Ga0495600_0025982 | 3300046809 | Bacteria | 3776 |
| 826 | Ga0495600_0032548 | 3300046809 | Bacteria | 3384 |
| 827 | Ga0495600_0055458 | 3300046809 | Bacteria | 2588 |
| 828 | Ga0495600_0260156 | 3300046809 | Bacteria | 1102 |
| 829 | Ga0495581_0011814 | 3300047315 | Bacteria | 5055 |
| 830 | Ga0495581_0026198 | 3300047315 | Bacteria | 3382 |
| 831 | Ga0495581_0065595 | 3300047315 | Bacteria | 2099 |
| 832 | Ga0495581_0386507 | 3300047315 | Bacteria | 817 |
| 833 | Ga0495604_0001255 | 3300047317 | Bacteria | 20785 |
| 834 | Ga0495604_0003178 | 3300047317 | Bacteria | 13125 |
| 835 | Ga0495604_0012787 | 3300047317 | Bacteria | 6683 |
| 836 | Ga0495604_0062533 | 3300047317 | Bacteria | 2843 |
| 837 | Ga0495604_0862465 | 3300047317 | Unclassified | 567 |
| 838 | Ga0495636_0366710 | 3300047318 | Unclassified | 682 |
| 839 | Ga0495674_0010576 | 3300047319 | Bacteria | 8733 |
| 840 | Ga0495674_0017131 | 3300047319 | Bacteria | 6748 |
| 841 | Ga0495674_0033805 | 3300047319 | Bacteria | 4628 |
| 842 | Ga0495674_0061051 | 3300047319 | Bacteria | 3287 |
| 843 | Ga0495674_0555985 | 3300047319 | Bacteria | 913 |
| 844 | Ga0495676_0042894 | 3300047321 | Bacteria | 3708 |
| 845 | Ga0495676_0132622 | 3300047321 | Bacteria | 1796 |
| 846 | Ga0495676_0272713 | 3300047321 | Bacteria | 1147 |
| 847 | Ga0495680_0002523 | 3300047322 | Bacteria | 18717 |
| 848 | Ga0495680_0006821 | 3300047322 | Bacteria | 10546 |
| 849 | Ga0495680_0027186 | 3300047322 | Bacteria | 4704 |
| 850 | Ga0495680_0037048 | 3300047322 | Bacteria | 3909 |
| 851 | Ga0495680_0037795 | 3300047322 | Bacteria | 3866 |
| 852 | Ga0495680_0039673 | 3300047322 | Bacteria | 3754 |
| 853 | Ga0495680_0450118 | 3300047322 | Bacteria | 881 |
| 854 | Ga0495675_0000731 | 3300047444 | Bacteria | 20534 |
| 855 | Ga0495675_0008665 | 3300047444 | Bacteria | 6310 |
| 856 | Ga0495675_0021234 | 3300047444 | Bacteria | 4134 |
| 857 | Ga0495675_0162683 | 3300047444 | Bacteria | 1374 |
| 858 | Ga0495677_0054128 | 3300047445 | Bacteria | 1480 |
| 859 | Ga0495684_0009500 | 3300047471 | Bacteria | 7503 |
| 860 | Ga0495684_0010490 | 3300047471 | Bacteria | 7166 |
| 861 | Ga0495684_0190316 | 3300047471 | Bacteria | 1517 |
| 862 | Ga0495593_0021876 | 3300047673 | Bacteria | 3568 |
| 863 | Ga0495593_0032629 | 3300047673 | Bacteria | 2837 |
| 864 | Ga0495593_0098042 | 3300047673 | Bacteria | 1505 |
| 865 | Ga0495602_0001314 | 3300048088 | Bacteria | 24503 |
| 866 | Ga0495602_0015855 | 3300048088 | Bacteria | 7590 |
| 867 | Ga0495602_0228318 | 3300048088 | Bacteria | 1400 |
| 868 | Ga0495602_0644417 | 3300048088 | Unclassified | 724 |
| 869 | Ga0495614_0056720 | 3300048089 | Bacteria | 1681 |
| 870 | Ga0496100_0000894 | 3300048903 | Bacteria | 14217 |
| 871 | Ga0496100_0051780 | 3300048903 | Bacteria | 2666 |
| 872 | Ga0496100_0056803 | 3300048903 | Bacteria | 2561 |
| 873 | Ga0496101_0008463 | 3300048904 | Bacteria | 6721 |
| 874 | Ga0496101_0017913 | 3300048904 | Bacteria | 4807 |
| 875 | Ga0496101_0043614 | 3300048904 | Bacteria | 3206 |
| 876 | Ga0496101_0080643 | 3300048904 | Bacteria | 2404 |
| 877 | Ga0496101_0723507 | 3300048904 | Bacteria | 786 |
| 878 | Ga0496101_1020323 | 3300048904 | Bacteria | 650 |
| 879 | Ga0496101_1615351 | 3300048904 | Bacteria | 503 |
| 880 | Ga0496102_0017100 | 3300048905 | Bacteria | 6349 |
| 881 | Ga0496102_0098605 | 3300048905 | Bacteria | 2711 |
| 882 | Ga0496102_0131897 | 3300048905 | Bacteria | 2339 |
| 883 | Ga0496103_0014513 | 3300048906 | Bacteria | 4676 |
| 884 | Ga0496103_0031284 | 3300048906 | Bacteria | 3241 |
| 885 | Ga0496103_0031726 | 3300048906 | Bacteria | 3221 |
| 886 | Ga0496103_0107695 | 3300048906 | Bacteria | 1768 |
| 887 | Ga0496104_0000061 | 3300048907 | Bacteria | 117394 |
| 888 | Ga0496104_0010521 | 3300048907 | Bacteria | 8265 |
| 889 | Ga0496104_0028757 | 3300048907 | Bacteria | 5151 |
| 890 | Ga0496104_0180633 | 3300048907 | Bacteria | 2020 |
| 891 | Ga0496105_0000365 | 3300048908 | Bacteria | 30018 |
| 892 | Ga0496105_0002920 | 3300048908 | Bacteria | 12546 |
| 893 | Ga0496105_0042986 | 3300048908 | Bacteria | 3726 |
| 894 | Ga0496105_0061594 | 3300048908 | Bacteria | 3096 |
| 895 | Ga0496106_0012105 | 3300048909 | Bacteria | 6367 |
| 896 | Ga0496106_0043121 | 3300048909 | Bacteria | 3384 |
| 897 | Ga0496106_0084133 | 3300048909 | Bacteria | 2447 |
| 898 | Ga0496106_0227779 | 3300048909 | Bacteria | 1487 |
| 899 | Ga0496106_0988095 | 3300048909 | Bacteria | 662 |
| 900 | Ga0496107_0045843 | 3300048910 | Bacteria | 3146 |
| 901 | Ga0496107_0052267 | 3300048910 | Bacteria | 2947 |
| 902 | Ga0496107_0222105 | 3300048910 | Bacteria | 1405 |
| 903 | Ga0496107_0347702 | 3300048910 | Bacteria | 1103 |
| 904 | Ga0496107_0493370 | 3300048910 | Bacteria | 908 |
| 905 | Ga0496108_0033735 | 3300048911 | Bacteria | 4251 |
| 906 | Ga0496108_0051476 | 3300048911 | Bacteria | 3450 |
| 907 | Ga0496108_0073073 | 3300048911 | Bacteria | 2896 |
| 908 | Ga0496108_0124609 | 3300048911 | Bacteria | 2211 |
| 909 | Ga0496108_0176488 | 3300048911 | Bacteria | 1849 |
| 910 | Ga0496109_0009059 | 3300048912 | Bacteria | 8476 |
| 911 | Ga0496109_0030539 | 3300048912 | Bacteria | 4829 |
| 912 | Ga0496109_0041283 | 3300048912 | Bacteria | 4179 |
| 913 | Ga0496109_0046125 | 3300048912 | Bacteria | 3957 |
| 914 | Ga0496109_0354784 | 3300048912 | Bacteria | 1385 |
| 915 | Ga0496110_0004230 | 3300048913 | Bacteria | 11109 |
| 916 | Ga0496110_0041642 | 3300048913 | Bacteria | 4008 |
| 917 | Ga0496110_0049100 | 3300048913 | Bacteria | 3700 |
| 918 | Ga0496110_0330286 | 3300048913 | Bacteria | 1389 |
| 919 | Ga0496111_0026546 | 3300048914 | Bacteria | 4090 |
| 920 | Ga0496111_0036602 | 3300048914 | Bacteria | 3510 |
| 921 | Ga0496111_0058838 | 3300048914 | Bacteria | 2783 |
| 922 | Ga0496111_0749418 | 3300048914 | Bacteria | 708 |
| 923 | Ga0496112_0043963 | 3300048915 | Bacteria | 4374 |
| 924 | Ga0496112_0060837 | 3300048915 | Bacteria | 3721 |
| 925 | Ga0496112_0067713 | 3300048915 | Bacteria | 3524 |
| 926 | Ga0496112_0523281 | 3300048915 | Bacteria | 1121 |
| 927 | Ga0496112_0552516 | 3300048915 | Bacteria | 1085 |
| 928 | Ga0496113_0011409 | 3300048916 | Bacteria | 5924 |
| 929 | Ga0496113_0035424 | 3300048916 | Bacteria | 3650 |
| 930 | Ga0496113_0088091 | 3300048916 | Bacteria | 2388 |
| 931 | Ga0496113_0336066 | 3300048916 | Bacteria | 1211 |
| 932 | Ga0496113_0563437 | 3300048916 | Bacteria | 913 |
| 933 | Ga0496114_0067528 | 3300048917 | Bacteria | 2999 |
| 934 | Ga0496114_0105965 | 3300048917 | Bacteria | 2405 |
| 935 | Ga0496114_0111012 | 3300048917 | Bacteria | 2349 |
| 936 | Ga0496114_0426066 | 3300048917 | Bacteria | 1175 |
| 937 | Ga0496115_0013508 | 3300048918 | Bacteria | 6178 |
| 938 | Ga0496115_0070030 | 3300048918 | Bacteria | 2842 |
| 939 | Ga0496115_0080712 | 3300048918 | Bacteria | 2648 |
| 940 | Ga0496115_0225835 | 3300048918 | Bacteria | 1544 |
