F489709
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1083 | 497 | 2166 | 97 |
Family's Representative Sequence
| Representative Sequence | 3300005466|Ga0070685_10625062|Ga0070685_106250622 |
| Length | 102 |
| Sequence | MAYLTTFYWGWLLASALLGLAMGWISVVQHGEGVSKNVKRWLAVLAAALVAAALSRTVPGRFGYWLDLGLTMFALYLVGCAIGSWLRDWVVSRSAPALRDLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 104 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 105 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 108 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 219 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 220 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 221 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 228 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 231 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 233 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 234 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 236 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 237 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 238 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 239 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 240 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 241 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 242 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 243 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 245 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 256 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 263 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 271 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 277 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 278 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 279 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 280 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 281 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 282 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 283 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 378 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 379 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 380 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 381 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 382 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 390 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 391 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 392 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 393 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 394 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 395 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 396 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 397 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 398 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 399 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 400 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 418 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 419 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 420 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 421 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 422 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 423 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 424 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 425 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 434 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 436 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 437 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 441 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 442 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 443 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 444 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 445 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 446 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 447 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 448 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 449 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 450 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 451 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 452 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 453 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 454 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 455 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 456 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 457 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 458 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 459 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 460 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 461 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 463 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 464 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 465 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 466 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 467 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 468 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 469 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 470 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 471 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 472 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 473 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 474 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 475 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 476 | 2791355199 | |||
| 477 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 478 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 479 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 480 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 481 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 482 | 2904699407 | |||
| 483 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 484 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 485 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 486 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 487 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 488 | 2922425934 | |||
| 489 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 490 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 491 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 492 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 493 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 494 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 495 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 496 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 497 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.31 |
| Metatranscriptomes | 0 |
| Isolates | 2.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.62 |
| Nodule | 2.68 |
| Rhizoplane | 6.37 |
| Rhizosphere | 74.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070685_10625062 | 3300005466 | Bacteria | 778 |
| 2 | CNAas_1005993 | 3300000532 | Bacteria | 781 |
