F489744
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1084 | 376 | 2168 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_1046289|Ga0395905_1046289_309_686 |
| Length | 125 |
| Sequence | MGRAEEGPVPLPGAYSMTDPVHARIDGIVKGADVVLFMKGTPLFPQCGFSSRACAILDRLGVAFDSVDVLQDQDIRQGIKGYSDWPTIPQLYVKGEFVGGSDIMMEMYEAGELQQLMTDQGVVGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 177 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 193 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 194 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 195 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 201 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 208 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 209 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 210 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 211 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 212 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 213 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 214 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 215 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 216 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 217 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 218 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 219 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 220 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 221 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 222 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 223 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 224 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 225 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 226 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 227 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 230 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 231 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 232 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 233 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 234 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 280 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 281 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 282 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 283 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 284 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 285 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 286 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 287 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 288 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 289 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 290 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 291 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 300 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 305 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 306 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 310 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 311 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 312 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 313 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 315 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 316 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 321 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 323 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 324 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 325 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 327 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 328 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 329 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 330 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 331 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 332 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 333 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 334 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 335 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 336 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 338 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 339 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 341 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 342 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 343 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 344 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 345 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 348 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 349 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 350 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 351 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 355 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 356 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 357 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 358 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 359 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 360 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 361 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 362 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 363 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 364 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 365 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 366 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 367 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 368 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 369 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 370 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 371 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 372 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 373 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 374 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 375 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 376 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.14 |
| Metatranscriptomes | 0.83 |
| Isolates | 2.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.46 |
| Bulb | 0 |
| Endosphere | 10.89 |
| Nodule | 0.18 |
| Rhizoplane | 4.06 |
| Rhizosphere | 79.89 |
| Stem | 0 |
| Stem Tuber | 0.09 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395905_1046289 | 3300037471 | Bacteria | 719 |
| 2 | RicEn_FSXC48507_g1 | 2010549000 | Bacteria | 793 |
| 3 | SwRhRL2b_contig_14491 | 2162886007 | Bacteria | 5668 |
| 4 | SwRhRL2b_contig_1941805 | 2162886007 | Bacteria | 1025 |
| 5 | JGI24741J21665_1009296 | 3300001915 | Bacteria | 1812 |
| 6 | JGI24741J21665_1026449 | 3300001915 | Bacteria | 883 |
| 7 | JGI24740J21852_10025645 | 3300001979 | Bacteria | 1984 |
| 8 | JGI24740J21852_10044246 | 3300001979 | Bacteria | 1322 |
| 9 | JGI24739J22299_10085084 | 3300001989 | Bacteria | 967 |
| 10 | JGI24737J22298_10015406 | 3300001990 | Bacteria | 2474 |
| 11 | JGI24737J22298_10141222 | 3300001990 | Bacteria | 711 |
| 12 | JGI24737J22298_10159807 | 3300001990 | Bacteria | 665 |
| 13 | JGI24735J21928_10004614 | 3300002067 | Bacteria | 4616 |
| 14 | JGI24735J21928_10009368 | 3300002067 | Bacteria | 3147 |
| 15 | JGI24735J21928_10020556 | 3300002067 | Bacteria | 2021 |
| 16 | JGI24749J21850_1080763 | 3300002076 | Bacteria | 511 |
| 17 | JGI24035J26624_1026530 | 3300002126 | Bacteria | 623 |
| 18 | JGI24034J26672_10032562 | 3300002239 | Bacteria | 854 |
| 19 | JGI24034J26672_10034318 | 3300002239 | Bacteria | 836 |
| 20 | JGI24751J29686_10000183 | 3300002459 | Bacteria | 28249 |
| 21 | JGI24751J29686_10006267 | 3300002459 | Bacteria | 2424 |
| 22 | JGI25406J46586_10073176 | 3300003203 | Bacteria | 1069 |
| 23 | Ga0055536_1001129 | 3300003781 | Bacteria | 16725 |
| 24 | Ga0055534_1028413 | 3300003784 | Bacteria | 877 |
| 25 | Ga0055530_10000217 | 3300003791 | Bacteria | 51317 |
| 26 | Ga0055530_10120939 | 3300003791 | Bacteria | 507 |
| 27 | Ga0055531_10000571 | 3300003794 | Bacteria | 32223 |
| 28 | Ga0055531_10017368 | 3300003794 | Bacteria | 3042 |
| 29 | Ga0058863_10010079 | 3300004799 | Bacteria | 1114 |
| 30 | Ga0065165_1005029 | 3300005262 | Bacteria | 7727 |
| 31 | Ga0065704_10070504 | 3300005289 | Bacteria | 22276 |
| 32 | Ga0065704_10160113 | 3300005289 | Bacteria | 1361 |
| 33 | Ga0065704_10623232 | 3300005289 | Bacteria | 585 |
| 34 | Ga0065712_10655293 | 3300005290 | Bacteria | 565 |
| 35 | Ga0070658_10001814 | 3300005327 | Bacteria | 17966 |
| 36 | Ga0070658_10004690 | 3300005327 | Bacteria | 11113 |
| 37 | Ga0070658_10078926 | 3300005327 | Bacteria | 2703 |
| 38 | Ga0070658_10254395 | 3300005327 | Bacteria | 1490 |
| 39 | Ga0070658_10486976 | 3300005327 | Bacteria | 1065 |
| 40 | Ga0070658_10553426 | 3300005327 | Bacteria | 996 |
| 41 | Ga0070658_10590018 | 3300005327 | Bacteria | 963 |
| 42 | Ga0070658_10819451 | 3300005327 | Bacteria | 809 |
| 43 | Ga0070658_10906585 | 3300005327 | Bacteria | 766 |
| 44 | Ga0070683_100080914 | 3300005329 | Bacteria | 3040 |
| 45 | Ga0070683_100142414 | 3300005329 | Bacteria | 2272 |
| 46 | Ga0070683_100209353 | 3300005329 | Bacteria | 1852 |
| 47 | Ga0070683_100412603 | 3300005329 | Bacteria | 1288 |
| 48 | Ga0070683_101204161 | 3300005329 | Bacteria | 728 |
| 49 | Ga0070690_100189611 | 3300005330 | Bacteria | 1425 |
| 50 | Ga0070670_100036211 | 3300005331 | Bacteria | 4247 |
| 51 | Ga0070670_100126344 | 3300005331 | Bacteria | 2207 |
| 52 | Ga0070670_100556582 | 3300005331 | Bacteria | 1023 |
| 53 | Ga0068869_101523852 | 3300005334 | Bacteria | 594 |
| 54 | Ga0070666_10031513 | 3300005335 | Bacteria | 3499 |
| 55 | Ga0070666_10245552 | 3300005335 | Bacteria | 1266 |
| 56 | Ga0070666_10257671 | 3300005335 | Bacteria | 1236 |
| 57 | Ga0070680_100001532 | 3300005336 | Bacteria | 16845 |
| 58 | Ga0070680_100130253 | 3300005336 | Bacteria | 2104 |
| 59 | Ga0070680_100862652 | 3300005336 | Bacteria | 781 |
| 60 | Ga0070680_100886637 | 3300005336 | Bacteria | 769 |
| 61 | Ga0070682_100231965 | 3300005337 | Bacteria | 1320 |
| 62 | Ga0070682_100292626 | 3300005337 | Bacteria | 1192 |
| 63 | Ga0070682_100574623 | 3300005337 | Bacteria | 886 |
| 64 | Ga0070660_100004583 | 3300005339 | Bacteria | 9552 |
| 65 | Ga0070660_100009577 | 3300005339 | Bacteria | 6822 |
| 66 | Ga0070660_100025704 | 3300005339 | Bacteria | 4378 |
| 67 | Ga0070660_100075067 | 3300005339 | Bacteria | 2646 |
| 68 | Ga0070660_100078162 | 3300005339 | Bacteria | 2594 |
| 69 | Ga0070660_100122768 | 3300005339 | Bacteria | 2073 |
| 70 | Ga0070660_100138856 | 3300005339 | Bacteria | 1948 |
| 71 | Ga0070660_100359155 | 3300005339 | Bacteria | 1200 |
| 72 | Ga0070660_100564963 | 3300005339 | Bacteria | 950 |
| 73 | Ga0070660_100768117 | 3300005339 | Bacteria | 810 |
| 74 | Ga0070687_100522493 | 3300005343 | Bacteria | 803 |
| 75 | Ga0070687_101372528 | 3300005343 | Bacteria | 527 |
| 76 | Ga0070661_100005966 | 3300005344 | Bacteria | 8385 |
| 77 | Ga0070661_100012214 | 3300005344 | Bacteria | 6005 |
| 78 | Ga0070661_100044029 | 3300005344 | Bacteria | 3260 |
| 79 | Ga0070692_10042253 | 3300005345 | Bacteria | 2340 |
| 80 | Ga0070692_10329553 | 3300005345 | Bacteria | 942 |
| 81 | Ga0070668_100000080 | 3300005347 | Bacteria | 60157 |
| 82 | Ga0070668_100011581 | 3300005347 | Bacteria | 6565 |
| 83 | Ga0070668_100027483 | 3300005347 | Bacteria | 4320 |
| 84 | Ga0070668_100038637 | 3300005347 | Bacteria | 3649 |
| 85 | Ga0070668_100408180 | 3300005347 | Bacteria | 1161 |
| 86 | Ga0070668_100899906 | 3300005347 | Bacteria | 791 |
| 87 | Ga0070669_100000082 | 3300005353 | Bacteria | 91465 |
| 88 | Ga0070669_100000270 | 3300005353 | Bacteria | 42327 |
| 89 | Ga0070669_100001657 | 3300005353 | Bacteria | 16111 |
| 90 | Ga0070669_100538648 | 3300005353 | Bacteria | 972 |
| 91 | Ga0070671_100000116 | 3300005355 | Bacteria | 51559 |
| 92 | Ga0070671_100000169 | 3300005355 | Bacteria | 43010 |
| 93 | Ga0070671_100000299 | 3300005355 | Bacteria | 33542 |
| 94 | Ga0070671_100013092 | 3300005355 | Bacteria | 6684 |
| 95 | Ga0070671_100017053 | 3300005355 | Bacteria | 5875 |
| 96 | Ga0070671_101306033 | 3300005355 | Bacteria | 640 |
| 97 | Ga0070671_102039776 | 3300005355 | Bacteria | 511 |
| 98 | Ga0070674_100041961 | 3300005356 | Bacteria | 3105 |
| 99 | Ga0070673_101163110 | 3300005364 | Bacteria | 722 |
| 100 | Ga0070659_100143162 | 3300005366 | Bacteria | 1947 |
| 101 | Ga0070659_100160559 | 3300005366 | Bacteria | 1837 |
| 102 | Ga0070659_100487981 | 3300005366 | Bacteria | 1049 |
| 103 | Ga0070659_100712402 | 3300005366 | Bacteria | 868 |
| 104 | Ga0070659_100757091 | 3300005366 | Bacteria | 843 |
| 105 | Ga0070659_102119143 | 3300005366 | Bacteria | 505 |
| 106 | Ga0070667_100000968 | 3300005367 | Bacteria | 26399 |
| 107 | Ga0070667_100001907 | 3300005367 | Bacteria | 18505 |
| 108 | Ga0070667_100038717 | 3300005367 | Bacteria | 3998 |
| 109 | Ga0070667_100125378 | 3300005367 | Bacteria | 2237 |
| 110 | Ga0070667_100352616 | 3300005367 | Bacteria | 1332 |
| 111 | Ga0070667_101184761 | 3300005367 | Bacteria | 715 |
| 112 | Ga0070711_101751273 | 3300005439 | Bacteria | 545 |
| 113 | Ga0070705_101929486 | 3300005440 | Bacteria | 503 |
| 114 | Ga0070663_100042802 | 3300005455 | Bacteria | 3184 |
| 115 | Ga0070663_100072263 | 3300005455 | Bacteria | 2512 |
| 116 | Ga0070663_100138996 | 3300005455 | Bacteria | 1852 |
| 117 | Ga0070663_100146585 | 3300005455 | Bacteria | 1806 |
| 118 | Ga0070663_100213009 | 3300005455 | Bacteria | 1514 |
| 119 | Ga0070663_100418732 | 3300005455 | Bacteria | 1098 |
| 120 | Ga0070663_100769265 | 3300005455 | Bacteria | 824 |
| 121 | Ga0070678_101599225 | 3300005456 | Bacteria | 612 |
| 122 | Ga0070662_100002038 | 3300005457 | Bacteria | 12374 |