| 941 | Ga0496117_0082112 | 3300048920 | Bacteria | 2112 |
| 942 | Ga0496126_0255518 | 3300048929 | Bacteria | 1459 |
| 943 | Ga0501031_0003092 | 3300049568 | Bacteria | 10652 |
| 944 | Ga0501032_0040473 | 3300049569 | Bacteria | 3168 |
| 945 | Ga0501032_0114003 | 3300049569 | Bacteria | 1788 |
| 946 | Ga0501032_0200808 | 3300049569 | Bacteria | 1301 |
| 947 | Ga0501034_0000319 | 3300049571 | Bacteria | 84488 |
| 948 | Ga0501034_0034953 | 3300049571 | Bacteria | 5097 |
| 949 | Ga0501034_0098231 | 3300049571 | Bacteria | 2924 |
| 950 | Ga0501034_0100449 | 3300049571 | Bacteria | 2887 |
| 951 | Ga0501034_0131062 | 3300049571 | Bacteria | 2490 |
| 952 | Ga0501034_0986100 | 3300049571 | Bacteria | 727 |
| 953 | Ga0501036_0032290 | 3300049572 | Bacteria | 4423 |
| 954 | Ga0501036_0107597 | 3300049572 | Bacteria | 2357 |
| 955 | Ga0501037_0016416 | 3300049573 | Bacteria | 5450 |
| 956 | Ga0501037_0024154 | 3300049573 | Bacteria | 4494 |
| 957 | Ga0501038_0038170 | 3300049574 | Bacteria | 4207 |
| 958 | Ga0501038_0072363 | 3300049574 | Bacteria | 2921 |
| 959 | Ga0501038_0078514 | 3300049574 | Bacteria | 2785 |
| 960 | Ga0501039_0011266 | 3300049575 | Bacteria | 6811 |
| 961 | Ga0501039_0087087 | 3300049575 | Bacteria | 2433 |
| 962 | Ga0501043_0430364 | 3300049579 | Bacteria | 994 |
| 963 | Ga0501043_0542870 | 3300049579 | Bacteria | 864 |
| 964 | Ga0501043_1278373 | 3300049579 | Bacteria | 513 |
| 965 | Ga0501046_0351594 | 3300049580 | Bacteria | 1070 |
| 966 | Ga0501047_0014222 | 3300049581 | Bacteria | 7564 |
| 967 | Ga0501047_0015912 | 3300049581 | Bacteria | 7170 |
| 968 | Ga0501047_0177639 | 3300049581 | Bacteria | 1996 |
| 969 | Ga0501047_0869609 | 3300049581 | Bacteria | 715 |
| 970 | Ga0501048_0388011 | 3300049582 | Bacteria | 997 |
| 971 | Ga0501067_0733343 | 3300049583 | Bacteria | 556 |
| 972 | Ga0501068_0051234 | 3300049584 | Bacteria | 2497 |
| 973 | Ga0501068_0352365 | 3300049584 | Bacteria | 946 |
| 974 | Ga0501068_0724864 | 3300049584 | Bacteria | 650 |
| 975 | Ga0501069_0005809 | 3300049585 | Bacteria | 6425 |
| 976 | Ga0501069_0304209 | 3300049585 | Bacteria | 935 |
| 977 | Ga0501069_1000148 | 3300049585 | Unclassified | 511 |
| 978 | Ga0501070_0006119 | 3300049586 | Bacteria | 10254 |
| 979 | Ga0501070_0031535 | 3300049586 | Bacteria | 4441 |
| 980 | Ga0501070_0129327 | 3300049586 | Bacteria | 2086 |
| 981 | Ga0501070_0154649 | 3300049586 | Bacteria | 1891 |
| 982 | Ga0501070_0157268 | 3300049586 | Bacteria | 1874 |
| 983 | Ga0501071_0185755 | 3300049587 | Bacteria | 1558 |
| 984 | Ga0501071_0354516 | 3300049587 | Bacteria | 1117 |
| 985 | Ga0501072_0141766 | 3300049588 | Bacteria | 1916 |
| 986 | Ga0501072_0250417 | 3300049588 | Bacteria | 1411 |
| 987 | Ga0501072_0302617 | 3300049588 | Bacteria | 1271 |
| 988 | Ga0501072_0440660 | 3300049588 | Bacteria | 1032 |
| 989 | Ga0501073_0125088 | 3300049589 | Bacteria | 1782 |
| 990 | Ga0501073_0465500 | 3300049589 | Bacteria | 874 |
| 991 | Ga0501073_0583372 | 3300049589 | Bacteria | 772 |
| 992 | Ga0501074_0050037 | 3300049590 | Bacteria | 3016 |
| 993 | Ga0501074_0119253 | 3300049590 | Bacteria | 1886 |
| 994 | Ga0501074_0185649 | 3300049590 | Bacteria | 1483 |
| 995 | Ga0501077_0056351 | 3300049593 | Bacteria | 2494 |
| 996 | Ga0501079_0210125 | 3300049741 | Bacteria | 1520 |
| 997 | Ga0501080_0101172 | 3300049742 | Bacteria | 2673 |
| 998 | Ga0501080_0219478 | 3300049742 | Bacteria | 1740 |
| 999 | Ga0501080_0609936 | 3300049742 | Bacteria | 968 |
| 1000 | Ga0501080_1375413 | 3300049742 | Unclassified | 603 |
| 1001 | Ga0501083_0028527 | 3300049744 | Bacteria | 3845 |
| 1002 | Ga0501083_0152007 | 3300049744 | Bacteria | 1516 |
| 1003 | Ga0501083_0273462 | 3300049744 | Bacteria | 1099 |
| 1004 | Ga0501035_0001800 | 3300049822 | Bacteria | 21664 |
| 1005 | Ga0501035_0029127 | 3300049822 | Bacteria | 5036 |
| 1006 | Ga0501035_0235247 | 3300049822 | Bacteria | 1560 |
| 1007 | Ga0501035_0371930 | 3300049822 | Bacteria | 1193 |
| 1008 | Ga0501044_0320652 | 3300049823 | Bacteria | 1474 |
| 1009 | Ga0501044_0483764 | 3300049823 | Bacteria | 1141 |
| 1010 | Ga0501044_0537985 | 3300049823 | Bacteria | 1066 |
| 1011 | Ga0501044_0917441 | 3300049823 | Bacteria | 750 |
| 1012 | nmdc:mga03683_631823_c1 | 3300050489 | Bacteria | 526 |
| 1013 | nmdc:mga03n38_217424_c1 | 3300050490 | Bacteria | 996 |
| 1014 | nmdc:mga03n38_74518_c1 | 3300050490 | Bacteria | 1579 |
| 1015 | nmdc:mga00v17_848946_c1 | 3300050491 | Bacteria | 580 |
| 1016 | nmdc:mga0yw44_1034339_c1 | 3300050492 | Bacteria | 556 |
| 1017 | nmdc:mga0yw44_344087_c1 | 3300050492 | Bacteria | 1003 |
| 1018 | nmdc:mga06z11_36082_c1 | 3300050494 | Bacteria | 2438 |
| 1019 | nmdc:mga04h51_210116_c1 | 3300050495 | Unclassified | 768 |
| 1020 | nmdc:mga07m45_138606_c1 | 3300050496 | Bacteria | 1409 |
| 1021 | nmdc:mga07m45_93737_c1 | 3300050496 | Bacteria | 1721 |
| 1022 | nmdc:mga05p37_1242_c1 | 3300050507 | Bacteria | 29598 |
| 1023 | nmdc:mga05p37_7606_c1 | 3300050507 | Bacteria | 12784 |
| 1024 | nmdc:mga09592_480_c1 | 3300050508 | Bacteria | 29887 |
| 1025 | nmdc:mga0qj67_514_c1 | 3300050509 | Bacteria | 26446 |
| 1026 | nmdc:mga06r32_1472165_c1 | 3300050510 | Bacteria | 621 |
| 1027 | nmdc:mga06r32_19785_c1 | 3300050510 | Bacteria | 6187 |
| 1028 | nmdc:mga06r32_633464_c1 | 3300050510 | Bacteria | 1038 |
| 1029 | nmdc:mga08y16_1532_c1 | 3300050511 | Bacteria | 23233 |
| 1030 | nmdc:mga08y16_2506_c1 | 3300050511 | Bacteria | 18888 |
| 1031 | nmdc:mga08y16_313418_c1 | 3300050511 | Bacteria | 1616 |
| 1032 | nmdc:mga0n895_1152_c1 | 3300050512 | Bacteria | 19359 |
| 1033 | nmdc:mga0n895_1592656_c1 | 3300050512 | Bacteria | 618 |
| 1034 | nmdc:mga0n895_2804_c1 | 3300050512 | Bacteria | 13777 |
| 1035 | nmdc:mga0n895_353560_c1 | 3300050512 | Bacteria | 1488 |
| 1036 | nmdc:mga0n895_377944_c1 | 3300050512 | Bacteria | 1434 |
| 1037 | nmdc:mga0n895_58640_c1 | 3300050512 | Bacteria | 3796 |
| 1038 | nmdc:mga0rr50_317889_c1 | 3300050513 | Unclassified | 1305 |
| 1039 | nmdc:mga0rr50_43930_c1 | 3300050513 | Bacteria | 3274 |
| 1040 | nmdc:mga0rr50_609103_c1 | 3300050513 | Bacteria | 931 |
| 1041 | nmdc:mga0rr50_77620_c1 | 3300050513 | Bacteria | 2553 |
| 1042 | nmdc:mga08x19_115137_c1 | 3300050514 | Bacteria | 1797 |
| 1043 | nmdc:mga08x19_164205_c1 | 3300050514 | Bacteria | 1061 |
| 1044 | nmdc:mga08x19_551906_c1 | 3300050514 | Bacteria | 815 |
| 1045 | nmdc:mga08x19_758606_c1 | 3300050514 | Unclassified | 689 |
| 1046 | nmdc:mga08x19_815033_c1 | 3300050514 | Bacteria | 663 |
| 1047 | nmdc:mga08x19_850206_c1 | 3300050514 | Bacteria | 648 |
| 1048 | nmdc:mga0a205_10123_c1 | 3300050515 | Bacteria | 8655 |
| 1049 | nmdc:mga0a205_1257_c1 | 3300050515 | Bacteria | 21275 |
| 1050 | nmdc:mga0a205_19977_c1 | 3300050515 | Bacteria | 6320 |
| 1051 | Ga0495601_0000095 | 3300053077 | Bacteria | 48556 |