| 3 | JGI24750J21931_1017621 | 3300002070 | Bacteria | 978 |
| 4 | JGI24748J21848_1033116 | 3300002074 | Unclassified | 643 |
| 5 | JGI25165J46597_1025250 | 3300003214 | Bacteria | 770 |
| 6 | rootH1_10041688 | 3300003323 | Bacteria | 3202 |
| 7 | JGI25404J52841_10017928 | 3300003659 | Bacteria | 1534 |
| 8 | JGI25404J52841_10020963 | 3300003659 | Bacteria | 1415 |
| 9 | Ga0065707_10283436 | 3300005295 | Bacteria | 1042 |
| 10 | Ga0070658_11077041 | 3300005327 | Bacteria | 699 |
| 11 | Ga0070676_10338834 | 3300005328 | Bacteria | 1031 |
| 12 | Ga0070676_10366967 | 3300005328 | Bacteria | 993 |
| 13 | Ga0070676_10500138 | 3300005328 | Bacteria | 863 |
| 14 | Ga0070676_10660764 | 3300005328 | Bacteria | 760 |
| 15 | Ga0070676_11307409 | 3300005328 | Bacteria | 554 |
| 16 | Ga0070683_101567661 | 3300005329 | Bacteria | 633 |
| 17 | Ga0070690_100252562 | 3300005330 | Bacteria | 1248 |
| 18 | Ga0070690_100315078 | 3300005330 | Bacteria | 1126 |
| 19 | Ga0070670_100174228 | 3300005331 | Bacteria | 1867 |
| 20 | Ga0070677_10269195 | 3300005333 | Bacteria | 854 |
| 21 | Ga0068869_100021616 | 3300005334 | Bacteria | 4428 |
| 22 | Ga0068869_100113202 | 3300005334 | Bacteria | 2066 |
| 23 | Ga0068869_100222862 | 3300005334 | Bacteria | 1495 |
| 24 | Ga0070666_10929593 | 3300005335 | Bacteria | 644 |
| 25 | Ga0070666_11067624 | 3300005335 | Bacteria | 600 |
| 26 | Ga0070666_11272161 | 3300005335 | Bacteria | 548 |
| 27 | Ga0070680_100110849 | 3300005336 | Bacteria | 2284 |
| 28 | Ga0070680_100546304 | 3300005336 | Bacteria | 993 |
| 29 | Ga0070680_100912620 | 3300005336 | Bacteria | 758 |
| 30 | Ga0070682_100591629 | 3300005337 | Bacteria | 875 |
| 31 | Ga0068868_100196063 | 3300005338 | Bacteria | 1681 |
| 32 | Ga0068868_100328088 | 3300005338 | Bacteria | 1305 |
| 33 | Ga0068868_101022434 | 3300005338 | Bacteria | 757 |
| 34 | Ga0070660_100187113 | 3300005339 | Bacteria | 1677 |
| 35 | Ga0070689_100087109 | 3300005340 | Bacteria | 2456 |
| 36 | Ga0070691_10378304 | 3300005341 | Bacteria | 793 |
| 37 | Ga0070661_100050478 | 3300005344 | Bacteria | 3044 |
| 38 | Ga0070661_100215826 | 3300005344 | Bacteria | 1470 |
| 39 | Ga0070661_100282157 | 3300005344 | Bacteria | 1289 |
| 40 | Ga0070661_100587028 | 3300005344 | Bacteria | 900 |
| 41 | Ga0070668_100200199 | 3300005347 | Bacteria | 1639 |
| 42 | Ga0070668_100298090 | 3300005347 | Bacteria | 1351 |
| 43 | Ga0070668_100464471 | 3300005347 | Bacteria | 1090 |
| 44 | Ga0070668_100851448 | 3300005347 | Bacteria | 812 |
| 45 | Ga0070668_100969456 | 3300005347 | Bacteria | 763 |
| 46 | Ga0070668_101033448 | 3300005347 | Bacteria | 739 |
| 47 | Ga0070669_100073283 | 3300005353 | Bacteria | 2536 |
| 48 | Ga0070669_100991418 | 3300005353 | Bacteria | 720 |
| 49 | Ga0070675_100079027 | 3300005354 | Bacteria | 2740 |
| 50 | Ga0070675_101034169 | 3300005354 | Bacteria | 754 |
| 51 | Ga0070675_101138317 | 3300005354 | Bacteria | 718 |
| 52 | Ga0070671_100035846 | 3300005355 | Bacteria | 4111 |
| 53 | Ga0070671_100308940 | 3300005355 | Bacteria | 1347 |
| 54 | Ga0070671_101082781 | 3300005355 | Bacteria | 704 |
| 55 | Ga0070674_100028167 | 3300005356 | Bacteria | 3688 |
| 56 | Ga0070674_100074542 | 3300005356 | Bacteria | 2408 |
| 57 | Ga0070674_100233565 | 3300005356 | Bacteria | 1436 |
| 58 | Ga0070674_100592587 | 3300005356 | Bacteria | 935 |
| 59 | Ga0070674_100822513 | 3300005356 | Bacteria | 804 |
| 60 | Ga0070673_100193672 | 3300005364 | Bacteria | 1747 |
| 61 | Ga0070673_102112555 | 3300005364 | Bacteria | 535 |
| 62 | Ga0070688_100242985 | 3300005365 | Bacteria | 1279 |
| 63 | Ga0070688_100741956 | 3300005365 | Bacteria | 764 |
| 64 | Ga0070659_100159893 | 3300005366 | Bacteria | 1841 |
| 65 | Ga0070667_100070033 | 3300005367 | Bacteria | 2985 |
| 66 | Ga0070667_101109350 | 3300005367 | Bacteria | 740 |
| 67 | Ga0070703_10032218 | 3300005406 | Bacteria | 1591 |
| 68 | Ga0070709_10003962 | 3300005434 | Bacteria | 7980 |
| 69 | Ga0070714_100404744 | 3300005435 | Bacteria | 1290 |
| 70 | Ga0070714_101760836 | 3300005435 | Bacteria | 605 |
| 71 | Ga0070713_100031271 | 3300005436 | Bacteria | 4239 |
| 72 | Ga0070713_100461775 | 3300005436 | Bacteria | 1194 |
| 73 | Ga0070710_10003249 | 3300005437 | Bacteria | 7704 |
| 74 | Ga0070701_10179658 | 3300005438 | Bacteria | 1238 |
| 75 | Ga0070701_10890180 | 3300005438 | Bacteria | 614 |
| 76 | Ga0070711_100003683 | 3300005439 | Bacteria | 8971 |
| 77 | Ga0070700_100501649 | 3300005441 | Bacteria | 934 |
| 78 | Ga0070700_100848545 | 3300005441 | Bacteria | 739 |
| 79 | Ga0070694_100031961 | 3300005444 | Bacteria | 3454 |
| 80 | Ga0070694_100483687 | 3300005444 | Bacteria | 983 |
| 81 | Ga0070708_101145333 | 3300005445 | Bacteria | 728 |
| 82 | Ga0070663_100006704 | 3300005455 | Bacteria | 6947 |
| 83 | Ga0070663_100031868 | 3300005455 | Bacteria | 3627 |
| 84 | Ga0070663_100049472 | 3300005455 | Bacteria | 2985 |
| 85 | Ga0070663_100085522 | 3300005455 | Bacteria | 2327 |
| 86 | Ga0070663_100116066 | 3300005455 | Bacteria | 2017 |
| 87 | Ga0070663_100147815 | 3300005455 | Bacteria | 1799 |
| 88 | Ga0070678_100111418 | 3300005456 | Bacteria | 2141 |
| 89 | Ga0070678_100148423 | 3300005456 | Bacteria | 1885 |
| 90 | Ga0070678_100158060 | 3300005456 | Bacteria | 1833 |
| 91 | Ga0070678_100174110 | 3300005456 | Bacteria | 1755 |
| 92 | Ga0070678_100327146 | 3300005456 | Bacteria | 1311 |
| 93 | Ga0070678_100785419 | 3300005456 | Bacteria | 864 |
| 94 | Ga0070678_101207059 | 3300005456 | Bacteria | 701 |
| 95 | Ga0070678_101235620 | 3300005456 | Bacteria | 694 |
| 96 | Ga0070662_100045046 | 3300005457 | Bacteria | 3163 |
| 97 | Ga0070662_100094482 | 3300005457 | Bacteria | 2251 |
| 98 | Ga0070662_100236004 | 3300005457 | Bacteria | 1465 |
| 99 | Ga0070662_100971378 | 3300005457 | Bacteria | 726 |
| 100 | Ga0070681_10046420 | 3300005458 | Bacteria | 4343 |
| 101 | Ga0068867_100305134 | 3300005459 | Bacteria | 1314 |
| 102 | Ga0068867_100737654 | 3300005459 | Bacteria | 873 |
| 103 | Ga0070685_10681621 | 3300005466 | Bacteria | 748 |
| 104 | Ga0070706_101089037 | 3300005467 | Bacteria | 736 |
| 105 | Ga0070698_100047027 | 3300005471 | Bacteria | 4411 |
| 106 | Ga0070699_100213534 | 3300005518 | Bacteria | 1718 |
| 107 | Ga0070679_100163495 | 3300005530 | Bacteria | 2200 |
| 108 | Ga0070679_102081176 | 3300005530 | Bacteria | 517 |
| 109 | Ga0070684_100004411 | 3300005535 | Bacteria | 10711 |
| 110 | Ga0070684_100369687 | 3300005535 | Bacteria | 1320 |
| 111 | Ga0070684_101265692 | 3300005535 | Bacteria | 694 |
| 112 | Ga0070684_101563973 | 3300005535 | Bacteria | 622 |
| 113 | Ga0070697_100098950 | 3300005536 | Bacteria | 2421 |
| 114 | Ga0068853_100058224 | 3300005539 | Bacteria | 3335 |
| 115 | Ga0068853_100127068 | 3300005539 | Bacteria | 2278 |
| 116 | Ga0068853_100784282 | 3300005539 | Bacteria | 912 |
| 117 | Ga0068853_101017455 | 3300005539 | Bacteria | 798 |
| 118 | Ga0068853_101242555 | 3300005539 | Bacteria | 719 |
| 119 | Ga0068853_101487769 | 3300005539 | Bacteria | 656 |
| 120 | Ga0068853_101616627 | 3300005539 | Bacteria | 628 |
| 121 | Ga0070672_100050034 | 3300005543 | Bacteria | 3254 |