| 123 | Ga0070662_100051197 | 3300005457 | Bacteria | 2981 |
| 124 | Ga0070662_100094062 | 3300005457 | Bacteria | 2256 |
| 125 | Ga0070662_100477503 | 3300005457 | Bacteria | 1038 |
| 126 | Ga0070681_10049910 | 3300005458 | Bacteria | 4176 |
| 127 | Ga0070681_10279946 | 3300005458 | Bacteria | 1579 |
| 128 | Ga0070681_10515005 | 3300005458 | Bacteria | 1109 |
| 129 | Ga0070681_10778075 | 3300005458 | Bacteria | 874 |
| 130 | Ga0070679_100049171 | 3300005530 | Bacteria | 4200 |
| 131 | Ga0070679_100053739 | 3300005530 | Bacteria | 4009 |
| 132 | Ga0070679_100125039 | 3300005530 | Bacteria | 2554 |
| 133 | Ga0070679_100165965 | 3300005530 | Bacteria | 2181 |
| 134 | Ga0070679_100797661 | 3300005530 | Bacteria | 887 |
| 135 | Ga0070684_100058240 | 3300005535 | Bacteria | 3376 |
| 136 | Ga0070684_100275617 | 3300005535 | Bacteria | 1540 |
| 137 | Ga0070684_101360092 | 3300005535 | Bacteria | 668 |
| 138 | Ga0068853_100000825 | 3300005539 | Bacteria | 21651 |
| 139 | Ga0068853_100001009 | 3300005539 | Bacteria | 19829 |
| 140 | Ga0068853_100090669 | 3300005539 | Bacteria | 2687 |
| 141 | Ga0068853_100099224 | 3300005539 | Bacteria | 2573 |
| 142 | Ga0068853_100175395 | 3300005539 | Bacteria | 1941 |
| 143 | Ga0068853_100773978 | 3300005539 | Bacteria | 918 |
| 144 | Ga0068853_100828533 | 3300005539 | Bacteria | 887 |
| 145 | Ga0068853_100932187 | 3300005539 | Bacteria | 835 |
| 146 | Ga0070686_100246175 | 3300005544 | Bacteria | 1304 |
| 147 | Ga0070665_100002434 | 3300005548 | Bacteria | 20520 |
| 148 | Ga0070665_100009702 | 3300005548 | Bacteria | 9728 |
| 149 | Ga0070665_100020215 | 3300005548 | Bacteria | 6685 |
| 150 | Ga0070665_100095381 | 3300005548 | Bacteria | 2980 |
| 151 | Ga0070665_100235968 | 3300005548 | Bacteria | 1829 |
| 152 | Ga0068855_100007299 | 3300005563 | Bacteria | 13385 |
| 153 | Ga0068855_100011899 | 3300005563 | Bacteria | 10520 |
| 154 | Ga0068855_100017657 | 3300005563 | Bacteria | 8580 |
| 155 | Ga0068855_100022037 | 3300005563 | Bacteria | 7637 |
| 156 | Ga0068855_100058341 | 3300005563 | Bacteria | 4521 |
| 157 | Ga0068855_100234877 | 3300005563 | Bacteria | 2051 |
| 158 | Ga0068855_100657660 | 3300005563 | Bacteria | 1125 |
| 159 | Ga0068855_101628431 | 3300005563 | Bacteria | 660 |
| 160 | Ga0070664_100004940 | 3300005564 | Bacteria | 10682 |
| 161 | Ga0070664_100063472 | 3300005564 | Bacteria | 3149 |
| 162 | Ga0070664_100107496 | 3300005564 | Bacteria | 2432 |
| 163 | Ga0070664_100685619 | 3300005564 | Bacteria | 954 |
| 164 | Ga0070664_101361990 | 3300005564 | Bacteria | 670 |
| 165 | Ga0068857_100012786 | 3300005577 | Bacteria | 7317 |
| 166 | Ga0068857_100034254 | 3300005577 | Bacteria | 4491 |
| 167 | Ga0068857_100246743 | 3300005577 | Bacteria | 1636 |
| 168 | Ga0068857_100532724 | 3300005577 | Bacteria | 1105 |
| 169 | Ga0068857_100782136 | 3300005577 | Bacteria | 910 |
| 170 | Ga0068857_100977674 | 3300005577 | Bacteria | 814 |
| 171 | Ga0068857_102328909 | 3300005577 | Bacteria | 526 |
| 172 | Ga0068854_100000459 | 3300005578 | Bacteria | 25127 |
| 173 | Ga0068854_100013420 | 3300005578 | Bacteria | 5377 |
| 174 | Ga0068854_100047093 | 3300005578 | Bacteria | 3072 |
| 175 | Ga0068854_100137097 | 3300005578 | Bacteria | 1874 |
| 176 | Ga0068854_100159330 | 3300005578 | Bacteria | 1746 |
| 177 | Ga0068854_100166546 | 3300005578 | Bacteria | 1711 |
| 178 | Ga0068854_100812281 | 3300005578 | Bacteria | 816 |
| 179 | Ga0068854_101049149 | 3300005578 | Bacteria | 724 |
| 180 | Ga0068854_101325357 | 3300005578 | Bacteria | 649 |
| 181 | Ga0068856_100025980 | 3300005614 | Bacteria | 5711 |
| 182 | Ga0068856_100034389 | 3300005614 | Bacteria | 4964 |
| 183 | Ga0068856_100194821 | 3300005614 | Bacteria | 2040 |
| 184 | Ga0068856_100328553 | 3300005614 | Bacteria | 1547 |
| 185 | Ga0068856_100520452 | 3300005614 | Bacteria | 1211 |
| 186 | Ga0068856_101792595 | 3300005614 | Bacteria | 625 |
| 187 | Ga0068852_100000231 | 3300005616 | Bacteria | 37728 |
| 188 | Ga0068852_100012993 | 3300005616 | Bacteria | 6354 |
| 189 | Ga0068852_100086148 | 3300005616 | Bacteria | 2800 |
| 190 | Ga0068852_100296204 | 3300005616 | Bacteria | 1564 |
| 191 | Ga0068852_100408267 | 3300005616 | Bacteria | 1337 |
| 192 | Ga0068852_100447063 | 3300005616 | Bacteria | 1279 |
| 193 | Ga0068852_100638361 | 3300005616 | Bacteria | 1071 |
| 194 | Ga0068852_102411732 | 3300005616 | Bacteria | 547 |
| 195 | Ga0068859_100010259 | 3300005617 | Bacteria | 9429 |
| 196 | Ga0068859_100859376 | 3300005617 | Bacteria | 993 |
| 197 | Ga0068859_100868714 | 3300005617 | Bacteria | 987 |
| 198 | Ga0068859_101026602 | 3300005617 | Bacteria | 906 |
| 199 | Ga0068859_101045548 | 3300005617 | Bacteria | 897 |
| 200 | Ga0068864_100003823 | 3300005618 | Bacteria | 12412 |
| 201 | Ga0068864_100004682 | 3300005618 | Bacteria | 11226 |
| 202 | Ga0068864_100029698 | 3300005618 | Bacteria | 4632 |
| 203 | Ga0068864_100080985 | 3300005618 | Bacteria | 2846 |
| 204 | Ga0068864_101173069 | 3300005618 | Bacteria | 766 |
| 205 | Ga0068861_100000001 | 3300005719 | Bacteria | 116118 |
| 206 | Ga0068863_100000001 | 3300005841 | Bacteria | 581116 |
| 207 | Ga0068863_100000106 | 3300005841 | Bacteria | 90344 |
| 208 | Ga0068863_100044294 | 3300005841 | Bacteria | 4224 |
| 209 | Ga0068863_100094394 | 3300005841 | Bacteria | 2839 |
| 210 | Ga0068863_100137511 | 3300005841 | Bacteria | 2334 |
| 211 | Ga0068863_100166090 | 3300005841 | Bacteria | 2116 |
| 212 | Ga0068863_100261102 | 3300005841 | Bacteria | 1674 |
| 213 | Ga0068858_100000327 | 3300005842 | Bacteria | 50180 |
| 214 | Ga0068858_100001247 | 3300005842 | Bacteria | 26301 |
| 215 | Ga0068858_100039777 | 3300005842 | Bacteria | 4359 |
| 216 | Ga0068858_100056520 | 3300005842 | Bacteria | 3627 |
| 217 | Ga0068858_100163708 | 3300005842 | Bacteria | 2095 |
| 218 | Ga0068858_100327621 | 3300005842 | Bacteria | 1464 |
| 219 | Ga0068860_100000386 | 3300005843 | Bacteria | 57855 |
| 220 | Ga0068860_100009605 | 3300005843 | Bacteria | 9613 |
| 221 | Ga0068860_100092375 | 3300005843 | Bacteria | 2883 |
| 222 | Ga0068860_100115216 | 3300005843 | Bacteria | 2570 |
| 223 | Ga0068860_100310382 | 3300005843 | Bacteria | 1546 |
| 224 | Ga0068860_100465108 | 3300005843 | Bacteria | 1259 |
| 225 | Ga0068860_102626142 | 3300005843 | Bacteria | 523 |
| 226 | Ga0068862_100009807 | 3300005844 | Bacteria | 7914 |
| 227 | Ga0068862_100021177 | 3300005844 | Bacteria | 5435 |
| 228 | Ga0068862_100027853 | 3300005844 | Bacteria | 4759 |
| 229 | Ga0068862_100049285 | 3300005844 | Bacteria | 3597 |
| 230 | Ga0068862_100490347 | 3300005844 | Bacteria | 1165 |
| 231 | Ga0068862_101159350 | 3300005844 | Bacteria | 770 |
| 232 | Ga0068862_101734200 | 3300005844 | Bacteria | 633 |
| 233 | Ga0081540_1162277 | 3300005983 | Bacteria | 865 |
| 234 | Ga0081539_10074933 | 3300005985 | Bacteria | 1800 |
| 235 | Ga0075365_10080983 | 3300006038 | Bacteria | 2199 |
| 236 | Ga0075365_10477151 | 3300006038 | Bacteria | 881 |
| 237 | Ga0075368_10000112 | 3300006042 | Bacteria | 21160 |
| 238 | Ga0075368_10000385 | 3300006042 | Bacteria | 12968 |
| 239 | Ga0075368_10322642 | 3300006042 | Bacteria | 669 |
| 240 | Ga0075363_100005439 | 3300006048 | Bacteria | 5665 |
| 241 | Ga0075363_100012861 | 3300006048 | Bacteria | 4042 |
| 242 | Ga0075364_10110693 | 3300006051 | Bacteria | 1832 |
| 243 | Ga0075362_10000129 | 3300006177 | Bacteria | 20881 |
| 244 | Ga0075362_10143095 | 3300006177 | Bacteria | 1144 |
| 245 | Ga0075362_10257530 | 3300006177 | Bacteria | 859 |
| 246 | Ga0075367_10000692 | 3300006178 | Bacteria | 12968 |
| 247 | Ga0075367_10782097 | 3300006178 | Bacteria | 608 |
| 248 | Ga0075369_10032715 | 3300006186 | Bacteria | 2201 |
| 249 | Ga0075369_10089500 | 3300006186 | Bacteria | 1372 |
| 250 | Ga0075369_10159290 | 3300006186 | Bacteria | 1034 |
| 251 | Ga0075366_10013664 | 3300006195 | Bacteria | 4628 |
| 252 | Ga0075366_10245806 | 3300006195 | Bacteria | 1091 |
| 253 | Ga0075366_10530539 | 3300006195 | Bacteria | 728 |
| 254 | Ga0075370_10010420 | 3300006353 | Bacteria | 4861 |
| 255 | Ga0075370_10043587 | 3300006353 | Bacteria | 2536 |
| 256 | Ga0075370_10058591 | 3300006353 | Bacteria | 2191 |
| 257 | Ga0075370_10126540 | 3300006353 | Bacteria | 1489 |
| 258 | Ga0075370_10394531 | 3300006353 | Bacteria | 830 |
| 259 | Ga0075429_100833896 | 3300006880 | Bacteria | 807 |
| 260 | Ga0068865_101099164 | 3300006881 | Bacteria | 700 |
| 261 | Ga0068865_101281440 | 3300006881 | Bacteria | 651 |
| 262 | Ga0097620_100010259 | 3300006931 | Bacteria | 9429 |
| 263 | Ga0097620_100859461 | 3300006931 | Bacteria | 993 |
| 264 | Ga0097620_100868709 | 3300006931 | Bacteria | 987 |
| 265 | Ga0097620_101026648 | 3300006931 | Bacteria | 906 |
| 266 | Ga0097620_101045495 | 3300006931 | Bacteria | 897 |
| 267 | Ga0079104_1061795 | 3300006946 | Bacteria | 805 |
| 268 | Ga0105251_10012362 | 3300009011 | Bacteria | 4831 |
| 269 | Ga0105250_10006517 | 3300009092 | Bacteria | 5096 |
| 270 | Ga0105240_10013931 | 3300009093 | Bacteria | 11008 |
| 271 | Ga0105240_10570341 | 3300009093 | Bacteria | 1250 |
| 272 | Ga0105240_10794470 | 3300009093 | Bacteria | 1025 |
| 273 | Ga0105247_10589857 | 3300009101 | Bacteria | 823 |
| 274 | Ga0105247_10716195 | 3300009101 | Bacteria | 755 |
| 275 | Ga0105243_10320752 | 3300009148 | Bacteria | 1412 |
| 276 | Ga0105243_10767589 | 3300009148 | Bacteria | 947 |
| 277 | Ga0105243_12130670 | 3300009148 | Bacteria | 597 |
| 278 | Ga0105241_10084481 | 3300009174 | Bacteria | 2492 |
| 279 | Ga0105241_10425900 | 3300009174 | Bacteria | 1169 |
| 280 | Ga0105241_10565791 | 3300009174 | Bacteria | 1022 |
| 281 | Ga0105242_11505959 | 3300009176 | Bacteria | 704 |
| 282 | Ga0105248_10001758 | 3300009177 | Bacteria | 24108 |
| 283 | Ga0105248_10029772 | 3300009177 | Bacteria | 6093 |
| 284 | Ga0105248_10030056 | 3300009177 | Bacteria | 6063 |
| 285 | Ga0105248_10043233 | 3300009177 | Bacteria | 5052 |
| 286 | Ga0105248_10074540 | 3300009177 | Bacteria | 3815 |
| 287 | Ga0105248_10106004 | 3300009177 | Bacteria | 3169 |
| 288 | Ga0105248_10158703 | 3300009177 | Bacteria | 2552 |
| 289 | Ga0105248_10168174 | 3300009177 | Bacteria | 2471 |
| 290 | Ga0105248_13145328 | 3300009177 | Bacteria | 525 |
| 291 | Ga0105237_11817604 | 3300009545 | Bacteria | 617 |
| 292 | Ga0105238_10070938 | 3300009551 | Bacteria | 3482 |
| 293 | Ga0105238_10231030 | 3300009551 | Bacteria | 1826 |
| 294 | Ga0105238_10668100 | 3300009551 | Bacteria | 1050 |
| 295 | Ga0105249_10037409 | 3300009553 | Bacteria | 4404 |
| 296 | Ga0105249_10174180 | 3300009553 | Bacteria | 2089 |
| 297 | Ga0105249_10261051 | 3300009553 | Bacteria | 1721 |
| 298 | Ga0105249_10265973 | 3300009553 | Bacteria | 1706 |
| 299 | Ga0105249_10538642 | 3300009553 | Bacteria | 1217 |
| 300 | Ga0105239_10846266 | 3300010375 | Bacteria | 1049 |
| 301 | Ga0105239_11201659 | 3300010375 | Bacteria | 874 |
| 302 | Ga0105239_11229129 | 3300010375 | Bacteria | 864 |
| 303 | Ga0105246_10477789 | 3300011119 | Bacteria | 1054 |
| 304 | Ga0157326_1000423 | 3300012513 | Bacteria | 5017 |
| 305 | Ga0157373_10005891 | 3300013100 | Bacteria | 9170 |
| 306 | Ga0157373_10073069 | 3300013100 | Bacteria | 2421 |
| 307 | Ga0157373_10073823 | 3300013100 | Bacteria | 2407 |
| 308 | Ga0157373_10118854 | 3300013100 | Bacteria | 1858 |
| 309 | Ga0157373_10152393 | 3300013100 | Bacteria | 1626 |
| 310 | Ga0157373_10210985 | 3300013100 | Bacteria | 1369 |
| 311 | Ga0157373_10439064 | 3300013100 | Bacteria | 938 |
| 312 | Ga0157373_11454634 | 3300013100 | Bacteria | 522 |
| 313 | Ga0157371_10005585 | 3300013102 | Bacteria | 10564 |
| 314 | Ga0157371_10014817 | 3300013102 | Bacteria | 5869 |
| 315 | Ga0157371_10030644 | 3300013102 | Bacteria | 3879 |
| 316 | Ga0157371_10126094 | 3300013102 | Bacteria | 1821 |
| 317 | Ga0157371_10159148 | 3300013102 | Bacteria | 1613 |
| 318 | Ga0157371_10285046 | 3300013102 | Bacteria | 1194 |
| 319 | Ga0157371_10670109 | 3300013102 | Bacteria | 775 |
| 320 | Ga0157370_10008601 | 3300013104 | Bacteria | 10992 |
| 321 | Ga0157370_10020840 | 3300013104 | Bacteria | 6541 |
| 322 | Ga0157370_10069312 | 3300013104 | Bacteria | 3331 |
| 323 | Ga0157370_10214812 | 3300013104 | Bacteria | 1782 |
| 324 | Ga0157370_10481893 | 3300013104 | Bacteria | 1140 |
| 325 | Ga0157370_10504540 | 3300013104 | Bacteria | 1111 |
| 326 | Ga0157370_10648743 | 3300013104 | Bacteria | 965 |
| 327 | Ga0157370_10998843 | 3300013104 | Bacteria | 757 |
| 328 | Ga0157370_11611114 | 3300013104 | Bacteria | 583 |
| 329 | Ga0157369_10001177 | 3300013105 | Bacteria | 32602 |
| 330 | Ga0157369_10011267 | 3300013105 | Bacteria | 10158 |
| 331 | Ga0157369_10012443 | 3300013105 | Bacteria | 9659 |
| 332 | Ga0157369_10073644 | 3300013105 | Bacteria | 3664 |
| 333 | Ga0157369_10109686 | 3300013105 | Bacteria | 2934 |
| 334 | Ga0157369_10173906 | 3300013105 | Bacteria | 2268 |
| 335 | Ga0157369_10181989 | 3300013105 | Bacteria | 2211 |
| 336 | Ga0157369_11651416 | 3300013105 | Bacteria | 651 |
| 337 | Ga0157374_10007709 | 3300013296 | Bacteria | 9191 |
| 338 | Ga0157378_10071999 | 3300013297 | Bacteria | 3105 |
| 339 | Ga0157378_11229493 | 3300013297 | Bacteria | 789 |
| 340 | Ga0163162_10016081 | 3300013306 | Bacteria | 7314 |
| 341 | Ga0163162_10049256 | 3300013306 | Bacteria | 4222 |
| 342 | Ga0163162_10065959 | 3300013306 | Bacteria | 3668 |
| 343 | Ga0163162_10814754 | 3300013306 | Bacteria | 1050 |
| 344 | Ga0163162_11240239 | 3300013306 | Bacteria | 847 |
| 345 | Ga0163162_11256044 | 3300013306 | Bacteria | 841 |
| 346 | Ga0163162_11336558 | 3300013306 | Bacteria | 815 |
| 347 | Ga0163162_11845107 | 3300013306 | Bacteria | 691 |
| 348 | Ga0157372_10026953 | 3300013307 | Bacteria | 6256 |
| 349 | Ga0157372_10069390 | 3300013307 | Bacteria | 3964 |