| 1052 | Ga0495601_0000316 | 3300053077 | Bacteria | 25622 |
| 1053 | Ga0495601_0006189 | 3300053077 | Bacteria | 6987 |
| 1054 | Ga0495601_0015389 | 3300053077 | Bacteria | 4623 |
| 1055 | Ga0495601_0041044 | 3300053077 | Bacteria | 2900 |
| 1056 | Ga0495601_0060341 | 3300053077 | Bacteria | 2407 |
| 1057 | Ga0495612_0000812 | 3300053078 | Bacteria | 12723 |
| 1058 | Ga0495612_0002682 | 3300053078 | Bacteria | 7351 |
| 1059 | Ga0495612_0003848 | 3300053078 | Bacteria | 6229 |
| 1060 | Ga0495612_0011752 | 3300053078 | Bacteria | 3529 |
| 1061 | Ga0495612_0018121 | 3300053078 | Bacteria | 2818 |
| 1062 | Ga0495612_0113492 | 3300053078 | Bacteria | 1161 |
| 1063 | Ga0495612_0126893 | 3300053078 | Bacteria | 1100 |
| 1064 | Ga0495612_0342705 | 3300053078 | Unclassified | 674 |
| 1065 | Ga0495595_0000261 | 3300053084 | Bacteria | 20962 |
| 1066 | Ga0495595_0002995 | 3300053084 | Bacteria | 6673 |
| 1067 | Ga0495595_0005688 | 3300053084 | Bacteria | 5047 |
| 1068 | Ga0495595_0016442 | 3300053084 | Bacteria | 3165 |
| 1069 | Ga0495595_0089650 | 3300053084 | Bacteria | 1474 |
| 1070 | Ga0495595_0313707 | 3300053084 | Bacteria | 789 |
| 1071 | Ga0495595_0749205 | 3300053084 | Unclassified | 501 |
| 1072 | Ga0495619_0000056 | 3300053085 | Bacteria | 95385 |
| 1073 | Ga0495619_0000498 | 3300053085 | Bacteria | 26335 |
| 1074 | Ga0495619_0003320 | 3300053085 | Bacteria | 10401 |
| 1075 | Ga0495619_0006134 | 3300053085 | Bacteria | 7614 |
| 1076 | Ga0495619_0076645 | 3300053085 | Bacteria | 2245 |
| 1077 | Ga0495619_0204791 | 3300053085 | Bacteria | 1366 |
| 1078 | Ga0495619_0816050 | 3300053085 | Bacteria | 630 |
| 1079 | Ga0495619_0847812 | 3300053085 | Bacteria | 616 |
| 1080 | Ga0500566_0414660 | 3300053094 | Unclassified | 599 |
| 1081 | Ga0500650_0188568 | 3300053098 | Bacteria | 942 |
| 1082 | Ga0501084_0112385 | 3300054114 | Bacteria | 2289 |
| 1083 | Ga0501082_0116952 | 3300060353 | Bacteria | 2309 |
| 1084 | Ga0501082_0312747 | 3300060353 | Bacteria | 1368 |
| 1085 | Ga0501082_0415173 | 3300060353 | Bacteria | 1175 |
| 1086 | Ga0501082_0735425 | 3300060353 | Bacteria | 863 |
| 1087 | Ga0466962_0092014 | 3300061719 | Bacteria | 1454 |
| 1088 | Ga0070679_100351705 | |||
| 1089 | JGI24741J21665_1011317 | |||
| 1090 | JGI24752J21851_1004034 | |||
| 1091 | JGI24746J21847_1003951 | |||
| 1092 | JGI24739J22299_10004113 | |||
| 1093 | JGI24739J22299_10068188 | |||
| 1094 | JGI24737J22298_10001610 | |||
| 1095 | JGI24743J22301_10004729 | |||
| 1096 | JGI24735J21928_10044950 | |||
| 1097 | JGI24750J21931_1000047 | |||
| 1098 | JGI24745J21846_1001071 | |||
| 1099 | JGI24748J21848_1005915 | |||
| 1100 | JGI24738J21930_10011556 | |||
| 1101 | JGI24749J21850_1006539 | |||
| 1102 | JGI24749J21850_1008897 | |||
| 1103 | JGI24744J21845_10002333 | |||
| 1104 | JGI24035J26624_1000692 | |||
| 1105 | JGI24033J26618_1000780 | |||
| 1106 | JGI24034J26672_10001282 | |||
| 1107 | JGI24742J22300_10000108 | |||
| 1108 | JGI24751J29686_10015732 | |||
| 1109 | JGI26145J50221_1002138 | |||
| 1110 | JGI25405J52794_10005075 | |||
| 1111 | Ga0065715_10000365 | |||
| 1112 | Ga0065715_10000449 | |||
| 1113 | Ga0070658_10077465 | |||
| 1114 | Ga0070658_10134776 | |||
| 1115 | Ga0070658_10293425 | |||
| 1116 | Ga0070676_10005804 | |||
| 1117 | Ga0070683_100027713 | |||
| 1118 | Ga0070683_100275485 | |||
| 1119 | Ga0070683_100408101 | |||
| 1120 | Ga0070690_100003335 | |||
| 1121 | Ga0070690_100013679 | |||
| 1122 | Ga0070690_100093275 | |||
| 1123 | Ga0070670_100019704 | |||
| 1124 | Ga0070670_100020956 | |||
| 1125 | Ga0070677_10000823 | |||
| 1126 | Ga0068869_100004243 | |||
| 1127 | Ga0068869_100189633 | |||
| 1128 | Ga0070666_10004766 | |||
| 1129 | Ga0070680_100007952 | |||
| 1130 | Ga0070680_100011474 | |||
| 1131 | Ga0070680_100111122 | |||
| 1132 | Ga0070680_100221240 | |||
| 1133 | Ga0070680_100417469 | |||
| 1134 | Ga0070680_100515319 | |||
| 1135 | Ga0070680_101149991 | |||
| 1136 | Ga0070682_100031542 | |||
| 1137 | Ga0068868_100007863 | |||
| 1138 | Ga0068868_100117520 | |||
| 1139 | Ga0068868_101049558 | |||
| 1140 | Ga0068868_101727891 | |||
| 1141 | Ga0070660_100000419 | |||
| 1142 | Ga0070689_100000784 | |||
| 1143 | Ga0070689_100345386 | |||
| 1144 | Ga0070691_10006949 | |||
| 1145 | Ga0070691_10044077 | |||
| 1146 | Ga0070691_10053380 | |||
| 1147 | Ga0070691_10192924 | |||
| 1148 | Ga0070691_10219092 | |||
| 1149 | Ga0070687_100004162 | |||
| 1150 | Ga0070687_100084021 | |||
| 1151 | Ga0070687_100164990 | |||
| 1152 | Ga0070661_100005802 | |||
| 1153 | Ga0070661_100548180 | |||
| 1154 | Ga0070692_10000927 | |||
| 1155 | Ga0070668_100016262 | |||
| 1156 | Ga0070668_100772738 | |||
| 1157 | Ga0070669_100010373 | |||
| 1158 | Ga0070675_100019626 | |||
| 1159 | Ga0070675_100050814 | |||
| 1160 | Ga0070675_100585896 | |||
| 1161 | Ga0070671_100340998 | |||
| 1162 | Ga0070671_100482294 | |||
| 1163 | Ga0070674_100004604 | |||
| 1164 | Ga0070674_100150354 | |||
| 1165 | Ga0070674_100497457 | |||
| 1166 | Ga0070673_100010441 | |||
| 1167 | Ga0070673_100013492 | |||
| 1168 | Ga0070673_100077593 | |||
| 1169 | Ga0070688_100000956 | |||
| 1170 | Ga0070688_100010878 | |||
| 1171 | Ga0070659_100023866 | |||
| 1172 | Ga0070659_100063256 | |||
| 1173 | Ga0070659_101006776 | |||
| 1174 | Ga0070667_100003581 | |||
| 1175 | Ga0070667_100141277 | |||
| 1176 | Ga0070667_100291441 | |||
| 1177 | Ga0070703_10002961 | |||
| 1178 | Ga0070709_10000959 | |||
| 1179 | Ga0070709_10070122 | |||
| 1180 | Ga0070709_10181050 | |||
| 1181 | Ga0070709_10259764 | |||
| 1182 | Ga0070714_100082526 | |||
| 1183 | Ga0070714_100190392 | |||
| 1184 | Ga0070714_100543241 | |||
| 1185 | Ga0070713_100010662 | |||
| 1186 | Ga0070713_100013123 | |||
| 1187 | Ga0070713_100022631 | |||
| 1188 | Ga0070713_100713209 | |||
| 1189 | Ga0070710_10002603 | |||
| 1190 | Ga0070710_10008826 | |||
| 1191 | Ga0070710_10359419 | |||
| 1192 | Ga0070710_10600219 | |||
| 1193 | Ga0070701_10001072 | |||
| 1194 | Ga0070711_100009109 | |||
| 1195 | Ga0070711_100360114 | |||
| 1196 | Ga0070711_100587830 | |||
| 1197 | Ga0070705_100004361 | |||
| 1198 | Ga0070705_100115495 | |||
| 1199 | Ga0070700_100005661 | |||
| 1200 | Ga0070694_100003415 | |||
| 1201 | Ga0070694_101115998 | |||
| 1202 | Ga0070708_100395300 | |||
| 1203 | Ga0070663_100015502 | |||
| 1204 | Ga0070663_100022520 | |||
| 1205 | Ga0070663_100028982 | |||
| 1206 | Ga0070663_100030908 | |||
| 1207 | Ga0070678_100010190 | |||
| 1208 | Ga0070678_100011179 | |||
| 1209 | Ga0070678_100101916 | |||
| 1210 | Ga0070662_100023224 | |||
| 1211 | Ga0070662_100107164 | |||
| 1212 | Ga0070662_100900873 | |||
| 1213 | Ga0070681_10001622 | |||
| 1214 | Ga0070681_10016579 | |||
| 1215 | Ga0070681_10062985 | |||
| 1216 | Ga0070681_10499329 | |||
| 1217 | Ga0070681_10650651 | |||
| 1218 | Ga0070681_11516973 | |||
| 1219 | Ga0070681_11651251 | |||