| 122 | Ga0070672_100191235 | 3300005543 | Bacteria | 1709 |
| 123 | Ga0070672_101449465 | 3300005543 | Bacteria | 615 |
| 124 | Ga0070686_100448158 | 3300005544 | Bacteria | 992 |
| 125 | Ga0070695_100452034 | 3300005545 | Bacteria | 984 |
| 126 | Ga0070695_100556782 | 3300005545 | Bacteria | 894 |
| 127 | Ga0070696_101114343 | 3300005546 | Bacteria | 664 |
| 128 | Ga0070693_100141796 | 3300005547 | Bacteria | 1513 |
| 129 | Ga0070693_100158169 | 3300005547 | Bacteria | 1441 |
| 130 | Ga0070693_100727330 | 3300005547 | Bacteria | 729 |
| 131 | Ga0070665_100006047 | 3300005548 | Bacteria | 12369 |
| 132 | Ga0070665_100046934 | 3300005548 | Bacteria | 4335 |
| 133 | Ga0070665_100088172 | 3300005548 | Bacteria | 3108 |
| 134 | Ga0070665_100147132 | 3300005548 | Bacteria | 2359 |
| 135 | Ga0070665_100242310 | 3300005548 | Bacteria | 1803 |
| 136 | Ga0070665_100359203 | 3300005548 | Bacteria | 1462 |
| 137 | Ga0070665_100449282 | 3300005548 | Bacteria | 1298 |
| 138 | Ga0070665_100680563 | 3300005548 | Bacteria | 1042 |
| 139 | Ga0070665_100995411 | 3300005548 | Bacteria | 851 |
| 140 | Ga0070665_101064742 | 3300005548 | Bacteria | 820 |
| 141 | Ga0070704_100996661 | 3300005549 | Bacteria | 757 |
| 142 | Ga0068855_100142397 | 3300005563 | Bacteria | 2731 |
| 143 | Ga0068855_101341858 | 3300005563 | Bacteria | 739 |
| 144 | Ga0070664_100752603 | 3300005564 | Bacteria | 909 |
| 145 | Ga0068857_100161780 | 3300005577 | Bacteria | 2031 |
| 146 | Ga0068857_101466126 | 3300005577 | Bacteria | 665 |
| 147 | Ga0068854_100050418 | 3300005578 | Bacteria | 2978 |
| 148 | Ga0068854_100133533 | 3300005578 | Bacteria | 1898 |
| 149 | Ga0068854_100350047 | 3300005578 | Bacteria | 1209 |
| 150 | Ga0068856_100045441 | 3300005614 | Bacteria | 4324 |
| 151 | Ga0068856_100218065 | 3300005614 | Bacteria | 1923 |
| 152 | Ga0070702_100240942 | 3300005615 | Bacteria | 1220 |
| 153 | Ga0070702_100357805 | 3300005615 | Bacteria | 1030 |
| 154 | Ga0070702_100483500 | 3300005615 | Bacteria | 905 |
| 155 | Ga0070702_100773885 | 3300005615 | Bacteria | 740 |
| 156 | Ga0070702_101499734 | 3300005615 | Bacteria | 555 |
| 157 | Ga0068852_100195806 | 3300005616 | Bacteria | 1910 |
| 158 | Ga0068852_100211650 | 3300005616 | Bacteria | 1839 |
| 159 | Ga0068852_100802086 | 3300005616 | Bacteria | 956 |
| 160 | Ga0068852_100831125 | 3300005616 | Bacteria | 939 |
| 161 | Ga0068859_100081687 | 3300005617 | Bacteria | 3274 |
| 162 | Ga0068859_100103695 | 3300005617 | Bacteria | 2902 |
| 163 | Ga0068859_100193831 | 3300005617 | Bacteria | 2116 |
| 164 | Ga0068859_100489587 | 3300005617 | Bacteria | 1325 |
| 165 | Ga0068864_100236351 | 3300005618 | Bacteria | 1692 |
| 166 | Ga0068864_100380312 | 3300005618 | Bacteria | 1338 |
| 167 | Ga0068866_10014019 | 3300005718 | Bacteria | 3529 |
| 168 | Ga0068866_10068672 | 3300005718 | Bacteria | 1864 |
| 169 | Ga0068866_10178015 | 3300005718 | Bacteria | 1254 |
| 170 | Ga0068866_11147688 | 3300005718 | Bacteria | 559 |
| 171 | Ga0068861_100114662 | 3300005719 | Bacteria | 2164 |
| 172 | Ga0068861_100132658 | 3300005719 | Bacteria | 2023 |
| 173 | Ga0068861_100455335 | 3300005719 | Bacteria | 1147 |
| 174 | Ga0068861_100559489 | 3300005719 | Bacteria | 1043 |
| 175 | Ga0068861_100873609 | 3300005719 | Bacteria | 849 |
| 176 | Ga0068851_10299235 | 3300005834 | Bacteria | 925 |
| 177 | Ga0068870_10062612 | 3300005840 | Bacteria | 2004 |
| 178 | Ga0068863_100342051 | 3300005841 | Bacteria | 1455 |
| 179 | Ga0068863_100452357 | 3300005841 | Bacteria | 1260 |
| 180 | Ga0068863_101721265 | 3300005841 | Bacteria | 637 |
| 181 | Ga0068858_100099908 | 3300005842 | Bacteria | 2706 |
| 182 | Ga0068858_100553727 | 3300005842 | Bacteria | 1113 |
| 183 | Ga0068860_100077344 | 3300005843 | Bacteria | 3164 |
| 184 | Ga0068860_100134772 | 3300005843 | Bacteria | 2371 |
| 185 | Ga0068860_100233815 | 3300005843 | Bacteria | 1786 |
| 186 | Ga0068860_100260103 | 3300005843 | Bacteria | 1691 |
| 187 | Ga0068860_100317765 | 3300005843 | Bacteria | 1528 |
| 188 | Ga0068862_100306533 | 3300005844 | Bacteria | 1462 |
| 189 | Ga0068862_101064457 | 3300005844 | Bacteria | 802 |
| 190 | Ga0068862_101860252 | 3300005844 | Bacteria | 612 |
| 191 | Ga0068862_101997501 | 3300005844 | Bacteria | 590 |
| 192 | Ga0068862_102661352 | 3300005844 | Bacteria | 512 |
| 193 | Ga0081455_10023941 | 3300005937 | Bacteria | 5669 |
| 194 | Ga0081455_10148450 | 3300005937 | Bacteria | 1810 |
| 195 | Ga0081538_10019994 | 3300005981 | Bacteria | 4950 |
| 196 | Ga0081540_1005122 | 3300005983 | Bacteria | 9825 |
| 197 | Ga0081540_1008650 | 3300005983 | Bacteria | 7094 |
| 198 | Ga0081540_1010370 | 3300005983 | Bacteria | 6318 |
| 199 | Ga0081540_1028568 | 3300005983 | Bacteria | 3129 |
| 200 | Ga0081540_1112096 | 3300005983 | Bacteria | 1150 |
| 201 | Ga0081539_10061245 | 3300005985 | Bacteria | 2063 |
| 202 | Ga0081539_10095727 | 3300005985 | Bacteria | 1525 |
| 203 | Ga0075365_10211511 | 3300006038 | Bacteria | 1359 |
| 204 | Ga0075365_10253956 | 3300006038 | Bacteria | 1236 |
| 205 | Ga0075365_10340808 | 3300006038 | Bacteria | 1056 |
| 206 | Ga0075365_10960146 | 3300006038 | Bacteria | 602 |
| 207 | Ga0075368_10041864 | 3300006042 | Bacteria | 1800 |
| 208 | Ga0075368_10073537 | 3300006042 | Bacteria | 1383 |
| 209 | Ga0075368_10120613 | 3300006042 | Bacteria | 1086 |
| 210 | Ga0075368_10139054 | 3300006042 | Bacteria | 1011 |
| 211 | Ga0075363_100019573 | 3300006048 | Bacteria | 3385 |
| 212 | Ga0075363_100204972 | 3300006048 | Bacteria | 1127 |
| 213 | Ga0075363_100219456 | 3300006048 | Bacteria | 1089 |
| 214 | Ga0075363_100323392 | 3300006048 | Bacteria | 897 |
| 215 | Ga0075363_100422567 | 3300006048 | Bacteria | 785 |
| 216 | Ga0075364_10043408 | 3300006051 | Bacteria | 2923 |
| 217 | Ga0075364_10111208 | 3300006051 | Bacteria | 1828 |
| 218 | Ga0075364_10191119 | 3300006051 | Bacteria | 1386 |
| 219 | Ga0075364_10667330 | 3300006051 | Bacteria | 710 |
| 220 | Ga0075432_10318984 | 3300006058 | Bacteria | 650 |
| 221 | Ga0070716_100191696 | 3300006173 | Bacteria | 1351 |
| 222 | Ga0070716_100355337 | 3300006173 | Bacteria | 1039 |
| 223 | Ga0070716_101749369 | 3300006173 | Bacteria | 514 |
| 224 | Ga0070712_100002748 | 3300006175 | Bacteria | 10879 |
| 225 | Ga0070712_100071562 | 3300006175 | Bacteria | 2481 |
| 226 | Ga0070712_100410939 | 3300006175 | Bacteria | 1120 |
| 227 | Ga0075362_10048946 | 3300006177 | Bacteria | 1887 |
| 228 | Ga0075362_10212115 | 3300006177 | Bacteria | 944 |
| 229 | Ga0075362_10545911 | 3300006177 | Bacteria | 596 |
| 230 | Ga0075367_10008917 | 3300006178 | Bacteria | 5219 |
| 231 | Ga0075367_10066140 | 3300006178 | Bacteria | 2165 |
| 232 | Ga0075367_10179835 | 3300006178 | Bacteria | 1318 |
| 233 | Ga0075367_10237592 | 3300006178 | Bacteria | 1141 |
| 234 | Ga0075367_10293843 | 3300006178 | Bacteria | 1022 |
| 235 | Ga0075367_10403583 | 3300006178 | Bacteria | 864 |
| 236 | Ga0075369_10063424 | 3300006186 | Bacteria | 1616 |
| 237 | Ga0075369_10087263 | 3300006186 | Bacteria | 1389 |
| 238 | Ga0075369_10156760 | 3300006186 | Bacteria | 1042 |
