F489744

General Info

Members Datasets Scaffolds Average Seq Length
1084 376 2168 108

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_1046289|Ga0395905_1046289_309_686
Length 125
Sequence MGRAEEGPVPLPGAYSMTDPVHARIDGIVKGADVVLFMKGTPLFPQCGFSSRACAILDRLGVAFDSVDVLQDQDIRQGIKGYSDWPTIPQLYVKGEFVGGSDIMMEMYEAGELQQLMTDQGVVGA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
115 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
170 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
201 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
204 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
205 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
208 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
209 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
210 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
213 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
214 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
215 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
225 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
226 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
238 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
239 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
240 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
241 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
242 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
243 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
246 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
247 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
248 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
249 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
259 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
260 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
261 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
283 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
286 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
291 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
300 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
301 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
302 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
303 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
304 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
305 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
306 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
307 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
310 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
311 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
312 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
315 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
316 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
321 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
322 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
323 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
324 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
325 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
326 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
327 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
328 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
329 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
330 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
331 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
332 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
333 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
334 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
335 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
336 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
337 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
338 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
339 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
340 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
341 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
342 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
343 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
344 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
345 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
346 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
347 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
348 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
349 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
350 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
351 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
356 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
357 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
358 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
359 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
360 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
361 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
362 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
363 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
364 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
365 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
366 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
367 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
368 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
369 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
370 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
371 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
372 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
373 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
374 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
375 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
376 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0.83
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 10.89
Nodule 0.18
Rhizoplane 4.06
Rhizosphere 79.89
Stem 0
Stem Tuber 0.09
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_1046289 3300037471 Bacteria 719
2 RicEn_FSXC48507_g1 2010549000 Bacteria 793
3 SwRhRL2b_contig_14491 2162886007 Bacteria 5668
4 SwRhRL2b_contig_1941805 2162886007 Bacteria 1025
5 JGI24741J21665_1009296 3300001915 Bacteria 1812
6 JGI24741J21665_1026449 3300001915 Bacteria 883
7 JGI24740J21852_10025645 3300001979 Bacteria 1984
8 JGI24740J21852_10044246 3300001979 Bacteria 1322
9 JGI24739J22299_10085084 3300001989 Bacteria 967
10 JGI24737J22298_10015406 3300001990 Bacteria 2474
11 JGI24737J22298_10141222 3300001990 Bacteria 711
12 JGI24737J22298_10159807 3300001990 Bacteria 665
13 JGI24735J21928_10004614 3300002067 Bacteria 4616
14 JGI24735J21928_10009368 3300002067 Bacteria 3147
15 JGI24735J21928_10020556 3300002067 Bacteria 2021
16 JGI24749J21850_1080763 3300002076 Bacteria 511
17 JGI24035J26624_1026530 3300002126 Bacteria 623
18 JGI24034J26672_10032562 3300002239 Bacteria 854
19 JGI24034J26672_10034318 3300002239 Bacteria 836
20 JGI24751J29686_10000183 3300002459 Bacteria 28249
21 JGI24751J29686_10006267 3300002459 Bacteria 2424
22 JGI25406J46586_10073176 3300003203 Bacteria 1069
23 Ga0055536_1001129 3300003781 Bacteria 16725
24 Ga0055534_1028413 3300003784 Bacteria 877
25 Ga0055530_10000217 3300003791 Bacteria 51317
26 Ga0055530_10120939 3300003791 Bacteria 507
27 Ga0055531_10000571 3300003794 Bacteria 32223
28 Ga0055531_10017368 3300003794 Bacteria 3042
29 Ga0058863_10010079 3300004799 Bacteria 1114
30 Ga0065165_1005029 3300005262 Bacteria 7727
31 Ga0065704_10070504 3300005289 Bacteria 22276
32 Ga0065704_10160113 3300005289 Bacteria 1361
33 Ga0065704_10623232 3300005289 Bacteria 585
34 Ga0065712_10655293 3300005290 Bacteria 565
35 Ga0070658_10001814 3300005327 Bacteria 17966
36 Ga0070658_10004690 3300005327 Bacteria 11113
37 Ga0070658_10078926 3300005327 Bacteria 2703
38 Ga0070658_10254395 3300005327 Bacteria 1490
39 Ga0070658_10486976 3300005327 Bacteria 1065
40 Ga0070658_10553426 3300005327 Bacteria 996
41 Ga0070658_10590018 3300005327 Bacteria 963
42 Ga0070658_10819451 3300005327 Bacteria 809
43 Ga0070658_10906585 3300005327 Bacteria 766
44 Ga0070683_100080914 3300005329 Bacteria 3040
45 Ga0070683_100142414 3300005329 Bacteria 2272
46 Ga0070683_100209353 3300005329 Bacteria 1852
47 Ga0070683_100412603 3300005329 Bacteria 1288
48 Ga0070683_101204161 3300005329 Bacteria 728
49 Ga0070690_100189611 3300005330 Bacteria 1425
50 Ga0070670_100036211 3300005331 Bacteria 4247
51 Ga0070670_100126344 3300005331 Bacteria 2207
52 Ga0070670_100556582 3300005331 Bacteria 1023
53 Ga0068869_101523852 3300005334 Bacteria 594
54 Ga0070666_10031513 3300005335 Bacteria 3499
55 Ga0070666_10245552 3300005335 Bacteria 1266
56 Ga0070666_10257671 3300005335 Bacteria 1236
57 Ga0070680_100001532 3300005336 Bacteria 16845
58 Ga0070680_100130253 3300005336 Bacteria 2104
59 Ga0070680_100862652 3300005336 Bacteria 781
60 Ga0070680_100886637 3300005336 Bacteria 769
61 Ga0070682_100231965 3300005337 Bacteria 1320
62 Ga0070682_100292626 3300005337 Bacteria 1192
63 Ga0070682_100574623 3300005337 Bacteria 886
64 Ga0070660_100004583 3300005339 Bacteria 9552
65 Ga0070660_100009577 3300005339 Bacteria 6822
66 Ga0070660_100025704 3300005339 Bacteria 4378
67 Ga0070660_100075067 3300005339 Bacteria 2646
68 Ga0070660_100078162 3300005339 Bacteria 2594
69 Ga0070660_100122768 3300005339 Bacteria 2073
70 Ga0070660_100138856 3300005339 Bacteria 1948
71 Ga0070660_100359155 3300005339 Bacteria 1200
72 Ga0070660_100564963 3300005339 Bacteria 950
73 Ga0070660_100768117 3300005339 Bacteria 810
74 Ga0070687_100522493 3300005343 Bacteria 803
75 Ga0070687_101372528 3300005343 Bacteria 527
76 Ga0070661_100005966 3300005344 Bacteria 8385
77 Ga0070661_100012214 3300005344 Bacteria 6005
78 Ga0070661_100044029 3300005344 Bacteria 3260
79 Ga0070692_10042253 3300005345 Bacteria 2340
80 Ga0070692_10329553 3300005345 Bacteria 942
81 Ga0070668_100000080 3300005347 Bacteria 60157
82 Ga0070668_100011581 3300005347 Bacteria 6565
83 Ga0070668_100027483 3300005347 Bacteria 4320
84 Ga0070668_100038637 3300005347 Bacteria 3649
85 Ga0070668_100408180 3300005347 Bacteria 1161
86 Ga0070668_100899906 3300005347 Bacteria 791
87 Ga0070669_100000082 3300005353 Bacteria 91465
88 Ga0070669_100000270 3300005353 Bacteria 42327
89 Ga0070669_100001657 3300005353 Bacteria 16111
90 Ga0070669_100538648 3300005353 Bacteria 972
91 Ga0070671_100000116 3300005355 Bacteria 51559
92 Ga0070671_100000169 3300005355 Bacteria 43010
93 Ga0070671_100000299 3300005355 Bacteria 33542
94 Ga0070671_100013092 3300005355 Bacteria 6684
95 Ga0070671_100017053 3300005355 Bacteria 5875
96 Ga0070671_101306033 3300005355 Bacteria 640
97 Ga0070671_102039776 3300005355 Bacteria 511