| 1220 | Ga0068867_100018127 | |||
| 1221 | Ga0068867_100569322 | |||
| 1222 | Ga0068867_100671701 | |||
| 1223 | Ga0070685_10006135 | |||
| 1224 | Ga0070685_10008365 | |||
| 1225 | Ga0070685_10140704 | |||
| 1226 | Ga0070707_100229177 | |||
| 1227 | Ga0070707_100902897 | |||
| 1228 | Ga0070699_100182991 | |||
| 1229 | Ga0070679_100018168 | |||
| 1230 | Ga0070679_100074050 | |||
| 1231 | Ga0070679_100103127 | |||
| 1232 | Ga0070679_100497050 | |||
| 1233 | Ga0070679_100539612 | |||
| 1234 | Ga0070679_100763948 | |||
| 1235 | Ga0070679_101311459 | |||
| 1236 | Ga0070679_101821276 | |||
| 1237 | Ga0070684_100007664 | |||
| 1238 | Ga0070684_100136515 | |||
| 1239 | Ga0070697_101028174 | |||
| 1240 | Ga0068853_100009267 | |||
| 1241 | Ga0068853_100714236 | |||
| 1242 | Ga0070686_100003330 | |||
| 1243 | Ga0070686_100009318 | |||
| 1244 | Ga0070686_100061657 | |||
| 1245 | Ga0070695_100007284 | |||
| 1246 | Ga0070695_100062036 | |||
| 1247 | Ga0070696_100009140 | |||
| 1248 | Ga0070696_100028902 | |||
| 1249 | Ga0070693_100009938 | |||
| 1250 | Ga0070665_100122566 | |||
| 1251 | Ga0070704_100000799 | |||
| 1252 | Ga0070704_100029063 | |||
| 1253 | Ga0068855_100231552 | |||
| 1254 | Ga0068855_100713392 | |||
| 1255 | Ga0068855_100762992 | |||
| 1256 | Ga0068855_101035280 | |||
| 1257 | Ga0070664_100061274 | |||
| 1258 | Ga0070664_100150393 | |||
| 1259 | Ga0070664_100190826 | |||
| 1260 | Ga0070664_100502627 | |||
| 1261 | Ga0070664_100562882 | |||
| 1262 | Ga0068854_100000702 | |||
| 1263 | Ga0068854_100134727 | |||
| 1264 | Ga0068856_100053436 | |||
| 1265 | Ga0068856_101177549 | |||
| 1266 | Ga0068856_101189361 | |||
| 1267 | Ga0070702_100004763 | |||
| 1268 | Ga0070702_100048350 | |||
| 1269 | Ga0068852_100002168 | |||
| 1270 | Ga0068852_100142940 | |||
| 1271 | Ga0068859_100066290 | |||
| 1272 | Ga0068859_100394915 | |||
| 1273 | Ga0068866_10133151 | |||
| 1274 | Ga0068861_100143197 | |||
| 1275 | Ga0068863_100710284 | |||
| 1276 | Ga0068863_101494468 | |||
| 1277 | Ga0068863_101732598 | |||
| 1278 | Ga0068858_100000657 | |||
| 1279 | Ga0068858_100177384 | |||
| 1280 | Ga0068858_101258818 | |||
| 1281 | Ga0068860_100039959 | |||
| 1282 | Ga0068860_100125999 | |||
| 1283 | Ga0068860_100331967 | |||
| 1284 | Ga0068862_100096723 | |||
| 1285 | Ga0068862_100366129 | |||
| 1286 | Ga0070717_10000720 | |||
| 1287 | Ga0070717_10264413 | |||
| 1288 | Ga0075365_10171872 | |||
| 1289 | Ga0075368_10203879 | |||
| 1290 | Ga0075363_100131669 | |||
| 1291 | Ga0075363_100752716 | |||
| 1292 | Ga0075364_10630249 | |||
| 1293 | Ga0075364_10822761 | |||
| 1294 | Ga0070715_10000434 | |||
| 1295 | Ga0070716_100022246 | |||
| 1296 | Ga0070712_100062335 | |||
| 1297 | Ga0070712_100274528 | |||
| 1298 | Ga0075362_10202996 | |||
| 1299 | Ga0075427_10000902 | |||
| 1300 | Ga0097621_100000078 | |||
| 1301 | Ga0097621_100013381 | |||
| 1302 | Ga0097621_100025587 | |||
| 1303 | Ga0075370_10100460 | |||
| 1304 | Ga0068871_100049791 | |||
| 1305 | Ga0068871_100108912 | |||
| 1306 | Ga0075428_100001638 | |||
| 1307 | Ga0075431_100001119 | |||
| 1308 | Ga0075431_100504567 | |||
| 1309 | Ga0075434_100003370 | |||
| 1310 | Ga0075434_100043579 | |||
| 1311 | Ga0075434_100265934 | |||
| 1312 | Ga0075434_100353360 | |||
| 1313 | Ga0075434_100596772 | |||
| 1314 | Ga0075429_100002649 | |||
| 1315 | Ga0068865_100000155 | |||
| 1316 | Ga0068865_100060317 | |||
| 1317 | Ga0075436_100012844 | |||
| 1318 | Ga0075436_100040929 | |||
| 1319 | Ga0075436_101117334 | |||
| 1320 | Ga0097620_100066295 | |||
| 1321 | Ga0097620_100394916 | |||
| 1322 | Ga0075435_100000970 | |||
| 1323 | Ga0075435_100008956 | |||
| 1324 | Ga0075435_100015334 | |||
| 1325 | Ga0105251_10058512 | |||
| 1326 | Ga0105251_10161613 | |||
| 1327 | Ga0105250_10036768 | |||
| 1328 | Ga0105240_10084806 | |||
| 1329 | Ga0105240_10154758 | |||
| 1330 | Ga0105240_10349069 | |||
| 1331 | Ga0105240_10996763 | |||
| 1332 | Ga0105240_11521840 | |||
| 1333 | Ga0111539_10010049 | |||
| 1334 | Ga0111539_10161211 | |||
| 1335 | Ga0111539_10383332 | |||
| 1336 | Ga0111539_11035230 | |||
| 1337 | Ga0111539_11723268 | |||
| 1338 | Ga0105245_10005766 | |||
| 1339 | Ga0105245_10030396 | |||
| 1340 | Ga0105245_10045065 | |||
| 1341 | Ga0105245_11957796 | |||
| 1342 | Ga0105247_10002157 | |||
| 1343 | Ga0105247_10018587 | |||
| 1344 | Ga0105247_10019956 | |||
| 1345 | Ga0105247_10119319 | |||
| 1346 | Ga0114129_10006926 | |||
| 1347 | Ga0114129_10022324 | |||
| 1348 | Ga0105243_10007171 | |||
| 1349 | Ga0105243_10043547 | |||
| 1350 | Ga0105243_10050124 | |||
| 1351 | Ga0105241_10008937 | |||
| 1352 | Ga0105241_10130906 | |||
| 1353 | Ga0105241_10652218 | |||
| 1354 | Ga0105241_11260244 | |||
| 1355 | Ga0105242_10004516 | |||
| 1356 | Ga0105242_10008202 | |||
| 1357 | Ga0105242_10369258 | |||
| 1358 | Ga0105248_10004213 | |||
| 1359 | Ga0105248_10014034 | |||
| 1360 | Ga0105248_10050815 | |||
| 1361 | Ga0105237_10012499 | |||
| 1362 | Ga0105237_10141573 | |||
| 1363 | Ga0105237_10152802 | |||
| 1364 | Ga0105238_10277489 | |||
| 1365 | Ga0105238_10703760 | |||
| 1366 | Ga0105238_10917172 | |||
| 1367 | Ga0105238_11002414 | |||
| 1368 | Ga0105238_13029066 | |||
| 1369 | Ga0105249_10031751 | |||
| 1370 | Ga0105249_10512897 | |||
| 1371 | Ga0105239_10062241 | |||
| 1372 | Ga0105239_10071125 | |||
| 1373 | Ga0105239_10324428 | |||
| 1374 | Ga0105246_10016930 | |||
| 1375 | Ga0105246_10053493 | |||
| 1376 | Ga0105246_10068024 | |||
| 1377 | Ga0105246_10115022 | |||
| 1378 | Ga0157337_1001327 | |||
| 1379 | Ga0157322_1019911 | |||
| 1380 | Ga0157373_10040872 | |||
| 1381 | Ga0157373_10209706 | |||
| 1382 | Ga0157373_10258185 | |||
| 1383 | Ga0157373_10682808 | |||
| 1384 | Ga0157371_10004410 | |||
| 1385 | Ga0157371_10056650 | |||
| 1386 | Ga0157371_11184194 | |||
| 1387 | Ga0157370_10031648 | |||
| 1388 | Ga0157370_10480050 | |||
| 1389 | Ga0157370_10755511 | |||
| 1390 | Ga0157369_10086258 | |||
| 1391 | Ga0157369_10508418 | |||
| 1392 | Ga0157369_10825812 | |||
| 1393 | Ga0157369_11020478 | |||
| 1394 | Ga0157374_10035360 | |||
| 1395 | Ga0157374_10182533 | |||
| 1396 | Ga0157374_10201751 | |||
| 1397 | Ga0157374_10316041 | |||
| 1398 | Ga0157378_10004404 | |||
| 1399 | Ga0157378_10053633 | |||
| 1400 | Ga0157378_10155903 | |||
| 1401 | Ga0157378_11187199 | |||
| 1402 | Ga0163162_10053663 | |||
| 1403 | Ga0163162_10220284 | |||
| 1404 | Ga0163162_11519017 | |||
| 1405 | Ga0157372_10012919 | |||
| 1406 | Ga0157372_10068346 | |||
| 1407 | Ga0157372_10319154 | |||
| 1408 | Ga0157372_10758855 | |||
| 1409 | Ga0157372_11351125 | |||
| 1410 | Ga0157372_11682640 | |||
| 1411 | Ga0157375_10023952 | |||
| 1412 | Ga0157375_12381496 | |||
| 1413 | Ga0163163_10002553 | |||
| 1414 | Ga0163163_10063209 | |||
| 1415 | Ga0163163_10135570 | |||
| 1416 | Ga0163163_10185607 | |||
| 1417 | Ga0157380_10153380 | |||