| 239 | Ga0075366_10043943 | 3300006195 | Bacteria | 2647 |
| 240 | Ga0075366_10205804 | 3300006195 | Bacteria | 1197 |
| 241 | Ga0075366_10335194 | 3300006195 | Bacteria | 927 |
| 242 | Ga0075366_10580541 | 3300006195 | Bacteria | 694 |
| 243 | Ga0097621_100091765 | 3300006237 | Bacteria | 2543 |
| 244 | Ga0097621_100132654 | 3300006237 | Bacteria | 2121 |
| 245 | Ga0097621_101074854 | 3300006237 | Bacteria | 755 |
| 246 | Ga0075370_10012018 | 3300006353 | Bacteria | 4564 |
| 247 | Ga0075370_10106281 | 3300006353 | Bacteria | 1627 |
| 248 | Ga0068871_100233636 | 3300006358 | Bacteria | 1597 |
| 249 | Ga0068871_100251773 | 3300006358 | Bacteria | 1539 |
| 250 | Ga0068871_100745820 | 3300006358 | Bacteria | 900 |
| 251 | Ga0068871_101217757 | 3300006358 | Bacteria | 706 |
| 252 | Ga0075428_100916099 | 3300006844 | Bacteria | 929 |
| 253 | Ga0075428_101013454 | 3300006844 | Bacteria | 879 |
| 254 | Ga0075431_100303669 | 3300006847 | Bacteria | 1612 |
| 255 | Ga0075433_11507387 | 3300006852 | Bacteria | 581 |
| 256 | Ga0068865_100010829 | 3300006881 | Bacteria | 5689 |
| 257 | Ga0068865_100156758 | 3300006881 | Bacteria | 1732 |
| 258 | Ga0068865_100307186 | 3300006881 | Bacteria | 1271 |
| 259 | Ga0068865_100505252 | 3300006881 | Bacteria | 1008 |
| 260 | Ga0068865_100906333 | 3300006881 | Bacteria | 767 |
| 261 | Ga0068865_101426112 | 3300006881 | Bacteria | 619 |
| 262 | Ga0075436_100134548 | 3300006914 | Bacteria | 1735 |
| 263 | Ga0075436_100528411 | 3300006914 | Bacteria | 865 |
| 264 | Ga0097620_100081686 | 3300006931 | Bacteria | 3274 |
| 265 | Ga0097620_100103699 | 3300006931 | Bacteria | 2902 |
| 266 | Ga0097620_100193831 | 3300006931 | Bacteria | 2116 |
| 267 | Ga0097620_100489632 | 3300006931 | Bacteria | 1325 |
| 268 | Ga0099825_1023278 | 3300006941 | Bacteria | 3829 |
| 269 | Ga0099824_1033392 | 3300006942 | Bacteria | 1745 |
| 270 | Ga0099822_1000191 | 3300006943 | Bacteria | 46107 |
| 271 | Ga0075435_100086775 | 3300007076 | Bacteria | 2578 |
| 272 | Ga0099794_10025181 | 3300007265 | Bacteria | 2738 |
| 273 | Ga0099795_10017094 | 3300007788 | Bacteria | 2307 |
| 274 | Ga0099795_10082459 | 3300007788 | Bacteria | 1233 |
| 275 | Ga0105250_10091244 | 3300009092 | Bacteria | 1239 |
| 276 | Ga0105240_10099049 | 3300009093 | Bacteria | 3549 |
| 277 | Ga0105240_11904592 | 3300009093 | Bacteria | 619 |
| 278 | Ga0111539_10057611 | 3300009094 | Bacteria | 4613 |
| 279 | Ga0111539_10834437 | 3300009094 | Bacteria | 1072 |
| 280 | Ga0105245_10215836 | 3300009098 | Bacteria | 1849 |
| 281 | Ga0105245_10438015 | 3300009098 | Bacteria | 1313 |
| 282 | Ga0105245_10547433 | 3300009098 | Bacteria | 1179 |
| 283 | Ga0105245_10632651 | 3300009098 | Bacteria | 1099 |
| 284 | Ga0105245_11844071 | 3300009098 | Bacteria | 658 |
| 285 | Ga0105247_10251361 | 3300009101 | Bacteria | 1208 |
| 286 | Ga0105247_10273958 | 3300009101 | Bacteria | 1162 |
| 287 | Ga0105247_10378583 | 3300009101 | Bacteria | 1003 |
| 288 | Ga0105247_10574522 | 3300009101 | Bacteria | 832 |
| 289 | Ga0105247_10759387 | 3300009101 | Bacteria | 736 |
| 290 | Ga0114129_10119006 | 3300009147 | Bacteria | 3638 |
| 291 | Ga0105243_10089029 | 3300009148 | Bacteria | 2537 |
| 292 | Ga0105243_10249223 | 3300009148 | Bacteria | 1585 |
| 293 | Ga0105243_10562342 | 3300009148 | Bacteria | 1092 |
| 294 | Ga0105243_11077275 | 3300009148 | Bacteria | 811 |
| 295 | Ga0105241_10111539 | 3300009174 | Bacteria | 2190 |
| 296 | Ga0105241_10196422 | 3300009174 | Bacteria | 1682 |
| 297 | Ga0105242_10051398 | 3300009176 | Bacteria | 3358 |
| 298 | Ga0105242_10569940 | 3300009176 | Bacteria | 1089 |
| 299 | Ga0105242_10587599 | 3300009176 | Bacteria | 1074 |
| 300 | Ga0105242_11751136 | 3300009176 | Bacteria | 659 |
| 301 | Ga0105248_10052096 | 3300009177 | Bacteria | 4593 |
| 302 | Ga0105248_10059734 | 3300009177 | Bacteria | 4283 |
| 303 | Ga0105248_10252605 | 3300009177 | Bacteria | 1984 |
| 304 | Ga0105248_10380194 | 3300009177 | Bacteria | 1590 |
| 305 | Ga0105248_10466140 | 3300009177 | Bacteria | 1424 |
| 306 | Ga0105248_10495624 | 3300009177 | Bacteria | 1377 |
| 307 | Ga0105248_10714438 | 3300009177 | Bacteria | 1131 |
| 308 | Ga0105237_10280693 | 3300009545 | Bacteria | 1668 |
| 309 | Ga0105237_10356602 | 3300009545 | Bacteria | 1467 |
| 310 | Ga0105237_10903743 | 3300009545 | Bacteria | 890 |
| 311 | Ga0105237_11465768 | 3300009545 | Bacteria | 689 |
| 312 | Ga0105238_10120163 | 3300009551 | Bacteria | 2607 |
| 313 | Ga0105238_10123963 | 3300009551 | Bacteria | 2563 |
| 314 | Ga0105238_11606265 | 3300009551 | Bacteria | 680 |
| 315 | Ga0105238_12876263 | 3300009551 | Bacteria | 518 |
| 316 | Ga0105249_10038661 | 3300009553 | Bacteria | 4330 |
| 317 | Ga0105249_10166891 | 3300009553 | Bacteria | 2132 |
| 318 | Ga0105249_10333447 | 3300009553 | Bacteria | 1531 |
| 319 | Ga0105249_10875378 | 3300009553 | Bacteria | 964 |
| 320 | Ga0105249_12175814 | 3300009553 | Bacteria | 627 |
| 321 | Ga0099796_10047206 | 3300010159 | Bacteria | 1481 |
| 322 | Ga0105239_10045817 | 3300010375 | Bacteria | 4792 |
| 323 | Ga0105239_10045962 | 3300010375 | Bacteria | 4785 |
| 324 | Ga0105239_10078073 | 3300010375 | Bacteria | 3644 |
| 325 | Ga0105239_10154693 | 3300010375 | Bacteria | 2560 |
| 326 | Ga0105239_11298562 | 3300010375 | Bacteria | 839 |
| 327 | Ga0105239_11416789 | 3300010375 | Bacteria | 802 |
| 328 | Ga0105239_12891748 | 3300010375 | Bacteria | 560 |
| 329 | Ga0105239_13101289 | 3300010375 | Bacteria | 541 |
| 330 | Ga0105246_10083619 | 3300011119 | Bacteria | 2281 |
| 331 | Ga0105246_10192462 | 3300011119 | Bacteria | 1580 |
| 332 | Ga0105246_10218545 | 3300011119 | Bacteria | 1492 |
| 333 | Ga0105246_10514215 | 3300011119 | Bacteria | 1019 |
| 334 | Ga0105246_10880933 | 3300011119 | Bacteria | 801 |
| 335 | Ga0157369_10007714 | 3300013105 | Bacteria | 12380 |
| 336 | Ga0157374_10020275 | 3300013296 | Bacteria | 5896 |
| 337 | Ga0157374_10508924 | 3300013296 | Bacteria | 1209 |
| 338 | Ga0157374_10902248 | 3300013296 | Bacteria | 901 |
| 339 | Ga0157374_11458196 | 3300013296 | Bacteria | 707 |
| 340 | Ga0157374_11849640 | 3300013296 | Bacteria | 629 |
| 341 | Ga0157374_12292734 | 3300013296 | Bacteria | 567 |
| 342 | Ga0157378_10015483 | 3300013297 | Bacteria | 6681 |
| 343 | Ga0157378_10093522 | 3300013297 | Bacteria | 2737 |
| 344 | Ga0157378_10889525 | 3300013297 | Bacteria | 921 |
| 345 | Ga0163162_10102095 | 3300013306 | Bacteria | 2961 |
| 346 | Ga0163162_10114346 | 3300013306 | Bacteria | 2798 |
| 347 | Ga0163162_10115742 | 3300013306 | Bacteria | 2781 |
| 348 | Ga0163162_10496912 | 3300013306 | Bacteria | 1350 |
| 349 | Ga0163162_11263824 | 3300013306 | Bacteria | 838 |
| 350 | Ga0163162_13025924 | 3300013306 | Bacteria | 540 |
| 351 | Ga0157372_11742165 | 3300013307 | Bacteria | 717 |
| 352 | Ga0157375_10094761 | 3300013308 | Bacteria | 3055 |
| 353 | Ga0157375_10269525 | 3300013308 | Bacteria | 1864 |
| 354 | Ga0157375_10331276 | 3300013308 | Bacteria | 1687 |
| 355 | Ga0157375_11874071 | 3300013308 | Bacteria | 712 |
| 356 | Ga0157375_12030473 | 3300013308 | Bacteria | 684 |
| 357 | Ga0157375_13344226 | 3300013308 | Bacteria | 534 |