98 Ga0070674_100041961 3300005356 Bacteria 3105
99 Ga0070673_101163110 3300005364 Bacteria 722
100 Ga0070659_100143162 3300005366 Bacteria 1947
101 Ga0070659_100160559 3300005366 Bacteria 1837
102 Ga0070659_100487981 3300005366 Bacteria 1049
103 Ga0070659_100712402 3300005366 Bacteria 868
104 Ga0070659_100757091 3300005366 Bacteria 843
105 Ga0070659_102119143 3300005366 Bacteria 505
106 Ga0070667_100000968 3300005367 Bacteria 26399
107 Ga0070667_100001907 3300005367 Bacteria 18505
108 Ga0070667_100038717 3300005367 Bacteria 3998
109 Ga0070667_100125378 3300005367 Bacteria 2237
110 Ga0070667_100352616 3300005367 Bacteria 1332
111 Ga0070667_101184761 3300005367 Bacteria 715
112 Ga0070711_101751273 3300005439 Bacteria 545
113 Ga0070705_101929486 3300005440 Bacteria 503
114 Ga0070663_100042802 3300005455 Bacteria 3184
115 Ga0070663_100072263 3300005455 Bacteria 2512
116 Ga0070663_100138996 3300005455 Bacteria 1852
117 Ga0070663_100146585 3300005455 Bacteria 1806
118 Ga0070663_100213009 3300005455 Bacteria 1514
119 Ga0070663_100418732 3300005455 Bacteria 1098
120 Ga0070663_100769265 3300005455 Bacteria 824
121 Ga0070678_101599225 3300005456 Bacteria 612
122 Ga0070662_100002038 3300005457 Bacteria 12374
123 Ga0070662_100051197 3300005457 Bacteria 2981
124 Ga0070662_100094062 3300005457 Bacteria 2256
125 Ga0070662_100477503 3300005457 Bacteria 1038
126 Ga0070681_10049910 3300005458 Bacteria 4176
127 Ga0070681_10279946 3300005458 Bacteria 1579
128 Ga0070681_10515005 3300005458 Bacteria 1109
129 Ga0070681_10778075 3300005458 Bacteria 874
130 Ga0070679_100049171 3300005530 Bacteria 4200
131 Ga0070679_100053739 3300005530 Bacteria 4009
132 Ga0070679_100125039 3300005530 Bacteria 2554
133 Ga0070679_100165965 3300005530 Bacteria 2181
134 Ga0070679_100797661 3300005530 Bacteria 887
135 Ga0070684_100058240 3300005535 Bacteria 3376
136 Ga0070684_100275617 3300005535 Bacteria 1540
137 Ga0070684_101360092 3300005535 Bacteria 668
138 Ga0068853_100000825 3300005539 Bacteria 21651
139 Ga0068853_100001009 3300005539 Bacteria 19829
140 Ga0068853_100090669 3300005539 Bacteria 2687
141 Ga0068853_100099224 3300005539 Bacteria 2573
142 Ga0068853_100175395 3300005539 Bacteria 1941
143 Ga0068853_100773978 3300005539 Bacteria 918
144 Ga0068853_100828533 3300005539 Bacteria 887
145 Ga0068853_100932187 3300005539 Bacteria 835
146 Ga0070686_100246175 3300005544 Bacteria 1304
147 Ga0070665_100002434 3300005548 Bacteria 20520
148 Ga0070665_100009702 3300005548 Bacteria 9728
149 Ga0070665_100020215 3300005548 Bacteria 6685
150 Ga0070665_100095381 3300005548 Bacteria 2980
151 Ga0070665_100235968 3300005548 Bacteria 1829
152 Ga0068855_100007299 3300005563 Bacteria 13385
153 Ga0068855_100011899 3300005563 Bacteria 10520
154 Ga0068855_100017657 3300005563 Bacteria 8580
155 Ga0068855_100022037 3300005563 Bacteria 7637
156 Ga0068855_100058341 3300005563 Bacteria 4521
157 Ga0068855_100234877 3300005563 Bacteria 2051
158 Ga0068855_100657660 3300005563 Bacteria 1125
159 Ga0068855_101628431 3300005563 Bacteria 660
160 Ga0070664_100004940 3300005564 Bacteria 10682
161 Ga0070664_100063472 3300005564 Bacteria 3149
162 Ga0070664_100107496 3300005564 Bacteria 2432
163 Ga0070664_100685619 3300005564 Bacteria 954
164 Ga0070664_101361990 3300005564 Bacteria 670
165 Ga0068857_100012786 3300005577 Bacteria 7317
166 Ga0068857_100034254 3300005577 Bacteria 4491
167 Ga0068857_100246743 3300005577 Bacteria 1636
168 Ga0068857_100532724 3300005577 Bacteria 1105
169 Ga0068857_100782136 3300005577 Bacteria 910
170 Ga0068857_100977674 3300005577 Bacteria 814
171 Ga0068857_102328909 3300005577 Bacteria 526
172 Ga0068854_100000459 3300005578 Bacteria 25127
173 Ga0068854_100013420 3300005578 Bacteria 5377
174 Ga0068854_100047093 3300005578 Bacteria 3072
175 Ga0068854_100137097 3300005578 Bacteria 1874
176 Ga0068854_100159330 3300005578 Bacteria 1746
177 Ga0068854_100166546 3300005578 Bacteria 1711
178 Ga0068854_100812281 3300005578 Bacteria 816
179 Ga0068854_101049149 3300005578 Bacteria 724
180 Ga0068854_101325357 3300005578 Bacteria 649
181 Ga0068856_100025980 3300005614 Bacteria 5711
182 Ga0068856_100034389 3300005614 Bacteria 4964
183 Ga0068856_100194821 3300005614 Bacteria 2040
184 Ga0068856_100328553 3300005614 Bacteria 1547
185 Ga0068856_100520452 3300005614 Bacteria 1211
186 Ga0068856_101792595 3300005614 Bacteria 625
187 Ga0068852_100000231 3300005616 Bacteria 37728
188 Ga0068852_100012993 3300005616 Bacteria 6354
189 Ga0068852_100086148 3300005616 Bacteria 2800
190 Ga0068852_100296204 3300005616 Bacteria 1564
191 Ga0068852_100408267 3300005616 Bacteria 1337
192 Ga0068852_100447063 3300005616 Bacteria 1279
193 Ga0068852_100638361 3300005616 Bacteria 1071
194 Ga0068852_102411732 3300005616 Bacteria 547
195 Ga0068859_100010259 3300005617 Bacteria 9429
196 Ga0068859_100859376 3300005617 Bacteria 993
197 Ga0068859_100868714 3300005617 Bacteria 987
198 Ga0068859_101026602 3300005617 Bacteria 906
199 Ga0068859_101045548 3300005617 Bacteria 897
200 Ga0068864_100003823 3300005618 Bacteria 12412
201 Ga0068864_100004682 3300005618 Bacteria 11226
202 Ga0068864_100029698 3300005618 Bacteria 4632
203 Ga0068864_100080985 3300005618 Bacteria 2846
204 Ga0068864_101173069 3300005618 Bacteria 766
205 Ga0068861_100000001 3300005719 Bacteria 116118
206 Ga0068863_100000001 3300005841 Bacteria 581116
207 Ga0068863_100000106 3300005841 Bacteria 90344
208 Ga0068863_100044294 3300005841 Bacteria 4224
209 Ga0068863_100094394 3300005841 Bacteria 2839
210 Ga0068863_100137511 3300005841 Bacteria 2334
211 Ga0068863_100166090 3300005841 Bacteria 2116
212 Ga0068863_100261102 3300005841 Bacteria 1674
213 Ga0068858_100000327 3300005842 Bacteria 50180
214 Ga0068858_100001247 3300005842 Bacteria 26301
215 Ga0068858_100039777 3300005842 Bacteria 4359
216 Ga0068858_100056520 3300005842 Bacteria 3627
217 Ga0068858_100163708 3300005842 Bacteria 2095
218 Ga0068858_100327621 3300005842 Bacteria 1464
219 Ga0068860_100000386 3300005843 Bacteria 57855
220 Ga0068860_100009605 3300005843 Bacteria 9613
221 Ga0068860_100092375 3300005843 Bacteria 2883
222 Ga0068860_100115216 3300005843 Bacteria 2570
223 Ga0068860_100310382 3300005843 Bacteria 1546
224 Ga0068860_100465108 3300005843 Bacteria 1259
225 Ga0068860_102626142 3300005843 Bacteria 523
226 Ga0068862_100009807 3300005844 Bacteria 7914
227 Ga0068862_100021177 3300005844 Bacteria 5435
228 Ga0068862_100027853 3300005844 Bacteria 4759
229 Ga0068862_100049285 3300005844 Bacteria 3597
230 Ga0068862_100490347 3300005844 Bacteria 1165
231 Ga0068862_101159350 3300005844 Bacteria 770
232 Ga0068862_101734200 3300005844 Bacteria 633
233 Ga0081540_1162277 3300005983 Bacteria 865
234 Ga0081539_10074933 3300005985 Bacteria 1800
235 Ga0075365_10080983 3300006038 Bacteria 2199
236 Ga0075365_10477151 3300006038 Bacteria 881
237 Ga0075368_10000112 3300006042 Bacteria 21160
238 Ga0075368_10000385 3300006042 Bacteria 12968
239 Ga0075368_10322642 3300006042 Bacteria 669
240 Ga0075363_100005439 3300006048 Bacteria 5665
241 Ga0075363_100012861 3300006048 Bacteria 4042
242 Ga0075364_10110693 3300006051 Bacteria 1832
243 Ga0075362_10000129 3300006177 Bacteria 20881
244 Ga0075362_10143095 3300006177 Bacteria 1144
245 Ga0075362_10257530 3300006177 Bacteria 859
246 Ga0075367_10000692 3300006178 Bacteria 12968
247 Ga0075367_10782097 3300006178 Bacteria 608
248 Ga0075369_10032715 3300006186 Bacteria 2201
249 Ga0075369_10089500 3300006186 Bacteria 1372
250 Ga0075369_10159290 3300006186 Bacteria 1034
251 Ga0075366_10013664 3300006195 Bacteria 4628
252 Ga0075366_10245806 3300006195 Bacteria 1091
253 Ga0075366_10530539 3300006195 Bacteria 728
254 Ga0075370_10010420 3300006353 Bacteria 4861
255 Ga0075370_10043587 3300006353 Bacteria 2536
256 Ga0075370_10058591 3300006353 Bacteria 2191
257 Ga0075370_10126540 3300006353 Bacteria 1489
258 Ga0075370_10394531 3300006353 Bacteria 830
259 Ga0075429_100833896 3300006880 Bacteria 807
260 Ga0068865_101099164 3300006881 Bacteria 700
261 Ga0068865_101281440 3300006881 Bacteria 651
262 Ga0097620_100010259 3300006931 Bacteria 9429
263 Ga0097620_100859461 3300006931 Bacteria 993
264 Ga0097620_100868709 3300006931 Bacteria 987
265 Ga0097620_101026648 3300006931 Bacteria 906
266 Ga0097620_101045495 3300006931 Bacteria 897
267 Ga0079104_1061795 3300006946 Bacteria 805
268 Ga0105251_10012362 3300009011 Bacteria 4831
269 Ga0105250_10006517 3300009092 Bacteria 5096
270 Ga0105240_10013931 3300009093 Bacteria 11008
271 Ga0105240_10570341 3300009093 Bacteria 1250
272 Ga0105240_10794470 3300009093 Bacteria 1025
273 Ga0105247_10589857 3300009101 Bacteria 823
274 Ga0105247_10716195 3300009101 Bacteria 755
275 Ga0105243_10320752 3300009148 Bacteria 1412
276 Ga0105243_10767589 3300009148 Bacteria 947
277 Ga0105243_12130670 3300009148 Bacteria 597
278 Ga0105241_10084481 3300009174 Bacteria 2492
279 Ga0105241_10425900 3300009174 Bacteria 1169
280 Ga0105241_10565791 3300009174 Bacteria 1022
281 Ga0105242_11505959 3300009176 Bacteria 704
282 Ga0105248_10001758 3300009177 Bacteria 24108
283 Ga0105248_10029772 3300009177 Bacteria 6093
284 Ga0105248_10030056 3300009177 Bacteria 6063
285 Ga0105248_10043233 3300009177 Bacteria 5052
286 Ga0105248_10074540 3300009177 Bacteria 3815
287 Ga0105248_10106004 3300009177 Bacteria 3169
288 Ga0105248_10158703 3300009177 Bacteria 2552
289 Ga0105248_10168174 3300009177 Bacteria 2471
290 Ga0105248_13145328 3300009177 Bacteria 525
291 Ga0105237_11817604 3300009545 Bacteria 617
292 Ga0105238_10070938 3300009551 Bacteria 3482
293 Ga0105238_10231030 3300009551 Bacteria 1826
294 Ga0105238_10668100 3300009551 Bacteria 1050
295 Ga0105249_10037409 3300009553 Bacteria 4404
296 Ga0105249_10174180 3300009553 Bacteria 2089
297 Ga0105249_10261051 3300009553 Bacteria 1721
298 Ga0105249_10265973 3300009553 Bacteria 1706
299 Ga0105249_10538642 3300009553 Bacteria 1217
300 Ga0105239_10846266 3300010375 Bacteria 1049
301 Ga0105239_11201659 3300010375 Bacteria 874
302 Ga0105239_11229129 3300010375 Bacteria 864
303 Ga0105246_10477789 3300011119 Bacteria 1054
304 Ga0157326_1000423 3300012513 Bacteria 5017
305 Ga0157373_10005891 3300013100 Bacteria 9170
306 Ga0157373_10073069 3300013100 Bacteria 2421
307 Ga0157373_10073823 3300013100 Bacteria 2407
308 Ga0157373_10118854 3300013100 Bacteria 1858
309 Ga0157373_10152393 3300013100 Bacteria 1626
310 Ga0157373_10210985 3300013100 Bacteria 1369
311 Ga0157373_10439064 3300013100 Bacteria 938
312 Ga0157373_11454634 3300013100 Bacteria 522
313 Ga0157371_10005585 3300013102 Bacteria 10564
314 Ga0157371_10014817 3300013102 Bacteria 5869
315 Ga0157371_10030644 3300013102 Bacteria 3879
316 Ga0157371_10126094 3300013102 Bacteria 1821
317 Ga0157371_10159148 3300013102 Bacteria 1613