| 1418 | Ga0157380_10323259 | |||
| 1419 | Ga0182008_10339428 | |||
| 1420 | Ga0157377_10011447 | |||
| 1421 | Ga0157377_10071860 | |||
| 1422 | Ga0157379_10000539 | |||
| 1423 | Ga0157379_10011925 | |||
| 1424 | Ga0157379_10041604 | |||
| 1425 | Ga0157379_10254918 | |||
| 1426 | Ga0157376_10035583 | |||
| 1427 | Ga0157376_10429982 | |||
| 1428 | Ga0157376_10896274 | |||
| 1429 | Ga0163161_10156427 | |||
| 1430 | Ga0163161_10294116 | |||
| 1431 | Ga0206356_11650372 | |||
| 1432 | Ga0206354_11487445 | |||
| 1433 | Ga0213876_10069391 | |||
| 1434 | Ga0213876_10121321 | |||
| 1435 | Ga0207666_1000522 | |||
| 1436 | Ga0207697_10004732 | |||
| 1437 | Ga0207656_10438672 | |||
| 1438 | Ga0207653_10002374 | |||
| 1439 | Ga0207692_10031568 | |||
| 1440 | Ga0207692_10068011 | |||
| 1441 | Ga0207692_10216566 | |||
| 1442 | Ga0207692_11004208 | |||
| 1443 | Ga0207642_10083253 | |||
| 1444 | Ga0207710_10524713 | |||
| 1445 | Ga0207688_10011771 | |||
| 1446 | Ga0207680_10010419 | |||
| 1447 | Ga0207680_10268720 | |||
| 1448 | Ga0207647_10007623 | |||
| 1449 | Ga0207685_10006002 | |||
| 1450 | Ga0207699_10005253 | |||
| 1451 | Ga0207699_10110016 | |||
| 1452 | Ga0207705_10375929 | |||
| 1453 | Ga0207705_10415933 | |||
| 1454 | Ga0207705_11280599 | |||
| 1455 | Ga0207707_10028853 | |||
| 1456 | Ga0207707_10066726 | |||
| 1457 | Ga0207707_10253050 | |||
| 1458 | Ga0207707_10393736 | |||
| 1459 | Ga0207707_11652340 | |||
| 1460 | Ga0207695_10034276 | |||
| 1461 | Ga0207695_10849137 | |||
| 1462 | Ga0207671_10513123 | |||
| 1463 | Ga0207693_10031101 | |||
| 1464 | Ga0207693_10101956 | |||
| 1465 | Ga0207693_10367682 | |||
| 1466 | Ga0207693_11184597 | |||
| 1467 | Ga0207663_10083400 | |||
| 1468 | Ga0207663_10105872 | |||
| 1469 | Ga0207663_10172873 | |||
| 1470 | Ga0207663_11069084 | |||
| 1471 | Ga0207660_10094332 | |||
| 1472 | Ga0207660_10241643 | |||
| 1473 | Ga0207660_10479820 | |||
| 1474 | Ga0207660_10481916 | |||
| 1475 | Ga0207660_11315965 | |||
| 1476 | Ga0207657_10722561 | |||
| 1477 | Ga0207657_10946503 | |||
| 1478 | Ga0207649_10183004 | |||
| 1479 | Ga0207649_10443418 | |||
| 1480 | Ga0207652_10025519 | |||
| 1481 | Ga0207652_10054252 | |||
| 1482 | Ga0207652_10123726 | |||
| 1483 | Ga0207652_10139752 | |||
| 1484 | Ga0207646_10518065 | |||
| 1485 | Ga0207694_10099036 | |||
| 1486 | Ga0207694_10534586 | |||
| 1487 | Ga0207694_10740513 | |||
| 1488 | Ga0207694_11521679 | |||
| 1489 | Ga0207650_10045297 | |||
| 1490 | Ga0207659_10011825 | |||
| 1491 | Ga0207659_10521539 | |||
| 1492 | Ga0207687_10033774 | |||
| 1493 | Ga0207687_10962425 | |||
| 1494 | Ga0207687_11652759 | |||
| 1495 | Ga0207700_10003137 | |||
| 1496 | Ga0207700_10011504 | |||
| 1497 | Ga0207700_10122195 | |||
| 1498 | Ga0207664_10233160 | |||
| 1499 | Ga0207644_10006166 | |||
| 1500 | Ga0207706_10010270 | |||
| 1501 | Ga0207706_10020507 | |||
| 1502 | Ga0207706_10037101 | |||
| 1503 | Ga0207686_10047722 | |||
| 1504 | Ga0207709_10005421 | |||
| 1505 | Ga0207709_10024667 | |||
| 1506 | Ga0207709_10086990 | |||
| 1507 | Ga0207670_10057666 | |||
| 1508 | Ga0207669_10405325 | |||
| 1509 | Ga0207704_10012530 | |||
| 1510 | Ga0207704_10361079 | |||
| 1511 | Ga0207665_10001296 | |||
| 1512 | Ga0207665_10135073 | |||
| 1513 | Ga0207665_10234006 | |||
| 1514 | Ga0207691_10022732 | |||
| 1515 | Ga0207711_10022254 | |||
| 1516 | Ga0207711_10035620 | |||
| 1517 | Ga0207689_10000503 | |||
| 1518 | Ga0207689_10597414 | |||
| 1519 | Ga0207661_10206126 | |||
| 1520 | Ga0207661_10436359 | |||
| 1521 | Ga0207661_11802428 | |||
| 1522 | Ga0207679_10110505 | |||
| 1523 | Ga0207679_10216184 | |||
| 1524 | Ga0207667_10005613 | |||
| 1525 | Ga0207667_10054142 | |||
| 1526 | Ga0207667_10500724 | |||
| 1527 | Ga0207667_11061334 | |||
| 1528 | Ga0207667_12193796 | |||
| 1529 | Ga0207712_10005771 | |||
| 1530 | Ga0207712_10020865 | |||
| 1531 | Ga0207640_10105047 | |||
| 1532 | Ga0207640_11078160 | |||
| 1533 | Ga0207658_10309801 | |||
| 1534 | Ga0207658_10544610 | |||
| 1535 | Ga0207677_10209966 | |||
| 1536 | Ga0207677_10711149 | |||
| 1537 | Ga0207703_10025900 | |||
| 1538 | Ga0207703_11092390 | |||
| 1539 | Ga0207703_11230866 | |||
| 1540 | Ga0207639_10141075 | |||
| 1541 | Ga0207639_10380899 | |||
| 1542 | Ga0207678_10045454 | |||
| 1543 | Ga0207678_10050320 | |||
| 1544 | Ga0207708_10075664 | |||
| 1545 | Ga0207702_10136832 | |||
| 1546 | Ga0207702_10147378 | |||
| 1547 | Ga0207702_11000602 | |||
| 1548 | Ga0207702_11309932 | |||
| 1549 | Ga0207648_10143054 | |||
| 1550 | Ga0207676_12056059 | |||
| 1551 | Ga0207683_10000069 | |||
| 1552 | Ga0207683_10010482 | |||
| 1553 | Ga0207683_12058167 | |||
| 1554 | Ga0207698_10104588 | |||
| 1555 | Ga0207698_11877715 | |||
| 1556 | Ga0209968_1017344 | |||
| 1557 | Ga0209999_1018733 | |||
| 1558 | Ga0209971_1009614 | |||
| 1559 | Ga0209966_1000576 | |||
| 1560 | Ga0209998_10002030 | |||
| 1561 | Ga0209998_10024511 | |||
| 1562 | Ga0209813_10148679 | |||
| 1563 | Ga0209974_10030337 | |||
| 1564 | Ga0207428_10000908 | |||
| 1565 | Ga0207428_10187035 | |||
| 1566 | Ga0268266_10023731 | |||
| 1567 | Ga0268266_10300327 | |||
| 1568 | Ga0268265_10120394 | |||
| 1569 | Ga0268265_11636935 | |||
| 1570 | Ga0268264_10023011 | |||
| 1571 | Ga0268264_10282408 | |||
| 1572 | Ga0268264_10484029 | |||
| 1573 | Ga0265337_1002835 | |||
| 1574 | Ga0265326_10095687 | |||
| 1575 | Ga0265334_10098678 | |||
| 1576 | Ga0265336_10021931 | |||
| 1577 | Ga0265338_10050343 | |||
| 1578 | Ga0265338_10091302 | |||
| 1579 | Ga0265338_10668293 | |||
| 1580 | Ga0265332_10174674 | |||
| 1581 | Ga0265332_10273513 | |||
| 1582 | Ga0265325_10003859 | |||
| 1583 | Ga0265325_10005573 | |||
| 1584 | Ga0265325_10029752 | |||
| 1585 | Ga0265329_10143255 | |||
| 1586 | Ga0265340_10014118 | |||
| 1587 | Ga0265340_10056702 | |||
| 1588 | Ga0265339_10004140 | |||
| 1589 | Ga0265339_10074226 | |||
| 1590 | Ga0265331_10082424 | |||
| 1591 | Ga0265316_10114851 | |||
| 1592 | Ga0265316_10816179 | |||
| 1593 | Ga0307408_100486467 | |||
| 1594 | Ga0265313_10000176 | |||
| 1595 | Ga0265313_10002253 | |||
| 1596 | Ga0265313_10014273 | |||
| 1597 | Ga0265313_10163158 | |||
| 1598 | Ga0265313_10215928 | |||
| 1599 | Ga0316579_10167313 | |||
| 1600 | Ga0265314_10002100 | |||
| 1601 | Ga0265342_10005459 | |||
| 1602 | Ga0307405_10482444 | |||
| 1603 | Ga0307405_10797507 | |||
| 1604 | Ga0307410_10739151 | |||
| 1605 | Ga0326468_10089776 | |||
| 1606 | Ga0307406_10285833 | |||
| 1607 | Ga0307409_100496611 | |||
| 1608 | Ga0307409_101102091 | |||
| 1609 | Ga0307414_10634363 | |||
| 1610 | Ga0373930_0037693 | |||
| 1611 | Ga0373950_0001194 | |||
| 1612 | Ga0373950_0059277 | |||
| 1613 | Ga0373958_0022229 | |||
| 1614 | Ga0373959_0015987 | |||
| 1615 | Ga0373938_0009995 | |||
| 1616 | Ga0373938_0050346 | |||
| 1617 | Ga0373926_0008736 | |||
| 1618 | Ga0373926_0015201 | |||
| 1619 | Ga0373928_0003734 | |||