| 350 | Ga0157372_10118609 | 3300013307 | Bacteria | 3036 |
| 351 | Ga0157372_10194284 | 3300013307 | Bacteria | 2351 |
| 352 | Ga0157372_10879583 | 3300013307 | Bacteria | 1040 |
| 353 | Ga0157372_11445556 | 3300013307 | Bacteria | 792 |
| 354 | Ga0157375_12513516 | 3300013308 | Bacteria | 615 |
| 355 | Ga0157375_12610828 | 3300013308 | Bacteria | 604 |
| 356 | Ga0163163_11045620 | 3300014325 | Bacteria | 880 |
| 357 | Ga0157380_10419982 | 3300014326 | Bacteria | 1275 |
| 358 | Ga0157380_12027684 | 3300014326 | Bacteria | 637 |
| 359 | Ga0157380_13020417 | 3300014326 | Bacteria | 536 |
| 360 | Ga0182008_10147420 | 3300014497 | Bacteria | 1179 |
| 361 | Ga0182008_10307738 | 3300014497 | Bacteria | 831 |
| 362 | Ga0157379_10103451 | 3300014968 | Bacteria | 2556 |
| 363 | Ga0157379_10164180 | 3300014968 | Bacteria | 2004 |
| 364 | Ga0163161_10001762 | 3300017792 | Bacteria | 15801 |
| 365 | Ga0163161_10236398 | 3300017792 | Bacteria | 1419 |
| 366 | Ga0163161_10420818 | 3300017792 | Bacteria | 1075 |
| 367 | Ga0163161_11570665 | 3300017792 | Bacteria | 579 |
| 368 | Ga0206356_10328308 | 3300020070 | Bacteria | 747 |
| 369 | Ga0206352_10656295 | 3300020078 | Bacteria | 825 |
| 370 | Ga0213876_10176276 | 3300021384 | Bacteria | 1137 |
| 371 | Ga0207672_1014332 | 3300025223 | Bacteria | 504 |
| 372 | Ga0209233_1000104 | 3300025261 | Bacteria | 272675 |
| 373 | Ga0209455_1059436 | 3300025272 | Bacteria | 505 |
| 374 | Ga0207673_1010721 | 3300025290 | Bacteria | 1182 |
| 375 | Ga0209675_1000082 | 3300025291 | Bacteria | 153550 |
| 376 | Ga0209676_1000424 | 3300025292 | Bacteria | 74314 |
| 377 | Ga0209676_1000567 | 3300025292 | Bacteria | 55724 |
| 378 | Ga0209676_1000670 | 3300025292 | Bacteria | 48733 |
| 379 | Ga0209025_1013258 | 3300025294 | Bacteria | 5198 |
| 380 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 381 | Ga0209050_1015992 | 3300025298 | Bacteria | 3102 |
| 382 | Ga0209050_1033183 | 3300025298 | Bacteria | 1570 |
| 383 | Ga0209257_1000151 | 3300025304 | Bacteria | 191408 |
| 384 | Ga0209257_1000202 | 3300025304 | Bacteria | 147246 |
| 385 | Ga0209257_1014543 | 3300025304 | Bacteria | 3372 |
| 386 | Ga0207697_10010597 | 3300025315 | Bacteria | 3934 |
| 387 | Ga0207697_10035408 | 3300025315 | Bacteria | 2044 |
| 388 | Ga0207697_10197006 | 3300025315 | Bacteria | 885 |
| 389 | Ga0207697_10279311 | 3300025315 | Bacteria | 740 |
| 390 | Ga0207656_10012272 | 3300025321 | Bacteria | 3255 |
| 391 | Ga0207696_1007265 | 3300025711 | Bacteria | 4353 |
| 392 | Ga0207713_1010142 | 3300025735 | Bacteria | 5236 |
| 393 | Ga0207713_1053960 | 3300025735 | Bacteria | 1579 |
| 394 | Ga0207710_10444116 | 3300025900 | Bacteria | 669 |
| 395 | Ga0207688_10153841 | 3300025901 | Bacteria | 1360 |
| 396 | Ga0207680_10104003 | 3300025903 | Bacteria | 1830 |
| 397 | Ga0207680_10140902 | 3300025903 | Bacteria | 1598 |
| 398 | Ga0207680_10181472 | 3300025903 | Bacteria | 1423 |
| 399 | Ga0207647_10065904 | 3300025904 | Bacteria | 2197 |
| 400 | Ga0207647_10103590 | 3300025904 | Bacteria | 1687 |
| 401 | Ga0207647_10498365 | 3300025904 | Bacteria | 679 |
| 402 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 403 | Ga0207705_10000101 | 3300025909 | Bacteria | 98231 |
| 404 | Ga0207705_10005310 | 3300025909 | Bacteria | 9638 |
| 405 | Ga0207705_10032428 | 3300025909 | Bacteria | 3733 |
| 406 | Ga0207705_10038874 | 3300025909 | Bacteria | 3409 |
| 407 | Ga0207705_10097229 | 3300025909 | Bacteria | 2162 |
| 408 | Ga0207705_10128666 | 3300025909 | Bacteria | 1883 |
| 409 | Ga0207705_10142233 | 3300025909 | Bacteria | 1792 |
| 410 | Ga0207705_10299322 | 3300025909 | Bacteria | 1233 |
| 411 | Ga0207705_10347589 | 3300025909 | Bacteria | 1142 |
| 412 | Ga0207705_10421385 | 3300025909 | Bacteria | 1033 |
| 413 | Ga0207705_10925174 | 3300025909 | Bacteria | 675 |
| 414 | Ga0207654_10546964 | 3300025911 | Bacteria | 822 |
| 415 | Ga0207707_10076073 | 3300025912 | Bacteria | 2929 |
| 416 | Ga0207707_10223926 | 3300025912 | Bacteria | 1637 |
| 417 | Ga0207707_10438375 | 3300025912 | Bacteria | 1118 |
| 418 | Ga0207707_10575695 | 3300025912 | Bacteria | 955 |
| 419 | Ga0207707_11330494 | 3300025912 | Bacteria | 576 |
| 420 | Ga0207695_10018947 | 3300025913 | Bacteria | 7939 |
| 421 | Ga0207695_10106455 | 3300025913 | Bacteria | 2790 |
| 422 | Ga0207660_10045514 | 3300025917 | Bacteria | 3091 |
| 423 | Ga0207660_10063096 | 3300025917 | Bacteria | 2670 |
| 424 | Ga0207662_10472288 | 3300025918 | Bacteria | 860 |
| 425 | Ga0207662_10763019 | 3300025918 | Bacteria | 680 |
| 426 | Ga0207662_10820166 | 3300025918 | Bacteria | 656 |
| 427 | Ga0207657_10000408 | 3300025919 | Bacteria | 45400 |
| 428 | Ga0207657_10012539 | 3300025919 | Bacteria | 8360 |
| 429 | Ga0207657_10026870 | 3300025919 | Bacteria | 5279 |
| 430 | Ga0207657_10040078 | 3300025919 | Bacteria | 4154 |
| 431 | Ga0207657_10048949 | 3300025919 | Bacteria | 3687 |
| 432 | Ga0207657_10052113 | 3300025919 | Bacteria | 3553 |
| 433 | Ga0207657_10071057 | 3300025919 | Bacteria | 2948 |
| 434 | Ga0207657_10261261 | 3300025919 | Bacteria | 1378 |
| 435 | Ga0207649_10003307 | 3300025920 | Bacteria | 8820 |
| 436 | Ga0207649_10024515 | 3300025920 | Bacteria | 3507 |
| 437 | Ga0207649_10158761 | 3300025920 | Bacteria | 1565 |
| 438 | Ga0207652_10031309 | 3300025921 | Bacteria | 4467 |
| 439 | Ga0207652_10063222 | 3300025921 | Bacteria | 3200 |
| 440 | Ga0207652_10134787 | 3300025921 | Bacteria | 2205 |
| 441 | Ga0207652_10139747 | 3300025921 | Bacteria | 2165 |
| 442 | Ga0207652_10253453 | 3300025921 | Bacteria | 1587 |
| 443 | Ga0207652_10365535 | 3300025921 | Bacteria | 1302 |
| 444 | Ga0207652_10784934 | 3300025921 | Bacteria | 846 |
| 445 | Ga0207681_10000109 | 3300025923 | Bacteria | 71373 |
| 446 | Ga0207681_10002968 | 3300025923 | Bacteria | 10674 |
| 447 | Ga0207681_10009596 | 3300025923 | Bacteria | 5915 |
| 448 | Ga0207681_10478058 | 3300025923 | Bacteria | 1017 |
| 449 | Ga0207681_11218265 | 3300025923 | Bacteria | 632 |
| 450 | Ga0207681_11290750 | 3300025923 | Bacteria | 613 |
| 451 | Ga0207694_10077123 | 3300025924 | Bacteria | 2611 |
| 452 | Ga0207694_10226894 | 3300025924 | Bacteria | 1525 |
| 453 | Ga0207694_10236267 | 3300025924 | Bacteria | 1493 |
| 454 | Ga0207694_10585392 | 3300025924 | Bacteria | 938 |
| 455 | Ga0207650_10126255 | 3300025925 | Bacteria | 1997 |
| 456 | Ga0207650_10174974 | 3300025925 | Bacteria | 1708 |
| 457 | Ga0207650_10381342 | 3300025925 | Bacteria | 1164 |
| 458 | Ga0207650_10853930 | 3300025925 | Bacteria | 772 |
| 459 | Ga0207650_11317486 | 3300025925 | Bacteria | 615 |
| 460 | Ga0207650_11880296 | 3300025925 | Bacteria | 506 |
| 461 | Ga0207687_10010076 | 3300025927 | Bacteria | 6180 |
| 462 | Ga0207664_10224251 | 3300025929 | Bacteria | 1631 |
| 463 | Ga0207644_10000012 | 3300025931 | Bacteria | 186652 |
| 464 | Ga0207644_10000191 | 3300025931 | Bacteria | 43874 |
| 465 | Ga0207644_10022749 | 3300025931 | Bacteria | 4285 |
| 466 | Ga0207644_10076366 | 3300025931 | Bacteria | 2464 |
| 467 | Ga0207644_10348981 | 3300025931 | Bacteria | 1201 |
| 468 | Ga0207644_10649711 | 3300025931 | Bacteria | 878 |
| 469 | Ga0207644_11159527 | 3300025931 | Bacteria | 649 |
| 470 | Ga0207690_10008011 | 3300025932 | Bacteria | 6272 |
| 471 | Ga0207690_10021761 | 3300025932 | Bacteria | 3980 |
| 472 | Ga0207690_10242687 | 3300025932 | Bacteria | 1388 |
| 473 | Ga0207690_10349896 | 3300025932 | Bacteria | 1168 |
| 474 | Ga0207690_10393138 | 3300025932 | Bacteria | 1104 |
| 475 | Ga0207690_10492626 | 3300025932 | Bacteria | 990 |
| 476 | Ga0207690_11806889 | 3300025932 | Bacteria | 510 |
| 477 | Ga0207706_10008254 | 3300025933 | Bacteria | 9609 |
| 478 | Ga0207706_10033279 | 3300025933 | Bacteria | 4590 |
| 479 | Ga0207706_10076637 | 3300025933 | Bacteria | 2941 |
| 480 | Ga0207706_10211000 | 3300025933 | Bacteria | 1702 |
| 481 | Ga0207706_10292525 | 3300025933 | Bacteria | 1420 |
| 482 | Ga0207706_10398949 | 3300025933 | Bacteria | 1192 |
| 483 | Ga0207709_10088718 | 3300025935 | Bacteria | 2014 |
| 484 | Ga0207709_10365053 | 3300025935 | Bacteria | 1094 |
| 485 | Ga0207709_10413443 | 3300025935 | Bacteria | 1034 |
| 486 | Ga0207670_10243061 | 3300025936 | Bacteria | 1388 |
| 487 | Ga0207669_10156416 | 3300025937 | Bacteria | 1604 |
| 488 | Ga0207704_10841359 | 3300025938 | Bacteria | 768 |
| 489 | Ga0207704_11156110 | 3300025938 | Bacteria | 659 |
| 490 | Ga0207691_10181467 | 3300025940 | Bacteria | 1839 |
| 491 | Ga0207711_10000852 | 3300025941 | Bacteria | 29486 |
| 492 | Ga0207711_10020403 | 3300025941 | Bacteria | 5524 |
| 493 | Ga0207711_10086344 | 3300025941 | Bacteria | 2751 |
| 494 | Ga0207711_10104536 | 3300025941 | Bacteria | 2510 |
| 495 | Ga0207711_10383571 | 3300025941 | Bacteria | 1304 |
| 496 | Ga0207711_10498269 | 3300025941 | Bacteria | 1135 |
| 497 | Ga0207711_10833452 | 3300025941 | Bacteria | 858 |
| 498 | Ga0207711_11370931 | 3300025941 | Bacteria | 649 |
| 499 | Ga0207689_10336795 | 3300025942 | Bacteria | 1253 |
| 500 | Ga0207661_10039869 | 3300025944 | Bacteria | 3689 |
| 501 | Ga0207661_10453662 | 3300025944 | Bacteria | 1168 |
| 502 | Ga0207661_11174662 | 3300025944 | Bacteria | 706 |
| 503 | Ga0207679_10004188 | 3300025945 | Bacteria | 8961 |
| 504 | Ga0207679_10017162 | 3300025945 | Bacteria | 4821 |
| 505 | Ga0207679_10255223 | 3300025945 | Bacteria | 1493 |
| 506 | Ga0207679_10561348 | 3300025945 | Bacteria | 1025 |
| 507 | Ga0207667_10003563 | 3300025949 | Bacteria | 19243 |
| 508 | Ga0207667_10005019 | 3300025949 | Bacteria | 16179 |
| 509 | Ga0207667_10016908 | 3300025949 | Bacteria | 8229 |
| 510 | Ga0207667_10038338 | 3300025949 | Bacteria | 5119 |
| 511 | Ga0207667_10070651 | 3300025949 | Bacteria | 3633 |
| 512 | Ga0207667_10078696 | 3300025949 | Bacteria | 3417 |
| 513 | Ga0207667_10098261 | 3300025949 | Bacteria | 3021 |
| 514 | Ga0207667_10112317 | 3300025949 | Bacteria | 2810 |
| 515 | Ga0207667_10748010 | 3300025949 | Bacteria | 977 |
| 516 | Ga0207712_10057696 | 3300025961 | Bacteria | 2740 |
| 517 | Ga0207712_10092123 | 3300025961 | Bacteria | 2234 |
| 518 | Ga0207712_10358131 | 3300025961 | Bacteria | 1215 |
| 519 | Ga0207712_10657564 | 3300025961 | Bacteria | 911 |
| 520 | Ga0207712_11861207 | 3300025961 | Bacteria | 539 |
| 521 | Ga0207668_10000304 | 3300025972 | Bacteria | 32235 |
| 522 | Ga0207668_10083673 | 3300025972 | Bacteria | 2322 |
| 523 | Ga0207668_10105153 | 3300025972 | Bacteria | 2106 |
| 524 | Ga0207668_10115951 | 3300025972 | Bacteria | 2019 |
| 525 | Ga0207668_10180046 | 3300025972 | Bacteria | 1666 |
| 526 | Ga0207668_10328540 | 3300025972 | Bacteria | 1271 |
| 527 | Ga0207668_10819854 | 3300025972 | Bacteria | 824 |
| 528 | Ga0207668_11892319 | 3300025972 | Bacteria | 538 |
| 529 | Ga0207640_10000508 | 3300025981 | Bacteria | 23527 |
| 530 | Ga0207640_10077559 | 3300025981 | Bacteria | 2259 |
| 531 | Ga0207640_10080263 | 3300025981 | Bacteria | 2226 |
| 532 | Ga0207640_10093030 | 3300025981 | Bacteria | 2093 |
| 533 | Ga0207640_10627768 | 3300025981 | Bacteria | 913 |
| 534 | Ga0207640_12027889 | 3300025981 | Bacteria | 521 |
| 535 | Ga0207658_10000344 | 3300025986 | Bacteria | 46055 |
| 536 | Ga0207658_10001008 | 3300025986 | Bacteria | 23029 |
| 537 | Ga0207658_10001566 | 3300025986 | Bacteria | 17731 |
| 538 | Ga0207658_10008713 | 3300025986 | Bacteria | 6892 |
| 539 | Ga0207658_11113228 | 3300025986 | Bacteria | 721 |
| 540 | Ga0207658_11372109 | 3300025986 | Bacteria | 646 |
| 541 | Ga0207703_10000244 | 3300026035 | Bacteria | 61520 |
| 542 | Ga0207703_10000775 | 3300026035 | Bacteria | 31437 |
| 543 | Ga0207703_10004946 | 3300026035 | Bacteria | 10819 |
| 544 | Ga0207703_10027481 | 3300026035 | Bacteria | 4481 |
| 545 | Ga0207703_10029046 | 3300026035 | Bacteria | 4362 |
| 546 | Ga0207703_10052344 | 3300026035 | Bacteria | 3315 |
| 547 | Ga0207639_10000771 | 3300026041 | Bacteria | 21846 |
| 548 | Ga0207639_10124943 | 3300026041 | Bacteria | 2120 |
| 549 | Ga0207639_10270861 | 3300026041 | Bacteria | 1489 |
| 550 | Ga0207639_10914052 | 3300026041 | Bacteria | 820 |
| 551 | Ga0207639_10977047 | 3300026041 | Bacteria | 793 |
| 552 | Ga0207639_11211883 | 3300026041 | Bacteria | 708 |
| 553 | Ga0207639_11376593 | 3300026041 | Bacteria | 662 |
| 554 | Ga0207678_10004771 | 3300026067 | Bacteria | 12166 |
| 555 | Ga0207678_10020075 | 3300026067 | Bacteria | 5870 |
| 556 | Ga0207678_10022461 | 3300026067 | Bacteria | 5524 |
| 557 | Ga0207678_10029324 | 3300026067 | Bacteria | 4802 |
| 558 | Ga0207678_10046385 | 3300026067 | Bacteria | 3757 |
| 559 | Ga0207678_10450446 | 3300026067 | Bacteria | 1119 |
| 560 | Ga0207702_10012315 | 3300026078 | Bacteria | 7118 |
| 561 | Ga0207702_10147935 | 3300026078 | Bacteria | 2134 |
| 562 | Ga0207702_10271381 | 3300026078 | Bacteria | 1600 |
| 563 | Ga0207702_10415455 | 3300026078 | Bacteria | 1300 |
| 564 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 565 | Ga0207641_10000733 | 3300026088 | Bacteria | 35188 |
| 566 | Ga0207641_10066769 | 3300026088 | Bacteria | 3079 |
| 567 | Ga0207641_10075989 | 3300026088 | Bacteria | 2902 |
| 568 | Ga0207641_10202140 | 3300026088 | Bacteria | 1832 |
| 569 | Ga0207648_10522443 | 3300026089 | Bacteria | 1088 |
| 570 | Ga0207676_10002656 | 3300026095 | Bacteria | 12704 |
| 571 | Ga0207676_10003409 | 3300026095 | Bacteria | 11239 |
| 572 | Ga0207676_10185065 | 3300026095 | Bacteria | 1827 |
| 573 | Ga0207676_11758449 | 3300026095 | Bacteria | 618 |
| 574 | Ga0207676_12238743 | 3300026095 | Bacteria | 544 |
| 575 | Ga0207674_10008322 | 3300026116 | Bacteria | 12002 |
| 576 | Ga0207674_10015484 | 3300026116 | Bacteria | 8376 |
| 577 | Ga0207674_10017301 | 3300026116 | Bacteria | 7866 |
| 578 | Ga0207674_10098726 | 3300026116 | Bacteria | 2903 |