| 358 | Ga0163163_10363328 | 3300014325 | Bacteria | 1504 |
| 359 | Ga0163163_10617738 | 3300014325 | Bacteria | 1147 |
| 360 | Ga0163163_10827272 | 3300014325 | Bacteria | 989 |
| 361 | Ga0163163_10948772 | 3300014325 | Bacteria | 923 |
| 362 | Ga0163163_11340026 | 3300014325 | Bacteria | 778 |
| 363 | Ga0163163_11656935 | 3300014325 | Bacteria | 700 |
| 364 | Ga0163163_11830600 | 3300014325 | Bacteria | 667 |
| 365 | Ga0163163_13290015 | 3300014325 | Bacteria | 504 |
| 366 | Ga0157380_10566922 | 3300014326 | Bacteria | 1117 |
| 367 | Ga0157380_10693656 | 3300014326 | Bacteria | 1022 |
| 368 | Ga0157380_10716500 | 3300014326 | Bacteria | 1007 |
| 369 | Ga0157380_11106285 | 3300014326 | Bacteria | 832 |
| 370 | Ga0157380_11728683 | 3300014326 | Bacteria | 683 |
| 371 | Ga0182008_10263735 | 3300014497 | Bacteria | 892 |
| 372 | Ga0157377_10190270 | 3300014745 | Bacteria | 1296 |
| 373 | Ga0157377_11361730 | 3300014745 | Bacteria | 558 |
| 374 | Ga0157379_10155773 | 3300014968 | Bacteria | 2061 |
| 375 | Ga0157379_10351469 | 3300014968 | Bacteria | 1350 |
| 376 | Ga0157379_10365434 | 3300014968 | Bacteria | 1323 |
| 377 | Ga0157379_12423835 | 3300014968 | Bacteria | 524 |
| 378 | Ga0157376_10004288 | 3300014969 | Bacteria | 9905 |
| 379 | Ga0157376_10604754 | 3300014969 | Bacteria | 1092 |
| 380 | Ga0157376_10989445 | 3300014969 | Bacteria | 863 |
| 381 | Ga0157376_11133347 | 3300014969 | Bacteria | 809 |
| 382 | Ga0157376_11230187 | 3300014969 | Bacteria | 777 |
| 383 | Ga0157376_11681043 | 3300014969 | Bacteria | 670 |
| 384 | Ga0182007_10351718 | 3300015262 | Bacteria | 553 |
| 385 | Ga0163161_10043682 | 3300017792 | Bacteria | 3227 |
| 386 | Ga0163161_10285992 | 3300017792 | Bacteria | 1295 |
| 387 | Ga0163161_10558316 | 3300017792 | Bacteria | 939 |
| 388 | Ga0213876_10344846 | 3300021384 | Bacteria | 792 |
| 389 | Ga0209677_125228 | 3300025253 | Bacteria | 643 |
| 390 | Ga0209025_1132440 | 3300025294 | Bacteria | 722 |
| 391 | Ga0209758_1004214 | 3300025297 | Bacteria | 12185 |
| 392 | Ga0209758_1022090 | 3300025297 | Bacteria | 2936 |
| 393 | Ga0207697_10131220 | 3300025315 | Bacteria | 1083 |
| 394 | Ga0207696_1027263 | 3300025711 | Bacteria | 1761 |
| 395 | Ga0207653_10028554 | 3300025885 | Bacteria | 1795 |
| 396 | Ga0207682_10177584 | 3300025893 | Bacteria | 971 |
| 397 | Ga0207692_10003473 | 3300025898 | Bacteria | 6163 |
| 398 | Ga0207692_10430837 | 3300025898 | Bacteria | 827 |
| 399 | Ga0207642_10125500 | 3300025899 | Bacteria | 1331 |
| 400 | Ga0207710_10049499 | 3300025900 | Bacteria | 1883 |
| 401 | Ga0207710_10157869 | 3300025900 | Bacteria | 1103 |
| 402 | Ga0207710_10178232 | 3300025900 | Bacteria | 1042 |
| 403 | Ga0207688_10010595 | 3300025901 | Bacteria | 5013 |
| 404 | Ga0207688_10027797 | 3300025901 | Bacteria | 3111 |
| 405 | Ga0207688_10126798 | 3300025901 | Bacteria | 1493 |
| 406 | Ga0207680_10622183 | 3300025903 | Bacteria | 772 |
| 407 | Ga0207680_10773742 | 3300025903 | Bacteria | 688 |
| 408 | Ga0207680_11146224 | 3300025903 | Bacteria | 555 |
| 409 | Ga0207647_10006138 | 3300025904 | Bacteria | 8753 |
| 410 | Ga0207685_10175751 | 3300025905 | Bacteria | 989 |
| 411 | Ga0207699_10005053 | 3300025906 | Bacteria | 6310 |
| 412 | Ga0207645_10209212 | 3300025907 | Bacteria | 1284 |
| 413 | Ga0207645_10269804 | 3300025907 | Bacteria | 1128 |
| 414 | Ga0207645_10475068 | 3300025907 | Bacteria | 845 |
| 415 | Ga0207643_10027305 | 3300025908 | Bacteria | 3164 |
| 416 | Ga0207643_10373065 | 3300025908 | Bacteria | 898 |
| 417 | Ga0207705_10704342 | 3300025909 | Bacteria | 785 |
| 418 | Ga0207684_11112591 | 3300025910 | Bacteria | 657 |
| 419 | Ga0207654_10050940 | 3300025911 | Bacteria | 2381 |
| 420 | Ga0207654_10576763 | 3300025911 | Bacteria | 801 |
| 421 | Ga0207707_10333055 | 3300025912 | Bacteria | 1309 |
| 422 | Ga0207671_10509091 | 3300025914 | Bacteria | 960 |
| 423 | Ga0207671_10548875 | 3300025914 | Bacteria | 921 |
| 424 | Ga0207693_10004152 | 3300025915 | Bacteria | 12287 |
| 425 | Ga0207693_10068856 | 3300025915 | Bacteria | 2770 |
| 426 | Ga0207693_10659459 | 3300025915 | Bacteria | 812 |
| 427 | Ga0207663_10006381 | 3300025916 | Bacteria | 6031 |
| 428 | Ga0207663_10878683 | 3300025916 | Bacteria | 716 |
| 429 | Ga0207660_10270447 | 3300025917 | Bacteria | 1346 |
| 430 | Ga0207662_10628210 | 3300025918 | Bacteria | 749 |
| 431 | Ga0207657_10094263 | 3300025919 | Bacteria | 2493 |
| 432 | Ga0207649_10060489 | 3300025920 | Bacteria | 2381 |
| 433 | Ga0207649_10457161 | 3300025920 | Bacteria | 965 |
| 434 | Ga0207652_10521305 | 3300025921 | Bacteria | 1069 |
| 435 | Ga0207681_10362754 | 3300025923 | Bacteria | 1162 |
| 436 | Ga0207681_10836809 | 3300025923 | Bacteria | 769 |
| 437 | Ga0207694_10197597 | 3300025924 | Bacteria | 1635 |
| 438 | Ga0207694_10890167 | 3300025924 | Bacteria | 753 |
| 439 | Ga0207694_11259125 | 3300025924 | Bacteria | 626 |
| 440 | Ga0207650_10987184 | 3300025925 | Bacteria | 716 |
| 441 | Ga0207659_10103723 | 3300025926 | Bacteria | 2149 |
| 442 | Ga0207687_10046156 | 3300025927 | Bacteria | 3015 |
| 443 | Ga0207687_10506660 | 3300025927 | Bacteria | 1008 |
| 444 | Ga0207687_10508010 | 3300025927 | Bacteria | 1007 |
| 445 | Ga0207687_10850452 | 3300025927 | Bacteria | 779 |
| 446 | Ga0207687_11213563 | 3300025927 | Bacteria | 648 |
| 447 | Ga0207700_10039017 | 3300025928 | Bacteria | 3452 |
| 448 | Ga0207700_10095690 | 3300025928 | Bacteria | 2356 |
| 449 | Ga0207700_10470232 | 3300025928 | Bacteria | 1110 |
| 450 | Ga0207664_10322313 | 3300025929 | Bacteria | 1364 |
| 451 | Ga0207664_11100170 | 3300025929 | Bacteria | 710 |
| 452 | Ga0207644_10070746 | 3300025931 | Bacteria | 2551 |
| 453 | Ga0207690_10086087 | 3300025932 | Bacteria | 2207 |
| 454 | Ga0207706_10067855 | 3300025933 | Bacteria | 3139 |
| 455 | Ga0207706_10129850 | 3300025933 | Bacteria | 2216 |
| 456 | Ga0207706_10422663 | 3300025933 | Bacteria | 1154 |
| 457 | Ga0207706_10848389 | 3300025933 | Bacteria | 774 |
| 458 | Ga0207686_10155370 | 3300025934 | Bacteria | 1597 |
| 459 | Ga0207686_10489309 | 3300025934 | Bacteria | 953 |
| 460 | Ga0207686_10552917 | 3300025934 | Bacteria | 900 |
| 461 | Ga0207686_11769778 | 3300025934 | Bacteria | 511 |
| 462 | Ga0207709_10158090 | 3300025935 | Bacteria | 1578 |
| 463 | Ga0207709_10278282 | 3300025935 | Bacteria | 1235 |
| 464 | Ga0207709_11019656 | 3300025935 | Bacteria | 677 |
| 465 | Ga0207709_11163532 | 3300025935 | Bacteria | 635 |
| 466 | Ga0207670_10380526 | 3300025936 | Bacteria | 1124 |
| 467 | Ga0207670_10902061 | 3300025936 | Bacteria | 740 |
| 468 | Ga0207669_10352911 | 3300025937 | Bacteria | 1137 |
| 469 | Ga0207669_10481356 | 3300025937 | Bacteria | 989 |
| 470 | Ga0207669_10912389 | 3300025937 | Bacteria | 734 |
| 471 | Ga0207704_10185027 | 3300025938 | Bacteria | 1509 |
| 472 | Ga0207704_10254222 | 3300025938 | Bacteria | 1321 |
| 473 | Ga0207704_10347113 | 3300025938 | Bacteria | 1154 |
| 474 | Ga0207704_10406919 | 3300025938 | Bacteria | 1075 |
| 475 | Ga0207704_11052582 | 3300025938 | Bacteria | 690 |
| 476 | Ga0207665_10239425 | 3300025939 | Bacteria | 1336 |