| 1620 | Ga0373929_0029716 | |||
| 1621 | Ga0373934_0040577 | |||
| 1622 | Ga0373934_0166821 | |||
| 1623 | Ga0373934_0395284 | |||
| 1624 | Ga0373944_0001606 | |||
| 1625 | Ga0373944_0131808 | |||
| 1626 | Ga0373949_0005414 | |||
| 1627 | Ga0373951_0010287 | |||
| 1628 | Ga0373951_0066138 | |||
| 1629 | Ga0373952_0001423 | |||
| 1630 | Ga0373952_0002309 | |||
| 1631 | Ga0373923_0002777 | |||
| 1632 | Ga0373923_0072262 | |||
| 1633 | Ga0373932_0021345 | |||
| 1634 | Ga0373936_0012971 | |||
| 1635 | Ga0373936_0101539 | |||
| 1636 | Ga0373939_0003721 | |||
| 1637 | Ga0373939_0003841 | |||
| 1638 | Ga0373941_0001156 | |||
| 1639 | Ga0373945_0004846 | |||
| 1640 | Ga0373945_0024843 | |||
| 1641 | Ga0373945_0169817 | |||
| 1642 | Ga0373953_0002682 | |||
| 1643 | Ga0373953_0023138 | |||
| 1644 | Ga0373953_0041143 | |||
| 1645 | Ga0373953_0217037 | |||
| 1646 | Ga0373954_0009519 | |||
| 1647 | Ga0373954_0022029 | |||
| 1648 | Ga0373954_0039070 | |||
| 1649 | Ga0373954_0051526 | |||
| 1650 | Ga0373954_0655818 | |||
| 1651 | Ga0373956_0008662 | |||
| 1652 | Ga0373956_0047792 | |||
| 1653 | Ga0373956_0359740 | |||
| 1654 | Ga0373957_0007212 | |||
| 1655 | Ga0373957_0022723 | |||
| 1656 | Ga0373957_0055364 | |||
| 1657 | Ga0373957_0160814 | |||
| 1658 | Ga0373957_0246082 | |||
| 1659 | Ga0373957_0305953 | |||
| 1660 | Ga0373960_0013894 | |||
| 1661 | Ga0373943_0067957 | |||
| 1662 | Ga0373943_0073111 | |||
| 1663 | Ga0373946_0002576 | |||
| 1664 | Ga0373946_0010115 | |||
| 1665 | Ga0373946_0046646 | |||
| 1666 | Ga0373955_0003855 | |||
| 1667 | Ga0373955_0004998 | |||
| 1668 | Ga0373955_0014019 | |||
| 1669 | Ga0373955_0207324 | |||
| 1670 | Ga0373955_0210402 | |||
| 1671 | Ga0373955_0585994 | |||
| 1672 | Ga0373942_0001355 | |||
| 1673 | Ga0373961_0014826 | |||
| 1674 | Ga0373961_0050761 | |||
| 1675 | Ga0373961_0216948 | |||
| 1676 | Ga0373962_0000166 | |||
| 1677 | Ga0373962_0048164 | |||
| 1678 | Ga0373962_0130938 | |||
| 1679 | Ga0373924_0002225 | |||
| 1680 | Ga0373924_0010364 | |||
| 1681 | Ga0373924_0109631 | |||
| 1682 | Ga0373924_0268905 | |||
| 1683 | Ga0373931_0007472 | |||
| 1684 | Ga0373931_0644954 | |||
| 1685 | Ga0373935_0012906 | |||
| 1686 | Ga0373935_0499727 | |||
| 1687 | Ga0373927_0006775 | |||
| 1688 | Ga0373927_0007569 | |||
| 1689 | Ga0373927_0088737 | |||
| 1690 | Ga0373927_1148481 | |||
| 1691 | Ga0373933_0001315 | |||
| 1692 | Ga0373933_0017514 | |||
| 1693 | Ga0373933_0034589 | |||
| 1694 | Ga0373933_0167902 | |||
| 1695 | Ga0373933_0468519 | |||
| 1696 | Ga0373933_0483350 | |||
| 1697 | Ga0373947_0003183 | |||
| 1698 | Ga0373947_0061133 | |||
| 1699 | Ga0373937_0001948 | |||
| 1700 | Ga0373937_0004646 | |||
| 1701 | Ga0373937_0005491 | |||
| 1702 | Ga0373937_0010388 | |||
| 1703 | Ga0373937_0019993 | |||
| 1704 | Ga0373937_0226570 | |||
| 1705 | Ga0373937_0376696 | |||
| 1706 | Ga0373937_0427662 | |||
| 1707 | Ga0373937_1107503 | |||
| 1708 | Ga0373937_1555402 | |||
| 1709 | Ga0316582_0137188 | |||
| 1710 | Ga0373925_0004198 | |||
| 1711 | Ga0373925_0051762 | |||
| 1712 | Ga0373925_0052206 | |||
| 1713 | Ga0395899_0036297 | |||
| 1714 | Ga0395899_0286870 | |||
| 1715 | Ga0395900_0002100 | |||
| 1716 | Ga0395900_0017672 | |||
| 1717 | Ga0395898_0043461 | |||
| 1718 | Ga0395898_0081163 | |||
| 1719 | Ga0395898_0231014 | |||
| 1720 | Ga0395901_0009830 | |||
| 1721 | Ga0395901_0266230 | |||
| 1722 | Ga0395901_0554734 | |||
| 1723 | Ga0395901_0755820 | |||
| 1724 | Ga0436365_0134733 | |||
| 1725 | Ga0436365_0725591 | |||
| 1726 | Ga0436365_1517860 | |||
| 1727 | Ga0451791_1740671 | |||
| 1728 | Ga0451841_0412571 | |||
| 1729 | Ga0451853_3541983 | |||
| 1730 | Ga0439448_0097514 | |||
| 1731 | Ga0439448_0142853 | |||
| 1732 | Ga0439448_0180167 | |||
| 1733 | Ga0439450_019932 | |||
| 1734 | Ga0439455_0013508 | |||
| 1735 | Ga0439456_049853 | |||
| 1736 | Ga0439463_014054 | |||
| 1737 | Ga0439463_108239 | |||
| 1738 | Ga0439458_0042380 | |||
| 1739 | Ga0439435_0147665 | |||
| 1740 | Ga0439444_0040634 | |||
| 1741 | Ga0439444_0188226 | |||
| 1742 | Ga0439464_0021635 | |||
| 1743 | Ga0439440_0016866 | |||
| 1744 | Ga0453683_0409132 | |||
| 1745 | Ga0466965_0311279 | |||
| 1746 | Ga0466966_0033677 | |||
| 1747 | Ga0466961_0048682 | |||
| 1748 | Ga0466963_0011092 | |||
| 1749 | Ga0466963_0062318 | |||
| 1750 | Ga0466963_0195957 | |||
| 1751 | Ga0466963_0236917 | |||
| 1752 | Ga0466963_0244750 | |||
| 1753 | Ga0466963_0798831 | |||
| 1754 | Ga0466971_0384545 | |||
| 1755 | Ga0466971_0562414 | |||
| 1756 | Ga0466957_0003449 | |||
| 1757 | Ga0466957_0033443 | |||
| 1758 | Ga0466957_0578932 | |||
| 1759 | Ga0466959_0016488 | |||
| 1760 | Ga0466959_0273282 | |||
| 1761 | Ga0466958_0025916 | |||
| 1762 | Ga0466958_0033391 | |||
| 1763 | Ga0466958_0164319 | |||
| 1764 | Ga0466958_0203098 | |||
| 1765 | Ga0466958_0362882 | |||
| 1766 | Ga0466967_0003827 | |||
| 1767 | Ga0466967_0022912 | |||
| 1768 | Ga0466967_0361817 | |||
| 1769 | Ga0495617_009204 | |||
| 1770 | Ga0495592_0001659 | |||
| 1771 | Ga0495592_0002844 | |||
| 1772 | Ga0495592_0002937 | |||
| 1773 | Ga0495592_0091752 | |||
| 1774 | Ga0495592_0134271 | |||
| 1775 | Ga0495592_0509116 | |||
| 1776 | Ga0495603_0017650 | |||
| 1777 | Ga0495603_0021917 | |||
| 1778 | Ga0495603_0046482 | |||
| 1779 | Ga0495629_0000820 | |||
| 1780 | Ga0495629_0054204 | |||
| 1781 | Ga0495629_0125985 | |||
| 1782 | Ga0495629_0249468 | |||
| 1783 | Ga0495629_0512068 | |||
| 1784 | Ga0495641_0019209 | |||
| 1785 | Ga0495641_0042047 | |||
| 1786 | Ga0495651_0001330 | |||
| 1787 | Ga0495651_0002388 | |||
| 1788 | Ga0495651_0008754 | |||
| 1789 | Ga0495651_0061982 | |||
| 1790 | Ga0495651_0067691 | |||
| 1791 | Ga0495651_0433583 | |||
| 1792 | Ga0495653_0010963 | |||
| 1793 | Ga0495653_0014755 | |||
| 1794 | Ga0495653_0024736 | |||
| 1795 | Ga0495653_0061019 | |||
| 1796 | Ga0495580_0007477 | |||
| 1797 | Ga0495580_0145193 | |||
| 1798 | Ga0495582_0002118 | |||
| 1799 | Ga0495582_0065823 | |||
| 1800 | Ga0495582_0082183 | |||
| 1801 | Ga0495605_0166319 | |||
| 1802 | Ga0495639_0004776 | |||
| 1803 | Ga0495639_0024628 | |||
| 1804 | Ga0495639_0043030 | |||
| 1805 | Ga0495662_0049089 | |||
| 1806 | Ga0495662_0104000 | |||
| 1807 | Ga0495664_0003775 | |||
| 1808 | Ga0495664_0005939 | |||
| 1809 | Ga0495664_0030892 | |||
| 1810 | Ga0495584_0099329 | |||
| 1811 | Ga0495584_0118693 | |||
| 1812 | Ga0495585_0001819 | |||
| 1813 | Ga0495594_0060760 | |||
| 1814 | Ga0495594_0070027 | |||
| 1815 | Ga0495607_0026222 | |||
| 1816 | Ga0495608_0000456 | |||
| 1817 | Ga0495608_0026720 | |||
| 1818 | Ga0495608_0028820 | |||
| 1819 | Ga0495608_0046466 | |||
| 1820 | Ga0495608_0192177 | |||
| 1821 | Ga0495616_0178855 | |||
| 1822 | Ga0495618_0004121 | |||
| 1823 | Ga0495618_0004633 | |||
| 1824 | Ga0495628_0001503 | |||
| 1825 | Ga0495628_0014563 | |||
| 1826 | Ga0495628_0070676 | |||