318 Ga0157371_10285046 3300013102 Bacteria 1194
319 Ga0157371_10670109 3300013102 Bacteria 775
320 Ga0157370_10008601 3300013104 Bacteria 10992
321 Ga0157370_10020840 3300013104 Bacteria 6541
322 Ga0157370_10069312 3300013104 Bacteria 3331
323 Ga0157370_10214812 3300013104 Bacteria 1782
324 Ga0157370_10481893 3300013104 Bacteria 1140
325 Ga0157370_10504540 3300013104 Bacteria 1111
326 Ga0157370_10648743 3300013104 Bacteria 965
327 Ga0157370_10998843 3300013104 Bacteria 757
328 Ga0157370_11611114 3300013104 Bacteria 583
329 Ga0157369_10001177 3300013105 Bacteria 32602
330 Ga0157369_10011267 3300013105 Bacteria 10158
331 Ga0157369_10012443 3300013105 Bacteria 9659
332 Ga0157369_10073644 3300013105 Bacteria 3664
333 Ga0157369_10109686 3300013105 Bacteria 2934
334 Ga0157369_10173906 3300013105 Bacteria 2268
335 Ga0157369_10181989 3300013105 Bacteria 2211
336 Ga0157369_11651416 3300013105 Bacteria 651
337 Ga0157374_10007709 3300013296 Bacteria 9191
338 Ga0157378_10071999 3300013297 Bacteria 3105
339 Ga0157378_11229493 3300013297 Bacteria 789
340 Ga0163162_10016081 3300013306 Bacteria 7314
341 Ga0163162_10049256 3300013306 Bacteria 4222
342 Ga0163162_10065959 3300013306 Bacteria 3668
343 Ga0163162_10814754 3300013306 Bacteria 1050
344 Ga0163162_11240239 3300013306 Bacteria 847
345 Ga0163162_11256044 3300013306 Bacteria 841
346 Ga0163162_11336558 3300013306 Bacteria 815
347 Ga0163162_11845107 3300013306 Bacteria 691
348 Ga0157372_10026953 3300013307 Bacteria 6256
349 Ga0157372_10069390 3300013307 Bacteria 3964
350 Ga0157372_10118609 3300013307 Bacteria 3036
351 Ga0157372_10194284 3300013307 Bacteria 2351
352 Ga0157372_10879583 3300013307 Bacteria 1040
353 Ga0157372_11445556 3300013307 Bacteria 792
354 Ga0157375_12513516 3300013308 Bacteria 615
355 Ga0157375_12610828 3300013308 Bacteria 604
356 Ga0163163_11045620 3300014325 Bacteria 880
357 Ga0157380_10419982 3300014326 Bacteria 1275
358 Ga0157380_12027684 3300014326 Bacteria 637
359 Ga0157380_13020417 3300014326 Bacteria 536
360 Ga0182008_10147420 3300014497 Bacteria 1179
361 Ga0182008_10307738 3300014497 Bacteria 831
362 Ga0157379_10103451 3300014968 Bacteria 2556
363 Ga0157379_10164180 3300014968 Bacteria 2004
364 Ga0163161_10001762 3300017792 Bacteria 15801
365 Ga0163161_10236398 3300017792 Bacteria 1419
366 Ga0163161_10420818 3300017792 Bacteria 1075
367 Ga0163161_11570665 3300017792 Bacteria 579
368 Ga0206356_10328308 3300020070 Bacteria 747
369 Ga0206352_10656295 3300020078 Bacteria 825
370 Ga0213876_10176276 3300021384 Bacteria 1137
371 Ga0207672_1014332 3300025223 Bacteria 504
372 Ga0209233_1000104 3300025261 Bacteria 272675
373 Ga0209455_1059436 3300025272 Bacteria 505
374 Ga0207673_1010721 3300025290 Bacteria 1182
375 Ga0209675_1000082 3300025291 Bacteria 153550
376 Ga0209676_1000424 3300025292 Bacteria 74314
377 Ga0209676_1000567 3300025292 Bacteria 55724
378 Ga0209676_1000670 3300025292 Bacteria 48733
379 Ga0209025_1013258 3300025294 Bacteria 5198
380 Ga0209050_1000017 3300025298 Bacteria 728928
381 Ga0209050_1015992 3300025298 Bacteria 3102
382 Ga0209050_1033183 3300025298 Bacteria 1570
383 Ga0209257_1000151 3300025304 Bacteria 191408
384 Ga0209257_1000202 3300025304 Bacteria 147246
385 Ga0209257_1014543 3300025304 Bacteria 3372
386 Ga0207697_10010597 3300025315 Bacteria 3934
387 Ga0207697_10035408 3300025315 Bacteria 2044
388 Ga0207697_10197006 3300025315 Bacteria 885
389 Ga0207697_10279311 3300025315 Bacteria 740
390 Ga0207656_10012272 3300025321 Bacteria 3255
391 Ga0207696_1007265 3300025711 Bacteria 4353
392 Ga0207713_1010142 3300025735 Bacteria 5236
393 Ga0207713_1053960 3300025735 Bacteria 1579
394 Ga0207710_10444116 3300025900 Bacteria 669
395 Ga0207688_10153841 3300025901 Bacteria 1360
396 Ga0207680_10104003 3300025903 Bacteria 1830
397 Ga0207680_10140902 3300025903 Bacteria 1598
398 Ga0207680_10181472 3300025903 Bacteria 1423
399 Ga0207647_10065904 3300025904 Bacteria 2197
400 Ga0207647_10103590 3300025904 Bacteria 1687
401 Ga0207647_10498365 3300025904 Bacteria 679
402 Ga0207705_10000004 3300025909 Bacteria 705756
403 Ga0207705_10000101 3300025909 Bacteria 98231
404 Ga0207705_10005310 3300025909 Bacteria 9638
405 Ga0207705_10032428 3300025909 Bacteria 3733
406 Ga0207705_10038874 3300025909 Bacteria 3409
407 Ga0207705_10097229 3300025909 Bacteria 2162
408 Ga0207705_10128666 3300025909 Bacteria 1883
409 Ga0207705_10142233 3300025909 Bacteria 1792
410 Ga0207705_10299322 3300025909 Bacteria 1233
411 Ga0207705_10347589 3300025909 Bacteria 1142
412 Ga0207705_10421385 3300025909 Bacteria 1033
413 Ga0207705_10925174 3300025909 Bacteria 675
414 Ga0207654_10546964 3300025911 Bacteria 822
415 Ga0207707_10076073 3300025912 Bacteria 2929
416 Ga0207707_10223926 3300025912 Bacteria 1637
417 Ga0207707_10438375 3300025912 Bacteria 1118
418 Ga0207707_10575695 3300025912 Bacteria 955
419 Ga0207707_11330494 3300025912 Bacteria 576
420 Ga0207695_10018947 3300025913 Bacteria 7939
421 Ga0207695_10106455 3300025913 Bacteria 2790
422 Ga0207660_10045514 3300025917 Bacteria 3091
423 Ga0207660_10063096 3300025917 Bacteria 2670
424 Ga0207662_10472288 3300025918 Bacteria 860
425 Ga0207662_10763019 3300025918 Bacteria 680
426 Ga0207662_10820166 3300025918 Bacteria 656
427 Ga0207657_10000408 3300025919 Bacteria 45400
428 Ga0207657_10012539 3300025919 Bacteria 8360
429 Ga0207657_10026870 3300025919 Bacteria 5279
430 Ga0207657_10040078 3300025919 Bacteria 4154
431 Ga0207657_10048949 3300025919 Bacteria 3687
432 Ga0207657_10052113 3300025919 Bacteria 3553
433 Ga0207657_10071057 3300025919 Bacteria 2948
434 Ga0207657_10261261 3300025919 Bacteria 1378
435 Ga0207649_10003307 3300025920 Bacteria 8820
436 Ga0207649_10024515 3300025920 Bacteria 3507
437 Ga0207649_10158761 3300025920 Bacteria 1565
438 Ga0207652_10031309 3300025921 Bacteria 4467
439 Ga0207652_10063222 3300025921 Bacteria 3200
440 Ga0207652_10134787 3300025921 Bacteria 2205
441 Ga0207652_10139747 3300025921 Bacteria 2165
442 Ga0207652_10253453 3300025921 Bacteria 1587
443 Ga0207652_10365535 3300025921 Bacteria 1302
444 Ga0207652_10784934 3300025921 Bacteria 846
445 Ga0207681_10000109 3300025923 Bacteria 71373
446 Ga0207681_10002968 3300025923 Bacteria 10674
447 Ga0207681_10009596 3300025923 Bacteria 5915
448 Ga0207681_10478058 3300025923 Bacteria 1017
449 Ga0207681_11218265 3300025923 Bacteria 632
450 Ga0207681_11290750 3300025923 Bacteria 613
451 Ga0207694_10077123 3300025924 Bacteria 2611
452 Ga0207694_10226894 3300025924 Bacteria 1525
453 Ga0207694_10236267 3300025924 Bacteria 1493
454 Ga0207694_10585392 3300025924 Bacteria 938
455 Ga0207650_10126255 3300025925 Bacteria 1997
456 Ga0207650_10174974 3300025925 Bacteria 1708
457 Ga0207650_10381342 3300025925 Bacteria 1164
458 Ga0207650_10853930 3300025925 Bacteria 772
459 Ga0207650_11317486 3300025925 Bacteria 615
460 Ga0207650_11880296 3300025925 Bacteria 506
461 Ga0207687_10010076 3300025927 Bacteria 6180
462 Ga0207664_10224251 3300025929 Bacteria 1631
463 Ga0207644_10000012 3300025931 Bacteria 186652
464 Ga0207644_10000191 3300025931 Bacteria 43874
465 Ga0207644_10022749 3300025931 Bacteria 4285
466 Ga0207644_10076366 3300025931 Bacteria 2464
467 Ga0207644_10348981 3300025931 Bacteria 1201
468 Ga0207644_10649711 3300025931 Bacteria 878
469 Ga0207644_11159527 3300025931 Bacteria 649
470 Ga0207690_10008011 3300025932 Bacteria 6272
471 Ga0207690_10021761 3300025932 Bacteria 3980
472 Ga0207690_10242687 3300025932 Bacteria 1388
473 Ga0207690_10349896 3300025932 Bacteria 1168
474 Ga0207690_10393138 3300025932 Bacteria 1104
475 Ga0207690_10492626 3300025932 Bacteria 990
476 Ga0207690_11806889 3300025932 Bacteria 510
477 Ga0207706_10008254 3300025933 Bacteria 9609
478 Ga0207706_10033279 3300025933 Bacteria 4590
479 Ga0207706_10076637 3300025933 Bacteria 2941
480 Ga0207706_10211000 3300025933 Bacteria 1702
481 Ga0207706_10292525 3300025933 Bacteria 1420
482 Ga0207706_10398949 3300025933 Bacteria 1192
483 Ga0207709_10088718 3300025935 Bacteria 2014
484 Ga0207709_10365053 3300025935 Bacteria 1094
485 Ga0207709_10413443 3300025935 Bacteria 1034
486 Ga0207670_10243061 3300025936 Bacteria 1388
487 Ga0207669_10156416 3300025937 Bacteria 1604
488 Ga0207704_10841359 3300025938 Bacteria 768
489 Ga0207704_11156110 3300025938 Bacteria 659
490 Ga0207691_10181467 3300025940 Bacteria 1839
491 Ga0207711_10000852 3300025941 Bacteria 29486
492 Ga0207711_10020403 3300025941 Bacteria 5524
493 Ga0207711_10086344 3300025941 Bacteria 2751
494 Ga0207711_10104536 3300025941 Bacteria 2510
495 Ga0207711_10383571 3300025941 Bacteria 1304
496 Ga0207711_10498269 3300025941 Bacteria 1135
497 Ga0207711_10833452 3300025941 Bacteria 858
498 Ga0207711_11370931 3300025941 Bacteria 649
499 Ga0207689_10336795 3300025942 Bacteria 1253
500 Ga0207661_10039869 3300025944 Bacteria 3689
501 Ga0207661_10453662 3300025944 Bacteria 1168
502 Ga0207661_11174662 3300025944 Bacteria 706
503 Ga0207679_10004188 3300025945 Bacteria 8961
504 Ga0207679_10017162 3300025945 Bacteria 4821
505 Ga0207679_10255223 3300025945 Bacteria 1493
506 Ga0207679_10561348 3300025945 Bacteria 1025
507 Ga0207667_10003563 3300025949 Bacteria 19243
508 Ga0207667_10005019 3300025949 Bacteria 16179
509 Ga0207667_10016908 3300025949 Bacteria 8229
510 Ga0207667_10038338 3300025949 Bacteria 5119
511 Ga0207667_10070651 3300025949 Bacteria 3633
512 Ga0207667_10078696 3300025949 Bacteria 3417
513 Ga0207667_10098261 3300025949 Bacteria 3021
514 Ga0207667_10112317 3300025949 Bacteria 2810
515 Ga0207667_10748010 3300025949 Bacteria 977
516 Ga0207712_10057696 3300025961 Bacteria 2740
517 Ga0207712_10092123 3300025961 Bacteria 2234
518 Ga0207712_10358131 3300025961 Bacteria 1215
519 Ga0207712_10657564 3300025961 Bacteria 911
520 Ga0207712_11861207 3300025961 Bacteria 539
521 Ga0207668_10000304 3300025972 Bacteria 32235
522 Ga0207668_10083673 3300025972 Bacteria 2322
523 Ga0207668_10105153 3300025972 Bacteria 2106
524 Ga0207668_10115951 3300025972 Bacteria 2019
525 Ga0207668_10180046 3300025972 Bacteria 1666
526 Ga0207668_10328540 3300025972 Bacteria 1271
527 Ga0207668_10819854 3300025972 Bacteria 824
528 Ga0207668_11892319 3300025972 Bacteria 538
529 Ga0207640_10000508 3300025981 Bacteria 23527
530 Ga0207640_10077559 3300025981 Bacteria 2259
531 Ga0207640_10080263 3300025981 Bacteria 2226
532 Ga0207640_10093030 3300025981 Bacteria 2093
533 Ga0207640_10627768 3300025981 Bacteria 913
534 Ga0207640_12027889 3300025981 Bacteria 521
535 Ga0207658_10000344 3300025986 Bacteria 46055
536 Ga0207658_10001008 3300025986 Bacteria 23029
537 Ga0207658_10001566 3300025986 Bacteria 17731
538 Ga0207658_10008713 3300025986 Bacteria 6892
539 Ga0207658_11113228 3300025986 Bacteria 721
540 Ga0207658_11372109 3300025986 Bacteria 646