| 477 | Ga0207665_10279087 | 3300025939 | Bacteria | 1243 |
| 478 | Ga0207691_10109437 | 3300025940 | Bacteria | 2458 |
| 479 | Ga0207691_10115524 | 3300025940 | Bacteria | 2383 |
| 480 | Ga0207691_10195566 | 3300025940 | Bacteria | 1762 |
| 481 | Ga0207691_10297606 | 3300025940 | Bacteria | 1387 |
| 482 | Ga0207711_10278108 | 3300025941 | Bacteria | 1541 |
| 483 | Ga0207711_10329868 | 3300025941 | Bacteria | 1411 |
| 484 | Ga0207711_10524654 | 3300025941 | Bacteria | 1104 |
| 485 | Ga0207711_11900261 | 3300025941 | Bacteria | 538 |
| 486 | Ga0207689_10205379 | 3300025942 | Bacteria | 1627 |
| 487 | Ga0207689_10368714 | 3300025942 | Bacteria | 1195 |
| 488 | Ga0207689_10868064 | 3300025942 | Bacteria | 761 |
| 489 | Ga0207689_10891136 | 3300025942 | Bacteria | 751 |
| 490 | Ga0207661_10226869 | 3300025944 | Bacteria | 1653 |
| 491 | Ga0207661_11382664 | 3300025944 | Bacteria | 646 |
| 492 | Ga0207679_10030722 | 3300025945 | Bacteria | 3754 |
| 493 | Ga0207679_10048765 | 3300025945 | Bacteria | 3085 |
| 494 | Ga0207679_10622680 | 3300025945 | Bacteria | 974 |
| 495 | Ga0207667_10155171 | 3300025949 | Bacteria | 2356 |
| 496 | Ga0207667_11078485 | 3300025949 | Bacteria | 787 |
| 497 | Ga0207651_10172599 | 3300025960 | Bacteria | 1707 |
| 498 | Ga0207651_10636927 | 3300025960 | Bacteria | 935 |
| 499 | Ga0207712_10091075 | 3300025961 | Bacteria | 2246 |
| 500 | Ga0207712_10774911 | 3300025961 | Bacteria | 842 |
| 501 | Ga0207712_11371803 | 3300025961 | Bacteria | 632 |
| 502 | Ga0207668_10013241 | 3300025972 | Bacteria | 5072 |
| 503 | Ga0207668_10159359 | 3300025972 | Bacteria | 1756 |
| 504 | Ga0207668_10273689 | 3300025972 | Bacteria | 1381 |
| 505 | Ga0207668_10310679 | 3300025972 | Bacteria | 1304 |
| 506 | Ga0207668_10758392 | 3300025972 | Bacteria | 856 |
| 507 | Ga0207668_11572912 | 3300025972 | Bacteria | 593 |
| 508 | Ga0207640_10567451 | 3300025981 | Bacteria | 956 |
| 509 | Ga0207640_10850945 | 3300025981 | Bacteria | 793 |
| 510 | Ga0207640_11868026 | 3300025981 | Bacteria | 543 |
| 511 | Ga0207658_10225666 | 3300025986 | Bacteria | 1578 |
| 512 | Ga0207677_10342501 | 3300026023 | Bacteria | 1249 |
| 513 | Ga0207677_11924720 | 3300026023 | Bacteria | 549 |
| 514 | Ga0207703_10041893 | 3300026035 | Bacteria | 3671 |
| 515 | Ga0207703_10197653 | 3300026035 | Bacteria | 1785 |
| 516 | Ga0207703_10549605 | 3300026035 | Bacteria | 1089 |
| 517 | Ga0207703_10784961 | 3300026035 | Bacteria | 909 |
| 518 | Ga0207639_10008358 | 3300026041 | Bacteria | 7095 |
| 519 | Ga0207639_10102877 | 3300026041 | Bacteria | 2313 |
| 520 | Ga0207639_10276341 | 3300026041 | Bacteria | 1475 |
| 521 | Ga0207639_10944362 | 3300026041 | Bacteria | 807 |
| 522 | Ga0207639_10984807 | 3300026041 | Bacteria | 789 |
| 523 | Ga0207639_11989112 | 3300026041 | Bacteria | 542 |
| 524 | Ga0207678_10015601 | 3300026067 | Bacteria | 6679 |
| 525 | Ga0207678_10043029 | 3300026067 | Bacteria | 3909 |
| 526 | Ga0207678_10097713 | 3300026067 | Bacteria | 2509 |
| 527 | Ga0207678_10262800 | 3300026067 | Bacteria | 1479 |
| 528 | Ga0207678_10353158 | 3300026067 | Bacteria | 1268 |
| 529 | Ga0207678_10355248 | 3300026067 | Bacteria | 1264 |
| 530 | Ga0207678_10401734 | 3300026067 | Bacteria | 1186 |
| 531 | Ga0207708_10210470 | 3300026075 | Bacteria | 1554 |
| 532 | Ga0207708_10518042 | 3300026075 | Bacteria | 1002 |
| 533 | Ga0207708_10990108 | 3300026075 | Bacteria | 730 |
| 534 | Ga0207702_10026010 | 3300026078 | Bacteria | 4859 |
| 535 | Ga0207702_11398066 | 3300026078 | Bacteria | 694 |
| 536 | Ga0207641_10274476 | 3300026088 | Bacteria | 1583 |
| 537 | Ga0207641_10276717 | 3300026088 | Bacteria | 1577 |
| 538 | Ga0207641_11022579 | 3300026088 | Bacteria | 823 |
| 539 | Ga0207648_10060782 | 3300026089 | Bacteria | 3295 |
| 540 | Ga0207648_10076280 | 3300026089 | Bacteria | 2922 |
| 541 | Ga0207648_10308751 | 3300026089 | Bacteria | 1419 |
| 542 | Ga0207648_10902915 | 3300026089 | Bacteria | 825 |
| 543 | Ga0207648_11227210 | 3300026089 | Bacteria | 704 |
| 544 | Ga0207676_10221684 | 3300026095 | Bacteria | 1685 |
| 545 | Ga0207674_10064470 | 3300026116 | Bacteria | 3695 |
| 546 | Ga0207674_10596281 | 3300026116 | Bacteria | 1067 |
| 547 | Ga0207674_10599365 | 3300026116 | Bacteria | 1064 |
| 548 | Ga0207675_100084466 | 3300026118 | Bacteria | 2979 |
| 549 | Ga0207675_100415238 | 3300026118 | Bacteria | 1328 |
| 550 | Ga0207675_100720203 | 3300026118 | Bacteria | 1008 |
| 551 | Ga0207675_101057761 | 3300026118 | Bacteria | 831 |
| 552 | Ga0207683_10062959 | 3300026121 | Bacteria | 3267 |
| 553 | Ga0207683_10069102 | 3300026121 | Bacteria | 3119 |
| 554 | Ga0207683_10113570 | 3300026121 | Bacteria | 2426 |
| 555 | Ga0207683_10251011 | 3300026121 | Bacteria | 1615 |
| 556 | Ga0207683_10273786 | 3300026121 | Bacteria | 1542 |
| 557 | Ga0207683_10370723 | 3300026121 | Bacteria | 1315 |
| 558 | Ga0207698_10197728 | 3300026142 | Bacteria | 1797 |
| 559 | Ga0207698_10241921 | 3300026142 | Bacteria | 1645 |
| 560 | Ga0207698_10243963 | 3300026142 | Bacteria | 1639 |
| 561 | Ga0207698_10391484 | 3300026142 | Bacteria | 1325 |
| 562 | Ga0209589_1000055 | 3300027357 | Bacteria | 111890 |
| 563 | Ga0209489_100128 | 3300027361 | Bacteria | 111890 |
| 564 | Ga0209700_100137 | 3300027363 | Bacteria | 111890 |
| 565 | Ga0209179_1064309 | 3300027512 | Bacteria | 799 |
| 566 | Ga0209179_1128566 | 3300027512 | Bacteria | 566 |
| 567 | Ga0209813_10128399 | 3300027866 | Bacteria | 889 |
| 568 | Ga0209813_10128717 | 3300027866 | Bacteria | 888 |
| 569 | Ga0207428_10220540 | 3300027907 | Bacteria | 1422 |
| 570 | Ga0268266_10001893 | 3300028379 | Bacteria | 23597 |
| 571 | Ga0268266_10010934 | 3300028379 | Bacteria | 7899 |
| 572 | Ga0268266_10020070 | 3300028379 | Bacteria | 5696 |
| 573 | Ga0268266_10060966 | 3300028379 | Bacteria | 3252 |
| 574 | Ga0268266_10061647 | 3300028379 | Bacteria | 3235 |
| 575 | Ga0268266_10223094 | 3300028379 | Bacteria | 1733 |
| 576 | Ga0268266_10316498 | 3300028379 | Bacteria | 1459 |
| 577 | Ga0268266_11101948 | 3300028379 | Bacteria | 768 |
| 578 | Ga0268265_10060512 | 3300028380 | Bacteria | 2902 |
| 579 | Ga0268265_10073561 | 3300028380 | Bacteria | 2669 |
| 580 | Ga0268265_10196619 | 3300028380 | Bacteria | 1745 |
| 581 | Ga0268265_10492698 | 3300028380 | Bacteria | 1153 |
| 582 | Ga0268265_11209364 | 3300028380 | Bacteria | 753 |
| 583 | Ga0268265_11267247 | 3300028380 | Bacteria | 736 |
| 584 | Ga0268264_10091485 | 3300028381 | Bacteria | 2624 |
| 585 | Ga0268264_10141336 | 3300028381 | Bacteria | 2147 |
| 586 | Ga0268264_11535631 | 3300028381 | Bacteria | 676 |
| 587 | Ga0307517_10007163 | 3300028786 | Bacteria | 16350 |
| 588 | Ga0307517_10239533 | 3300028786 | Bacteria | 1078 |
| 589 | Ga0307515_10037445 | 3300028794 | Bacteria | 7801 |
| 590 | Ga0307515_10313545 | 3300028794 | Bacteria | 1241 |
| 591 | Ga0307512_10104489 | 3300030522 | Bacteria | 1900 |
| 592 | Ga0265330_10009605 | 3300031235 | Bacteria | 4590 |
| 593 | Ga0265330_10014019 | 3300031235 | Bacteria | 3722 |
| 594 | Ga0265328_10101253 | 3300031239 | Bacteria | 1067 |
| 595 | Ga0265340_10013754 | 3300031247 | Bacteria | 4244 |