| 579 | Ga0207674_10894032 | 3300026116 | Bacteria | 856 |
| 580 | Ga0207674_10895518 | 3300026116 | Bacteria | 855 |
| 581 | Ga0207674_11037951 | 3300026116 | Bacteria | 789 |
| 582 | Ga0207674_11384357 | 3300026116 | Bacteria | 673 |
| 583 | Ga0207675_100000196 | 3300026118 | Bacteria | 55631 |
| 584 | Ga0207675_100575285 | 3300026118 | Bacteria | 1127 |
| 585 | Ga0207698_10000058 | 3300026142 | Bacteria | 78048 |
| 586 | Ga0207698_10099316 | 3300026142 | Bacteria | 2407 |
| 587 | Ga0207698_10729225 | 3300026142 | Bacteria | 988 |
| 588 | Ga0207698_10864109 | 3300026142 | Bacteria | 910 |
| 589 | Ga0207698_11099152 | 3300026142 | Bacteria | 808 |
| 590 | Ga0207698_12320571 | 3300026142 | Bacteria | 548 |
| 591 | Ga0209281_1071516 | 3300027111 | Bacteria | 506 |
| 592 | Ga0209983_1096238 | 3300027665 | Bacteria | 669 |
| 593 | Ga0209813_10000051 | 3300027866 | Bacteria | 47545 |
| 594 | Ga0209813_10001612 | 3300027866 | Bacteria | 5084 |
| 595 | Ga0209974_10006613 | 3300027876 | Bacteria | 4035 |
| 596 | Ga0209974_10008683 | 3300027876 | Bacteria | 3462 |
| 597 | Ga0209974_10347866 | 3300027876 | Bacteria | 574 |
| 598 | Ga0268266_10002003 | 3300028379 | Bacteria | 22767 |
| 599 | Ga0268266_10005024 | 3300028379 | Bacteria | 12491 |
| 600 | Ga0268266_10006189 | 3300028379 | Bacteria | 10993 |
| 601 | Ga0268266_10124658 | 3300028379 | Bacteria | 2297 |
| 602 | Ga0268266_10158947 | 3300028379 | Bacteria | 2043 |
| 603 | Ga0268265_10017233 | 3300028380 | Bacteria | 4981 |
| 604 | Ga0268265_10070317 | 3300028380 | Bacteria | 2721 |
| 605 | Ga0268265_10129908 | 3300028380 | Bacteria | 2091 |
| 606 | Ga0268265_10146980 | 3300028380 | Bacteria | 1982 |
| 607 | Ga0268265_10243981 | 3300028380 | Bacteria | 1587 |
| 608 | Ga0268265_10387566 | 3300028380 | Bacteria | 1287 |
| 609 | Ga0268265_10984873 | 3300028380 | Bacteria | 832 |
| 610 | Ga0268265_12105585 | 3300028380 | Bacteria | 571 |
| 611 | Ga0268264_10000040 | 3300028381 | Bacteria | 373714 |
| 612 | Ga0268264_10004259 | 3300028381 | Bacteria | 12215 |
| 613 | Ga0268264_10007794 | 3300028381 | Bacteria | 8916 |
| 614 | Ga0268264_10012572 | 3300028381 | Bacteria | 6971 |
| 615 | Ga0268264_10290110 | 3300028381 | Bacteria | 1536 |
| 616 | Ga0307515_10596048 | 3300028794 | Bacteria | 715 |
| 617 | Ga0265331_10081417 | 3300031250 | Bacteria | 1503 |
| 618 | Ga0307408_100036575 | 3300031548 | Bacteria | 3452 |
| 619 | Ga0307408_100189378 | 3300031548 | Bacteria | 1656 |
| 620 | Ga0307408_100266195 | 3300031548 | Bacteria | 1421 |
| 621 | Ga0307408_100631195 | 3300031548 | Bacteria | 955 |
| 622 | Ga0307408_101090399 | 3300031548 | Bacteria | 740 |
| 623 | Ga0307508_10000231 | 3300031616 | Bacteria | 67806 |
| 624 | Ga0307405_10015706 | 3300031731 | Bacteria | 4108 |
| 625 | Ga0307405_10046408 | 3300031731 | Bacteria | 2669 |
| 626 | Ga0307405_10111192 | 3300031731 | Bacteria | 1856 |
| 627 | Ga0307405_10179072 | 3300031731 | Bacteria | 1520 |
| 628 | Ga0307405_10420225 | 3300031731 | Bacteria | 1052 |
| 629 | Ga0307405_10422638 | 3300031731 | Bacteria | 1049 |
| 630 | Ga0307405_10549733 | 3300031731 | Bacteria | 934 |
| 631 | Ga0307405_10554500 | 3300031731 | Bacteria | 930 |
| 632 | Ga0307405_10868865 | 3300031731 | Bacteria | 760 |
| 633 | Ga0307405_11199702 | 3300031731 | Bacteria | 656 |
| 634 | Ga0307405_11987736 | 3300031731 | Bacteria | 520 |
| 635 | Ga0307405_12083234 | 3300031731 | Bacteria | 509 |
| 636 | Ga0316577_10488641 | 3300031733 | Bacteria | 700 |
| 637 | Ga0307413_10008092 | 3300031824 | Bacteria | 4937 |
| 638 | Ga0307413_10095332 | 3300031824 | Bacteria | 1950 |
| 639 | Ga0307413_10111184 | 3300031824 | Bacteria | 1834 |
| 640 | Ga0307413_10116974 | 3300031824 | Bacteria | 1797 |
| 641 | Ga0307413_10378532 | 3300031824 | Bacteria | 1102 |
| 642 | Ga0307413_10419605 | 3300031824 | Bacteria | 1053 |
| 643 | Ga0307413_10513941 | 3300031824 | Bacteria | 964 |
| 644 | Ga0307413_10663468 | 3300031824 | Bacteria | 862 |
| 645 | Ga0307413_11247714 | 3300031824 | Bacteria | 648 |
| 646 | Ga0307413_11749671 | 3300031824 | Bacteria | 555 |
| 647 | Ga0307410_10032218 | 3300031852 | Bacteria | 3370 |
| 648 | Ga0307410_10127384 | 3300031852 | Bacteria | 1866 |
| 649 | Ga0307410_10129375 | 3300031852 | Bacteria | 1853 |
| 650 | Ga0307410_10131184 | 3300031852 | Bacteria | 1841 |
| 651 | Ga0307410_10137046 | 3300031852 | Bacteria | 1805 |
| 652 | Ga0307410_10180454 | 3300031852 | Bacteria | 1598 |
| 653 | Ga0307410_10407750 | 3300031852 | Bacteria | 1099 |
| 654 | Ga0307410_10572941 | 3300031852 | Bacteria | 938 |
| 655 | Ga0307410_10930431 | 3300031852 | Bacteria | 746 |
| 656 | Ga0307410_11223504 | 3300031852 | Bacteria | 655 |
| 657 | Ga0307410_11401924 | 3300031852 | Bacteria | 613 |
| 658 | Ga0307406_10033738 | 3300031901 | Bacteria | 3134 |
| 659 | Ga0307406_10091044 | 3300031901 | Bacteria | 2054 |
| 660 | Ga0307406_10271518 | 3300031901 | Bacteria | 1288 |
| 661 | Ga0307406_10313769 | 3300031901 | Bacteria | 1210 |
| 662 | Ga0307406_10350397 | 3300031901 | Bacteria | 1153 |
| 663 | Ga0307406_11715690 | 3300031901 | Bacteria | 557 |
| 664 | Ga0307406_11945942 | 3300031901 | Bacteria | 525 |
| 665 | Ga0307407_10054827 | 3300031903 | Bacteria | 2301 |
| 666 | Ga0307407_10087998 | 3300031903 | Bacteria | 1896 |
| 667 | Ga0307407_10194064 | 3300031903 | Bacteria | 1356 |
| 668 | Ga0307407_10227621 | 3300031903 | Bacteria | 1264 |
| 669 | Ga0307407_10604107 | 3300031903 | Bacteria | 817 |
| 670 | Ga0307407_10811828 | 3300031903 | Bacteria | 712 |
| 671 | Ga0307407_10922904 | 3300031903 | Bacteria | 671 |
| 672 | Ga0307412_10001165 | 3300031911 | Bacteria | 15055 |
| 673 | Ga0307412_10015626 | 3300031911 | Bacteria | 4506 |
| 674 | Ga0307412_10125238 | 3300031911 | Bacteria | 1857 |
| 675 | Ga0307412_10135773 | 3300031911 | Bacteria | 1794 |
| 676 | Ga0307412_10153714 | 3300031911 | Bacteria | 1701 |
| 677 | Ga0307412_10202251 | 3300031911 | Bacteria | 1509 |
| 678 | Ga0307412_10426873 | 3300031911 | Bacteria | 1085 |
| 679 | Ga0307412_10820651 | 3300031911 | Bacteria | 809 |
| 680 | Ga0307412_10955735 | 3300031911 | Bacteria | 754 |
| 681 | Ga0307412_11271016 | 3300031911 | Bacteria | 661 |
| 682 | Ga0307409_100095312 | 3300031995 | Bacteria | 2452 |
| 683 | Ga0307409_100117196 | 3300031995 | Bacteria | 2247 |
| 684 | Ga0307409_100149115 | 3300031995 | Bacteria | 2028 |
| 685 | Ga0307409_100332388 | 3300031995 | Bacteria | 1426 |
| 686 | Ga0307409_100342934 | 3300031995 | Bacteria | 1406 |
| 687 | Ga0307409_100435543 | 3300031995 | Bacteria | 1261 |
| 688 | Ga0307409_100461811 | 3300031995 | Bacteria | 1228 |
| 689 | Ga0307409_100485830 | 3300031995 | Bacteria | 1199 |
| 690 | Ga0307409_100594830 | 3300031995 | Bacteria | 1092 |
| 691 | Ga0307409_100674330 | 3300031995 | Bacteria | 1030 |
| 692 | Ga0307409_101883139 | 3300031995 | Bacteria | 627 |
| 693 | Ga0307409_102048642 | 3300031995 | Bacteria | 602 |
| 694 | Ga0307416_100040940 | 3300032002 | Bacteria | 3604 |
| 695 | Ga0307416_100153329 | 3300032002 | Bacteria | 2117 |
| 696 | Ga0307416_100168294 | 3300032002 | Bacteria | 2036 |
| 697 | Ga0307416_100175956 | 3300032002 | Bacteria | 1999 |
| 698 | Ga0307416_100204887 | 3300032002 | Bacteria | 1875 |
| 699 | Ga0307416_100376208 | 3300032002 | Bacteria | 1448 |
| 700 | Ga0307416_100380462 | 3300032002 | Bacteria | 1441 |
| 701 | Ga0307416_100482992 | 3300032002 | Bacteria | 1299 |
| 702 | Ga0307416_100658642 | 3300032002 | Bacteria | 1132 |
| 703 | Ga0307416_100741865 | 3300032002 | Bacteria | 1074 |
| 704 | Ga0307416_101023308 | 3300032002 | Bacteria | 929 |
| 705 | Ga0307416_101514386 | 3300032002 | Bacteria | 776 |
| 706 | Ga0307416_101638397 | 3300032002 | Bacteria | 748 |
| 707 | Ga0307416_103152627 | 3300032002 | Bacteria | 552 |
| 708 | Ga0307414_10000090 | 3300032004 | Bacteria | 78448 |
| 709 | Ga0307414_10000343 | 3300032004 | Bacteria | 26284 |
| 710 | Ga0307414_10002814 | 3300032004 | Bacteria | 9169 |
| 711 | Ga0307414_10009210 | 3300032004 | Bacteria | 5659 |
| 712 | Ga0307414_10029163 | 3300032004 | Bacteria | 3588 |
| 713 | Ga0307414_10037198 | 3300032004 | Bacteria | 3257 |
| 714 | Ga0307414_10092078 | 3300032004 | Bacteria | 2255 |
| 715 | Ga0307414_10107005 | 3300032004 | Bacteria | 2118 |
| 716 | Ga0307414_10165350 | 3300032004 | Bacteria | 1762 |
| 717 | Ga0307414_10214200 | 3300032004 | Bacteria | 1577 |
| 718 | Ga0307414_10456215 | 3300032004 | Bacteria | 1122 |
| 719 | Ga0307414_10618279 | 3300032004 | Bacteria | 973 |
| 720 | Ga0307414_10638625 | 3300032004 | Bacteria | 958 |
| 721 | Ga0307414_11791120 | 3300032004 | Bacteria | 573 |
| 722 | Ga0307411_10029935 | 3300032005 | Bacteria | 3332 |
| 723 | Ga0307411_10049558 | 3300032005 | Bacteria | 2730 |
| 724 | Ga0307411_10089366 | 3300032005 | Bacteria | 2145 |
| 725 | Ga0307411_10098320 | 3300032005 | Bacteria | 2062 |
| 726 | Ga0307411_10318724 | 3300032005 | Bacteria | 1254 |
| 727 | Ga0307411_10342784 | 3300032005 | Bacteria | 1215 |
| 728 | Ga0307411_10394801 | 3300032005 | Bacteria | 1142 |
| 729 | Ga0307411_10559042 | 3300032005 | Bacteria | 977 |
| 730 | Ga0307411_10594900 | 3300032005 | Bacteria | 950 |
| 731 | Ga0307411_10894142 | 3300032005 | Bacteria | 788 |
| 732 | Ga0307411_11094600 | 3300032005 | Bacteria | 718 |
| 733 | Ga0307411_11096189 | 3300032005 | Bacteria | 717 |
| 734 | Ga0307411_11120777 | 3300032005 | Bacteria | 710 |
| 735 | Ga0307415_100021335 | 3300032126 | Bacteria | 3979 |
| 736 | Ga0307415_100060290 | 3300032126 | Bacteria | 2621 |
| 737 | Ga0307415_100251349 | 3300032126 | Bacteria | 1436 |
| 738 | Ga0307415_100308804 | 3300032126 | Bacteria | 1313 |
| 739 | Ga0307415_100310477 | 3300032126 | Bacteria | 1310 |
| 740 | Ga0307415_100434342 | 3300032126 | Bacteria | 1130 |
| 741 | Ga0307415_100487062 | 3300032126 | Bacteria | 1075 |
| 742 | Ga0307415_101374269 | 3300032126 | Bacteria | 671 |
| 743 | Ga0307415_101554950 | 3300032126 | Bacteria | 634 |
| 744 | Ga0316583_10017344 | 3300032133 | Bacteria | 2590 |
| 745 | Ga0307510_10148726 | 3300033180 | Bacteria | 1967 |
| 746 | Ga0316582_0123061 | 3300036647 | Bacteria | 1737 |
| 747 | Ga0316584_0322947 | 3300036712 | Bacteria | 1113 |
| 748 | Ga0395899_0021460 | 3300037312 | Bacteria | 4899 |
| 749 | Ga0395899_0037336 | 3300037312 | Bacteria | 3642 |
| 750 | Ga0395899_0044654 | 3300037312 | Bacteria | 3301 |
| 751 | Ga0395900_0003576 | 3300037418 | Bacteria | 16706 |
| 752 | Ga0395900_0065379 | 3300037418 | Bacteria | 3736 |
| 753 | Ga0395900_0227501 | 3300037418 | Bacteria | 1877 |
| 754 | Ga0395900_0285305 | 3300037418 | Bacteria | 1641 |
| 755 | Ga0395900_0338178 | 3300037418 | Bacteria | 1481 |
| 756 | Ga0395900_0914872 | 3300037418 | Bacteria | 800 |
| 757 | Ga0395898_0006820 | 3300037466 | Bacteria | 12144 |
| 758 | Ga0395898_0029920 | 3300037466 | Bacteria | 5451 |
| 759 | Ga0395898_0174873 | 3300037466 | Bacteria | 2052 |
| 760 | Ga0395905_0020072 | 3300037471 | Bacteria | 6332 |
| 761 | Ga0395905_0089111 | 3300037471 | Bacteria | 2892 |
| 762 | Ga0395905_0127455 | 3300037471 | Bacteria | 2393 |
| 763 | Ga0395905_0183179 | 3300037471 | Bacteria | 1966 |
| 764 | Ga0395905_0592616 | 3300037471 | Bacteria | 1010 |
| 765 | Ga0395905_1115582 | 3300037471 | Bacteria | 692 |
| 766 | Ga0395901_0023315 | 3300038443 | Bacteria | 6343 |
| 767 | Ga0395901_0024563 | 3300038443 | Bacteria | 6188 |
| 768 | Ga0395901_0037956 | 3300038443 | Bacteria | 4982 |
| 769 | Ga0395901_0053668 | 3300038443 | Bacteria | 4188 |
| 770 | Ga0395901_0306549 | 3300038443 | Bacteria | 1645 |
| 771 | Ga0395901_0530584 | 3300038443 | Bacteria | 1195 |
| 772 | Ga0237819_00646 | 3300038705 | Bacteria | 11334 |
| 773 | Ga0237816_01651 | 3300039145 | Bacteria | 1796 |
| 774 | Ga0436365_0212007 | 3300039437 | Bacteria | 1166 |
| 775 | Ga0436365_0321020 | 3300039437 | Bacteria | 2362 |
| 776 | Ga0451789_0091044 | 3300041443 | Bacteria | 771 |
| 777 | Ga0451795_0301848 | 3300041456 | Bacteria | 578 |
| 778 | Ga0451804_0326837 | 3300041463 | Bacteria | 560 |
| 779 | Ga0451807_0971417 | 3300041486 | Bacteria | 1022 |
| 780 | Ga0451833_1322386 | 3300041491 | Bacteria | 517 |
| 781 | Ga0451845_0301951 | 3300041501 | Bacteria | 878 |
| 782 | Ga0451851_1209629 | 3300041507 | Bacteria | 530 |
| 783 | Ga0451855_1343931 | 3300041511 | Bacteria | 534 |
| 784 | Ga0439448_0001939 | 3300042005 | Bacteria | 5514 |
| 785 | Ga0439448_0002459 | 3300042005 | Bacteria | 5047 |
| 786 | Ga0439448_0012547 | 3300042005 | Bacteria | 2537 |
| 787 | Ga0439452_070674 | 3300042010 | Bacteria | 770 |
| 788 | Ga0439455_0001428 | 3300042012 | Bacteria | 3992 |
| 789 | Ga0439455_0003870 | 3300042012 | Bacteria | 2911 |
| 790 | Ga0450915_020857 | 3300042119 | Bacteria | 522 |
| 791 | Ga0450907_038417 | 3300042146 | Bacteria | 819 |
| 792 | Ga0439458_0000137 | 3300042157 | Bacteria | 15585 |
| 793 | Ga0439459_0102785 | 3300042438 | Bacteria | 701 |
| 794 | Ga0466969_0020897 | 3300044656 | Bacteria | 3386 |
| 795 | Ga0466969_0057629 | 3300044656 | Bacteria | 1893 |
| 796 | Ga0466972_0000826 | 3300044658 | Bacteria | 14820 |
| 797 | Ga0466965_0775357 | 3300044683 | Bacteria | 554 |
| 798 | Ga0466966_0000740 | 3300044684 | Bacteria | 20741 |
| 799 | Ga0466966_0002854 | 3300044684 | Bacteria | 11375 |
| 800 | Ga0466966_0010964 | 3300044684 | Bacteria | 6016 |
| 801 | Ga0466966_0502502 | 3300044684 | Bacteria | 729 |
| 802 | Ga0466961_0008230 | 3300044693 | Bacteria | 6641 |
| 803 | Ga0466961_0463072 | 3300044693 | Bacteria | 767 |
| 804 | Ga0466963_0020310 | 3300044694 | Bacteria | 4176 |
| 805 | Ga0466963_0100484 | 3300044694 | Bacteria | 1979 |
| 806 | Ga0466964_0000258 | 3300044706 | Bacteria | 15333 |
| 807 | Ga0466971_0005161 | 3300044719 | Bacteria | 5653 |
| 808 | Ga0466968_0285448 | 3300044735 | Bacteria | 791 |