541 Ga0207703_10000244 3300026035 Bacteria 61520
542 Ga0207703_10000775 3300026035 Bacteria 31437
543 Ga0207703_10004946 3300026035 Bacteria 10819
544 Ga0207703_10027481 3300026035 Bacteria 4481
545 Ga0207703_10029046 3300026035 Bacteria 4362
546 Ga0207703_10052344 3300026035 Bacteria 3315
547 Ga0207639_10000771 3300026041 Bacteria 21846
548 Ga0207639_10124943 3300026041 Bacteria 2120
549 Ga0207639_10270861 3300026041 Bacteria 1489
550 Ga0207639_10914052 3300026041 Bacteria 820
551 Ga0207639_10977047 3300026041 Bacteria 793
552 Ga0207639_11211883 3300026041 Bacteria 708
553 Ga0207639_11376593 3300026041 Bacteria 662
554 Ga0207678_10004771 3300026067 Bacteria 12166
555 Ga0207678_10020075 3300026067 Bacteria 5870
556 Ga0207678_10022461 3300026067 Bacteria 5524
557 Ga0207678_10029324 3300026067 Bacteria 4802
558 Ga0207678_10046385 3300026067 Bacteria 3757
559 Ga0207678_10450446 3300026067 Bacteria 1119
560 Ga0207702_10012315 3300026078 Bacteria 7118
561 Ga0207702_10147935 3300026078 Bacteria 2134
562 Ga0207702_10271381 3300026078 Bacteria 1600
563 Ga0207702_10415455 3300026078 Bacteria 1300
564 Ga0207641_10000001 3300026088 Bacteria 1180841
565 Ga0207641_10000733 3300026088 Bacteria 35188
566 Ga0207641_10066769 3300026088 Bacteria 3079
567 Ga0207641_10075989 3300026088 Bacteria 2902
568 Ga0207641_10202140 3300026088 Bacteria 1832
569 Ga0207648_10522443 3300026089 Bacteria 1088
570 Ga0207676_10002656 3300026095 Bacteria 12704
571 Ga0207676_10003409 3300026095 Bacteria 11239
572 Ga0207676_10185065 3300026095 Bacteria 1827
573 Ga0207676_11758449 3300026095 Bacteria 618
574 Ga0207676_12238743 3300026095 Bacteria 544
575 Ga0207674_10008322 3300026116 Bacteria 12002
576 Ga0207674_10015484 3300026116 Bacteria 8376
577 Ga0207674_10017301 3300026116 Bacteria 7866
578 Ga0207674_10098726 3300026116 Bacteria 2903
579 Ga0207674_10894032 3300026116 Bacteria 856
580 Ga0207674_10895518 3300026116 Bacteria 855
581 Ga0207674_11037951 3300026116 Bacteria 789
582 Ga0207674_11384357 3300026116 Bacteria 673
583 Ga0207675_100000196 3300026118 Bacteria 55631
584 Ga0207675_100575285 3300026118 Bacteria 1127
585 Ga0207698_10000058 3300026142 Bacteria 78048
586 Ga0207698_10099316 3300026142 Bacteria 2407
587 Ga0207698_10729225 3300026142 Bacteria 988
588 Ga0207698_10864109 3300026142 Bacteria 910
589 Ga0207698_11099152 3300026142 Bacteria 808
590 Ga0207698_12320571 3300026142 Bacteria 548
591 Ga0209281_1071516 3300027111 Bacteria 506
592 Ga0209983_1096238 3300027665 Bacteria 669
593 Ga0209813_10000051 3300027866 Bacteria 47545
594 Ga0209813_10001612 3300027866 Bacteria 5084
595 Ga0209974_10006613 3300027876 Bacteria 4035
596 Ga0209974_10008683 3300027876 Bacteria 3462
597 Ga0209974_10347866 3300027876 Bacteria 574
598 Ga0268266_10002003 3300028379 Bacteria 22767
599 Ga0268266_10005024 3300028379 Bacteria 12491
600 Ga0268266_10006189 3300028379 Bacteria 10993
601 Ga0268266_10124658 3300028379 Bacteria 2297
602 Ga0268266_10158947 3300028379 Bacteria 2043
603 Ga0268265_10017233 3300028380 Bacteria 4981
604 Ga0268265_10070317 3300028380 Bacteria 2721
605 Ga0268265_10129908 3300028380 Bacteria 2091
606 Ga0268265_10146980 3300028380 Bacteria 1982
607 Ga0268265_10243981 3300028380 Bacteria 1587
608 Ga0268265_10387566 3300028380 Bacteria 1287
609 Ga0268265_10984873 3300028380 Bacteria 832
610 Ga0268265_12105585 3300028380 Bacteria 571
611 Ga0268264_10000040 3300028381 Bacteria 373714
612 Ga0268264_10004259 3300028381 Bacteria 12215
613 Ga0268264_10007794 3300028381 Bacteria 8916
614 Ga0268264_10012572 3300028381 Bacteria 6971
615 Ga0268264_10290110 3300028381 Bacteria 1536
616 Ga0307515_10596048 3300028794 Bacteria 715
617 Ga0265331_10081417 3300031250 Bacteria 1503
618 Ga0307408_100036575 3300031548 Bacteria 3452
619 Ga0307408_100189378 3300031548 Bacteria 1656
620 Ga0307408_100266195 3300031548 Bacteria 1421
621 Ga0307408_100631195 3300031548 Bacteria 955
622 Ga0307408_101090399 3300031548 Bacteria 740
623 Ga0307508_10000231 3300031616 Bacteria 67806
624 Ga0307405_10015706 3300031731 Bacteria 4108
625 Ga0307405_10046408 3300031731 Bacteria 2669
626 Ga0307405_10111192 3300031731 Bacteria 1856
627 Ga0307405_10179072 3300031731 Bacteria 1520
628 Ga0307405_10420225 3300031731 Bacteria 1052
629 Ga0307405_10422638 3300031731 Bacteria 1049
630 Ga0307405_10549733 3300031731 Bacteria 934
631 Ga0307405_10554500 3300031731 Bacteria 930
632 Ga0307405_10868865 3300031731 Bacteria 760
633 Ga0307405_11199702 3300031731 Bacteria 656
634 Ga0307405_11987736 3300031731 Bacteria 520
635 Ga0307405_12083234 3300031731 Bacteria 509
636 Ga0316577_10488641 3300031733 Bacteria 700
637 Ga0307413_10008092 3300031824 Bacteria 4937
638 Ga0307413_10095332 3300031824 Bacteria 1950
639 Ga0307413_10111184 3300031824 Bacteria 1834
640 Ga0307413_10116974 3300031824 Bacteria 1797
641 Ga0307413_10378532 3300031824 Bacteria 1102
642 Ga0307413_10419605 3300031824 Bacteria 1053
643 Ga0307413_10513941 3300031824 Bacteria 964
644 Ga0307413_10663468 3300031824 Bacteria 862
645 Ga0307413_11247714 3300031824 Bacteria 648
646 Ga0307413_11749671 3300031824 Bacteria 555
647 Ga0307410_10032218 3300031852 Bacteria 3370
648 Ga0307410_10127384 3300031852 Bacteria 1866
649 Ga0307410_10129375 3300031852 Bacteria 1853
650 Ga0307410_10131184 3300031852 Bacteria 1841
651 Ga0307410_10137046 3300031852 Bacteria 1805
652 Ga0307410_10180454 3300031852 Bacteria 1598
653 Ga0307410_10407750 3300031852 Bacteria 1099
654 Ga0307410_10572941 3300031852 Bacteria 938
655 Ga0307410_10930431 3300031852 Bacteria 746
656 Ga0307410_11223504 3300031852 Bacteria 655
657 Ga0307410_11401924 3300031852 Bacteria 613
658 Ga0307406_10033738 3300031901 Bacteria 3134
659 Ga0307406_10091044 3300031901 Bacteria 2054
660 Ga0307406_10271518 3300031901 Bacteria 1288
661 Ga0307406_10313769 3300031901 Bacteria 1210
662 Ga0307406_10350397 3300031901 Bacteria 1153
663 Ga0307406_11715690 3300031901 Bacteria 557
664 Ga0307406_11945942 3300031901 Bacteria 525
665 Ga0307407_10054827 3300031903 Bacteria 2301
666 Ga0307407_10087998 3300031903 Bacteria 1896
667 Ga0307407_10194064 3300031903 Bacteria 1356
668 Ga0307407_10227621 3300031903 Bacteria 1264
669 Ga0307407_10604107 3300031903 Bacteria 817
670 Ga0307407_10811828 3300031903 Bacteria 712
671 Ga0307407_10922904 3300031903 Bacteria 671
672 Ga0307412_10001165 3300031911 Bacteria 15055
673 Ga0307412_10015626 3300031911 Bacteria 4506
674 Ga0307412_10125238 3300031911 Bacteria 1857
675 Ga0307412_10135773 3300031911 Bacteria 1794
676 Ga0307412_10153714 3300031911 Bacteria 1701
677 Ga0307412_10202251 3300031911 Bacteria 1509
678 Ga0307412_10426873 3300031911 Bacteria 1085
679 Ga0307412_10820651 3300031911 Bacteria 809
680 Ga0307412_10955735 3300031911 Bacteria 754
681 Ga0307412_11271016 3300031911 Bacteria 661
682 Ga0307409_100095312 3300031995 Bacteria 2452
683 Ga0307409_100117196 3300031995 Bacteria 2247
684 Ga0307409_100149115 3300031995 Bacteria 2028
685 Ga0307409_100332388 3300031995 Bacteria 1426
686 Ga0307409_100342934 3300031995 Bacteria 1406
687 Ga0307409_100435543 3300031995 Bacteria 1261
688 Ga0307409_100461811 3300031995 Bacteria 1228
689 Ga0307409_100485830 3300031995 Bacteria 1199
690 Ga0307409_100594830 3300031995 Bacteria 1092
691 Ga0307409_100674330 3300031995 Bacteria 1030
692 Ga0307409_101883139 3300031995 Bacteria 627
693 Ga0307409_102048642 3300031995 Bacteria 602
694 Ga0307416_100040940 3300032002 Bacteria 3604
695 Ga0307416_100153329 3300032002 Bacteria 2117
696 Ga0307416_100168294 3300032002 Bacteria 2036
697 Ga0307416_100175956 3300032002 Bacteria 1999
698 Ga0307416_100204887 3300032002 Bacteria 1875
699 Ga0307416_100376208 3300032002 Bacteria 1448
700 Ga0307416_100380462 3300032002 Bacteria 1441
701 Ga0307416_100482992 3300032002 Bacteria 1299
702 Ga0307416_100658642 3300032002 Bacteria 1132
703 Ga0307416_100741865 3300032002 Bacteria 1074
704 Ga0307416_101023308 3300032002 Bacteria 929
705 Ga0307416_101514386 3300032002 Bacteria 776
706 Ga0307416_101638397 3300032002 Bacteria 748
707 Ga0307416_103152627 3300032002 Bacteria 552
708 Ga0307414_10000090 3300032004 Bacteria 78448
709 Ga0307414_10000343 3300032004 Bacteria 26284
710 Ga0307414_10002814 3300032004 Bacteria 9169
711 Ga0307414_10009210 3300032004 Bacteria 5659
712 Ga0307414_10029163 3300032004 Bacteria 3588
713 Ga0307414_10037198 3300032004 Bacteria 3257
714 Ga0307414_10092078 3300032004 Bacteria 2255
715 Ga0307414_10107005 3300032004 Bacteria 2118
716 Ga0307414_10165350 3300032004 Bacteria 1762
717 Ga0307414_10214200 3300032004 Bacteria 1577
718 Ga0307414_10456215 3300032004 Bacteria 1122
719 Ga0307414_10618279 3300032004 Bacteria 973
720 Ga0307414_10638625 3300032004 Bacteria 958
721 Ga0307414_11791120 3300032004 Bacteria 573
722 Ga0307411_10029935 3300032005 Bacteria 3332
723 Ga0307411_10049558 3300032005 Bacteria 2730
724 Ga0307411_10089366 3300032005 Bacteria 2145
725 Ga0307411_10098320 3300032005 Bacteria 2062
726 Ga0307411_10318724 3300032005 Bacteria 1254
727 Ga0307411_10342784 3300032005 Bacteria 1215
728 Ga0307411_10394801 3300032005 Bacteria 1142
729 Ga0307411_10559042 3300032005 Bacteria 977
730 Ga0307411_10594900 3300032005 Bacteria 950
731 Ga0307411_10894142 3300032005 Bacteria 788
732 Ga0307411_11094600 3300032005 Bacteria 718
733 Ga0307411_11096189 3300032005 Bacteria 717
734 Ga0307411_11120777 3300032005 Bacteria 710
735 Ga0307415_100021335 3300032126 Bacteria 3979
736 Ga0307415_100060290 3300032126 Bacteria 2621
737 Ga0307415_100251349 3300032126 Bacteria 1436
738 Ga0307415_100308804 3300032126 Bacteria 1313
739 Ga0307415_100310477 3300032126 Bacteria 1310
740 Ga0307415_100434342 3300032126 Bacteria 1130
741 Ga0307415_100487062 3300032126 Bacteria 1075
742 Ga0307415_101374269 3300032126 Bacteria 671
743 Ga0307415_101554950 3300032126 Bacteria 634
744 Ga0316583_10017344 3300032133 Bacteria 2590
745 Ga0307510_10148726 3300033180 Bacteria 1967
746 Ga0316582_0123061 3300036647 Bacteria 1737
747 Ga0316584_0322947 3300036712 Bacteria 1113
748 Ga0395899_0021460 3300037312 Bacteria 4899
749 Ga0395899_0037336 3300037312 Bacteria 3642
750 Ga0395899_0044654 3300037312 Bacteria 3301
751 Ga0395900_0003576 3300037418 Bacteria 16706
752 Ga0395900_0065379 3300037418 Bacteria 3736
753 Ga0395900_0227501 3300037418 Bacteria 1877
754 Ga0395900_0285305 3300037418 Bacteria 1641
755 Ga0395900_0338178 3300037418 Bacteria 1481
756 Ga0395900_0914872 3300037418 Bacteria 800
757 Ga0395898_0006820 3300037466 Bacteria 12144
758 Ga0395898_0029920 3300037466 Bacteria 5451
759 Ga0395898_0174873 3300037466 Bacteria 2052
760 Ga0395905_0020072 3300037471 Bacteria 6332
761 Ga0395905_0089111 3300037471 Bacteria 2892
762 Ga0395905_0127455 3300037471 Bacteria 2393
763 Ga0395905_0183179 3300037471 Bacteria 1966