| 596 | Ga0265316_10038043 | 3300031344 | Bacteria | 3880 |
| 597 | Ga0265316_10135129 | 3300031344 | Bacteria | 1856 |
| 598 | Ga0307513_10105731 | 3300031456 | Bacteria | 2823 |
| 599 | Ga0307513_10116572 | 3300031456 | Bacteria | 2649 |
| 600 | Ga0307513_10730428 | 3300031456 | Bacteria | 696 |
| 601 | Ga0307408_100093076 | 3300031548 | Bacteria | 2280 |
| 602 | Ga0307408_100268596 | 3300031548 | Bacteria | 1415 |
| 603 | Ga0307408_100549943 | 3300031548 | Bacteria | 1018 |
| 604 | Ga0307408_101138755 | 3300031548 | Bacteria | 725 |
| 605 | Ga0307408_102363302 | 3300031548 | Bacteria | 515 |
| 606 | Ga0307508_10026412 | 3300031616 | Bacteria | 5263 |
| 607 | Ga0307514_10320590 | 3300031649 | Bacteria | 851 |
| 608 | Ga0265342_10136272 | 3300031712 | Bacteria | 1372 |
| 609 | Ga0307516_10002153 | 3300031730 | Bacteria | 26718 |
| 610 | Ga0307516_10033701 | 3300031730 | Bacteria | 5153 |
| 611 | Ga0307516_10038892 | 3300031730 | Bacteria | 4743 |
| 612 | Ga0307516_10232620 | 3300031730 | Bacteria | 1546 |
| 613 | Ga0307516_10520583 | 3300031730 | Bacteria | 843 |
| 614 | Ga0307405_10087782 | 3300031731 | Bacteria | 2051 |
| 615 | Ga0307405_10160054 | 3300031731 | Bacteria | 1593 |
| 616 | Ga0307405_10507376 | 3300031731 | Bacteria | 968 |
| 617 | Ga0307406_10098745 | 3300031901 | Bacteria | 1983 |
| 618 | Ga0307406_10341238 | 3300031901 | Bacteria | 1167 |
| 619 | Ga0307406_11457624 | 3300031901 | Bacteria | 601 |
| 620 | Ga0307407_10395947 | 3300031903 | Bacteria | 990 |
| 621 | Ga0307407_10610292 | 3300031903 | Bacteria | 813 |
| 622 | Ga0307412_10102251 | 3300031911 | Bacteria | 2029 |
| 623 | Ga0307412_10189714 | 3300031911 | Bacteria | 1553 |
| 624 | Ga0307412_10925364 | 3300031911 | Bacteria | 766 |
| 625 | Ga0307409_100296235 | 3300031995 | Bacteria | 1502 |
| 626 | Ga0307416_100035338 | 3300032002 | Bacteria | 3815 |
| 627 | Ga0307416_100114693 | 3300032002 | Bacteria | 2384 |
| 628 | Ga0307416_100279052 | 3300032002 | Bacteria | 1646 |
| 629 | Ga0307416_100302237 | 3300032002 | Bacteria | 1591 |
| 630 | Ga0307416_100508001 | 3300032002 | Bacteria | 1271 |
| 631 | Ga0307416_100713568 | 3300032002 | Bacteria | 1093 |
| 632 | Ga0307414_11034754 | 3300032004 | Bacteria | 757 |
| 633 | Ga0307411_10136013 | 3300032005 | Bacteria | 1804 |
| 634 | Ga0307411_10202581 | 3300032005 | Bacteria | 1525 |
| 635 | Ga0307415_100243316 | 3300032126 | Bacteria | 1457 |
| 636 | Ga0307415_100652738 | 3300032126 | Bacteria | 943 |
| 637 | Ga0307510_10007834 | 3300033180 | Bacteria | 12735 |
| 638 | Ga0307510_10096261 | 3300033180 | Bacteria | 2776 |
| 639 | Ga0315911_1000076 | 3300033442 | Bacteria | 14517 |
| 640 | Ga0373930_0005846 | 3300034816 | Bacteria | 2060 |
| 641 | Ga0373958_0161831 | 3300034819 | Bacteria | 566 |
| 642 | Ga0373929_0099883 | 3300035085 | Bacteria | 730 |
| 643 | Ga0373934_0017039 | 3300035086 | Bacteria | 2769 |
| 644 | Ga0373940_0359277 | 3300035088 | Bacteria | 513 |
| 645 | Ga0373923_0004715 | 3300035111 | Bacteria | 4552 |
| 646 | Ga0373932_0012313 | 3300035112 | Bacteria | 2105 |
| 647 | Ga0373936_0091591 | 3300035113 | Bacteria | 1275 |
| 648 | Ga0373939_0143798 | 3300035114 | Bacteria | 862 |
| 649 | Ga0373945_0150553 | 3300035116 | Bacteria | 943 |
| 650 | Ga0373953_0013127 | 3300035117 | Bacteria | 2950 |
| 651 | Ga0373954_0001537 | 3300035118 | Bacteria | 9390 |
| 652 | Ga0373956_0007238 | 3300035119 | Bacteria | 4468 |
| 653 | Ga0373957_0027090 | 3300035120 | Bacteria | 2079 |
| 654 | Ga0373943_0167207 | 3300035170 | Bacteria | 1201 |
| 655 | Ga0373946_0030362 | 3300035171 | Bacteria | 2157 |
| 656 | Ga0373955_0000421 | 3300035172 | Bacteria | 17923 |
| 657 | Ga0373924_0005265 | 3300035410 | Bacteria | 4573 |
| 658 | Ga0373931_0002773 | 3300035691 | Bacteria | 7796 |
| 659 | Ga0373935_0055204 | 3300035692 | Bacteria | 2531 |
| 660 | Ga0373927_0106329 | 3300035695 | Bacteria | 1827 |
| 661 | Ga0373933_0012141 | 3300035724 | Bacteria | 4757 |
| 662 | Ga0373937_0017372 | 3300036401 | Bacteria | 6407 |
| 663 | Ga0373925_0643718 | 3300037068 | Bacteria | 873 |
| 664 | Ga0373925_0754851 | 3300037068 | Bacteria | 802 |
| 665 | Ga0395900_0827956 | 3300037418 | Bacteria | 852 |
| 666 | Ga0395898_0141730 | 3300037466 | Bacteria | 2301 |
| 667 | Ga0395905_0018502 | 3300037471 | Bacteria | 6613 |
| 668 | Ga0395905_0792214 | 3300037471 | Bacteria | 851 |
| 669 | Ga0436365_1432829 | 3300039437 | Bacteria | 1102 |
| 670 | Ga0439465_0212985 | 3300041413 | Bacteria | 707 |
| 671 | Ga0451791_0937014 | 3300041451 | Bacteria | 518 |
| 672 | Ga0451791_1187594 | 3300041451 | Bacteria | 1105 |
| 673 | Ga0451791_1597070 | 3300041451 | Bacteria | 676 |
| 674 | Ga0451793_0322342 | 3300041452 | Bacteria | 651 |
| 675 | Ga0451793_0591189 | 3300041452 | Bacteria | 618 |
| 676 | Ga0451797_1451936 | 3300041453 | Bacteria | 642 |
| 677 | Ga0451798_0889967 | 3300041458 | Bacteria | 635 |
| 678 | Ga0451800_0821725 | 3300041459 | Bacteria | 987 |
| 679 | Ga0451843_0538096 | 3300041509 | Bacteria | 1206 |
| 680 | Ga0451855_0326912 | 3300041511 | Bacteria | 654 |
| 681 | Ga0451853_2025861 | 3300041512 | Bacteria | 576 |
| 682 | Ga0451853_2279900 | 3300041512 | Bacteria | 579 |
| 683 | Ga0439431_0051291 | 3300041997 | Bacteria | 1070 |
| 684 | Ga0439463_169067 | 3300042016 | Bacteria | 567 |
| 685 | Ga0439458_0073616 | 3300042157 | Bacteria | 865 |
| 686 | Ga0439459_0023725 | 3300042438 | Bacteria | 1198 |
| 687 | Ga0466963_0031196 | 3300044694 | Bacteria | 3444 |
| 688 | Ga0466967_0828729 | 3300045976 | Bacteria | 919 |
| 689 | Ga0495617_011757 | 3300046452 | Bacteria | 2985 |
| 690 | Ga0495617_245138 | 3300046452 | Bacteria | 553 |
| 691 | Ga0495627_060934 | 3300046453 | Bacteria | 1117 |
| 692 | Ga0495592_0001087 | 3300046454 | Bacteria | 18850 |
| 693 | Ga0495603_0251449 | 3300046455 | Bacteria | 1017 |
| 694 | Ga0495603_0344861 | 3300046455 | Bacteria | 854 |
| 695 | Ga0495603_0666955 | 3300046455 | Bacteria | 595 |
| 696 | Ga0495591_136099 | 3300046458 | Bacteria | 594 |
| 697 | Ga0495629_0000232 | 3300046459 | Bacteria | 49422 |
| 698 | Ga0495638_0205673 | 3300046460 | Bacteria | 1108 |
| 699 | Ga0495638_0362734 | 3300046460 | Bacteria | 761 |
| 700 | Ga0495638_0475664 | 3300046460 | Bacteria | 633 |
| 701 | Ga0495641_0045103 | 3300046461 | Bacteria | 2031 |
| 702 | Ga0495651_0056910 | 3300046462 | Bacteria | 3002 |
| 703 | Ga0495651_0084336 | 3300046462 | Bacteria | 2394 |
| 704 | Ga0495653_0000575 | 3300046463 | Bacteria | 28178 |
| 705 | Ga0495650_0166007 | 3300046471 | Bacteria | 784 |
| 706 | Ga0495650_0191533 | 3300046471 | Bacteria | 714 |
| 707 | Ga0495580_0062006 | 3300046472 | Bacteria | 2624 |
| 708 | Ga0495582_0052731 | 3300046473 | Bacteria | 2243 |
| 709 | Ga0495582_0641688 | 3300046473 | Bacteria | 614 |
| 710 | Ga0495605_0196278 | 3300046474 | Bacteria | 881 |
| 711 | Ga0495605_0319029 | 3300046474 | Bacteria | 655 |
| 712 | Ga0495639_0026104 | 3300046475 | Bacteria | 2580 |
| 713 | Ga0495639_0419831 | 3300046475 | Bacteria | 677 |
| 714 | Ga0495664_0099957 | 3300046477 | Bacteria | 1747 |
| 715 | Ga0495584_0154900 | 3300046491 | Bacteria | 1164 |