| 809 | Ga0466970_0001595 | 3300044765 | Bacteria | 10930 |
| 810 | Ga0466970_0010990 | 3300044765 | Bacteria | 4606 |
| 811 | Ga0466970_0055342 | 3300044765 | Bacteria | 2119 |
| 812 | Ga0466970_0319151 | 3300044765 | Bacteria | 878 |
| 813 | Ga0466957_0000272 | 3300044842 | Bacteria | 25068 |
| 814 | Ga0466957_0326232 | 3300044842 | Bacteria | 1037 |
| 815 | Ga0466960_0004100 | 3300044901 | Bacteria | 5665 |
| 816 | Ga0466960_0181762 | 3300044901 | Bacteria | 1140 |
| 817 | Ga0466960_0617589 | 3300044901 | Bacteria | 645 |
| 818 | Ga0466959_0125671 | 3300045049 | Bacteria | 1820 |
| 819 | Ga0466959_0310885 | 3300045049 | Bacteria | 1078 |
| 820 | Ga0466959_0330778 | 3300045049 | Bacteria | 1040 |
| 821 | Ga0451576_0394264 | 3300045051 | Bacteria | 1451 |
| 822 | Ga0466958_0000445 | 3300045836 | Bacteria | 17129 |
| 823 | Ga0466958_0350118 | 3300045836 | Bacteria | 951 |
| 824 | Ga0466958_0536346 | 3300045836 | Bacteria | 760 |
| 825 | Ga0466967_0206551 | 3300045976 | Bacteria | 1862 |
| 826 | Ga0495627_000090 | 3300046453 | Bacteria | 109622 |
| 827 | Ga0495638_0000758 | 3300046460 | Bacteria | 34400 |
| 828 | Ga0495638_0042982 | 3300046460 | Bacteria | 2853 |
| 829 | Ga0495638_0076777 | 3300046460 | Bacteria | 2035 |
| 830 | Ga0495650_0000818 | 3300046471 | Bacteria | 37910 |
| 831 | Ga0495605_0087182 | 3300046474 | Bacteria | 1452 |
| 832 | Ga0495585_0402340 | 3300046492 | Bacteria | 659 |
| 833 | Ga0495596_0000220 | 3300046500 | Bacteria | 39671 |
| 834 | Ga0495607_0031559 | 3300046501 | Bacteria | 3242 |
| 835 | Ga0495607_0093490 | 3300046501 | Bacteria | 1624 |
| 836 | Ga0495583_0000218 | 3300046506 | Bacteria | 96349 |
| 837 | Ga0495583_0030064 | 3300046506 | Bacteria | 2651 |
| 838 | Ga0495606_0026454 | 3300046507 | Bacteria | 4136 |
| 839 | Ga0495610_0000015 | 3300046512 | Bacteria | 391489 |
| 840 | Ga0495610_0000604 | 3300046512 | Bacteria | 35531 |
| 841 | Ga0495610_0144969 | 3300046512 | Bacteria | 1018 |
| 842 | Ga0495610_0203141 | 3300046512 | Bacteria | 810 |
| 843 | Ga0495620_0007587 | 3300046515 | Bacteria | 5880 |
| 844 | Ga0495643_0000023 | 3300046522 | Bacteria | 288590 |
| 845 | Ga0495643_0011542 | 3300046522 | Bacteria | 5374 |
| 846 | Ga0495643_0040178 | 3300046522 | Bacteria | 2555 |
| 847 | Ga0495643_0045408 | 3300046522 | Bacteria | 2385 |
| 848 | Ga0495663_0018920 | 3300046525 | Bacteria | 1965 |
| 849 | Ga0495654_0086760 | 3300046530 | Bacteria | 1458 |
| 850 | Ga0495598_0000471 | 3300046537 | Bacteria | 7367 |
| 851 | Ga0495609_0007605 | 3300046538 | Bacteria | 5387 |
| 852 | Ga0495621_0000475 | 3300046539 | Bacteria | 9889 |
| 853 | Ga0495597_0090244 | 3300046542 | Bacteria | 1302 |
| 854 | Ga0495622_0052737 | 3300046557 | Bacteria | 1887 |
| 855 | Ga0495633_0016335 | 3300046558 | Bacteria | 3829 |
| 856 | Ga0495633_0126799 | 3300046558 | Bacteria | 1181 |
| 857 | Ga0495668_0000031 | 3300046616 | Bacteria | 256576 |
| 858 | Ga0495668_0006416 | 3300046616 | Bacteria | 7706 |
| 859 | Ga0495668_0171660 | 3300046616 | Bacteria | 1188 |
| 860 | Ga0495625_0000115 | 3300046660 | Bacteria | 122861 |
| 861 | Ga0495625_0001717 | 3300046660 | Bacteria | 25448 |
| 862 | Ga0495625_0045065 | 3300046660 | Bacteria | 3190 |
| 863 | Ga0495625_0051483 | 3300046660 | Bacteria | 2952 |
| 864 | Ga0495625_0269902 | 3300046660 | Bacteria | 1098 |
| 865 | Ga0495669_0002223 | 3300046684 | Bacteria | 7968 |
| 866 | Ga0495670_0000002 | 3300046691 | Bacteria | 601814 |
| 867 | Ga0495670_0006264 | 3300046691 | Bacteria | 5837 |
| 868 | Ga0495670_0010027 | 3300046691 | Bacteria | 4659 |
| 869 | Ga0495670_0058113 | 3300046691 | Bacteria | 1942 |
| 870 | Ga0495671_0298136 | 3300046692 | Bacteria | 775 |
| 871 | Ga0495671_0375704 | 3300046692 | Bacteria | 681 |
| 872 | Ga0495683_0201635 | 3300047323 | Bacteria | 897 |
| 873 | Ga0495687_145671 | 3300047443 | Bacteria | 817 |
| 874 | Ga0495677_0045073 | 3300047445 | Bacteria | 1617 |
| 875 | Ga0495673_0011196 | 3300047469 | Bacteria | 4841 |
| 876 | Ga0495681_0000048 | 3300047470 | Bacteria | 110216 |
| 877 | Ga0495681_0113368 | 3300047470 | Bacteria | 1171 |
| 878 | Ga0495686_0029938 | 3300047472 | Bacteria | 3538 |
| 879 | Ga0495686_0069949 | 3300047472 | Bacteria | 2163 |
| 880 | Ga0495686_0356930 | 3300047472 | Bacteria | 793 |
| 881 | Ga0496101_0070957 | 3300048904 | Bacteria | 2552 |
| 882 | Ga0496101_0138327 | 3300048904 | Bacteria | 1854 |
| 883 | Ga0496101_1212027 | 3300048904 | Bacteria | 591 |
| 884 | Ga0496102_0000615 | 3300048905 | Bacteria | 36925 |
| 885 | Ga0496102_0023742 | 3300048905 | Bacteria | 5449 |
| 886 | Ga0496102_0366878 | 3300048905 | Bacteria | 1355 |
| 887 | Ga0496102_1210665 | 3300048905 | Bacteria | 675 |
| 888 | Ga0496102_1587739 | 3300048905 | Bacteria | 573 |
| 889 | Ga0496103_0009010 | 3300048906 | Bacteria | 5911 |
| 890 | Ga0496103_0009373 | 3300048906 | Bacteria | 5799 |
| 891 | Ga0496103_0075504 | 3300048906 | Bacteria | 2114 |
| 892 | Ga0496104_0000081 | 3300048907 | Bacteria | 94514 |
| 893 | Ga0496104_0041285 | 3300048907 | Bacteria | 4325 |
| 894 | Ga0496104_0050407 | 3300048907 | Bacteria | 3928 |
| 895 | Ga0496104_0182830 | 3300048907 | Bacteria | 2007 |
| 896 | Ga0496105_0000034 | 3300048908 | Bacteria | 127505 |
| 897 | Ga0496105_0000870 | 3300048908 | Bacteria | 20664 |
| 898 | Ga0496105_0181294 | 3300048908 | Bacteria | 1724 |
| 899 | Ga0496107_0025431 | 3300048910 | Bacteria | 4191 |
| 900 | Ga0496108_0094660 | 3300048911 | Bacteria | 2542 |
| 901 | Ga0496108_0193191 | 3300048911 | Bacteria | 1765 |
| 902 | Ga0496109_0168001 | 3300048912 | Bacteria | 2057 |
| 903 | Ga0496109_0539887 | 3300048912 | Bacteria | 1100 |
| 904 | Ga0496109_1345838 | 3300048912 | Bacteria | 650 |
| 905 | Ga0496110_0140371 | 3300048913 | Bacteria | 2184 |
| 906 | Ga0496110_0633428 | 3300048913 | Bacteria | 968 |
| 907 | Ga0496110_0744136 | 3300048913 | Bacteria | 883 |
| 908 | Ga0496111_0147028 | 3300048914 | Bacteria | 1747 |
| 909 | Ga0496111_0176913 | 3300048914 | Bacteria | 1586 |
| 910 | Ga0496111_0992402 | 3300048914 | Bacteria | 602 |
| 911 | Ga0496112_0116278 | 3300048915 | Bacteria | 2645 |
| 912 | Ga0496112_0219258 | 3300048915 | Bacteria | 1858 |
| 913 | Ga0496112_0979400 | 3300048915 | Bacteria | 766 |
| 914 | Ga0496113_0000101 | 3300048916 | Bacteria | 36217 |
| 915 | Ga0496113_0006116 | 3300048916 | Bacteria | 7596 |
| 916 | Ga0496113_0385385 | 3300048916 | Bacteria | 1125 |
| 917 | Ga0496113_1267349 | 3300048916 | Bacteria | 574 |
| 918 | Ga0496114_0023435 | 3300048917 | Bacteria | 5038 |
| 919 | Ga0496115_0108956 | 3300048918 | Bacteria | 2274 |
| 920 | Ga0496115_0280671 | 3300048918 | Bacteria | 1367 |
| 921 | Ga0496116_0077129 | 3300048919 | Bacteria | 2084 |
| 922 | Ga0496116_0101176 | 3300048919 | Bacteria | 1721 |
| 923 | Ga0496117_0000146 | 3300048920 | Bacteria | 152244 |
| 924 | Ga0496117_0067828 | 3300048920 | Bacteria | 2411 |
| 925 | Ga0496117_0312713 | 3300048920 | Bacteria | 826 |
| 926 | Ga0496117_0471181 | 3300048920 | Bacteria | 616 |
| 927 | Ga0496118_0015425 | 3300048921 | Bacteria | 7071 |
| 928 | Ga0496118_0081041 | 3300048921 | Bacteria | 2281 |
| 929 | Ga0496118_0109131 | 3300048921 | Bacteria | 1843 |
| 930 | Ga0496119_0000057 | 3300048922 | Bacteria | 173746 |
| 931 | Ga0496119_0003988 | 3300048922 | Bacteria | 14944 |
| 932 | Ga0496120_0005360 | 3300048923 | Bacteria | 10261 |
| 933 | Ga0496120_0020958 | 3300048923 | Bacteria | 4139 |
| 934 | Ga0496120_0171194 | 3300048923 | Bacteria | 1074 |
| 935 | Ga0496120_0185785 | 3300048923 | Bacteria | 1017 |
| 936 | Ga0496121_0000196 | 3300048924 | Bacteria | 135812 |
| 937 | Ga0496121_0006053 | 3300048924 | Bacteria | 15228 |
| 938 | Ga0496121_0017016 | 3300048924 | Bacteria | 7461 |
| 939 | Ga0496122_0000723 | 3300048925 | Bacteria | 64694 |
| 940 | Ga0496122_0286403 | 3300048925 | Bacteria | 897 |
| 941 | Ga0496123_0002968 | 3300048926 | Bacteria | 19751 |
| 942 | Ga0496123_0116075 | 3300048926 | Bacteria | 1517 |
| 943 | Ga0496124_0000874 | 3300048927 | Bacteria | 49185 |
| 944 | Ga0496124_0023588 | 3300048927 | Bacteria | 5614 |
| 945 | Ga0496124_0476023 | 3300048927 | Bacteria | 844 |
| 946 | Ga0496124_0507938 | 3300048927 | Bacteria | 806 |
| 947 | Ga0496125_0002465 | 3300048928 | Bacteria | 24034 |
| 948 | Ga0496125_0091131 | 3300048928 | Bacteria | 2285 |
| 949 | Ga0496126_0000028 | 3300048929 | Bacteria | 394082 |
| 950 | Ga0496126_0027682 | 3300048929 | Bacteria | 5410 |
| 951 | Ga0496126_0137560 | 3300048929 | Bacteria | 2105 |
| 952 | Ga0501296_087318 | 3300049519 | Bacteria | 501 |
| 953 | Ga0501314_003183 | 3300049530 | Bacteria | 1312 |
| 954 | Ga0501337_019737 | 3300049553 | Bacteria | 543 |
| 955 | Ga0501032_0706763 | 3300049569 | Bacteria | 639 |
| 956 | Ga0501032_0770248 | 3300049569 | Bacteria | 608 |
| 957 | Ga0501033_0214787 | 3300049570 | Bacteria | 1371 |
| 958 | Ga0501034_0071253 | 3300049571 | Bacteria | 3485 |
| 959 | Ga0501034_0420947 | 3300049571 | Bacteria | 1257 |
| 960 | Ga0501036_0133161 | 3300049572 | Bacteria | 2098 |
| 961 | Ga0501071_0207474 | 3300049587 | Bacteria | 1473 |
| 962 | Ga0501074_0347840 | 3300049590 | Bacteria | 1052 |
| 963 | Ga0501217_052350 | 3300049661 | Bacteria | 1071 |
| 964 | Ga0501223_000342 | 3300049663 | Bacteria | 11557 |
| 965 | Ga0501224_000033 | 3300049664 | Bacteria | 39112 |
| 966 | Ga0501233_000413 | 3300049668 | Bacteria | 6716 |
| 967 | Ga0501233_145843 | 3300049668 | Bacteria | 657 |
| 968 | Ga0501235_003998 | 3300049669 | Bacteria | 3193 |
| 969 | Ga0501247_034768 | 3300049677 | Bacteria | 702 |
| 970 | Ga0501249_122167 | 3300049679 | Bacteria | 636 |
| 971 | Ga0501225_0000097 | 3300049705 | Bacteria | 28134 |
| 972 | Ga0501225_0080312 | 3300049705 | Bacteria | 936 |
| 973 | Ga0501225_0114646 | 3300049705 | Bacteria | 797 |
| 974 | Ga0501234_002770 | 3300049707 | Bacteria | 2760 |
| 975 | Ga0501080_0282719 | 3300049742 | Bacteria | 1508 |
| 976 | Ga0501080_0610107 | 3300049742 | Bacteria | 968 |
| 977 | Ga0501241_014967 | 3300049758 | Bacteria | 1410 |
| 978 | Ga0501268_007953 | 3300049765 | Bacteria | 1593 |
| 979 | Ga0501270_065210 | 3300049767 | Bacteria | 692 |
| 980 | Ga0501273_002915 | 3300049770 | Bacteria | 1780 |
| 981 | Ga0501044_0339672 | 3300049823 | Bacteria | 1423 |
| 982 | Ga0501044_0422819 | 3300049823 | Bacteria | 1242 |
| 983 | Ga0501044_0595752 | 3300049823 | Bacteria | 999 |
| 984 | Ga0501044_0659534 | 3300049823 | Bacteria | 935 |
| 985 | Ga0501226_000056 | 3300049853 | Bacteria | 39071 |
| 986 | nmdc:mga03683_344_c1 | 3300050489 | Bacteria | 13557 |
| 987 | nmdc:mga03683_409990_c1 | 3300050489 | Bacteria | 648 |
| 988 | nmdc:mga03683_73463_c1 | 3300050489 | Bacteria | 1466 |
| 989 | nmdc:mga03n38_22087_c1 | 3300050490 | Bacteria | 2570 |
| 990 | nmdc:mga03n38_418364_c1 | 3300050490 | Bacteria | 741 |
| 991 | nmdc:mga00v17_25514_c1 | 3300050491 | Bacteria | 3436 |
| 992 | nmdc:mga00v17_75476_c1 | 3300050491 | Bacteria | 1412 |
| 993 | nmdc:mga0k408_344198_c1 | 3300050493 | Bacteria | 889 |
| 994 | nmdc:mga0k408_484340_c1 | 3300050493 | Bacteria | 734 |
| 995 | nmdc:mga0k408_9833_c1 | 3300050493 | Bacteria | 5164 |
| 996 | nmdc:mga06z11_17_c1 | 3300050494 | Bacteria | 79602 |
| 997 | nmdc:mga04h51_146_c1 | 3300050495 | Bacteria | 20585 |
| 998 | nmdc:mga04h51_284722_c1 | 3300050495 | Bacteria | 670 |
| 999 | nmdc:mga04h51_3829_c1 | 3300050495 | Bacteria | 3693 |
| 1000 | nmdc:mga07m45_111328_c1 | 3300050496 | Bacteria | 1577 |
| 1001 | nmdc:mga07m45_189975_c1 | 3300050496 | Bacteria | 1194 |
| 1002 | nmdc:mga07m45_24809_c1 | 3300050496 | Bacteria | 3287 |
| 1003 | nmdc:mga07m45_4_c1 | 3300050496 | Bacteria | 409607 |
| 1004 | nmdc:mga07m45_60295_c1 | 3300050496 | Bacteria | 2147 |
| 1005 | nmdc:mga07m45_65525_c1 | 3300050496 | Bacteria | 2063 |
| 1006 | nmdc:mga0sz30_149231_c1 | 3300050516 | Bacteria | 1034 |
| 1007 | nmdc:mga0sz30_31307_c1 | 3300050516 | Bacteria | 2201 |
| 1008 | nmdc:mga0sz30_46_c1 | 3300050516 | Bacteria | 44412 |
| 1009 | Ga0500643_000004 | 3300053087 | Bacteria | 857484 |
| 1010 | Ga0500643_000783 | 3300053087 | Bacteria | 20603 |
| 1011 | Ga0500643_025387 | 3300053087 | Bacteria | 1869 |
| 1012 | Ga0500643_034160 | 3300053087 | Bacteria | 1533 |
| 1013 | Ga0500643_083586 | 3300053087 | Bacteria | 875 |
| 1014 | Ga0500647_0021734 | 3300053091 | Bacteria | 2996 |
| 1015 | Ga0500566_0294819 | 3300053094 | Bacteria | 766 |
| 1016 | Ga0500641_0073291 | 3300053096 | Bacteria | 1445 |
| 1017 | Ga0500555_000575 | 3300053103 | Bacteria | 14512 |
| 1018 | Ga0500555_184163 | 3300053103 | Bacteria | 505 |
| 1019 | Ga0500556_0000222 | 3300053104 | Bacteria | 45971 |
| 1020 | Ga0500557_124997 | 3300053105 | Bacteria | 853 |
| 1021 | Ga0500562_012822 | 3300053108 | Bacteria | 2134 |
| 1022 | Ga0500562_096187 | 3300053108 | Bacteria | 805 |
| 1023 | Ga0500594_0008135 | 3300053118 | Bacteria | 2385 |
| 1024 | Ga0500595_000572 | 3300053119 | Bacteria | 21961 |
| 1025 | Ga0500595_095238 | 3300053119 | Bacteria | 858 |
| 1026 | Ga0500607_000055 | 3300053121 | Bacteria | 78780 |
| 1027 | Ga0500607_000844 | 3300053121 | Bacteria | 29501 |
| 1028 | Ga0500607_184589 | 3300053121 | Bacteria | 920 |
| 1029 | Ga0500608_001074 | 3300053122 | Bacteria | 9755 |
| 1030 | Ga0500608_007769 | 3300053122 | Bacteria | 4458 |
| 1031 | Ga0500614_053067 | 3300053123 | Bacteria | 1070 |
| 1032 | Ga0500614_155718 | 3300053123 | Bacteria | 690 |
| 1033 | Ga0500618_033483 | 3300053125 | Bacteria | 1198 |
| 1034 | Ga0500618_120739 | 3300053125 | Bacteria | 593 |
| 1035 | Ga0500642_0000011 | 3300053130 | Bacteria | 215963 |
| 1036 | Ga0500642_0121939 | 3300053130 | Bacteria | 1220 |
| 1037 | Ga0500559_0003805 | 3300053136 | Bacteria | 7307 |
| 1038 | Ga0500559_0156387 | 3300053136 | Bacteria | 1071 |