764 Ga0395905_0592616 3300037471 Bacteria 1010
765 Ga0395905_1115582 3300037471 Bacteria 692
766 Ga0395901_0023315 3300038443 Bacteria 6343
767 Ga0395901_0024563 3300038443 Bacteria 6188
768 Ga0395901_0037956 3300038443 Bacteria 4982
769 Ga0395901_0053668 3300038443 Bacteria 4188
770 Ga0395901_0306549 3300038443 Bacteria 1645
771 Ga0395901_0530584 3300038443 Bacteria 1195
772 Ga0237819_00646 3300038705 Bacteria 11334
773 Ga0237816_01651 3300039145 Bacteria 1796
774 Ga0436365_0212007 3300039437 Bacteria 1166
775 Ga0436365_0321020 3300039437 Bacteria 2362
776 Ga0451789_0091044 3300041443 Bacteria 771
777 Ga0451795_0301848 3300041456 Bacteria 578
778 Ga0451804_0326837 3300041463 Bacteria 560
779 Ga0451807_0971417 3300041486 Bacteria 1022
780 Ga0451833_1322386 3300041491 Bacteria 517
781 Ga0451845_0301951 3300041501 Bacteria 878
782 Ga0451851_1209629 3300041507 Bacteria 530
783 Ga0451855_1343931 3300041511 Bacteria 534
784 Ga0439448_0001939 3300042005 Bacteria 5514
785 Ga0439448_0002459 3300042005 Bacteria 5047
786 Ga0439448_0012547 3300042005 Bacteria 2537
787 Ga0439452_070674 3300042010 Bacteria 770
788 Ga0439455_0001428 3300042012 Bacteria 3992
789 Ga0439455_0003870 3300042012 Bacteria 2911
790 Ga0450915_020857 3300042119 Bacteria 522
791 Ga0450907_038417 3300042146 Bacteria 819
792 Ga0439458_0000137 3300042157 Bacteria 15585
793 Ga0439459_0102785 3300042438 Bacteria 701
794 Ga0466969_0020897 3300044656 Bacteria 3386
795 Ga0466969_0057629 3300044656 Bacteria 1893
796 Ga0466972_0000826 3300044658 Bacteria 14820
797 Ga0466965_0775357 3300044683 Bacteria 554
798 Ga0466966_0000740 3300044684 Bacteria 20741
799 Ga0466966_0002854 3300044684 Bacteria 11375
800 Ga0466966_0010964 3300044684 Bacteria 6016
801 Ga0466966_0502502 3300044684 Bacteria 729
802 Ga0466961_0008230 3300044693 Bacteria 6641
803 Ga0466961_0463072 3300044693 Bacteria 767
804 Ga0466963_0020310 3300044694 Bacteria 4176
805 Ga0466963_0100484 3300044694 Bacteria 1979
806 Ga0466964_0000258 3300044706 Bacteria 15333
807 Ga0466971_0005161 3300044719 Bacteria 5653
808 Ga0466968_0285448 3300044735 Bacteria 791
809 Ga0466970_0001595 3300044765 Bacteria 10930
810 Ga0466970_0010990 3300044765 Bacteria 4606
811 Ga0466970_0055342 3300044765 Bacteria 2119
812 Ga0466970_0319151 3300044765 Bacteria 878
813 Ga0466957_0000272 3300044842 Bacteria 25068
814 Ga0466957_0326232 3300044842 Bacteria 1037
815 Ga0466960_0004100 3300044901 Bacteria 5665
816 Ga0466960_0181762 3300044901 Bacteria 1140
817 Ga0466960_0617589 3300044901 Bacteria 645
818 Ga0466959_0125671 3300045049 Bacteria 1820
819 Ga0466959_0310885 3300045049 Bacteria 1078
820 Ga0466959_0330778 3300045049 Bacteria 1040
821 Ga0451576_0394264 3300045051 Bacteria 1451
822 Ga0466958_0000445 3300045836 Bacteria 17129
823 Ga0466958_0350118 3300045836 Bacteria 951
824 Ga0466958_0536346 3300045836 Bacteria 760
825 Ga0466967_0206551 3300045976 Bacteria 1862
826 Ga0495627_000090 3300046453 Bacteria 109622
827 Ga0495638_0000758 3300046460 Bacteria 34400
828 Ga0495638_0042982 3300046460 Bacteria 2853
829 Ga0495638_0076777 3300046460 Bacteria 2035
830 Ga0495650_0000818 3300046471 Bacteria 37910
831 Ga0495605_0087182 3300046474 Bacteria 1452
832 Ga0495585_0402340 3300046492 Bacteria 659
833 Ga0495596_0000220 3300046500 Bacteria 39671
834 Ga0495607_0031559 3300046501 Bacteria 3242
835 Ga0495607_0093490 3300046501 Bacteria 1624
836 Ga0495583_0000218 3300046506 Bacteria 96349
837 Ga0495583_0030064 3300046506 Bacteria 2651
838 Ga0495606_0026454 3300046507 Bacteria 4136
839 Ga0495610_0000015 3300046512 Bacteria 391489
840 Ga0495610_0000604 3300046512 Bacteria 35531
841 Ga0495610_0144969 3300046512 Bacteria 1018
842 Ga0495610_0203141 3300046512 Bacteria 810
843 Ga0495620_0007587 3300046515 Bacteria 5880
844 Ga0495643_0000023 3300046522 Bacteria 288590
845 Ga0495643_0011542 3300046522 Bacteria 5374
846 Ga0495643_0040178 3300046522 Bacteria 2555
847 Ga0495643_0045408 3300046522 Bacteria 2385
848 Ga0495663_0018920 3300046525 Bacteria 1965
849 Ga0495654_0086760 3300046530 Bacteria 1458
850 Ga0495598_0000471 3300046537 Bacteria 7367
851 Ga0495609_0007605 3300046538 Bacteria 5387
852 Ga0495621_0000475 3300046539 Bacteria 9889
853 Ga0495597_0090244 3300046542 Bacteria 1302
854 Ga0495622_0052737 3300046557 Bacteria 1887
855 Ga0495633_0016335 3300046558 Bacteria 3829
856 Ga0495633_0126799 3300046558 Bacteria 1181
857 Ga0495668_0000031 3300046616 Bacteria 256576
858 Ga0495668_0006416 3300046616 Bacteria 7706
859 Ga0495668_0171660 3300046616 Bacteria 1188
860 Ga0495625_0000115 3300046660 Bacteria 122861
861 Ga0495625_0001717 3300046660 Bacteria 25448
862 Ga0495625_0045065 3300046660 Bacteria 3190
863 Ga0495625_0051483 3300046660 Bacteria 2952
864 Ga0495625_0269902 3300046660 Bacteria 1098
865 Ga0495669_0002223 3300046684 Bacteria 7968
866 Ga0495670_0000002 3300046691 Bacteria 601814
867 Ga0495670_0006264 3300046691 Bacteria 5837
868 Ga0495670_0010027 3300046691 Bacteria 4659
869 Ga0495670_0058113 3300046691 Bacteria 1942
870 Ga0495671_0298136 3300046692 Bacteria 775
871 Ga0495671_0375704 3300046692 Bacteria 681
872 Ga0495683_0201635 3300047323 Bacteria 897
873 Ga0495687_145671 3300047443 Bacteria 817
874 Ga0495677_0045073 3300047445 Bacteria 1617
875 Ga0495673_0011196 3300047469 Bacteria 4841
876 Ga0495681_0000048 3300047470 Bacteria 110216
877 Ga0495681_0113368 3300047470 Bacteria 1171
878 Ga0495686_0029938 3300047472 Bacteria 3538
879 Ga0495686_0069949 3300047472 Bacteria 2163
880 Ga0495686_0356930 3300047472 Bacteria 793
881 Ga0496101_0070957 3300048904 Bacteria 2552
882 Ga0496101_0138327 3300048904 Bacteria 1854
883 Ga0496101_1212027 3300048904 Bacteria 591
884 Ga0496102_0000615 3300048905 Bacteria 36925
885 Ga0496102_0023742 3300048905 Bacteria 5449
886 Ga0496102_0366878 3300048905 Bacteria 1355
887 Ga0496102_1210665 3300048905 Bacteria 675
888 Ga0496102_1587739 3300048905 Bacteria 573
889 Ga0496103_0009010 3300048906 Bacteria 5911
890 Ga0496103_0009373 3300048906 Bacteria 5799
891 Ga0496103_0075504 3300048906 Bacteria 2114
892 Ga0496104_0000081 3300048907 Bacteria 94514
893 Ga0496104_0041285 3300048907 Bacteria 4325
894 Ga0496104_0050407 3300048907 Bacteria 3928
895 Ga0496104_0182830 3300048907 Bacteria 2007
896 Ga0496105_0000034 3300048908 Bacteria 127505
897 Ga0496105_0000870 3300048908 Bacteria 20664
898 Ga0496105_0181294 3300048908 Bacteria 1724
899 Ga0496107_0025431 3300048910 Bacteria 4191
900 Ga0496108_0094660 3300048911 Bacteria 2542
901 Ga0496108_0193191 3300048911 Bacteria 1765
902 Ga0496109_0168001 3300048912 Bacteria 2057
903 Ga0496109_0539887 3300048912 Bacteria 1100
904 Ga0496109_1345838 3300048912 Bacteria 650
905 Ga0496110_0140371 3300048913 Bacteria 2184
906 Ga0496110_0633428 3300048913 Bacteria 968
907 Ga0496110_0744136 3300048913 Bacteria 883
908 Ga0496111_0147028 3300048914 Bacteria 1747
909 Ga0496111_0176913 3300048914 Bacteria 1586
910 Ga0496111_0992402 3300048914 Bacteria 602
911 Ga0496112_0116278 3300048915 Bacteria 2645
912 Ga0496112_0219258 3300048915 Bacteria 1858
913 Ga0496112_0979400 3300048915 Bacteria 766
914 Ga0496113_0000101 3300048916 Bacteria 36217
915 Ga0496113_0006116 3300048916 Bacteria 7596
916 Ga0496113_0385385 3300048916 Bacteria 1125
917 Ga0496113_1267349 3300048916 Bacteria 574
918 Ga0496114_0023435 3300048917 Bacteria 5038
919 Ga0496115_0108956 3300048918 Bacteria 2274
920 Ga0496115_0280671 3300048918 Bacteria 1367
921 Ga0496116_0077129 3300048919 Bacteria 2084
922 Ga0496116_0101176 3300048919 Bacteria 1721
923 Ga0496117_0000146 3300048920 Bacteria 152244
924 Ga0496117_0067828 3300048920 Bacteria 2411
925 Ga0496117_0312713 3300048920 Bacteria 826
926 Ga0496117_0471181 3300048920 Bacteria 616
927 Ga0496118_0015425 3300048921 Bacteria 7071
928 Ga0496118_0081041 3300048921 Bacteria 2281
929 Ga0496118_0109131 3300048921 Bacteria 1843
930 Ga0496119_0000057 3300048922 Bacteria 173746
931 Ga0496119_0003988 3300048922 Bacteria 14944
932 Ga0496120_0005360 3300048923 Bacteria 10261
933 Ga0496120_0020958 3300048923 Bacteria 4139
934 Ga0496120_0171194 3300048923 Bacteria 1074
935 Ga0496120_0185785 3300048923 Bacteria 1017
936 Ga0496121_0000196 3300048924 Bacteria 135812
937 Ga0496121_0006053 3300048924 Bacteria 15228
938 Ga0496121_0017016 3300048924 Bacteria 7461
939 Ga0496122_0000723 3300048925 Bacteria 64694
940 Ga0496122_0286403 3300048925 Bacteria 897
941 Ga0496123_0002968 3300048926 Bacteria 19751
942 Ga0496123_0116075 3300048926 Bacteria 1517
943 Ga0496124_0000874 3300048927 Bacteria 49185
944 Ga0496124_0023588 3300048927 Bacteria 5614
945 Ga0496124_0476023 3300048927 Bacteria 844
946 Ga0496124_0507938 3300048927 Bacteria 806
947 Ga0496125_0002465 3300048928 Bacteria 24034
948 Ga0496125_0091131 3300048928 Bacteria 2285
949 Ga0496126_0000028 3300048929 Bacteria 394082
950 Ga0496126_0027682 3300048929 Bacteria 5410
951 Ga0496126_0137560 3300048929 Bacteria 2105
952 Ga0501296_087318 3300049519 Bacteria 501
953 Ga0501314_003183 3300049530 Bacteria 1312
954 Ga0501337_019737 3300049553 Bacteria 543
955 Ga0501032_0706763 3300049569 Bacteria 639
956 Ga0501032_0770248 3300049569 Bacteria 608
957 Ga0501033_0214787 3300049570 Bacteria 1371
958 Ga0501034_0071253 3300049571 Bacteria 3485
959 Ga0501034_0420947 3300049571 Bacteria 1257
960 Ga0501036_0133161 3300049572 Bacteria 2098
961 Ga0501071_0207474 3300049587 Bacteria 1473
962 Ga0501074_0347840 3300049590 Bacteria 1052
963 Ga0501217_052350 3300049661 Bacteria 1071
964 Ga0501223_000342 3300049663 Bacteria 11557
965 Ga0501224_000033 3300049664 Bacteria 39112
966 Ga0501233_000413 3300049668 Bacteria 6716
967 Ga0501233_145843 3300049668 Bacteria 657
968 Ga0501235_003998 3300049669 Bacteria 3193
969 Ga0501247_034768 3300049677 Bacteria 702
970 Ga0501249_122167 3300049679 Bacteria 636
971 Ga0501225_0000097 3300049705 Bacteria 28134
972 Ga0501225_0080312 3300049705 Bacteria 936
973 Ga0501225_0114646 3300049705 Bacteria 797
974 Ga0501234_002770 3300049707 Bacteria 2760
975 Ga0501080_0282719 3300049742 Bacteria 1508
976 Ga0501080_0610107 3300049742 Bacteria 968
977 Ga0501241_014967 3300049758 Bacteria 1410
978 Ga0501268_007953 3300049765 Bacteria 1593
979 Ga0501270_065210 3300049767 Bacteria 692
980 Ga0501273_002915 3300049770 Bacteria 1780
981 Ga0501044_0339672 3300049823 Bacteria 1423
982 Ga0501044_0422819 3300049823 Bacteria 1242
983 Ga0501044_0595752 3300049823 Bacteria 999
984 Ga0501044_0659534 3300049823 Bacteria 935
985 Ga0501226_000056 3300049853 Bacteria 39071
986 nmdc:mga03683_344_c1 3300050489 Bacteria 13557
987 nmdc:mga03683_409990_c1 3300050489 Bacteria 648
988 nmdc:mga03683_73463_c1 3300050489 Bacteria 1466
989 nmdc:mga03n38_22087_c1 3300050490 Bacteria 2570
990 nmdc:mga03n38_418364_c1 3300050490 Bacteria 741