| 1827 | Ga0495628_0287345 | |||
| 1828 | Ga0495630_0030356 | |||
| 1829 | Ga0495630_0273897 | |||
| 1830 | Ga0495637_0066348 | |||
| 1831 | Ga0495644_0030671 | |||
| 1832 | Ga0495663_0019820 | |||
| 1833 | Ga0495666_0003570 | |||
| 1834 | Ga0495652_0002402 | |||
| 1835 | Ga0495652_0007617 | |||
| 1836 | Ga0495652_0090695 | |||
| 1837 | Ga0495652_0121999 | |||
| 1838 | Ga0495652_0127148 | |||
| 1839 | Ga0495652_0497044 | |||
| 1840 | Ga0495665_0008032 | |||
| 1841 | Ga0495640_0009310 | |||
| 1842 | Ga0495640_0017560 | |||
| 1843 | Ga0495640_0081980 | |||
| 1844 | Ga0495640_0155249 | |||
| 1845 | Ga0495640_0179755 | |||
| 1846 | Ga0495640_0850710 | |||
| 1847 | Ga0495586_0000868 | |||
| 1848 | Ga0495586_0062998 | |||
| 1849 | Ga0495587_0018735 | |||
| 1850 | Ga0495587_0036933 | |||
| 1851 | Ga0495587_0077278 | |||
| 1852 | Ga0495587_0190812 | |||
| 1853 | Ga0495587_0499532 | |||
| 1854 | Ga0495598_0221759 | |||
| 1855 | Ga0495609_0024222 | |||
| 1856 | Ga0495609_0231874 | |||
| 1857 | Ga0495645_0000399 | |||
| 1858 | Ga0495645_0034116 | |||
| 1859 | Ga0495645_0053488 | |||
| 1860 | Ga0495645_0161493 | |||
| 1861 | Ga0495645_0278035 | |||
| 1862 | Ga0495645_0340636 | |||
| 1863 | Ga0495622_0001874 | |||
| 1864 | Ga0495622_0037383 | |||
| 1865 | Ga0495633_0005540 | |||
| 1866 | Ga0495667_0000832 | |||
| 1867 | Ga0495667_0005478 | |||
| 1868 | Ga0495667_0012581 | |||
| 1869 | Ga0495667_0014107 | |||
| 1870 | Ga0495667_0042353 | |||
| 1871 | Ga0495656_0006330 | |||
| 1872 | Ga0495634_0025861 | |||
| 1873 | Ga0495634_0055623 | |||
| 1874 | Ga0495634_0069998 | |||
| 1875 | Ga0495635_0002323 | |||
| 1876 | Ga0495635_0017866 | |||
| 1877 | Ga0495635_0021281 | |||
| 1878 | Ga0495635_0519840 | |||
| 1879 | Ga0495635_0632532 | |||
| 1880 | Ga0495659_0001022 | |||
| 1881 | Ga0495661_0021555 | |||
| 1882 | Ga0495588_0000486 | |||
| 1883 | Ga0495588_0029502 | |||
| 1884 | Ga0495588_0069692 | |||
| 1885 | Ga0495657_0008710 | |||
| 1886 | Ga0495657_0067045 | |||
| 1887 | Ga0495657_0199268 | |||
| 1888 | Ga0495657_0200963 | |||
| 1889 | Ga0495657_0362815 | |||
| 1890 | Ga0495599_0004419 | |||
| 1891 | Ga0495599_0012733 | |||
| 1892 | Ga0495599_0013002 | |||
| 1893 | Ga0495623_0022383 | |||
| 1894 | Ga0495623_0216416 | |||
| 1895 | Ga0495646_0001728 | |||
| 1896 | Ga0495646_0001784 | |||
| 1897 | Ga0495646_0581084 | |||
| 1898 | Ga0495647_0000847 | |||
| 1899 | Ga0495647_0009297 | |||
| 1900 | Ga0495647_0010230 | |||
| 1901 | Ga0495658_0000479 | |||
| 1902 | Ga0495658_0039147 | |||
| 1903 | Ga0495658_0046752 | |||
| 1904 | Ga0495658_0059534 | |||
| 1905 | Ga0495613_0010280 | |||
| 1906 | Ga0495613_0225454 | |||
| 1907 | Ga0495613_0351421 | |||
| 1908 | Ga0495624_0014088 | |||
| 1909 | Ga0495670_0013284 | |||
| 1910 | Ga0495589_0123449 | |||
| 1911 | Ga0495600_0001355 | |||
| 1912 | Ga0495600_0025982 | |||
| 1913 | Ga0495600_0032548 | |||
| 1914 | Ga0495600_0055458 | |||
| 1915 | Ga0495600_0260156 | |||
| 1916 | Ga0495581_0011814 | |||
| 1917 | Ga0495581_0026198 | |||
| 1918 | Ga0495581_0065595 | |||
| 1919 | Ga0495581_0386507 | |||
| 1920 | Ga0495604_0001255 | |||
| 1921 | Ga0495604_0003178 | |||
| 1922 | Ga0495604_0012787 | |||
| 1923 | Ga0495604_0062533 | |||
| 1924 | Ga0495604_0862465 | |||
| 1925 | Ga0495636_0366710 | |||
| 1926 | Ga0495674_0010576 | |||
| 1927 | Ga0495674_0017131 | |||
| 1928 | Ga0495674_0033805 | |||
| 1929 | Ga0495674_0061051 | |||
| 1930 | Ga0495674_0555985 | |||
| 1931 | Ga0495676_0042894 | |||
| 1932 | Ga0495676_0132622 | |||
| 1933 | Ga0495676_0272713 | |||
| 1934 | Ga0495680_0002523 | |||
| 1935 | Ga0495680_0006821 | |||
| 1936 | Ga0495680_0027186 | |||
| 1937 | Ga0495680_0037048 | |||
| 1938 | Ga0495680_0037795 | |||
| 1939 | Ga0495680_0039673 | |||
| 1940 | Ga0495680_0450118 | |||
| 1941 | Ga0495675_0000731 | |||
| 1942 | Ga0495675_0008665 | |||
| 1943 | Ga0495675_0021234 | |||
| 1944 | Ga0495675_0162683 | |||
| 1945 | Ga0495677_0054128 | |||
| 1946 | Ga0495684_0009500 | |||
| 1947 | Ga0495684_0010490 | |||
| 1948 | Ga0495684_0190316 | |||
| 1949 | Ga0495593_0021876 | |||
| 1950 | Ga0495593_0032629 | |||
| 1951 | Ga0495593_0098042 | |||
| 1952 | Ga0495602_0001314 | |||
| 1953 | Ga0495602_0015855 | |||
| 1954 | Ga0495602_0228318 | |||
| 1955 | Ga0495602_0644417 | |||
| 1956 | Ga0495614_0056720 | |||
| 1957 | Ga0496100_0000894 | |||
| 1958 | Ga0496100_0051780 | |||
| 1959 | Ga0496100_0056803 | |||
| 1960 | Ga0496101_0008463 | |||
| 1961 | Ga0496101_0017913 | |||
| 1962 | Ga0496101_0043614 | |||
| 1963 | Ga0496101_0080643 | |||
| 1964 | Ga0496101_0723507 | |||
| 1965 | Ga0496101_1020323 | |||
| 1966 | Ga0496101_1615351 | |||
| 1967 | Ga0496102_0017100 | |||
| 1968 | Ga0496102_0098605 | |||
| 1969 | Ga0496102_0131897 | |||
| 1970 | Ga0496103_0014513 | |||
| 1971 | Ga0496103_0031284 | |||
| 1972 | Ga0496103_0031726 | |||
| 1973 | Ga0496103_0107695 | |||
| 1974 | Ga0496104_0000061 | |||
| 1975 | Ga0496104_0010521 | |||
| 1976 | Ga0496104_0028757 | |||
| 1977 | Ga0496104_0180633 | |||
| 1978 | Ga0496105_0000365 | |||
| 1979 | Ga0496105_0002920 | |||
| 1980 | Ga0496105_0042986 | |||
| 1981 | Ga0496105_0061594 | |||
| 1982 | Ga0496106_0012105 | |||
| 1983 | Ga0496106_0043121 | |||
| 1984 | Ga0496106_0084133 | |||
| 1985 | Ga0496106_0227779 | |||
| 1986 | Ga0496106_0988095 | |||
| 1987 | Ga0496107_0045843 | |||
| 1988 | Ga0496107_0052267 | |||
| 1989 | Ga0496107_0222105 | |||
| 1990 | Ga0496107_0347702 | |||
| 1991 | Ga0496107_0493370 | |||
| 1992 | Ga0496108_0033735 | |||
| 1993 | Ga0496108_0051476 | |||
| 1994 | Ga0496108_0073073 | |||
| 1995 | Ga0496108_0124609 | |||
| 1996 | Ga0496108_0176488 | |||
| 1997 | Ga0496109_0009059 | |||
| 1998 | Ga0496109_0030539 | |||
| 1999 | Ga0496109_0041283 | |||
| 2000 | Ga0496109_0046125 | |||
| 2001 | Ga0496109_0354784 | |||
| 2002 | Ga0496110_0004230 | |||
| 2003 | Ga0496110_0041642 | |||
| 2004 | Ga0496110_0049100 | |||
| 2005 | Ga0496110_0330286 | |||
| 2006 | Ga0496111_0026546 | |||
| 2007 | Ga0496111_0036602 | |||
| 2008 | Ga0496111_0058838 | |||
| 2009 | Ga0496111_0749418 | |||
| 2010 | Ga0496112_0043963 | |||
| 2011 | Ga0496112_0060837 | |||
| 2012 | Ga0496112_0067713 | |||
| 2013 | Ga0496112_0523281 | |||
| 2014 | Ga0496112_0552516 | |||
| 2015 | Ga0496113_0011409 | |||
| 2016 | Ga0496113_0035424 | |||
| 2017 | Ga0496113_0088091 | |||
| 2018 | Ga0496113_0336066 | |||
| 2019 | Ga0496113_0563437 | |||
| 2020 | Ga0496114_0067528 | |||
| 2021 | Ga0496114_0105965 | |||
| 2022 | Ga0496114_0111012 | |||
| 2023 | Ga0496114_0426066 | |||
| 2024 | Ga0496115_0013508 | |||
| 2025 | Ga0496115_0070030 | |||
| 2026 | Ga0496115_0080712 | |||
| 2027 | Ga0496115_0225835 | |||
| 2028 | Ga0496117_0082112 | |||
| 2029 | Ga0496126_0255518 | |||
| 2030 | Ga0501031_0003092 | |||
| 2031 | Ga0501032_0040473 | |||
| 2032 | Ga0501032_0114003 | |||
| 2033 | Ga0501032_0200808 | |||