| 1039 | Ga0500564_001322 | 3300053138 | Bacteria | 8462 |
| 1040 | Ga0500568_0006166 | 3300053139 | Bacteria | 6063 |
| 1041 | Ga0500568_0229107 | 3300053139 | Bacteria | 678 |
| 1042 | Ga0500573_0000114 | 3300053140 | Bacteria | 32888 |
| 1043 | Ga0500590_011655 | 3300053148 | Bacteria | 4459 |
| 1044 | Ga0500616_0006078 | 3300053153 | Bacteria | 8008 |
| 1045 | Ga0500616_0142733 | 3300053153 | Bacteria | 1117 |
| 1046 | Ga0500622_0001994 | 3300053156 | Bacteria | 15306 |
| 1047 | Ga0500622_0077848 | 3300053156 | Bacteria | 1665 |
| 1048 | Ga0500622_0162940 | 3300053156 | Bacteria | 1044 |
| 1049 | Ga0500622_0264177 | 3300053156 | Bacteria | 749 |
| 1050 | Ga0500627_0506062 | 3300053158 | Bacteria | 502 |
| 1051 | Ga0500636_0180881 | 3300053177 | Bacteria | 1132 |
| 1052 | Ga0500567_000074 | 3300053723 | Bacteria | 22867 |
| 1053 | Ga0500625_000002 | 3300053729 | Bacteria | 371909 |
| 1054 | Ga0500645_000417 | 3300053730 | Bacteria | 29425 |
| 1055 | Ga0500645_004197 | 3300053730 | Bacteria | 5605 |
| 1056 | Ga0500645_006930 | 3300053730 | Bacteria | 3999 |
| 1057 | Ga0590075_118063 | 3300059424 | Bacteria | 694 |
| 1058 | Ga0587070_107679 | 3300059491 | Bacteria | 650 |
| 1059 | Ga0587085_013648 | 3300059506 | Bacteria | 1134 |
| 1060 | Ga0587085_032596 | 3300059506 | Bacteria | 865 |
| 1061 | Ga0587062_008373 | 3300059639 | Bacteria | 1232 |
| 1062 | Ga0466962_0002892 | 3300061719 | Bacteria | 8187 |
| 1063 | 2511130324 | 2510917021 | Bacteria | 5705459 |
| 1064 | 2643819656 | 2643221560 | Bacteria | 4801179 |
| 1065 | 2739651864 | 2739367664 | Bacteria | 4114334 |
| 1066 | 2740030338 | 2739367865 | Bacteria | 4114482 |
| 1067 | 2778125106 | 2775507255 | Bacteria | 3945731 |
| 1068 | 2830076934 | 2830075706 | Bacteria | 3855215 |
| 1069 | 2852654519 | 2852653556 | Bacteria | 4050083 |
| 1070 | 2852684014 | 2852680915 | Bacteria | 4100189 |
| 1071 | 2882807015 | 2882806704 | Bacteria | 3007728 |
| 1072 | 2885427691 | 2885427238 | Bacteria | 2291351 |
| 1073 | 2895888362 | 2895880812 | Bacteria | 11255272 |
| 1074 | 2896186911 | 2896184354 | Bacteria | 3258548 |
| 1075 | 2928030296 | 2928027323 | Bacteria | 4382488 |
| 1076 | 2946789281 | 2946787523 | Bacteria | 4366789 |
| 1077 | 2984558873 | 2984555340 | Bacteria | 4247089 |
| 1078 | 2984566613 | 2984564862 | Bacteria | 4339992 |
| 1079 | 2990266883 | 2990265787 | Bacteria | 3943888 |
| 1080 | 2993357809 | 2993356040 | Bacteria | 4247105 |
| 1081 | 2993693828 | 2993693658 | Bacteria | 4040749 |
| 1082 | 3000866466 | 3000865235 | Bacteria | 3106258 |
| 1083 | 8054303053 | 8054302542 | Bacteria | 5698134 |
| 1084 | 8057101257 | 8057101203 | Bacteria | 5034064 |
| 1085 | Ga0395905_1046289 | |||
| 1086 | RicEn_FSXC48507_g1 | |||
| 1087 | SwRhRL2b_contig_14491 | |||
| 1088 | SwRhRL2b_contig_1941805 | |||
| 1089 | JGI24741J21665_1009296 | |||
| 1090 | JGI24741J21665_1026449 | |||
| 1091 | JGI24740J21852_10025645 | |||
| 1092 | JGI24740J21852_10044246 | |||
| 1093 | JGI24739J22299_10085084 | |||
| 1094 | JGI24737J22298_10015406 | |||
| 1095 | JGI24737J22298_10141222 | |||
| 1096 | JGI24737J22298_10159807 | |||
| 1097 | JGI24735J21928_10004614 | |||
| 1098 | JGI24735J21928_10009368 | |||
| 1099 | JGI24735J21928_10020556 | |||
| 1100 | JGI24749J21850_1080763 | |||
| 1101 | JGI24035J26624_1026530 | |||
| 1102 | JGI24034J26672_10032562 | |||
| 1103 | JGI24034J26672_10034318 | |||
| 1104 | JGI24751J29686_10000183 | |||
| 1105 | JGI24751J29686_10006267 | |||
| 1106 | JGI25406J46586_10073176 | |||
| 1107 | Ga0055536_1001129 | |||
| 1108 | Ga0055534_1028413 | |||
| 1109 | Ga0055530_10000217 | |||
| 1110 | Ga0055530_10120939 | |||
| 1111 | Ga0055531_10000571 | |||
| 1112 | Ga0055531_10017368 | |||
| 1113 | Ga0058863_10010079 | |||
| 1114 | Ga0065165_1005029 | |||
| 1115 | Ga0065704_10070504 | |||
| 1116 | Ga0065704_10160113 | |||
| 1117 | Ga0065704_10623232 | |||
| 1118 | Ga0065712_10655293 | |||
| 1119 | Ga0070658_10001814 | |||
| 1120 | Ga0070658_10004690 | |||
| 1121 | Ga0070658_10078926 | |||
| 1122 | Ga0070658_10254395 | |||
| 1123 | Ga0070658_10486976 | |||
| 1124 | Ga0070658_10553426 | |||
| 1125 | Ga0070658_10590018 | |||
| 1126 | Ga0070658_10819451 | |||
| 1127 | Ga0070658_10906585 | |||
| 1128 | Ga0070683_100080914 | |||
| 1129 | Ga0070683_100142414 | |||
| 1130 | Ga0070683_100209353 | |||
| 1131 | Ga0070683_100412603 | |||
| 1132 | Ga0070683_101204161 | |||
| 1133 | Ga0070690_100189611 | |||
| 1134 | Ga0070670_100036211 | |||
| 1135 | Ga0070670_100126344 | |||
| 1136 | Ga0070670_100556582 | |||
| 1137 | Ga0068869_101523852 | |||
| 1138 | Ga0070666_10031513 | |||
| 1139 | Ga0070666_10245552 | |||
| 1140 | Ga0070666_10257671 | |||
| 1141 | Ga0070680_100001532 | |||
| 1142 | Ga0070680_100130253 | |||
| 1143 | Ga0070680_100862652 | |||
| 1144 | Ga0070680_100886637 | |||
| 1145 | Ga0070682_100231965 | |||
| 1146 | Ga0070682_100292626 | |||
| 1147 | Ga0070682_100574623 | |||
| 1148 | Ga0070660_100004583 | |||
| 1149 | Ga0070660_100009577 | |||
| 1150 | Ga0070660_100025704 | |||
| 1151 | Ga0070660_100075067 | |||
| 1152 | Ga0070660_100078162 | |||
| 1153 | Ga0070660_100122768 | |||
| 1154 | Ga0070660_100138856 | |||
| 1155 | Ga0070660_100359155 | |||
| 1156 | Ga0070660_100564963 | |||
| 1157 | Ga0070660_100768117 | |||
| 1158 | Ga0070687_100522493 | |||
| 1159 | Ga0070687_101372528 | |||
| 1160 | Ga0070661_100005966 | |||
| 1161 | Ga0070661_100012214 | |||
| 1162 | Ga0070661_100044029 | |||
| 1163 | Ga0070692_10042253 | |||
| 1164 | Ga0070692_10329553 | |||
| 1165 | Ga0070668_100000080 | |||
| 1166 | Ga0070668_100011581 | |||
| 1167 | Ga0070668_100027483 | |||
| 1168 | Ga0070668_100038637 | |||
| 1169 | Ga0070668_100408180 | |||
| 1170 | Ga0070668_100899906 | |||
| 1171 | Ga0070669_100000082 | |||
| 1172 | Ga0070669_100000270 | |||
| 1173 | Ga0070669_100001657 | |||
| 1174 | Ga0070669_100538648 | |||
| 1175 | Ga0070671_100000116 | |||
| 1176 | Ga0070671_100000169 | |||
| 1177 | Ga0070671_100000299 | |||
| 1178 | Ga0070671_100013092 | |||
| 1179 | Ga0070671_100017053 | |||
| 1180 | Ga0070671_101306033 | |||
| 1181 | Ga0070671_102039776 | |||
| 1182 | Ga0070674_100041961 | |||
| 1183 | Ga0070673_101163110 | |||
| 1184 | Ga0070659_100143162 | |||
| 1185 | Ga0070659_100160559 | |||
| 1186 | Ga0070659_100487981 | |||
| 1187 | Ga0070659_100712402 | |||
| 1188 | Ga0070659_100757091 | |||
| 1189 | Ga0070659_102119143 | |||
| 1190 | Ga0070667_100000968 | |||
| 1191 | Ga0070667_100001907 | |||
| 1192 | Ga0070667_100038717 | |||
| 1193 | Ga0070667_100125378 | |||
| 1194 | Ga0070667_100352616 | |||
| 1195 | Ga0070667_101184761 | |||
| 1196 | Ga0070711_101751273 | |||
| 1197 | Ga0070705_101929486 | |||
| 1198 | Ga0070663_100042802 | |||
| 1199 | Ga0070663_100072263 | |||
| 1200 | Ga0070663_100138996 | |||
| 1201 | Ga0070663_100146585 | |||
| 1202 | Ga0070663_100213009 | |||
| 1203 | Ga0070663_100418732 | |||
| 1204 | Ga0070663_100769265 | |||
| 1205 | Ga0070678_101599225 | |||
| 1206 | Ga0070662_100002038 | |||
| 1207 | Ga0070662_100051197 | |||
| 1208 | Ga0070662_100094062 | |||
| 1209 | Ga0070662_100477503 | |||
| 1210 | Ga0070681_10049910 | |||
| 1211 | Ga0070681_10279946 | |||
| 1212 | Ga0070681_10515005 | |||
| 1213 | Ga0070681_10778075 | |||
| 1214 | Ga0070679_100049171 | |||
| 1215 | Ga0070679_100053739 | |||
| 1216 | Ga0070679_100125039 | |||
| 1217 | Ga0070679_100165965 | |||
| 1218 | Ga0070679_100797661 | |||
| 1219 | Ga0070684_100058240 | |||
| 1220 | Ga0070684_100275617 | |||
| 1221 | Ga0070684_101360092 | |||
| 1222 | Ga0068853_100000825 | |||
| 1223 | Ga0068853_100001009 | |||
| 1224 | Ga0068853_100090669 | |||
| 1225 | Ga0068853_100099224 | |||
| 1226 | Ga0068853_100175395 | |||
| 1227 | Ga0068853_100773978 | |||
| 1228 | Ga0068853_100828533 | |||
| 1229 | Ga0068853_100932187 | |||
| 1230 | Ga0070686_100246175 | |||
| 1231 | Ga0070665_100002434 | |||
| 1232 | Ga0070665_100009702 | |||
| 1233 | Ga0070665_100020215 | |||
| 1234 | Ga0070665_100095381 | |||
| 1235 | Ga0070665_100235968 | |||
| 1236 | Ga0068855_100007299 | |||
| 1237 | Ga0068855_100011899 | |||
| 1238 | Ga0068855_100017657 | |||
| 1239 | Ga0068855_100022037 | |||
| 1240 | Ga0068855_100058341 | |||
| 1241 | Ga0068855_100234877 | |||
| 1242 | Ga0068855_100657660 | |||
| 1243 | Ga0068855_101628431 | |||
| 1244 | Ga0070664_100004940 | |||
| 1245 | Ga0070664_100063472 | |||
| 1246 | Ga0070664_100107496 | |||
| 1247 | Ga0070664_100685619 | |||
| 1248 | Ga0070664_101361990 | |||
| 1249 | Ga0068857_100012786 | |||
| 1250 | Ga0068857_100034254 | |||
| 1251 | Ga0068857_100246743 | |||
| 1252 | Ga0068857_100532724 | |||
| 1253 | Ga0068857_100782136 | |||
| 1254 | Ga0068857_100977674 | |||
| 1255 | Ga0068857_102328909 | |||
| 1256 | Ga0068854_100000459 | |||
| 1257 | Ga0068854_100013420 | |||
| 1258 | Ga0068854_100047093 | |||
| 1259 | Ga0068854_100137097 | |||
| 1260 | Ga0068854_100159330 | |||
| 1261 | Ga0068854_100166546 | |||
| 1262 | Ga0068854_100812281 | |||
| 1263 | Ga0068854_101049149 | |||
| 1264 | Ga0068854_101325357 | |||
| 1265 | Ga0068856_100025980 | |||
| 1266 | Ga0068856_100034389 | |||
| 1267 | Ga0068856_100194821 | |||
| 1268 | Ga0068856_100328553 | |||
| 1269 | Ga0068856_100520452 | |||
| 1270 | Ga0068856_101792595 | |||
| 1271 | Ga0068852_100000231 | |||
| 1272 | Ga0068852_100012993 | |||
| 1273 | Ga0068852_100086148 | |||
| 1274 | Ga0068852_100296204 | |||
| 1275 | Ga0068852_100408267 | |||
| 1276 | Ga0068852_100447063 | |||
| 1277 | Ga0068852_100638361 | |||
| 1278 | Ga0068852_102411732 | |||
| 1279 | Ga0068859_100010259 | |||
| 1280 | Ga0068859_100859376 | |||
| 1281 | Ga0068859_100868714 | |||
| 1282 | Ga0068859_101026602 | |||
| 1283 | Ga0068859_101045548 | |||
| 1284 | Ga0068864_100003823 | |||
| 1285 | Ga0068864_100004682 | |||
| 1286 | Ga0068864_100029698 | |||
| 1287 | Ga0068864_100080985 | |||
| 1288 | Ga0068864_101173069 | |||
| 1289 | Ga0068861_100000001 | |||
| 1290 | Ga0068863_100000001 | |||
| 1291 | Ga0068863_100000106 | |||
| 1292 | Ga0068863_100044294 | |||
| 1293 | Ga0068863_100094394 | |||
| 1294 | Ga0068863_100137511 | |||
| 1295 | Ga0068863_100166090 | |||
| 1296 | Ga0068863_100261102 | |||
| 1297 | Ga0068858_100000327 | |||
| 1298 | Ga0068858_100001247 | |||
| 1299 | Ga0068858_100039777 | |||
| 1300 | Ga0068858_100056520 | |||
| 1301 | Ga0068858_100163708 | |||
| 1302 | Ga0068858_100327621 | |||
| 1303 | Ga0068860_100000386 | |||
| 1304 | Ga0068860_100009605 | |||
| 1305 | Ga0068860_100092375 | |||
| 1306 | Ga0068860_100115216 | |||
| 1307 | Ga0068860_100310382 | |||
| 1308 | Ga0068860_100465108 | |||
| 1309 | Ga0068860_102626142 | |||
| 1310 | Ga0068862_100009807 | |||
| 1311 | Ga0068862_100021177 | |||
| 1312 | Ga0068862_100027853 | |||
| 1313 | Ga0068862_100049285 | |||
| 1314 | Ga0068862_100490347 | |||
| 1315 | Ga0068862_101159350 | |||
| 1316 | Ga0068862_101734200 | |||
| 1317 | Ga0081540_1162277 | |||
| 1318 | Ga0081539_10074933 | |||
| 1319 | Ga0075365_10080983 | |||
| 1320 | Ga0075365_10477151 | |||
| 1321 | Ga0075368_10000112 | |||
| 1322 | Ga0075368_10000385 | |||
| 1323 | Ga0075368_10322642 | |||
| 1324 | Ga0075363_100005439 | |||
| 1325 | Ga0075363_100012861 | |||
| 1326 | Ga0075364_10110693 | |||
| 1327 | Ga0075362_10000129 | |||
| 1328 | Ga0075362_10143095 | |||
| 1329 | Ga0075362_10257530 | |||
| 1330 | Ga0075367_10000692 | |||
| 1331 | Ga0075367_10782097 | |||
| 1332 | Ga0075369_10032715 | |||
| 1333 | Ga0075369_10089500 | |||
| 1334 | Ga0075369_10159290 | |||
| 1335 | Ga0075366_10013664 | |||
| 1336 | Ga0075366_10245806 | |||
| 1337 | Ga0075366_10530539 | |||
| 1338 | Ga0075370_10010420 | |||
| 1339 | Ga0075370_10043587 | |||
| 1340 | Ga0075370_10058591 | |||
| 1341 | Ga0075370_10126540 | |||
| 1342 | Ga0075370_10394531 | |||
| 1343 | Ga0075429_100833896 | |||
| 1344 | Ga0068865_101099164 | |||
| 1345 | Ga0068865_101281440 | |||
| 1346 | Ga0097620_100010259 | |||
| 1347 | Ga0097620_100859461 | |||
| 1348 | Ga0097620_100868709 | |||
| 1349 | Ga0097620_101026648 | |||
| 1350 | Ga0097620_101045495 | |||
| 1351 | Ga0079104_1061795 | |||
| 1352 | Ga0105251_10012362 | |||
| 1353 | Ga0105250_10006517 | |||
| 1354 | Ga0105240_10013931 | |||
| 1355 | Ga0105240_10570341 | |||
| 1356 | Ga0105240_10794470 | |||
| 1357 | Ga0105247_10589857 | |||
| 1358 | Ga0105247_10716195 | |||
| 1359 | Ga0105243_10320752 | |||
| 1360 | Ga0105243_10767589 | |||
| 1361 | Ga0105243_12130670 | |||
| 1362 | Ga0105241_10084481 | |||
| 1363 | Ga0105241_10425900 | |||
| 1364 | Ga0105241_10565791 | |||
| 1365 | Ga0105242_11505959 | |||
| 1366 | Ga0105248_10001758 | |||
| 1367 | Ga0105248_10029772 | |||
| 1368 | Ga0105248_10030056 | |||
| 1369 | Ga0105248_10043233 | |||
| 1370 | Ga0105248_10074540 | |||
| 1371 | Ga0105248_10106004 | |||
| 1372 | Ga0105248_10158703 | |||
| 1373 | Ga0105248_10168174 | |||
| 1374 | Ga0105248_13145328 | |||
| 1375 | Ga0105237_11817604 | |||
| 1376 | Ga0105238_10070938 | |||
| 1377 | Ga0105238_10231030 | |||
| 1378 | Ga0105238_10668100 | |||
| 1379 | Ga0105249_10037409 | |||
| 1380 | Ga0105249_10174180 | |||
| 1381 | Ga0105249_10261051 | |||
| 1382 | Ga0105249_10265973 | |||
| 1383 | Ga0105249_10538642 | |||
| 1384 | Ga0105239_10846266 | |||
| 1385 | Ga0105239_11201659 | |||
| 1386 | Ga0105239_11229129 | |||
| 1387 | Ga0105246_10477789 | |||
| 1388 | Ga0157326_1000423 | |||
| 1389 | Ga0157373_10005891 | |||
| 1390 | Ga0157373_10073069 | |||
| 1391 | Ga0157373_10073823 | |||
| 1392 | Ga0157373_10118854 | |||
| 1393 | Ga0157373_10152393 | |||
| 1394 | Ga0157373_10210985 | |||
| 1395 | Ga0157373_10439064 | |||
| 1396 | Ga0157373_11454634 | |||
| 1397 | Ga0157371_10005585 | |||
| 1398 | Ga0157371_10014817 | |||
| 1399 | Ga0157371_10030644 | |||
| 1400 | Ga0157371_10126094 | |||
| 1401 | Ga0157371_10159148 | |||