991 nmdc:mga00v17_25514_c1 3300050491 Bacteria 3436
992 nmdc:mga00v17_75476_c1 3300050491 Bacteria 1412
993 nmdc:mga0k408_344198_c1 3300050493 Bacteria 889
994 nmdc:mga0k408_484340_c1 3300050493 Bacteria 734
995 nmdc:mga0k408_9833_c1 3300050493 Bacteria 5164
996 nmdc:mga06z11_17_c1 3300050494 Bacteria 79602
997 nmdc:mga04h51_146_c1 3300050495 Bacteria 20585
998 nmdc:mga04h51_284722_c1 3300050495 Bacteria 670
999 nmdc:mga04h51_3829_c1 3300050495 Bacteria 3693
1000 nmdc:mga07m45_111328_c1 3300050496 Bacteria 1577
1001 nmdc:mga07m45_189975_c1 3300050496 Bacteria 1194
1002 nmdc:mga07m45_24809_c1 3300050496 Bacteria 3287
1003 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
1004 nmdc:mga07m45_60295_c1 3300050496 Bacteria 2147
1005 nmdc:mga07m45_65525_c1 3300050496 Bacteria 2063
1006 nmdc:mga0sz30_149231_c1 3300050516 Bacteria 1034
1007 nmdc:mga0sz30_31307_c1 3300050516 Bacteria 2201
1008 nmdc:mga0sz30_46_c1 3300050516 Bacteria 44412
1009 Ga0500643_000004 3300053087 Bacteria 857484
1010 Ga0500643_000783 3300053087 Bacteria 20603
1011 Ga0500643_025387 3300053087 Bacteria 1869
1012 Ga0500643_034160 3300053087 Bacteria 1533
1013 Ga0500643_083586 3300053087 Bacteria 875
1014 Ga0500647_0021734 3300053091 Bacteria 2996
1015 Ga0500566_0294819 3300053094 Bacteria 766
1016 Ga0500641_0073291 3300053096 Bacteria 1445
1017 Ga0500555_000575 3300053103 Bacteria 14512
1018 Ga0500555_184163 3300053103 Bacteria 505
1019 Ga0500556_0000222 3300053104 Bacteria 45971
1020 Ga0500557_124997 3300053105 Bacteria 853
1021 Ga0500562_012822 3300053108 Bacteria 2134
1022 Ga0500562_096187 3300053108 Bacteria 805
1023 Ga0500594_0008135 3300053118 Bacteria 2385
1024 Ga0500595_000572 3300053119 Bacteria 21961
1025 Ga0500595_095238 3300053119 Bacteria 858
1026 Ga0500607_000055 3300053121 Bacteria 78780
1027 Ga0500607_000844 3300053121 Bacteria 29501
1028 Ga0500607_184589 3300053121 Bacteria 920
1029 Ga0500608_001074 3300053122 Bacteria 9755
1030 Ga0500608_007769 3300053122 Bacteria 4458
1031 Ga0500614_053067 3300053123 Bacteria 1070
1032 Ga0500614_155718 3300053123 Bacteria 690
1033 Ga0500618_033483 3300053125 Bacteria 1198
1034 Ga0500618_120739 3300053125 Bacteria 593
1035 Ga0500642_0000011 3300053130 Bacteria 215963
1036 Ga0500642_0121939 3300053130 Bacteria 1220
1037 Ga0500559_0003805 3300053136 Bacteria 7307
1038 Ga0500559_0156387 3300053136 Bacteria 1071
1039 Ga0500564_001322 3300053138 Bacteria 8462
1040 Ga0500568_0006166 3300053139 Bacteria 6063
1041 Ga0500568_0229107 3300053139 Bacteria 678
1042 Ga0500573_0000114 3300053140 Bacteria 32888
1043 Ga0500590_011655 3300053148 Bacteria 4459
1044 Ga0500616_0006078 3300053153 Bacteria 8008
1045 Ga0500616_0142733 3300053153 Bacteria 1117
1046 Ga0500622_0001994 3300053156 Bacteria 15306
1047 Ga0500622_0077848 3300053156 Bacteria 1665
1048 Ga0500622_0162940 3300053156 Bacteria 1044
1049 Ga0500622_0264177 3300053156 Bacteria 749
1050 Ga0500627_0506062 3300053158 Bacteria 502
1051 Ga0500636_0180881 3300053177 Bacteria 1132
1052 Ga0500567_000074 3300053723 Bacteria 22867
1053 Ga0500625_000002 3300053729 Bacteria 371909
1054 Ga0500645_000417 3300053730 Bacteria 29425
1055 Ga0500645_004197 3300053730 Bacteria 5605
1056 Ga0500645_006930 3300053730 Bacteria 3999
1057 Ga0590075_118063 3300059424 Bacteria 694
1058 Ga0587070_107679 3300059491 Bacteria 650
1059 Ga0587085_013648 3300059506 Bacteria 1134
1060 Ga0587085_032596 3300059506 Bacteria 865
1061 Ga0587062_008373 3300059639 Bacteria 1232
1062 Ga0466962_0002892 3300061719 Bacteria 8187
1063 2511130324 2510917021 Bacteria 5705459
1064 2643819656 2643221560 Bacteria 4801179
1065 2739651864 2739367664 Bacteria 4114334
1066 2740030338 2739367865 Bacteria 4114482
1067 2778125106 2775507255 Bacteria 3945731
1068 2830076934 2830075706 Bacteria 3855215
1069 2852654519 2852653556 Bacteria 4050083
1070 2852684014 2852680915 Bacteria 4100189
1071 2882807015 2882806704 Bacteria 3007728
1072 2885427691 2885427238 Bacteria 2291351
1073 2895888362 2895880812 Bacteria 11255272
1074 2896186911 2896184354 Bacteria 3258548
1075 2928030296 2928027323 Bacteria 4382488
1076 2946789281 2946787523 Bacteria 4366789
1077 2984558873 2984555340 Bacteria 4247089
1078 2984566613 2984564862 Bacteria 4339992
1079 2990266883 2990265787 Bacteria 3943888
1080 2993357809 2993356040 Bacteria 4247105
1081 2993693828 2993693658 Bacteria 4040749
1082 3000866466 3000865235 Bacteria 3106258
1083 8054303053 8054302542 Bacteria 5698134
1084 8057101257 8057101203 Bacteria 5034064
1085 Ga0395905_1046289
1086 RicEn_FSXC48507_g1
1087 SwRhRL2b_contig_14491
1088 SwRhRL2b_contig_1941805
1089 JGI24741J21665_1009296
1090 JGI24741J21665_1026449
1091 JGI24740J21852_10025645
1092 JGI24740J21852_10044246
1093 JGI24739J22299_10085084
1094 JGI24737J22298_10015406
1095 JGI24737J22298_10141222
1096 JGI24737J22298_10159807
1097 JGI24735J21928_10004614
1098 JGI24735J21928_10009368
1099 JGI24735J21928_10020556
1100 JGI24749J21850_1080763
1101 JGI24035J26624_1026530
1102 JGI24034J26672_10032562
1103 JGI24034J26672_10034318
1104 JGI24751J29686_10000183
1105 JGI24751J29686_10006267
1106 JGI25406J46586_10073176
1107 Ga0055536_1001129
1108 Ga0055534_1028413
1109 Ga0055530_10000217
1110 Ga0055530_10120939
1111 Ga0055531_10000571
1112 Ga0055531_10017368
1113 Ga0058863_10010079
1114 Ga0065165_1005029
1115 Ga0065704_10070504
1116 Ga0065704_10160113
1117 Ga0065704_10623232
1118 Ga0065712_10655293
1119 Ga0070658_10001814
1120 Ga0070658_10004690
1121 Ga0070658_10078926
1122 Ga0070658_10254395
1123 Ga0070658_10486976
1124 Ga0070658_10553426
1125 Ga0070658_10590018
1126 Ga0070658_10819451
1127 Ga0070658_10906585
1128 Ga0070683_100080914
1129 Ga0070683_100142414
1130 Ga0070683_100209353
1131 Ga0070683_100412603
1132 Ga0070683_101204161
1133 Ga0070690_100189611
1134 Ga0070670_100036211
1135 Ga0070670_100126344
1136 Ga0070670_100556582
1137 Ga0068869_101523852
1138 Ga0070666_10031513
1139 Ga0070666_10245552
1140 Ga0070666_10257671
1141 Ga0070680_100001532
1142 Ga0070680_100130253
1143 Ga0070680_100862652
1144 Ga0070680_100886637
1145 Ga0070682_100231965
1146 Ga0070682_100292626
1147 Ga0070682_100574623
1148 Ga0070660_100004583
1149 Ga0070660_100009577
1150 Ga0070660_100025704
1151 Ga0070660_100075067
1152 Ga0070660_100078162
1153 Ga0070660_100122768
1154 Ga0070660_100138856
1155 Ga0070660_100359155
1156 Ga0070660_100564963
1157 Ga0070660_100768117
1158 Ga0070687_100522493
1159 Ga0070687_101372528
1160 Ga0070661_100005966
1161 Ga0070661_100012214
1162 Ga0070661_100044029
1163 Ga0070692_10042253
1164 Ga0070692_10329553
1165 Ga0070668_100000080
1166 Ga0070668_100011581
1167 Ga0070668_100027483
1168 Ga0070668_100038637
1169 Ga0070668_100408180
1170 Ga0070668_100899906
1171 Ga0070669_100000082
1172 Ga0070669_100000270
1173 Ga0070669_100001657
1174 Ga0070669_100538648
1175 Ga0070671_100000116
1176 Ga0070671_100000169
1177 Ga0070671_100000299
1178 Ga0070671_100013092
1179 Ga0070671_100017053
1180 Ga0070671_101306033
1181 Ga0070671_102039776
1182 Ga0070674_100041961
1183 Ga0070673_101163110
1184 Ga0070659_100143162
1185 Ga0070659_100160559
1186 Ga0070659_100487981
1187 Ga0070659_100712402
1188 Ga0070659_100757091
1189 Ga0070659_102119143
1190 Ga0070667_100000968
1191 Ga0070667_100001907
1192 Ga0070667_100038717
1193 Ga0070667_100125378
1194 Ga0070667_100352616
1195 Ga0070667_101184761
1196 Ga0070711_101751273
1197 Ga0070705_101929486
1198 Ga0070663_100042802
1199 Ga0070663_100072263
1200 Ga0070663_100138996
1201 Ga0070663_100146585
1202 Ga0070663_100213009
1203 Ga0070663_100418732
1204 Ga0070663_100769265
1205 Ga0070678_101599225
1206 Ga0070662_100002038
1207 Ga0070662_100051197
1208 Ga0070662_100094062
1209 Ga0070662_100477503
1210 Ga0070681_10049910
1211 Ga0070681_10279946
1212 Ga0070681_10515005
1213 Ga0070681_10778075
1214 Ga0070679_100049171
1215 Ga0070679_100053739
1216 Ga0070679_100125039
1217 Ga0070679_100165965
1218 Ga0070679_100797661
1219 Ga0070684_100058240
1220 Ga0070684_100275617
1221 Ga0070684_101360092
1222 Ga0068853_100000825
1223 Ga0068853_100001009
1224 Ga0068853_100090669
1225 Ga0068853_100099224
1226 Ga0068853_100175395
1227 Ga0068853_100773978
1228 Ga0068853_100828533
1229 Ga0068853_100932187
1230 Ga0070686_100246175
1231 Ga0070665_100002434
1232 Ga0070665_100009702
1233 Ga0070665_100020215
1234 Ga0070665_100095381
1235 Ga0070665_100235968
1236 Ga0068855_100007299
1237 Ga0068855_100011899
1238 Ga0068855_100017657
1239 Ga0068855_100022037
1240 Ga0068855_100058341
1241 Ga0068855_100234877
1242 Ga0068855_100657660
1243 Ga0068855_101628431
1244 Ga0070664_100004940
1245 Ga0070664_100063472
1246 Ga0070664_100107496
1247 Ga0070664_100685619
1248 Ga0070664_101361990
1249 Ga0068857_100012786
1250 Ga0068857_100034254
1251 Ga0068857_100246743
1252 Ga0068857_100532724
1253 Ga0068857_100782136
1254 Ga0068857_100977674
1255 Ga0068857_102328909
1256 Ga0068854_100000459
1257 Ga0068854_100013420
1258 Ga0068854_100047093
1259 Ga0068854_100137097
1260 Ga0068854_100159330
1261 Ga0068854_100166546
1262 Ga0068854_100812281
1263 Ga0068854_101049149
1264 Ga0068854_101325357
1265 Ga0068856_100025980
1266 Ga0068856_100034389
1267 Ga0068856_100194821
1268 Ga0068856_100328553
1269 Ga0068856_100520452
1270 Ga0068856_101792595
1271 Ga0068852_100000231
1272 Ga0068852_100012993
1273 Ga0068852_100086148
1274 Ga0068852_100296204
1275 Ga0068852_100408267
1276 Ga0068852_100447063
1277 Ga0068852_100638361
1278 Ga0068852_102411732
1279 Ga0068859_100010259
1280 Ga0068859_100859376
1281 Ga0068859_100868714
1282 Ga0068859_101026602
1283 Ga0068859_101045548
1284 Ga0068864_100003823
1285 Ga0068864_100004682
1286 Ga0068864_100029698
1287 Ga0068864_100080985
1288 Ga0068864_101173069
1289 Ga0068861_100000001
1290 Ga0068863_100000001
1291 Ga0068863_100000106
1292 Ga0068863_100044294
1293 Ga0068863_100094394
1294 Ga0068863_100137511
1295 Ga0068863_100166090
1296 Ga0068863_100261102
1297 Ga0068858_100000327
1298 Ga0068858_100001247
1299 Ga0068858_100039777
1300 Ga0068858_100056520
1301 Ga0068858_100163708
1302 Ga0068858_100327621
1303 Ga0068860_100000386
1304 Ga0068860_100009605
1305 Ga0068860_100092375
1306 Ga0068860_100115216
1307 Ga0068860_100310382
1308 Ga0068860_100465108
1309 Ga0068860_102626142
1310 Ga0068862_100009807
1311 Ga0068862_100021177
1312 Ga0068862_100027853
1313 Ga0068862_100049285
1314 Ga0068862_100490347
1315 Ga0068862_101159350
1316 Ga0068862_101734200
1317 Ga0081540_1162277
1318 Ga0081539_10074933
1319 Ga0075365_10080983
1320 Ga0075365_10477151
1321 Ga0075368_10000112
1322 Ga0075368_10000385
1323 Ga0075368_10322642
1324 Ga0075363_100005439
1325 Ga0075363_100012861
1326 Ga0075364_10110693
1327 Ga0075362_10000129
1328 Ga0075362_10143095
1329 Ga0075362_10257530
1330 Ga0075367_10000692
1331 Ga0075367_10782097