| 2034 | Ga0501034_0000319 | |||
| 2035 | Ga0501034_0034953 | |||
| 2036 | Ga0501034_0098231 | |||
| 2037 | Ga0501034_0100449 | |||
| 2038 | Ga0501034_0131062 | |||
| 2039 | Ga0501034_0986100 | |||
| 2040 | Ga0501036_0032290 | |||
| 2041 | Ga0501036_0107597 | |||
| 2042 | Ga0501037_0016416 | |||
| 2043 | Ga0501037_0024154 | |||
| 2044 | Ga0501038_0038170 | |||
| 2045 | Ga0501038_0072363 | |||
| 2046 | Ga0501038_0078514 | |||
| 2047 | Ga0501039_0011266 | |||
| 2048 | Ga0501039_0087087 | |||
| 2049 | Ga0501043_0430364 | |||
| 2050 | Ga0501043_0542870 | |||
| 2051 | Ga0501043_1278373 | |||
| 2052 | Ga0501046_0351594 | |||
| 2053 | Ga0501047_0014222 | |||
| 2054 | Ga0501047_0015912 | |||
| 2055 | Ga0501047_0177639 | |||
| 2056 | Ga0501047_0869609 | |||
| 2057 | Ga0501048_0388011 | |||
| 2058 | Ga0501067_0733343 | |||
| 2059 | Ga0501068_0051234 | |||
| 2060 | Ga0501068_0352365 | |||
| 2061 | Ga0501068_0724864 | |||
| 2062 | Ga0501069_0005809 | |||
| 2063 | Ga0501069_0304209 | |||
| 2064 | Ga0501069_1000148 | |||
| 2065 | Ga0501070_0006119 | |||
| 2066 | Ga0501070_0031535 | |||
| 2067 | Ga0501070_0129327 | |||
| 2068 | Ga0501070_0154649 | |||
| 2069 | Ga0501070_0157268 | |||
| 2070 | Ga0501071_0185755 | |||
| 2071 | Ga0501071_0354516 | |||
| 2072 | Ga0501072_0141766 | |||
| 2073 | Ga0501072_0250417 | |||
| 2074 | Ga0501072_0302617 | |||
| 2075 | Ga0501072_0440660 | |||
| 2076 | Ga0501073_0125088 | |||
| 2077 | Ga0501073_0465500 | |||
| 2078 | Ga0501073_0583372 | |||
| 2079 | Ga0501074_0050037 | |||
| 2080 | Ga0501074_0119253 | |||
| 2081 | Ga0501074_0185649 | |||
| 2082 | Ga0501077_0056351 | |||
| 2083 | Ga0501079_0210125 | |||
| 2084 | Ga0501080_0101172 | |||
| 2085 | Ga0501080_0219478 | |||
| 2086 | Ga0501080_0609936 | |||
| 2087 | Ga0501080_1375413 | |||
| 2088 | Ga0501083_0028527 | |||
| 2089 | Ga0501083_0152007 | |||
| 2090 | Ga0501083_0273462 | |||
| 2091 | Ga0501035_0001800 | |||
| 2092 | Ga0501035_0029127 | |||
| 2093 | Ga0501035_0235247 | |||
| 2094 | Ga0501035_0371930 | |||
| 2095 | Ga0501044_0320652 | |||
| 2096 | Ga0501044_0483764 | |||
| 2097 | Ga0501044_0537985 | |||
| 2098 | Ga0501044_0917441 | |||
| 2099 | nmdc:mga03683_631823_c1 | |||
| 2100 | nmdc:mga03n38_217424_c1 | |||
| 2101 | nmdc:mga03n38_74518_c1 | |||
| 2102 | nmdc:mga00v17_848946_c1 | |||
| 2103 | nmdc:mga0yw44_1034339_c1 | |||
| 2104 | nmdc:mga0yw44_344087_c1 | |||
| 2105 | nmdc:mga06z11_36082_c1 | |||
| 2106 | nmdc:mga04h51_210116_c1 | |||
| 2107 | nmdc:mga07m45_138606_c1 | |||
| 2108 | nmdc:mga07m45_93737_c1 | |||
| 2109 | nmdc:mga05p37_1242_c1 | |||
| 2110 | nmdc:mga05p37_7606_c1 | |||
| 2111 | nmdc:mga09592_480_c1 | |||
| 2112 | nmdc:mga0qj67_514_c1 | |||
| 2113 | nmdc:mga06r32_1472165_c1 | |||
| 2114 | nmdc:mga06r32_19785_c1 | |||
| 2115 | nmdc:mga06r32_633464_c1 | |||
| 2116 | nmdc:mga08y16_1532_c1 | |||
| 2117 | nmdc:mga08y16_2506_c1 | |||
| 2118 | nmdc:mga08y16_313418_c1 | |||
| 2119 | nmdc:mga0n895_1152_c1 | |||
| 2120 | nmdc:mga0n895_1592656_c1 | |||
| 2121 | nmdc:mga0n895_2804_c1 | |||
| 2122 | nmdc:mga0n895_353560_c1 | |||
| 2123 | nmdc:mga0n895_377944_c1 | |||
| 2124 | nmdc:mga0n895_58640_c1 | |||
| 2125 | nmdc:mga0rr50_317889_c1 | |||
| 2126 | nmdc:mga0rr50_43930_c1 | |||
| 2127 | nmdc:mga0rr50_609103_c1 | |||
| 2128 | nmdc:mga0rr50_77620_c1 | |||
| 2129 | nmdc:mga08x19_115137_c1 | |||
| 2130 | nmdc:mga08x19_164205_c1 | |||
| 2131 | nmdc:mga08x19_551906_c1 | |||
| 2132 | nmdc:mga08x19_758606_c1 | |||
| 2133 | nmdc:mga08x19_815033_c1 | |||
| 2134 | nmdc:mga08x19_850206_c1 | |||
| 2135 | nmdc:mga0a205_10123_c1 | |||
| 2136 | nmdc:mga0a205_1257_c1 | |||
| 2137 | nmdc:mga0a205_19977_c1 | |||
| 2138 | Ga0495601_0000095 | |||
| 2139 | Ga0495601_0000316 | |||
| 2140 | Ga0495601_0006189 | |||
| 2141 | Ga0495601_0015389 | |||
| 2142 | Ga0495601_0041044 | |||
| 2143 | Ga0495601_0060341 | |||
| 2144 | Ga0495612_0000812 | |||
| 2145 | Ga0495612_0002682 | |||
| 2146 | Ga0495612_0003848 | |||
| 2147 | Ga0495612_0011752 | |||
| 2148 | Ga0495612_0018121 | |||
| 2149 | Ga0495612_0113492 | |||
| 2150 | Ga0495612_0126893 | |||
| 2151 | Ga0495612_0342705 | |||
| 2152 | Ga0495595_0000261 | |||
| 2153 | Ga0495595_0002995 | |||
| 2154 | Ga0495595_0005688 | |||
| 2155 | Ga0495595_0016442 | |||
| 2156 | Ga0495595_0089650 | |||
| 2157 | Ga0495595_0313707 | |||
| 2158 | Ga0495595_0749205 | |||
| 2159 | Ga0495619_0000056 | |||
| 2160 | Ga0495619_0000498 | |||
| 2161 | Ga0495619_0003320 | |||
| 2162 | Ga0495619_0006134 | |||
| 2163 | Ga0495619_0076645 | |||
| 2164 | Ga0495619_0204791 | |||
| 2165 | Ga0495619_0816050 | |||
| 2166 | Ga0495619_0847812 | |||
| 2167 | Ga0500566_0414660 | |||
| 2168 | Ga0500650_0188568 | |||
| 2169 | Ga0501084_0112385 | |||
| 2170 | Ga0501082_0116952 | |||
| 2171 | Ga0501082_0312747 | |||
| 2172 | Ga0501082_0415173 | |||
| 2173 | Ga0501082_0735425 | |||
| 2174 | Ga0466962_0092014 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j2l-assembly1.cif.gz_B | crystal structure of bi-functional enzyme | 0.9625 | 5 | 91 |
| 6j22-assembly1.cif.gz_B | crystal structure of bi-functional enzyme | 0.9623 | 5 | 91 |
| 6j22-assembly1.cif.gz_A | crystal structure of bi-functional enzyme | 0.945 | 5 | 91 |
| 6j2l-assembly1.cif.gz_A | crystal structure of bi-functional enzyme | 0.9366 | 5 | 91 |
| 2a7w-assembly1.cif.gz_A | crystal structure of phosphoribosyl-atp pyrophosphatase from chromobacterium violaceum (atcc 12472). nesg target cvr7 | 0.9235 | 4 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P06989_113_203_1.10.287.1080 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.9517 | 5 | 92 | 1.10.287.1080 |
| af_Q2FUU3_358_449_1.10.287.1080 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.9367 | 5 | 92 | 1.10.287.1080 |
| af_P06989_113_203_1.10.287.1080 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.912 | 5 | 92 | 1.10.287.1080 |
| af_P9WMM9_1_93_1.10.287.1080 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.9046 | 5 | 87 | 1.10.287.1080 |
| 3c90A00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.9042 | 5 | 87 | 1.10.287.1080 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E5L437-F1-model_v4 | Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) | 0.9764 | 1 | 92 |
GO:0000105
GO:0004636 GO:0005524 GO:0005737 |
| AF-A0A523FMD8-F1-model_v4 | phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) | 0.9757 | 3 | 85 |
GO:0000105
GO:0004636 GO:0005524 |
| AF-A0A2A5IJP4-F1-model_v4 | phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) | 0.9743 | 5 | 76 |
GO:0000105
GO:0004636 GO:0005524 |
| AF-A0A7J7IQH8-F1-model_v4 | phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) | 0.9713 | 3 | 92 |
GO:0000105
GO:0004636 GO:0005524 GO:0008685 GO:0016114 |
| AF-A0A061QKU7-F1-model_v4 | Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) | 0.971 | 3 | 92 |
GO:0000105
GO:0004636 GO:0005524 GO:0005737 |