| 1402 | Ga0157371_10285046 | |||
| 1403 | Ga0157371_10670109 | |||
| 1404 | Ga0157370_10008601 | |||
| 1405 | Ga0157370_10020840 | |||
| 1406 | Ga0157370_10069312 | |||
| 1407 | Ga0157370_10214812 | |||
| 1408 | Ga0157370_10481893 | |||
| 1409 | Ga0157370_10504540 | |||
| 1410 | Ga0157370_10648743 | |||
| 1411 | Ga0157370_10998843 | |||
| 1412 | Ga0157370_11611114 | |||
| 1413 | Ga0157369_10001177 | |||
| 1414 | Ga0157369_10011267 | |||
| 1415 | Ga0157369_10012443 | |||
| 1416 | Ga0157369_10073644 | |||
| 1417 | Ga0157369_10109686 | |||
| 1418 | Ga0157369_10173906 | |||
| 1419 | Ga0157369_10181989 | |||
| 1420 | Ga0157369_11651416 | |||
| 1421 | Ga0157374_10007709 | |||
| 1422 | Ga0157378_10071999 | |||
| 1423 | Ga0157378_11229493 | |||
| 1424 | Ga0163162_10016081 | |||
| 1425 | Ga0163162_10049256 | |||
| 1426 | Ga0163162_10065959 | |||
| 1427 | Ga0163162_10814754 | |||
| 1428 | Ga0163162_11240239 | |||
| 1429 | Ga0163162_11256044 | |||
| 1430 | Ga0163162_11336558 | |||
| 1431 | Ga0163162_11845107 | |||
| 1432 | Ga0157372_10026953 | |||
| 1433 | Ga0157372_10069390 | |||
| 1434 | Ga0157372_10118609 | |||
| 1435 | Ga0157372_10194284 | |||
| 1436 | Ga0157372_10879583 | |||
| 1437 | Ga0157372_11445556 | |||
| 1438 | Ga0157375_12513516 | |||
| 1439 | Ga0157375_12610828 | |||
| 1440 | Ga0163163_11045620 | |||
| 1441 | Ga0157380_10419982 | |||
| 1442 | Ga0157380_12027684 | |||
| 1443 | Ga0157380_13020417 | |||
| 1444 | Ga0182008_10147420 | |||
| 1445 | Ga0182008_10307738 | |||
| 1446 | Ga0157379_10103451 | |||
| 1447 | Ga0157379_10164180 | |||
| 1448 | Ga0163161_10001762 | |||
| 1449 | Ga0163161_10236398 | |||
| 1450 | Ga0163161_10420818 | |||
| 1451 | Ga0163161_11570665 | |||
| 1452 | Ga0206356_10328308 | |||
| 1453 | Ga0206352_10656295 | |||
| 1454 | Ga0213876_10176276 | |||
| 1455 | Ga0207672_1014332 | |||
| 1456 | Ga0209233_1000104 | |||
| 1457 | Ga0209455_1059436 | |||
| 1458 | Ga0207673_1010721 | |||
| 1459 | Ga0209675_1000082 | |||
| 1460 | Ga0209676_1000424 | |||
| 1461 | Ga0209676_1000567 | |||
| 1462 | Ga0209676_1000670 | |||
| 1463 | Ga0209025_1013258 | |||
| 1464 | Ga0209050_1000017 | |||
| 1465 | Ga0209050_1015992 | |||
| 1466 | Ga0209050_1033183 | |||
| 1467 | Ga0209257_1000151 | |||
| 1468 | Ga0209257_1000202 | |||
| 1469 | Ga0209257_1014543 | |||
| 1470 | Ga0207697_10010597 | |||
| 1471 | Ga0207697_10035408 | |||
| 1472 | Ga0207697_10197006 | |||
| 1473 | Ga0207697_10279311 | |||
| 1474 | Ga0207656_10012272 | |||
| 1475 | Ga0207696_1007265 | |||
| 1476 | Ga0207713_1010142 | |||
| 1477 | Ga0207713_1053960 | |||
| 1478 | Ga0207710_10444116 | |||
| 1479 | Ga0207688_10153841 | |||
| 1480 | Ga0207680_10104003 | |||
| 1481 | Ga0207680_10140902 | |||
| 1482 | Ga0207680_10181472 | |||
| 1483 | Ga0207647_10065904 | |||
| 1484 | Ga0207647_10103590 | |||
| 1485 | Ga0207647_10498365 | |||
| 1486 | Ga0207705_10000004 | |||
| 1487 | Ga0207705_10000101 | |||
| 1488 | Ga0207705_10005310 | |||
| 1489 | Ga0207705_10032428 | |||
| 1490 | Ga0207705_10038874 | |||
| 1491 | Ga0207705_10097229 | |||
| 1492 | Ga0207705_10128666 | |||
| 1493 | Ga0207705_10142233 | |||
| 1494 | Ga0207705_10299322 | |||
| 1495 | Ga0207705_10347589 | |||
| 1496 | Ga0207705_10421385 | |||
| 1497 | Ga0207705_10925174 | |||
| 1498 | Ga0207654_10546964 | |||
| 1499 | Ga0207707_10076073 | |||
| 1500 | Ga0207707_10223926 | |||
| 1501 | Ga0207707_10438375 | |||
| 1502 | Ga0207707_10575695 | |||
| 1503 | Ga0207707_11330494 | |||
| 1504 | Ga0207695_10018947 | |||
| 1505 | Ga0207695_10106455 | |||
| 1506 | Ga0207660_10045514 | |||
| 1507 | Ga0207660_10063096 | |||
| 1508 | Ga0207662_10472288 | |||
| 1509 | Ga0207662_10763019 | |||
| 1510 | Ga0207662_10820166 | |||
| 1511 | Ga0207657_10000408 | |||
| 1512 | Ga0207657_10012539 | |||
| 1513 | Ga0207657_10026870 | |||
| 1514 | Ga0207657_10040078 | |||
| 1515 | Ga0207657_10048949 | |||
| 1516 | Ga0207657_10052113 | |||
| 1517 | Ga0207657_10071057 | |||
| 1518 | Ga0207657_10261261 | |||
| 1519 | Ga0207649_10003307 | |||
| 1520 | Ga0207649_10024515 | |||
| 1521 | Ga0207649_10158761 | |||
| 1522 | Ga0207652_10031309 | |||
| 1523 | Ga0207652_10063222 | |||
| 1524 | Ga0207652_10134787 | |||
| 1525 | Ga0207652_10139747 | |||
| 1526 | Ga0207652_10253453 | |||
| 1527 | Ga0207652_10365535 | |||
| 1528 | Ga0207652_10784934 | |||
| 1529 | Ga0207681_10000109 | |||
| 1530 | Ga0207681_10002968 | |||
| 1531 | Ga0207681_10009596 | |||
| 1532 | Ga0207681_10478058 | |||
| 1533 | Ga0207681_11218265 | |||
| 1534 | Ga0207681_11290750 | |||
| 1535 | Ga0207694_10077123 | |||
| 1536 | Ga0207694_10226894 | |||
| 1537 | Ga0207694_10236267 | |||
| 1538 | Ga0207694_10585392 | |||
| 1539 | Ga0207650_10126255 | |||
| 1540 | Ga0207650_10174974 | |||
| 1541 | Ga0207650_10381342 | |||
| 1542 | Ga0207650_10853930 | |||
| 1543 | Ga0207650_11317486 | |||
| 1544 | Ga0207650_11880296 | |||
| 1545 | Ga0207687_10010076 | |||
| 1546 | Ga0207664_10224251 | |||
| 1547 | Ga0207644_10000012 | |||
| 1548 | Ga0207644_10000191 | |||
| 1549 | Ga0207644_10022749 | |||
| 1550 | Ga0207644_10076366 | |||
| 1551 | Ga0207644_10348981 | |||
| 1552 | Ga0207644_10649711 | |||
| 1553 | Ga0207644_11159527 | |||
| 1554 | Ga0207690_10008011 | |||
| 1555 | Ga0207690_10021761 | |||
| 1556 | Ga0207690_10242687 | |||
| 1557 | Ga0207690_10349896 | |||
| 1558 | Ga0207690_10393138 | |||
| 1559 | Ga0207690_10492626 | |||
| 1560 | Ga0207690_11806889 | |||
| 1561 | Ga0207706_10008254 | |||
| 1562 | Ga0207706_10033279 | |||
| 1563 | Ga0207706_10076637 | |||
| 1564 | Ga0207706_10211000 | |||
| 1565 | Ga0207706_10292525 | |||
| 1566 | Ga0207706_10398949 | |||
| 1567 | Ga0207709_10088718 | |||
| 1568 | Ga0207709_10365053 | |||
| 1569 | Ga0207709_10413443 | |||
| 1570 | Ga0207670_10243061 | |||
| 1571 | Ga0207669_10156416 | |||
| 1572 | Ga0207704_10841359 | |||
| 1573 | Ga0207704_11156110 | |||
| 1574 | Ga0207691_10181467 | |||
| 1575 | Ga0207711_10000852 | |||
| 1576 | Ga0207711_10020403 | |||
| 1577 | Ga0207711_10086344 | |||
| 1578 | Ga0207711_10104536 | |||
| 1579 | Ga0207711_10383571 | |||
| 1580 | Ga0207711_10498269 | |||
| 1581 | Ga0207711_10833452 | |||
| 1582 | Ga0207711_11370931 | |||
| 1583 | Ga0207689_10336795 | |||
| 1584 | Ga0207661_10039869 | |||
| 1585 | Ga0207661_10453662 | |||
| 1586 | Ga0207661_11174662 | |||
| 1587 | Ga0207679_10004188 | |||
| 1588 | Ga0207679_10017162 | |||
| 1589 | Ga0207679_10255223 | |||
| 1590 | Ga0207679_10561348 | |||
| 1591 | Ga0207667_10003563 | |||
| 1592 | Ga0207667_10005019 | |||
| 1593 | Ga0207667_10016908 | |||
| 1594 | Ga0207667_10038338 | |||
| 1595 | Ga0207667_10070651 | |||
| 1596 | Ga0207667_10078696 | |||
| 1597 | Ga0207667_10098261 | |||
| 1598 | Ga0207667_10112317 | |||
| 1599 | Ga0207667_10748010 | |||
| 1600 | Ga0207712_10057696 | |||
| 1601 | Ga0207712_10092123 | |||
| 1602 | Ga0207712_10358131 | |||
| 1603 | Ga0207712_10657564 | |||
| 1604 | Ga0207712_11861207 | |||
| 1605 | Ga0207668_10000304 | |||
| 1606 | Ga0207668_10083673 | |||
| 1607 | Ga0207668_10105153 | |||
| 1608 | Ga0207668_10115951 | |||
| 1609 | Ga0207668_10180046 | |||
| 1610 | Ga0207668_10328540 | |||
| 1611 | Ga0207668_10819854 | |||
| 1612 | Ga0207668_11892319 | |||
| 1613 | Ga0207640_10000508 | |||
| 1614 | Ga0207640_10077559 | |||
| 1615 | Ga0207640_10080263 | |||
| 1616 | Ga0207640_10093030 | |||
| 1617 | Ga0207640_10627768 | |||
| 1618 | Ga0207640_12027889 | |||
| 1619 | Ga0207658_10000344 | |||
| 1620 | Ga0207658_10001008 | |||
| 1621 | Ga0207658_10001566 | |||
| 1622 | Ga0207658_10008713 | |||
| 1623 | Ga0207658_11113228 | |||
| 1624 | Ga0207658_11372109 | |||
| 1625 | Ga0207703_10000244 | |||
| 1626 | Ga0207703_10000775 | |||
| 1627 | Ga0207703_10004946 | |||
| 1628 | Ga0207703_10027481 | |||
| 1629 | Ga0207703_10029046 | |||
| 1630 | Ga0207703_10052344 | |||
| 1631 | Ga0207639_10000771 | |||
| 1632 | Ga0207639_10124943 | |||
| 1633 | Ga0207639_10270861 | |||
| 1634 | Ga0207639_10914052 | |||
| 1635 | Ga0207639_10977047 | |||
| 1636 | Ga0207639_11211883 | |||
| 1637 | Ga0207639_11376593 | |||
| 1638 | Ga0207678_10004771 | |||
| 1639 | Ga0207678_10020075 | |||
| 1640 | Ga0207678_10022461 | |||
| 1641 | Ga0207678_10029324 | |||
| 1642 | Ga0207678_10046385 | |||
| 1643 | Ga0207678_10450446 | |||
| 1644 | Ga0207702_10012315 | |||
| 1645 | Ga0207702_10147935 | |||
| 1646 | Ga0207702_10271381 | |||
| 1647 | Ga0207702_10415455 | |||
| 1648 | Ga0207641_10000001 | |||
| 1649 | Ga0207641_10000733 | |||
| 1650 | Ga0207641_10066769 | |||
| 1651 | Ga0207641_10075989 | |||
| 1652 | Ga0207641_10202140 | |||
| 1653 | Ga0207648_10522443 | |||
| 1654 | Ga0207676_10002656 | |||
| 1655 | Ga0207676_10003409 | |||
| 1656 | Ga0207676_10185065 | |||
| 1657 | Ga0207676_11758449 | |||
| 1658 | Ga0207676_12238743 | |||
| 1659 | Ga0207674_10008322 | |||
| 1660 | Ga0207674_10015484 | |||
| 1661 | Ga0207674_10017301 | |||
| 1662 | Ga0207674_10098726 | |||
| 1663 | Ga0207674_10894032 | |||
| 1664 | Ga0207674_10895518 | |||
| 1665 | Ga0207674_11037951 | |||
| 1666 | Ga0207674_11384357 | |||
| 1667 | Ga0207675_100000196 | |||
| 1668 | Ga0207675_100575285 | |||
| 1669 | Ga0207698_10000058 | |||
| 1670 | Ga0207698_10099316 | |||
| 1671 | Ga0207698_10729225 | |||
| 1672 | Ga0207698_10864109 | |||
| 1673 | Ga0207698_11099152 | |||
| 1674 | Ga0207698_12320571 | |||
| 1675 | Ga0209281_1071516 | |||
| 1676 | Ga0209983_1096238 | |||
| 1677 | Ga0209813_10000051 | |||
| 1678 | Ga0209813_10001612 | |||
| 1679 | Ga0209974_10006613 | |||
| 1680 | Ga0209974_10008683 | |||
| 1681 | Ga0209974_10347866 | |||
| 1682 | Ga0268266_10002003 | |||
| 1683 | Ga0268266_10005024 | |||
| 1684 | Ga0268266_10006189 | |||
| 1685 | Ga0268266_10124658 | |||
| 1686 | Ga0268266_10158947 | |||
| 1687 | Ga0268265_10017233 | |||
| 1688 | Ga0268265_10070317 | |||
| 1689 | Ga0268265_10129908 | |||
| 1690 | Ga0268265_10146980 | |||
| 1691 | Ga0268265_10243981 | |||
| 1692 | Ga0268265_10387566 | |||
| 1693 | Ga0268265_10984873 | |||
| 1694 | Ga0268265_12105585 | |||
| 1695 | Ga0268264_10000040 | |||
| 1696 | Ga0268264_10004259 | |||
| 1697 | Ga0268264_10007794 | |||
| 1698 | Ga0268264_10012572 | |||
| 1699 | Ga0268264_10290110 | |||
| 1700 | Ga0307515_10596048 | |||
| 1701 | Ga0265331_10081417 | |||
| 1702 | Ga0307408_100036575 | |||
| 1703 | Ga0307408_100189378 | |||
| 1704 | Ga0307408_100266195 | |||
| 1705 | Ga0307408_100631195 | |||
| 1706 | Ga0307408_101090399 | |||
| 1707 | Ga0307508_10000231 | |||
| 1708 | Ga0307405_10015706 | |||
| 1709 | Ga0307405_10046408 | |||
| 1710 | Ga0307405_10111192 | |||
| 1711 | Ga0307405_10179072 | |||
| 1712 | Ga0307405_10420225 | |||
| 1713 | Ga0307405_10422638 | |||
| 1714 | Ga0307405_10549733 | |||
| 1715 | Ga0307405_10554500 | |||
| 1716 | Ga0307405_10868865 | |||
| 1717 | Ga0307405_11199702 | |||
| 1718 | Ga0307405_11987736 | |||
| 1719 | Ga0307405_12083234 | |||
| 1720 | Ga0316577_10488641 | |||
| 1721 | Ga0307413_10008092 | |||
| 1722 | Ga0307413_10095332 | |||
| 1723 | Ga0307413_10111184 | |||
| 1724 | Ga0307413_10116974 | |||
| 1725 | Ga0307413_10378532 | |||
| 1726 | Ga0307413_10419605 | |||
| 1727 | Ga0307413_10513941 | |||
| 1728 | Ga0307413_10663468 | |||
| 1729 | Ga0307413_11247714 | |||
| 1730 | Ga0307413_11749671 | |||
| 1731 | Ga0307410_10032218 | |||
| 1732 | Ga0307410_10127384 | |||
| 1733 | Ga0307410_10129375 | |||
| 1734 | Ga0307410_10131184 | |||
| 1735 | Ga0307410_10137046 | |||
| 1736 | Ga0307410_10180454 | |||
| 1737 | Ga0307410_10407750 | |||
| 1738 | Ga0307410_10572941 | |||
| 1739 | Ga0307410_10930431 | |||
| 1740 | Ga0307410_11223504 | |||
| 1741 | Ga0307410_11401924 | |||
| 1742 | Ga0307406_10033738 | |||
| 1743 | Ga0307406_10091044 | |||
| 1744 | Ga0307406_10271518 | |||
| 1745 | Ga0307406_10313769 | |||
| 1746 | Ga0307406_10350397 | |||
| 1747 | Ga0307406_11715690 | |||
| 1748 | Ga0307406_11945942 | |||
| 1749 | Ga0307407_10054827 | |||
| 1750 | Ga0307407_10087998 | |||
| 1751 | Ga0307407_10194064 | |||
| 1752 | Ga0307407_10227621 | |||
| 1753 | Ga0307407_10604107 | |||
| 1754 | Ga0307407_10811828 | |||
| 1755 | Ga0307407_10922904 | |||
| 1756 | Ga0307412_10001165 | |||
| 1757 | Ga0307412_10015626 | |||
| 1758 | Ga0307412_10125238 | |||
| 1759 | Ga0307412_10135773 | |||
| 1760 | Ga0307412_10153714 | |||
| 1761 | Ga0307412_10202251 | |||
| 1762 | Ga0307412_10426873 | |||
| 1763 | Ga0307412_10820651 | |||
| 1764 | Ga0307412_10955735 | |||
| 1765 | Ga0307412_11271016 | |||
| 1766 | Ga0307409_100095312 | |||
| 1767 | Ga0307409_100117196 | |||
| 1768 | Ga0307409_100149115 | |||
| 1769 | Ga0307409_100332388 | |||
| 1770 | Ga0307409_100342934 | |||
| 1771 | Ga0307409_100435543 | |||
| 1772 | Ga0307409_100461811 | |||
| 1773 | Ga0307409_100485830 | |||
| 1774 | Ga0307409_100594830 | |||
| 1775 | Ga0307409_100674330 | |||
| 1776 | Ga0307409_101883139 | |||
| 1777 | Ga0307409_102048642 | |||
| 1778 | Ga0307416_100040940 | |||
| 1779 | Ga0307416_100153329 | |||
| 1780 | Ga0307416_100168294 | |||
| 1781 | Ga0307416_100175956 | |||
| 1782 | Ga0307416_100204887 | |||
| 1783 | Ga0307416_100376208 | |||
| 1784 | Ga0307416_100380462 | |||
| 1785 | Ga0307416_100482992 | |||
| 1786 | Ga0307416_100658642 | |||
| 1787 | Ga0307416_100741865 | |||
| 1788 | Ga0307416_101023308 | |||
| 1789 | Ga0307416_101514386 | |||
| 1790 | Ga0307416_101638397 | |||
| 1791 | Ga0307416_103152627 | |||
| 1792 | Ga0307414_10000090 | |||
| 1793 | Ga0307414_10000343 | |||
| 1794 | Ga0307414_10002814 | |||
| 1795 | Ga0307414_10009210 | |||
| 1796 | Ga0307414_10029163 | |||
| 1797 | Ga0307414_10037198 | |||
| 1798 | Ga0307414_10092078 | |||
| 1799 | Ga0307414_10107005 | |||
| 1800 | Ga0307414_10165350 | |||
| 1801 | Ga0307414_10214200 | |||
| 1802 | Ga0307414_10456215 | |||
| 1803 | Ga0307414_10618279 | |||
| 1804 | Ga0307414_10638625 | |||