1332 Ga0075369_10032715
1333 Ga0075369_10089500
1334 Ga0075369_10159290
1335 Ga0075366_10013664
1336 Ga0075366_10245806
1337 Ga0075366_10530539
1338 Ga0075370_10010420
1339 Ga0075370_10043587
1340 Ga0075370_10058591
1341 Ga0075370_10126540
1342 Ga0075370_10394531
1343 Ga0075429_100833896
1344 Ga0068865_101099164
1345 Ga0068865_101281440
1346 Ga0097620_100010259
1347 Ga0097620_100859461
1348 Ga0097620_100868709
1349 Ga0097620_101026648
1350 Ga0097620_101045495
1351 Ga0079104_1061795
1352 Ga0105251_10012362
1353 Ga0105250_10006517
1354 Ga0105240_10013931
1355 Ga0105240_10570341
1356 Ga0105240_10794470
1357 Ga0105247_10589857
1358 Ga0105247_10716195
1359 Ga0105243_10320752
1360 Ga0105243_10767589
1361 Ga0105243_12130670
1362 Ga0105241_10084481
1363 Ga0105241_10425900
1364 Ga0105241_10565791
1365 Ga0105242_11505959
1366 Ga0105248_10001758
1367 Ga0105248_10029772
1368 Ga0105248_10030056
1369 Ga0105248_10043233
1370 Ga0105248_10074540
1371 Ga0105248_10106004
1372 Ga0105248_10158703
1373 Ga0105248_10168174
1374 Ga0105248_13145328
1375 Ga0105237_11817604
1376 Ga0105238_10070938
1377 Ga0105238_10231030
1378 Ga0105238_10668100
1379 Ga0105249_10037409
1380 Ga0105249_10174180
1381 Ga0105249_10261051
1382 Ga0105249_10265973
1383 Ga0105249_10538642
1384 Ga0105239_10846266
1385 Ga0105239_11201659
1386 Ga0105239_11229129
1387 Ga0105246_10477789
1388 Ga0157326_1000423
1389 Ga0157373_10005891
1390 Ga0157373_10073069
1391 Ga0157373_10073823
1392 Ga0157373_10118854
1393 Ga0157373_10152393
1394 Ga0157373_10210985
1395 Ga0157373_10439064
1396 Ga0157373_11454634
1397 Ga0157371_10005585
1398 Ga0157371_10014817
1399 Ga0157371_10030644
1400 Ga0157371_10126094
1401 Ga0157371_10159148
1402 Ga0157371_10285046
1403 Ga0157371_10670109
1404 Ga0157370_10008601
1405 Ga0157370_10020840
1406 Ga0157370_10069312
1407 Ga0157370_10214812
1408 Ga0157370_10481893
1409 Ga0157370_10504540
1410 Ga0157370_10648743
1411 Ga0157370_10998843
1412 Ga0157370_11611114
1413 Ga0157369_10001177
1414 Ga0157369_10011267
1415 Ga0157369_10012443
1416 Ga0157369_10073644
1417 Ga0157369_10109686
1418 Ga0157369_10173906
1419 Ga0157369_10181989
1420 Ga0157369_11651416
1421 Ga0157374_10007709
1422 Ga0157378_10071999
1423 Ga0157378_11229493
1424 Ga0163162_10016081
1425 Ga0163162_10049256
1426 Ga0163162_10065959
1427 Ga0163162_10814754
1428 Ga0163162_11240239
1429 Ga0163162_11256044
1430 Ga0163162_11336558
1431 Ga0163162_11845107
1432 Ga0157372_10026953
1433 Ga0157372_10069390
1434 Ga0157372_10118609
1435 Ga0157372_10194284
1436 Ga0157372_10879583
1437 Ga0157372_11445556
1438 Ga0157375_12513516
1439 Ga0157375_12610828
1440 Ga0163163_11045620
1441 Ga0157380_10419982
1442 Ga0157380_12027684
1443 Ga0157380_13020417
1444 Ga0182008_10147420
1445 Ga0182008_10307738
1446 Ga0157379_10103451
1447 Ga0157379_10164180
1448 Ga0163161_10001762
1449 Ga0163161_10236398
1450 Ga0163161_10420818
1451 Ga0163161_11570665
1452 Ga0206356_10328308
1453 Ga0206352_10656295
1454 Ga0213876_10176276
1455 Ga0207672_1014332
1456 Ga0209233_1000104
1457 Ga0209455_1059436
1458 Ga0207673_1010721
1459 Ga0209675_1000082
1460 Ga0209676_1000424
1461 Ga0209676_1000567
1462 Ga0209676_1000670
1463 Ga0209025_1013258
1464 Ga0209050_1000017
1465 Ga0209050_1015992
1466 Ga0209050_1033183
1467 Ga0209257_1000151
1468 Ga0209257_1000202
1469 Ga0209257_1014543
1470 Ga0207697_10010597
1471 Ga0207697_10035408
1472 Ga0207697_10197006
1473 Ga0207697_10279311
1474 Ga0207656_10012272
1475 Ga0207696_1007265
1476 Ga0207713_1010142
1477 Ga0207713_1053960
1478 Ga0207710_10444116
1479 Ga0207688_10153841
1480 Ga0207680_10104003
1481 Ga0207680_10140902
1482 Ga0207680_10181472
1483 Ga0207647_10065904
1484 Ga0207647_10103590
1485 Ga0207647_10498365
1486 Ga0207705_10000004
1487 Ga0207705_10000101
1488 Ga0207705_10005310
1489 Ga0207705_10032428
1490 Ga0207705_10038874
1491 Ga0207705_10097229
1492 Ga0207705_10128666
1493 Ga0207705_10142233
1494 Ga0207705_10299322
1495 Ga0207705_10347589
1496 Ga0207705_10421385
1497 Ga0207705_10925174
1498 Ga0207654_10546964
1499 Ga0207707_10076073
1500 Ga0207707_10223926
1501 Ga0207707_10438375
1502 Ga0207707_10575695
1503 Ga0207707_11330494
1504 Ga0207695_10018947
1505 Ga0207695_10106455
1506 Ga0207660_10045514
1507 Ga0207660_10063096
1508 Ga0207662_10472288
1509 Ga0207662_10763019
1510 Ga0207662_10820166
1511 Ga0207657_10000408
1512 Ga0207657_10012539
1513 Ga0207657_10026870
1514 Ga0207657_10040078
1515 Ga0207657_10048949
1516 Ga0207657_10052113
1517 Ga0207657_10071057
1518 Ga0207657_10261261
1519 Ga0207649_10003307
1520 Ga0207649_10024515
1521 Ga0207649_10158761
1522 Ga0207652_10031309
1523 Ga0207652_10063222
1524 Ga0207652_10134787
1525 Ga0207652_10139747
1526 Ga0207652_10253453
1527 Ga0207652_10365535
1528 Ga0207652_10784934
1529 Ga0207681_10000109
1530 Ga0207681_10002968
1531 Ga0207681_10009596
1532 Ga0207681_10478058
1533 Ga0207681_11218265
1534 Ga0207681_11290750
1535 Ga0207694_10077123
1536 Ga0207694_10226894
1537 Ga0207694_10236267
1538 Ga0207694_10585392
1539 Ga0207650_10126255
1540 Ga0207650_10174974
1541 Ga0207650_10381342
1542 Ga0207650_10853930
1543 Ga0207650_11317486
1544 Ga0207650_11880296
1545 Ga0207687_10010076
1546 Ga0207664_10224251
1547 Ga0207644_10000012
1548 Ga0207644_10000191
1549 Ga0207644_10022749
1550 Ga0207644_10076366
1551 Ga0207644_10348981
1552 Ga0207644_10649711
1553 Ga0207644_11159527
1554 Ga0207690_10008011
1555 Ga0207690_10021761
1556 Ga0207690_10242687
1557 Ga0207690_10349896
1558 Ga0207690_10393138
1559 Ga0207690_10492626
1560 Ga0207690_11806889
1561 Ga0207706_10008254
1562 Ga0207706_10033279
1563 Ga0207706_10076637
1564 Ga0207706_10211000
1565 Ga0207706_10292525
1566 Ga0207706_10398949
1567 Ga0207709_10088718
1568 Ga0207709_10365053
1569 Ga0207709_10413443
1570 Ga0207670_10243061
1571 Ga0207669_10156416
1572 Ga0207704_10841359
1573 Ga0207704_11156110
1574 Ga0207691_10181467
1575 Ga0207711_10000852
1576 Ga0207711_10020403
1577 Ga0207711_10086344
1578 Ga0207711_10104536
1579 Ga0207711_10383571
1580 Ga0207711_10498269
1581 Ga0207711_10833452
1582 Ga0207711_11370931
1583 Ga0207689_10336795
1584 Ga0207661_10039869
1585 Ga0207661_10453662
1586 Ga0207661_11174662
1587 Ga0207679_10004188
1588 Ga0207679_10017162
1589 Ga0207679_10255223
1590 Ga0207679_10561348
1591 Ga0207667_10003563
1592 Ga0207667_10005019
1593 Ga0207667_10016908
1594 Ga0207667_10038338
1595 Ga0207667_10070651
1596 Ga0207667_10078696
1597 Ga0207667_10098261
1598 Ga0207667_10112317
1599 Ga0207667_10748010
1600 Ga0207712_10057696
1601 Ga0207712_10092123
1602 Ga0207712_10358131
1603 Ga0207712_10657564
1604 Ga0207712_11861207
1605 Ga0207668_10000304
1606 Ga0207668_10083673
1607 Ga0207668_10105153
1608 Ga0207668_10115951
1609 Ga0207668_10180046
1610 Ga0207668_10328540
1611 Ga0207668_10819854
1612 Ga0207668_11892319
1613 Ga0207640_10000508
1614 Ga0207640_10077559
1615 Ga0207640_10080263
1616 Ga0207640_10093030
1617 Ga0207640_10627768
1618 Ga0207640_12027889
1619 Ga0207658_10000344
1620 Ga0207658_10001008
1621 Ga0207658_10001566
1622 Ga0207658_10008713
1623 Ga0207658_11113228
1624 Ga0207658_11372109
1625 Ga0207703_10000244
1626 Ga0207703_10000775
1627 Ga0207703_10004946
1628 Ga0207703_10027481
1629 Ga0207703_10029046
1630 Ga0207703_10052344
1631 Ga0207639_10000771
1632 Ga0207639_10124943
1633 Ga0207639_10270861
1634 Ga0207639_10914052
1635 Ga0207639_10977047
1636 Ga0207639_11211883
1637 Ga0207639_11376593
1638 Ga0207678_10004771
1639 Ga0207678_10020075
1640 Ga0207678_10022461
1641 Ga0207678_10029324
1642 Ga0207678_10046385
1643 Ga0207678_10450446
1644 Ga0207702_10012315
1645 Ga0207702_10147935
1646 Ga0207702_10271381
1647 Ga0207702_10415455
1648 Ga0207641_10000001
1649 Ga0207641_10000733
1650 Ga0207641_10066769
1651 Ga0207641_10075989
1652 Ga0207641_10202140
1653 Ga0207648_10522443
1654 Ga0207676_10002656
1655 Ga0207676_10003409
1656 Ga0207676_10185065
1657 Ga0207676_11758449
1658 Ga0207676_12238743
1659 Ga0207674_10008322
1660 Ga0207674_10015484
1661 Ga0207674_10017301
1662 Ga0207674_10098726
1663 Ga0207674_10894032
1664 Ga0207674_10895518
1665 Ga0207674_11037951
1666 Ga0207674_11384357
1667 Ga0207675_100000196
1668 Ga0207675_100575285
1669 Ga0207698_10000058
1670 Ga0207698_10099316
1671 Ga0207698_10729225
1672 Ga0207698_10864109
1673 Ga0207698_11099152
1674 Ga0207698_12320571
1675 Ga0209281_1071516
1676 Ga0209983_1096238
1677 Ga0209813_10000051
1678 Ga0209813_10001612
1679 Ga0209974_10006613
1680 Ga0209974_10008683
1681 Ga0209974_10347866
1682 Ga0268266_10002003
1683 Ga0268266_10005024
1684 Ga0268266_10006189
1685 Ga0268266_10124658
1686 Ga0268266_10158947
1687 Ga0268265_10017233
1688 Ga0268265_10070317
1689 Ga0268265_10129908
1690 Ga0268265_10146980
1691 Ga0268265_10243981
1692 Ga0268265_10387566
1693 Ga0268265_10984873
1694 Ga0268265_12105585
1695 Ga0268264_10000040
1696 Ga0268264_10004259
1697 Ga0268264_10007794
1698 Ga0268264_10012572
1699 Ga0268264_10290110
1700 Ga0307515_10596048
1701 Ga0265331_10081417
1702 Ga0307408_100036575
1703 Ga0307408_100189378
1704 Ga0307408_100266195
1705 Ga0307408_100631195
1706 Ga0307408_101090399
1707 Ga0307508_10000231
1708 Ga0307405_10015706
1709 Ga0307405_10046408
1710 Ga0307405_10111192
1711 Ga0307405_10179072
1712 Ga0307405_10420225
1713 Ga0307405_10422638
1714 Ga0307405_10549733
1715 Ga0307405_10554500
1716 Ga0307405_10868865
1717 Ga0307405_11199702
1718 Ga0307405_11987736
1719 Ga0307405_12083234
1720 Ga0316577_10488641
1721 Ga0307413_10008092
1722 Ga0307413_10095332
1723 Ga0307413_10111184
1724 Ga0307413_10116974
1725 Ga0307413_10378532
1726 Ga0307413_10419605
1727 Ga0307413_10513941
1728 Ga0307413_10663468
1729 Ga0307413_11247714
1730 Ga0307413_11749671
1731 Ga0307410_10032218
1732 Ga0307410_10127384
1733 Ga0307410_10129375
1734 Ga0307410_10131184
1735 Ga0307410_10137046
1736 Ga0307410_10180454
1737 Ga0307410_10407750
1738 Ga0307410_10572941
1739 Ga0307410_10930431
1740 Ga0307410_11223504
1741 Ga0307410_11401924
1742 Ga0307406_10033738
1743 Ga0307406_10091044
1744 Ga0307406_10271518
1745 Ga0307406_10313769
1746 Ga0307406_10350397
1747 Ga0307406_11715690
1748 Ga0307406_11945942
1749 Ga0307407_10054827
1750 Ga0307407_10087998
1751 Ga0307407_10194064
1752 Ga0307407_10227621
1753 Ga0307407_10604107
1754 Ga0307407_10811828
1755 Ga0307407_10922904
1756 Ga0307412_10001165
1757 Ga0307412_10015626
1758 Ga0307412_10125238
1759 Ga0307412_10135773
1760 Ga0307412_10153714
1761 Ga0307412_10202251
1762 Ga0307412_10426873
1763 Ga0307412_10820651
1764 Ga0307412_10955735
1765 Ga0307412_11271016
1766 Ga0307409_100095312
1767 Ga0307409_100117196
1768 Ga0307409_100149115
1769 Ga0307409_100332388
1770 Ga0307409_100342934
1771 Ga0307409_100435543
1772 Ga0307409_100461811
1773 Ga0307409_100485830
1774 Ga0307409_100594830
1775 Ga0307409_100674330