| 1805 | Ga0307414_11791120 | |||
| 1806 | Ga0307411_10029935 | |||
| 1807 | Ga0307411_10049558 | |||
| 1808 | Ga0307411_10089366 | |||
| 1809 | Ga0307411_10098320 | |||
| 1810 | Ga0307411_10318724 | |||
| 1811 | Ga0307411_10342784 | |||
| 1812 | Ga0307411_10394801 | |||
| 1813 | Ga0307411_10559042 | |||
| 1814 | Ga0307411_10594900 | |||
| 1815 | Ga0307411_10894142 | |||
| 1816 | Ga0307411_11094600 | |||
| 1817 | Ga0307411_11096189 | |||
| 1818 | Ga0307411_11120777 | |||
| 1819 | Ga0307415_100021335 | |||
| 1820 | Ga0307415_100060290 | |||
| 1821 | Ga0307415_100251349 | |||
| 1822 | Ga0307415_100308804 | |||
| 1823 | Ga0307415_100310477 | |||
| 1824 | Ga0307415_100434342 | |||
| 1825 | Ga0307415_100487062 | |||
| 1826 | Ga0307415_101374269 | |||
| 1827 | Ga0307415_101554950 | |||
| 1828 | Ga0316583_10017344 | |||
| 1829 | Ga0307510_10148726 | |||
| 1830 | Ga0316582_0123061 | |||
| 1831 | Ga0316584_0322947 | |||
| 1832 | Ga0395899_0021460 | |||
| 1833 | Ga0395899_0037336 | |||
| 1834 | Ga0395899_0044654 | |||
| 1835 | Ga0395900_0003576 | |||
| 1836 | Ga0395900_0065379 | |||
| 1837 | Ga0395900_0227501 | |||
| 1838 | Ga0395900_0285305 | |||
| 1839 | Ga0395900_0338178 | |||
| 1840 | Ga0395900_0914872 | |||
| 1841 | Ga0395898_0006820 | |||
| 1842 | Ga0395898_0029920 | |||
| 1843 | Ga0395898_0174873 | |||
| 1844 | Ga0395905_0020072 | |||
| 1845 | Ga0395905_0089111 | |||
| 1846 | Ga0395905_0127455 | |||
| 1847 | Ga0395905_0183179 | |||
| 1848 | Ga0395905_0592616 | |||
| 1849 | Ga0395905_1115582 | |||
| 1850 | Ga0395901_0023315 | |||
| 1851 | Ga0395901_0024563 | |||
| 1852 | Ga0395901_0037956 | |||
| 1853 | Ga0395901_0053668 | |||
| 1854 | Ga0395901_0306549 | |||
| 1855 | Ga0395901_0530584 | |||
| 1856 | Ga0237819_00646 | |||
| 1857 | Ga0237816_01651 | |||
| 1858 | Ga0436365_0212007 | |||
| 1859 | Ga0436365_0321020 | |||
| 1860 | Ga0451789_0091044 | |||
| 1861 | Ga0451795_0301848 | |||
| 1862 | Ga0451804_0326837 | |||
| 1863 | Ga0451807_0971417 | |||
| 1864 | Ga0451833_1322386 | |||
| 1865 | Ga0451845_0301951 | |||
| 1866 | Ga0451851_1209629 | |||
| 1867 | Ga0451855_1343931 | |||
| 1868 | Ga0439448_0001939 | |||
| 1869 | Ga0439448_0002459 | |||
| 1870 | Ga0439448_0012547 | |||
| 1871 | Ga0439452_070674 | |||
| 1872 | Ga0439455_0001428 | |||
| 1873 | Ga0439455_0003870 | |||
| 1874 | Ga0450915_020857 | |||
| 1875 | Ga0450907_038417 | |||
| 1876 | Ga0439458_0000137 | |||
| 1877 | Ga0439459_0102785 | |||
| 1878 | Ga0466969_0020897 | |||
| 1879 | Ga0466969_0057629 | |||
| 1880 | Ga0466972_0000826 | |||
| 1881 | Ga0466965_0775357 | |||
| 1882 | Ga0466966_0000740 | |||
| 1883 | Ga0466966_0002854 | |||
| 1884 | Ga0466966_0010964 | |||
| 1885 | Ga0466966_0502502 | |||
| 1886 | Ga0466961_0008230 | |||
| 1887 | Ga0466961_0463072 | |||
| 1888 | Ga0466963_0020310 | |||
| 1889 | Ga0466963_0100484 | |||
| 1890 | Ga0466964_0000258 | |||
| 1891 | Ga0466971_0005161 | |||
| 1892 | Ga0466968_0285448 | |||
| 1893 | Ga0466970_0001595 | |||
| 1894 | Ga0466970_0010990 | |||
| 1895 | Ga0466970_0055342 | |||
| 1896 | Ga0466970_0319151 | |||
| 1897 | Ga0466957_0000272 | |||
| 1898 | Ga0466957_0326232 | |||
| 1899 | Ga0466960_0004100 | |||
| 1900 | Ga0466960_0181762 | |||
| 1901 | Ga0466960_0617589 | |||
| 1902 | Ga0466959_0125671 | |||
| 1903 | Ga0466959_0310885 | |||
| 1904 | Ga0466959_0330778 | |||
| 1905 | Ga0451576_0394264 | |||
| 1906 | Ga0466958_0000445 | |||
| 1907 | Ga0466958_0350118 | |||
| 1908 | Ga0466958_0536346 | |||
| 1909 | Ga0466967_0206551 | |||
| 1910 | Ga0495627_000090 | |||
| 1911 | Ga0495638_0000758 | |||
| 1912 | Ga0495638_0042982 | |||
| 1913 | Ga0495638_0076777 | |||
| 1914 | Ga0495650_0000818 | |||
| 1915 | Ga0495605_0087182 | |||
| 1916 | Ga0495585_0402340 | |||
| 1917 | Ga0495596_0000220 | |||
| 1918 | Ga0495607_0031559 | |||
| 1919 | Ga0495607_0093490 | |||
| 1920 | Ga0495583_0000218 | |||
| 1921 | Ga0495583_0030064 | |||
| 1922 | Ga0495606_0026454 | |||
| 1923 | Ga0495610_0000015 | |||
| 1924 | Ga0495610_0000604 | |||
| 1925 | Ga0495610_0144969 | |||
| 1926 | Ga0495610_0203141 | |||
| 1927 | Ga0495620_0007587 | |||
| 1928 | Ga0495643_0000023 | |||
| 1929 | Ga0495643_0011542 | |||
| 1930 | Ga0495643_0040178 | |||
| 1931 | Ga0495643_0045408 | |||
| 1932 | Ga0495663_0018920 | |||
| 1933 | Ga0495654_0086760 | |||
| 1934 | Ga0495598_0000471 | |||
| 1935 | Ga0495609_0007605 | |||
| 1936 | Ga0495621_0000475 | |||
| 1937 | Ga0495597_0090244 | |||
| 1938 | Ga0495622_0052737 | |||
| 1939 | Ga0495633_0016335 | |||
| 1940 | Ga0495633_0126799 | |||
| 1941 | Ga0495668_0000031 | |||
| 1942 | Ga0495668_0006416 | |||
| 1943 | Ga0495668_0171660 | |||
| 1944 | Ga0495625_0000115 | |||
| 1945 | Ga0495625_0001717 | |||
| 1946 | Ga0495625_0045065 | |||
| 1947 | Ga0495625_0051483 | |||
| 1948 | Ga0495625_0269902 | |||
| 1949 | Ga0495669_0002223 | |||
| 1950 | Ga0495670_0000002 | |||
| 1951 | Ga0495670_0006264 | |||
| 1952 | Ga0495670_0010027 | |||
| 1953 | Ga0495670_0058113 | |||
| 1954 | Ga0495671_0298136 | |||
| 1955 | Ga0495671_0375704 | |||
| 1956 | Ga0495683_0201635 | |||
| 1957 | Ga0495687_145671 | |||
| 1958 | Ga0495677_0045073 | |||
| 1959 | Ga0495673_0011196 | |||
| 1960 | Ga0495681_0000048 | |||
| 1961 | Ga0495681_0113368 | |||
| 1962 | Ga0495686_0029938 | |||
| 1963 | Ga0495686_0069949 | |||
| 1964 | Ga0495686_0356930 | |||
| 1965 | Ga0496101_0070957 | |||
| 1966 | Ga0496101_0138327 | |||
| 1967 | Ga0496101_1212027 | |||
| 1968 | Ga0496102_0000615 | |||
| 1969 | Ga0496102_0023742 | |||
| 1970 | Ga0496102_0366878 | |||
| 1971 | Ga0496102_1210665 | |||
| 1972 | Ga0496102_1587739 | |||
| 1973 | Ga0496103_0009010 | |||
| 1974 | Ga0496103_0009373 | |||
| 1975 | Ga0496103_0075504 | |||
| 1976 | Ga0496104_0000081 | |||
| 1977 | Ga0496104_0041285 | |||
| 1978 | Ga0496104_0050407 | |||
| 1979 | Ga0496104_0182830 | |||
| 1980 | Ga0496105_0000034 | |||
| 1981 | Ga0496105_0000870 | |||
| 1982 | Ga0496105_0181294 | |||
| 1983 | Ga0496107_0025431 | |||
| 1984 | Ga0496108_0094660 | |||
| 1985 | Ga0496108_0193191 | |||
| 1986 | Ga0496109_0168001 | |||
| 1987 | Ga0496109_0539887 | |||
| 1988 | Ga0496109_1345838 | |||
| 1989 | Ga0496110_0140371 | |||
| 1990 | Ga0496110_0633428 | |||
| 1991 | Ga0496110_0744136 | |||
| 1992 | Ga0496111_0147028 | |||
| 1993 | Ga0496111_0176913 | |||
| 1994 | Ga0496111_0992402 | |||
| 1995 | Ga0496112_0116278 | |||
| 1996 | Ga0496112_0219258 | |||
| 1997 | Ga0496112_0979400 | |||
| 1998 | Ga0496113_0000101 | |||
| 1999 | Ga0496113_0006116 | |||
| 2000 | Ga0496113_0385385 | |||
| 2001 | Ga0496113_1267349 | |||
| 2002 | Ga0496114_0023435 | |||
| 2003 | Ga0496115_0108956 | |||
| 2004 | Ga0496115_0280671 | |||
| 2005 | Ga0496116_0077129 | |||
| 2006 | Ga0496116_0101176 | |||
| 2007 | Ga0496117_0000146 | |||
| 2008 | Ga0496117_0067828 | |||
| 2009 | Ga0496117_0312713 | |||
| 2010 | Ga0496117_0471181 | |||
| 2011 | Ga0496118_0015425 | |||
| 2012 | Ga0496118_0081041 | |||
| 2013 | Ga0496118_0109131 | |||
| 2014 | Ga0496119_0000057 | |||
| 2015 | Ga0496119_0003988 | |||
| 2016 | Ga0496120_0005360 | |||
| 2017 | Ga0496120_0020958 | |||
| 2018 | Ga0496120_0171194 | |||
| 2019 | Ga0496120_0185785 | |||
| 2020 | Ga0496121_0000196 | |||
| 2021 | Ga0496121_0006053 | |||
| 2022 | Ga0496121_0017016 | |||
| 2023 | Ga0496122_0000723 | |||
| 2024 | Ga0496122_0286403 | |||
| 2025 | Ga0496123_0002968 | |||
| 2026 | Ga0496123_0116075 | |||
| 2027 | Ga0496124_0000874 | |||
| 2028 | Ga0496124_0023588 | |||
| 2029 | Ga0496124_0476023 | |||
| 2030 | Ga0496124_0507938 | |||
| 2031 | Ga0496125_0002465 | |||
| 2032 | Ga0496125_0091131 | |||
| 2033 | Ga0496126_0000028 | |||
| 2034 | Ga0496126_0027682 | |||
| 2035 | Ga0496126_0137560 | |||
| 2036 | Ga0501296_087318 | |||
| 2037 | Ga0501314_003183 | |||
| 2038 | Ga0501337_019737 | |||
| 2039 | Ga0501032_0706763 | |||
| 2040 | Ga0501032_0770248 | |||
| 2041 | Ga0501033_0214787 | |||
| 2042 | Ga0501034_0071253 | |||
| 2043 | Ga0501034_0420947 | |||
| 2044 | Ga0501036_0133161 | |||
| 2045 | Ga0501071_0207474 | |||
| 2046 | Ga0501074_0347840 | |||
| 2047 | Ga0501217_052350 | |||
| 2048 | Ga0501223_000342 | |||
| 2049 | Ga0501224_000033 | |||
| 2050 | Ga0501233_000413 | |||
| 2051 | Ga0501233_145843 | |||
| 2052 | Ga0501235_003998 | |||
| 2053 | Ga0501247_034768 | |||
| 2054 | Ga0501249_122167 | |||
| 2055 | Ga0501225_0000097 | |||
| 2056 | Ga0501225_0080312 | |||
| 2057 | Ga0501225_0114646 | |||
| 2058 | Ga0501234_002770 | |||
| 2059 | Ga0501080_0282719 | |||
| 2060 | Ga0501080_0610107 | |||
| 2061 | Ga0501241_014967 | |||
| 2062 | Ga0501268_007953 | |||
| 2063 | Ga0501270_065210 | |||
| 2064 | Ga0501273_002915 | |||
| 2065 | Ga0501044_0339672 | |||
| 2066 | Ga0501044_0422819 | |||
| 2067 | Ga0501044_0595752 | |||
| 2068 | Ga0501044_0659534 | |||
| 2069 | Ga0501226_000056 | |||
| 2070 | nmdc:mga03683_344_c1 | |||
| 2071 | nmdc:mga03683_409990_c1 | |||
| 2072 | nmdc:mga03683_73463_c1 | |||
| 2073 | nmdc:mga03n38_22087_c1 | |||
| 2074 | nmdc:mga03n38_418364_c1 | |||
| 2075 | nmdc:mga00v17_25514_c1 | |||
| 2076 | nmdc:mga00v17_75476_c1 | |||
| 2077 | nmdc:mga0k408_344198_c1 | |||
| 2078 | nmdc:mga0k408_484340_c1 | |||
| 2079 | nmdc:mga0k408_9833_c1 | |||
| 2080 | nmdc:mga06z11_17_c1 | |||
| 2081 | nmdc:mga04h51_146_c1 | |||
| 2082 | nmdc:mga04h51_284722_c1 | |||
| 2083 | nmdc:mga04h51_3829_c1 | |||
| 2084 | nmdc:mga07m45_111328_c1 | |||
| 2085 | nmdc:mga07m45_189975_c1 | |||
| 2086 | nmdc:mga07m45_24809_c1 | |||
| 2087 | nmdc:mga07m45_4_c1 | |||
| 2088 | nmdc:mga07m45_60295_c1 | |||
| 2089 | nmdc:mga07m45_65525_c1 | |||
| 2090 | nmdc:mga0sz30_149231_c1 | |||
| 2091 | nmdc:mga0sz30_31307_c1 | |||
| 2092 | nmdc:mga0sz30_46_c1 | |||
| 2093 | Ga0500643_000004 | |||
| 2094 | Ga0500643_000783 | |||
| 2095 | Ga0500643_025387 | |||
| 2096 | Ga0500643_034160 | |||
| 2097 | Ga0500643_083586 | |||
| 2098 | Ga0500647_0021734 | |||
| 2099 | Ga0500566_0294819 | |||
| 2100 | Ga0500641_0073291 | |||
| 2101 | Ga0500555_000575 | |||
| 2102 | Ga0500555_184163 | |||
| 2103 | Ga0500556_0000222 | |||
| 2104 | Ga0500557_124997 | |||
| 2105 | Ga0500562_012822 | |||
| 2106 | Ga0500562_096187 | |||
| 2107 | Ga0500594_0008135 | |||
| 2108 | Ga0500595_000572 | |||
| 2109 | Ga0500595_095238 | |||
| 2110 | Ga0500607_000055 | |||
| 2111 | Ga0500607_000844 | |||
| 2112 | Ga0500607_184589 | |||
| 2113 | Ga0500608_001074 | |||
| 2114 | Ga0500608_007769 | |||
| 2115 | Ga0500614_053067 | |||
| 2116 | Ga0500614_155718 | |||
| 2117 | Ga0500618_033483 | |||
| 2118 | Ga0500618_120739 | |||
| 2119 | Ga0500642_0000011 | |||
| 2120 | Ga0500642_0121939 | |||
| 2121 | Ga0500559_0003805 | |||
| 2122 | Ga0500559_0156387 | |||
| 2123 | Ga0500564_001322 | |||
| 2124 | Ga0500568_0006166 | |||
| 2125 | Ga0500568_0229107 | |||
| 2126 | Ga0500573_0000114 | |||
| 2127 | Ga0500590_011655 | |||
| 2128 | Ga0500616_0006078 | |||
| 2129 | Ga0500616_0142733 | |||
| 2130 | Ga0500622_0001994 | |||
| 2131 | Ga0500622_0077848 | |||
| 2132 | Ga0500622_0162940 | |||
| 2133 | Ga0500622_0264177 | |||
| 2134 | Ga0500627_0506062 | |||
| 2135 | Ga0500636_0180881 | |||
| 2136 | Ga0500567_000074 | |||
| 2137 | Ga0500625_000002 | |||
| 2138 | Ga0500645_000417 | |||
| 2139 | Ga0500645_004197 | |||
| 2140 | Ga0500645_006930 | |||
| 2141 | Ga0590075_118063 | |||
| 2142 | Ga0587070_107679 | |||
| 2143 | Ga0587085_013648 | |||
| 2144 | Ga0587085_032596 | |||
| 2145 | Ga0587062_008373 | |||
| 2146 | Ga0466962_0002892 | |||
| 2147 | 2511130324 | |||
| 2148 | 2643819656 | |||
| 2149 | 2739651864 | |||
| 2150 | 2740030338 | |||
| 2151 | 2778125106 | |||
| 2152 | 2830076934 | |||
| 2153 | 2852654519 | |||
| 2154 | 2852684014 | |||
| 2155 | 2882807015 | |||
| 2156 | 2885427691 | |||
| 2157 | 2895888362 | |||
| 2158 | 2896186911 | |||
| 2159 | 2928030296 | |||
| 2160 | 2946789281 | |||
| 2161 | 2984558873 | |||
| 2162 | 2984566613 | |||
| 2163 | 2990266883 | |||
| 2164 | 2993357809 | |||
| 2165 | 2993693828 | |||
| 2166 | 3000866466 | |||
| 2167 | 8054303053 | |||
| 2168 | 8057101257 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zyw-assembly1.cif.gz_A | crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3) | 0.9666 | 5 | 99 |
| 2wul-assembly1.cif.gz_D | crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster | 0.9646 | 6 | 109 |
| 2mma-assembly1.cif.gz_A | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.9581 | 1 | 99 |
| 2wci-assembly1.cif.gz_A | structure of e. coli monothiol glutaredoxin grx4 homodimer | 0.9512 | 1 | 103 |
| 3gx8-assembly1.cif.gz_A | structural and biochemical characterization of yeast monothiol glutaredoxin grx5 | 0.9492 | 3 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6KSR7_119_214_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9853 | 8 | 99 | 3.40.30.10 |
| 2wemC01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9831 | 9 | 103 | 3.40.30.10 |
| af_Q555C8_40_141_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9797 | 9 | 108 | 3.40.30.10 |
| af_Q4CNA8_28_125_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9776 | 9 | 104 | 3.40.30.10 |
| af_K7UQQ8_80_167_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9767 | 10 | 94 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K0TKX0-F1-model_v4 | Glutaredoxin domain-containing protein | 0.9951 | 2 | 100 |
GO:0005759
GO:0046872 GO:0051537 |
| AF-A0A7S2WSS4-F1-model_v4 | Glutaredoxin domain-containing protein | 0.994 | 2 | 110 |
GO:0005759
GO:0046872 GO:0051537 |
| AF-B8C7D4-F1-model_v4 | Glutaredoxin domain-containing protein | 0.9937 | 2 | 102 |
GO:0005759
GO:0046872 GO:0051537 |
| AF-A0A7R9W3H0-F1-model_v4 | Glutaredoxin domain-containing protein | 0.9929 | 1 | 99 |
GO:0005759
GO:0046872 GO:0051537 |
| AF-A0A1F6GPI9-F1-model_v4 | Glutaredoxin | 0.9925 | 5 | 102 |
GO:0015036
GO:0046872 GO:0051537 |