1776 Ga0307409_101883139
1777 Ga0307409_102048642
1778 Ga0307416_100040940
1779 Ga0307416_100153329
1780 Ga0307416_100168294
1781 Ga0307416_100175956
1782 Ga0307416_100204887
1783 Ga0307416_100376208
1784 Ga0307416_100380462
1785 Ga0307416_100482992
1786 Ga0307416_100658642
1787 Ga0307416_100741865
1788 Ga0307416_101023308
1789 Ga0307416_101514386
1790 Ga0307416_101638397
1791 Ga0307416_103152627
1792 Ga0307414_10000090
1793 Ga0307414_10000343
1794 Ga0307414_10002814
1795 Ga0307414_10009210
1796 Ga0307414_10029163
1797 Ga0307414_10037198
1798 Ga0307414_10092078
1799 Ga0307414_10107005
1800 Ga0307414_10165350
1801 Ga0307414_10214200
1802 Ga0307414_10456215
1803 Ga0307414_10618279
1804 Ga0307414_10638625
1805 Ga0307414_11791120
1806 Ga0307411_10029935
1807 Ga0307411_10049558
1808 Ga0307411_10089366
1809 Ga0307411_10098320
1810 Ga0307411_10318724
1811 Ga0307411_10342784
1812 Ga0307411_10394801
1813 Ga0307411_10559042
1814 Ga0307411_10594900
1815 Ga0307411_10894142
1816 Ga0307411_11094600
1817 Ga0307411_11096189
1818 Ga0307411_11120777
1819 Ga0307415_100021335
1820 Ga0307415_100060290
1821 Ga0307415_100251349
1822 Ga0307415_100308804
1823 Ga0307415_100310477
1824 Ga0307415_100434342
1825 Ga0307415_100487062
1826 Ga0307415_101374269
1827 Ga0307415_101554950
1828 Ga0316583_10017344
1829 Ga0307510_10148726
1830 Ga0316582_0123061
1831 Ga0316584_0322947
1832 Ga0395899_0021460
1833 Ga0395899_0037336
1834 Ga0395899_0044654
1835 Ga0395900_0003576
1836 Ga0395900_0065379
1837 Ga0395900_0227501
1838 Ga0395900_0285305
1839 Ga0395900_0338178
1840 Ga0395900_0914872
1841 Ga0395898_0006820
1842 Ga0395898_0029920
1843 Ga0395898_0174873
1844 Ga0395905_0020072
1845 Ga0395905_0089111
1846 Ga0395905_0127455
1847 Ga0395905_0183179
1848 Ga0395905_0592616
1849 Ga0395905_1115582
1850 Ga0395901_0023315
1851 Ga0395901_0024563
1852 Ga0395901_0037956
1853 Ga0395901_0053668
1854 Ga0395901_0306549
1855 Ga0395901_0530584
1856 Ga0237819_00646
1857 Ga0237816_01651
1858 Ga0436365_0212007
1859 Ga0436365_0321020
1860 Ga0451789_0091044
1861 Ga0451795_0301848
1862 Ga0451804_0326837
1863 Ga0451807_0971417
1864 Ga0451833_1322386
1865 Ga0451845_0301951
1866 Ga0451851_1209629
1867 Ga0451855_1343931
1868 Ga0439448_0001939
1869 Ga0439448_0002459
1870 Ga0439448_0012547
1871 Ga0439452_070674
1872 Ga0439455_0001428
1873 Ga0439455_0003870
1874 Ga0450915_020857
1875 Ga0450907_038417
1876 Ga0439458_0000137
1877 Ga0439459_0102785
1878 Ga0466969_0020897
1879 Ga0466969_0057629
1880 Ga0466972_0000826
1881 Ga0466965_0775357
1882 Ga0466966_0000740
1883 Ga0466966_0002854
1884 Ga0466966_0010964
1885 Ga0466966_0502502
1886 Ga0466961_0008230
1887 Ga0466961_0463072
1888 Ga0466963_0020310
1889 Ga0466963_0100484
1890 Ga0466964_0000258
1891 Ga0466971_0005161
1892 Ga0466968_0285448
1893 Ga0466970_0001595
1894 Ga0466970_0010990
1895 Ga0466970_0055342
1896 Ga0466970_0319151
1897 Ga0466957_0000272
1898 Ga0466957_0326232
1899 Ga0466960_0004100
1900 Ga0466960_0181762
1901 Ga0466960_0617589
1902 Ga0466959_0125671
1903 Ga0466959_0310885
1904 Ga0466959_0330778
1905 Ga0451576_0394264
1906 Ga0466958_0000445
1907 Ga0466958_0350118
1908 Ga0466958_0536346
1909 Ga0466967_0206551
1910 Ga0495627_000090
1911 Ga0495638_0000758
1912 Ga0495638_0042982
1913 Ga0495638_0076777
1914 Ga0495650_0000818
1915 Ga0495605_0087182
1916 Ga0495585_0402340
1917 Ga0495596_0000220
1918 Ga0495607_0031559
1919 Ga0495607_0093490
1920 Ga0495583_0000218
1921 Ga0495583_0030064
1922 Ga0495606_0026454
1923 Ga0495610_0000015
1924 Ga0495610_0000604
1925 Ga0495610_0144969
1926 Ga0495610_0203141
1927 Ga0495620_0007587
1928 Ga0495643_0000023
1929 Ga0495643_0011542
1930 Ga0495643_0040178
1931 Ga0495643_0045408
1932 Ga0495663_0018920
1933 Ga0495654_0086760
1934 Ga0495598_0000471
1935 Ga0495609_0007605
1936 Ga0495621_0000475
1937 Ga0495597_0090244
1938 Ga0495622_0052737
1939 Ga0495633_0016335
1940 Ga0495633_0126799
1941 Ga0495668_0000031
1942 Ga0495668_0006416
1943 Ga0495668_0171660
1944 Ga0495625_0000115
1945 Ga0495625_0001717
1946 Ga0495625_0045065
1947 Ga0495625_0051483
1948 Ga0495625_0269902
1949 Ga0495669_0002223
1950 Ga0495670_0000002
1951 Ga0495670_0006264
1952 Ga0495670_0010027
1953 Ga0495670_0058113
1954 Ga0495671_0298136
1955 Ga0495671_0375704
1956 Ga0495683_0201635
1957 Ga0495687_145671
1958 Ga0495677_0045073
1959 Ga0495673_0011196
1960 Ga0495681_0000048
1961 Ga0495681_0113368
1962 Ga0495686_0029938
1963 Ga0495686_0069949
1964 Ga0495686_0356930
1965 Ga0496101_0070957
1966 Ga0496101_0138327
1967 Ga0496101_1212027
1968 Ga0496102_0000615
1969 Ga0496102_0023742
1970 Ga0496102_0366878
1971 Ga0496102_1210665
1972 Ga0496102_1587739
1973 Ga0496103_0009010
1974 Ga0496103_0009373
1975 Ga0496103_0075504
1976 Ga0496104_0000081
1977 Ga0496104_0041285
1978 Ga0496104_0050407
1979 Ga0496104_0182830
1980 Ga0496105_0000034
1981 Ga0496105_0000870
1982 Ga0496105_0181294
1983 Ga0496107_0025431
1984 Ga0496108_0094660
1985 Ga0496108_0193191
1986 Ga0496109_0168001
1987 Ga0496109_0539887
1988 Ga0496109_1345838
1989 Ga0496110_0140371
1990 Ga0496110_0633428
1991 Ga0496110_0744136
1992 Ga0496111_0147028
1993 Ga0496111_0176913
1994 Ga0496111_0992402
1995 Ga0496112_0116278
1996 Ga0496112_0219258
1997 Ga0496112_0979400
1998 Ga0496113_0000101
1999 Ga0496113_0006116
2000 Ga0496113_0385385
2001 Ga0496113_1267349
2002 Ga0496114_0023435
2003 Ga0496115_0108956
2004 Ga0496115_0280671
2005 Ga0496116_0077129
2006 Ga0496116_0101176
2007 Ga0496117_0000146
2008 Ga0496117_0067828
2009 Ga0496117_0312713
2010 Ga0496117_0471181
2011 Ga0496118_0015425
2012 Ga0496118_0081041
2013 Ga0496118_0109131
2014 Ga0496119_0000057
2015 Ga0496119_0003988
2016 Ga0496120_0005360
2017 Ga0496120_0020958
2018 Ga0496120_0171194
2019 Ga0496120_0185785
2020 Ga0496121_0000196
2021 Ga0496121_0006053
2022 Ga0496121_0017016
2023 Ga0496122_0000723
2024 Ga0496122_0286403
2025 Ga0496123_0002968
2026 Ga0496123_0116075
2027 Ga0496124_0000874
2028 Ga0496124_0023588
2029 Ga0496124_0476023
2030 Ga0496124_0507938
2031 Ga0496125_0002465
2032 Ga0496125_0091131
2033 Ga0496126_0000028
2034 Ga0496126_0027682
2035 Ga0496126_0137560
2036 Ga0501296_087318
2037 Ga0501314_003183
2038 Ga0501337_019737
2039 Ga0501032_0706763
2040 Ga0501032_0770248
2041 Ga0501033_0214787
2042 Ga0501034_0071253
2043 Ga0501034_0420947
2044 Ga0501036_0133161
2045 Ga0501071_0207474
2046 Ga0501074_0347840
2047 Ga0501217_052350
2048 Ga0501223_000342
2049 Ga0501224_000033
2050 Ga0501233_000413
2051 Ga0501233_145843
2052 Ga0501235_003998
2053 Ga0501247_034768
2054 Ga0501249_122167
2055 Ga0501225_0000097
2056 Ga0501225_0080312
2057 Ga0501225_0114646
2058 Ga0501234_002770
2059 Ga0501080_0282719
2060 Ga0501080_0610107
2061 Ga0501241_014967
2062 Ga0501268_007953
2063 Ga0501270_065210
2064 Ga0501273_002915
2065 Ga0501044_0339672
2066 Ga0501044_0422819
2067 Ga0501044_0595752
2068 Ga0501044_0659534
2069 Ga0501226_000056
2070 nmdc:mga03683_344_c1
2071 nmdc:mga03683_409990_c1
2072 nmdc:mga03683_73463_c1
2073 nmdc:mga03n38_22087_c1
2074 nmdc:mga03n38_418364_c1
2075 nmdc:mga00v17_25514_c1
2076 nmdc:mga00v17_75476_c1
2077 nmdc:mga0k408_344198_c1
2078 nmdc:mga0k408_484340_c1
2079 nmdc:mga0k408_9833_c1
2080 nmdc:mga06z11_17_c1
2081 nmdc:mga04h51_146_c1
2082 nmdc:mga04h51_284722_c1
2083 nmdc:mga04h51_3829_c1
2084 nmdc:mga07m45_111328_c1
2085 nmdc:mga07m45_189975_c1
2086 nmdc:mga07m45_24809_c1
2087 nmdc:mga07m45_4_c1
2088 nmdc:mga07m45_60295_c1
2089 nmdc:mga07m45_65525_c1
2090 nmdc:mga0sz30_149231_c1
2091 nmdc:mga0sz30_31307_c1
2092 nmdc:mga0sz30_46_c1
2093 Ga0500643_000004
2094 Ga0500643_000783
2095 Ga0500643_025387
2096 Ga0500643_034160
2097 Ga0500643_083586
2098 Ga0500647_0021734
2099 Ga0500566_0294819
2100 Ga0500641_0073291
2101 Ga0500555_000575
2102 Ga0500555_184163
2103 Ga0500556_0000222
2104 Ga0500557_124997
2105 Ga0500562_012822
2106 Ga0500562_096187
2107 Ga0500594_0008135
2108 Ga0500595_000572
2109 Ga0500595_095238
2110 Ga0500607_000055
2111 Ga0500607_000844
2112 Ga0500607_184589
2113 Ga0500608_001074
2114 Ga0500608_007769
2115 Ga0500614_053067
2116 Ga0500614_155718
2117 Ga0500618_033483
2118 Ga0500618_120739
2119 Ga0500642_0000011
2120 Ga0500642_0121939
2121 Ga0500559_0003805
2122 Ga0500559_0156387
2123 Ga0500564_001322
2124 Ga0500568_0006166
2125 Ga0500568_0229107
2126 Ga0500573_0000114
2127 Ga0500590_011655
2128 Ga0500616_0006078
2129 Ga0500616_0142733
2130 Ga0500622_0001994
2131 Ga0500622_0077848
2132 Ga0500622_0162940
2133 Ga0500622_0264177
2134 Ga0500627_0506062
2135 Ga0500636_0180881
2136 Ga0500567_000074
2137 Ga0500625_000002
2138 Ga0500645_000417
2139 Ga0500645_004197
2140 Ga0500645_006930
2141 Ga0590075_118063
2142 Ga0587070_107679
2143 Ga0587085_013648
2144 Ga0587085_032596
2145 Ga0587062_008373
2146 Ga0466962_0002892
2147 2511130324
2148 2643819656
2149 2739651864
2150 2740030338
2151 2778125106
2152 2830076934
2153 2852654519
2154 2852684014
2155 2882807015
2156 2885427691
2157 2895888362
2158 2896186911
2159 2928030296
2160 2946789281
2161 2984558873
2162 2984566613
2163 2990266883
2164 2993357809
2165 2993693828
2166 3000866466
2167 8054303053
2168 8057101257

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

34

98

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zyw-assembly1.cif.gz_A crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3) 0.9666 5 99
2wul-assembly1.cif.gz_D crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster 0.9646 6 109
2mma-assembly1.cif.gz_A nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.9581 1 99
2wci-assembly1.cif.gz_A structure of e. coli monothiol glutaredoxin grx4 homodimer 0.9512 1 103
3gx8-assembly1.cif.gz_A structural and biochemical characterization of yeast monothiol glutaredoxin grx5 0.9492 3 107
ID Description Score Start End Superfamily
af_C6KSR7_119_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9853 8 99 3.40.30.10
2wemC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9831 9 103 3.40.30.10
af_Q555C8_40_141_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9797 9 108 3.40.30.10
af_Q4CNA8_28_125_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9776 9 104 3.40.30.10
af_K7UQQ8_80_167_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9767 10 94 3.40.30.10
ID Description Score Start End GO Terms
AF-K0TKX0-F1-model_v4 Glutaredoxin domain-containing protein 0.9951 2 100 GO:0005759
GO:0046872
GO:0051537
AF-A0A7S2WSS4-F1-model_v4 Glutaredoxin domain-containing protein 0.994 2 110 GO:0005759
GO:0046872
GO:0051537
AF-B8C7D4-F1-model_v4 Glutaredoxin domain-containing protein 0.9937 2 102 GO:0005759
GO:0046872
GO:0051537
AF-A0A7R9W3H0-F1-model_v4 Glutaredoxin domain-containing protein 0.9929 1 99 GO:0005759
GO:0046872
GO:0051537
AF-A0A1F6GPI9-F1-model_v4 Glutaredoxin 0.9925 5 102 GO:0015036
GO:0046872
GO:0051537

Map