| 716 | Ga0495584_0361259 | 3300046491 | Bacteria | 737 |
| 717 | Ga0495584_0471173 | 3300046491 | Bacteria | 639 |
| 718 | Ga0495585_0049317 | 3300046492 | Bacteria | 2338 |
| 719 | Ga0495585_0070049 | 3300046492 | Bacteria | 1913 |
| 720 | Ga0495585_0084017 | 3300046492 | Bacteria | 1722 |
| 721 | Ga0495594_0096190 | 3300046499 | Bacteria | 1663 |
| 722 | Ga0495594_0349173 | 3300046499 | Bacteria | 842 |
| 723 | Ga0495594_0548169 | 3300046499 | Bacteria | 656 |
| 724 | Ga0495606_0287303 | 3300046507 | Bacteria | 896 |
| 725 | Ga0495606_0611888 | 3300046507 | Bacteria | 533 |
| 726 | Ga0495608_0010274 | 3300046511 | Bacteria | 6530 |
| 727 | Ga0495610_0226410 | 3300046512 | Bacteria | 752 |
| 728 | Ga0495616_0245235 | 3300046513 | Bacteria | 771 |
| 729 | Ga0495616_0326654 | 3300046513 | Bacteria | 643 |
| 730 | Ga0495618_0085312 | 3300046514 | Bacteria | 2018 |
| 731 | Ga0495620_0049974 | 3300046515 | Bacteria | 1786 |
| 732 | Ga0495628_0021846 | 3300046516 | Bacteria | 5259 |
| 733 | Ga0495628_0159962 | 3300046516 | Bacteria | 1712 |
| 734 | Ga0495628_0459436 | 3300046516 | Bacteria | 924 |
| 735 | Ga0495631_0101877 | 3300046518 | Bacteria | 1235 |
| 736 | Ga0495631_0214324 | 3300046518 | Bacteria | 822 |
| 737 | Ga0495632_0221208 | 3300046519 | Bacteria | 856 |
| 738 | Ga0495632_0331705 | 3300046519 | Bacteria | 671 |
| 739 | Ga0495637_0148877 | 3300046520 | Bacteria | 884 |
| 740 | Ga0495643_0233037 | 3300046522 | Bacteria | 867 |
| 741 | Ga0495644_0056399 | 3300046523 | Bacteria | 1476 |
| 742 | Ga0495644_0208465 | 3300046523 | Bacteria | 754 |
| 743 | Ga0495644_0325184 | 3300046523 | Bacteria | 603 |
| 744 | Ga0495648_0000767 | 3300046524 | Bacteria | 34209 |
| 745 | Ga0495648_0262289 | 3300046524 | Bacteria | 828 |
| 746 | Ga0495648_0514572 | 3300046524 | Bacteria | 511 |
| 747 | Ga0495663_0057218 | 3300046525 | Bacteria | 1219 |
| 748 | Ga0495642_0144413 | 3300046528 | Bacteria | 1028 |
| 749 | Ga0495642_0205083 | 3300046528 | Bacteria | 860 |
| 750 | Ga0495652_0015475 | 3300046529 | Bacteria | 6829 |
| 751 | Ga0495654_0251578 | 3300046530 | Bacteria | 736 |
| 752 | Ga0495665_0246992 | 3300046531 | Bacteria | 919 |
| 753 | Ga0495640_0012477 | 3300046533 | Bacteria | 6488 |
| 754 | Ga0495587_0003955 | 3300046536 | Bacteria | 9827 |
| 755 | Ga0495598_0007022 | 3300046537 | Bacteria | 2565 |
| 756 | Ga0495598_0076620 | 3300046537 | Bacteria | 1064 |
| 757 | Ga0495598_0261384 | 3300046537 | Bacteria | 644 |
| 758 | Ga0495609_0032697 | 3300046538 | Bacteria | 2362 |
| 759 | Ga0495609_0250597 | 3300046538 | Bacteria | 729 |
| 760 | Ga0495621_0029247 | 3300046539 | Bacteria | 1877 |
| 761 | Ga0495645_0034945 | 3300046543 | Bacteria | 3664 |
| 762 | Ga0495622_0303227 | 3300046557 | Bacteria | 696 |
| 763 | Ga0495633_0052304 | 3300046558 | Bacteria | 1924 |
| 764 | Ga0495633_0301487 | 3300046558 | Bacteria | 728 |
| 765 | Ga0495667_0001504 | 3300046559 | Bacteria | 15376 |
| 766 | Ga0495656_0020292 | 3300046615 | Bacteria | 2576 |
| 767 | Ga0495656_0097647 | 3300046615 | Bacteria | 1353 |
| 768 | Ga0495656_0174697 | 3300046615 | Bacteria | 1052 |
| 769 | Ga0495656_0251695 | 3300046615 | Bacteria | 892 |
| 770 | Ga0495668_0107764 | 3300046616 | Bacteria | 1524 |
| 771 | Ga0495668_0118052 | 3300046616 | Bacteria | 1451 |
| 772 | Ga0495668_0208683 | 3300046616 | Bacteria | 1069 |
| 773 | Ga0495668_0288341 | 3300046616 | Bacteria | 899 |
| 774 | Ga0495668_0855326 | 3300046616 | Bacteria | 504 |
| 775 | Ga0495634_0044765 | 3300046642 | Bacteria | 2994 |
| 776 | Ga0495611_0290359 | 3300046648 | Bacteria | 754 |
| 777 | Ga0495625_0121382 | 3300046660 | Bacteria | 1778 |
| 778 | Ga0495625_0149403 | 3300046660 | Bacteria | 1571 |
| 779 | Ga0495625_0251692 | 3300046660 | Bacteria | 1146 |
| 780 | Ga0495625_0394530 | 3300046660 | Bacteria | 866 |
| 781 | Ga0495625_0682651 | 3300046660 | Bacteria | 608 |
| 782 | Ga0495625_0779557 | 3300046660 | Bacteria | 558 |
| 783 | Ga0495625_0887667 | 3300046660 | Bacteria | 512 |
| 784 | Ga0495635_0004681 | 3300046663 | Bacteria | 9498 |
| 785 | Ga0495635_0202498 | 3300046663 | Bacteria | 1346 |
| 786 | Ga0495635_0554567 | 3300046663 | Bacteria | 753 |
| 787 | Ga0495659_0005622 | 3300046664 | Bacteria | 3949 |
| 788 | Ga0495659_0058896 | 3300046664 | Bacteria | 1414 |
| 789 | Ga0495661_0115165 | 3300046665 | Bacteria | 1493 |
| 790 | Ga0495661_0276719 | 3300046665 | Bacteria | 847 |
| 791 | Ga0495661_0350958 | 3300046665 | Bacteria | 726 |
| 792 | Ga0495588_0052172 | 3300046674 | Bacteria | 2107 |
| 793 | Ga0495588_0476097 | 3300046674 | Bacteria | 655 |
| 794 | Ga0495657_0002790 | 3300046675 | Bacteria | 14529 |
| 795 | Ga0495599_0000374 | 3300046678 | Bacteria | 26092 |
| 796 | Ga0495623_0003450 | 3300046679 | Bacteria | 10460 |
| 797 | Ga0495623_0100202 | 3300046679 | Bacteria | 1766 |
| 798 | Ga0495646_0012512 | 3300046680 | Bacteria | 5394 |
| 799 | Ga0495647_0110369 | 3300046681 | Bacteria | 1147 |
| 800 | Ga0495647_0636201 | 3300046681 | Bacteria | 502 |
| 801 | Ga0495658_0895544 | 3300046683 | Bacteria | 567 |
| 802 | Ga0495669_0071854 | 3300046684 | Bacteria | 1578 |
| 803 | Ga0495669_0088882 | 3300046684 | Bacteria | 1424 |
| 804 | Ga0495669_0206828 | 3300046684 | Bacteria | 939 |
| 805 | Ga0495669_0348144 | 3300046684 | Bacteria | 716 |
| 806 | Ga0495669_0557729 | 3300046684 | Bacteria | 557 |
| 807 | Ga0495613_0173806 | 3300046689 | Bacteria | 1528 |
| 808 | Ga0495613_0361477 | 3300046689 | Bacteria | 995 |
| 809 | Ga0495624_0441369 | 3300046690 | Bacteria | 780 |
| 810 | Ga0495670_0106179 | 3300046691 | Bacteria | 1450 |
| 811 | Ga0495670_0216270 | 3300046691 | Bacteria | 1017 |
| 812 | Ga0495670_0406804 | 3300046691 | Bacteria | 735 |
| 813 | Ga0495671_0058193 | 3300046692 | Bacteria | 1912 |
| 814 | Ga0495649_0210466 | 3300046694 | Bacteria | 1007 |
| 815 | Ga0495649_0379303 | 3300046694 | Bacteria | 712 |
| 816 | Ga0495649_0670095 | 3300046694 | Bacteria | 509 |
| 817 | Ga0495589_0140716 | 3300046794 | Bacteria | 1155 |
| 818 | Ga0495589_0275926 | 3300046794 | Bacteria | 782 |
| 819 | Ga0495589_0283989 | 3300046794 | Bacteria | 769 |
| 820 | Ga0495589_0297304 | 3300046794 | Bacteria | 749 |
| 821 | Ga0495589_0407574 | 3300046794 | Bacteria | 624 |
| 822 | Ga0495600_0000970 | 3300046809 | Bacteria | 15447 |
| 823 | Ga0495600_0380910 | 3300046809 | Bacteria | 880 |
| 824 | Ga0495660_0147676 | 3300046810 | Bacteria | 1164 |
| 825 | Ga0495581_0809334 | 3300047315 | Bacteria | 537 |
| 826 | Ga0495604_0003086 | 3300047317 | Bacteria | 13324 |
| 827 | Ga0495636_0054101 | 3300047318 | Bacteria | 1686 |
| 828 | Ga0495636_0109509 | 3300047318 | Bacteria | 1214 |
| 829 | Ga0495674_0146076 | 3300047319 | Bacteria | 1985 |
| 830 | Ga0495674_0252273 | 3300047319 | Bacteria | 1452 |
| 831 | Ga0495672_0024556 | 3300047320 | Bacteria | 3879 |
| 832 | Ga0495672_0159882 | 3300047320 | Bacteria | 1159 |
| 833 | Ga0495676_0043899 | 3300047321 | Bacteria | 3654 |
| 834 | Ga0495676_0742707 | 3300047321 | Bacteria | 634 |
| 835 | Ga0495680_0001718 | 3300047322 | Bacteria | 23247 |
| 836 | Ga0495680_0330668 | 3300047322 | Bacteria | 1065 |
| 837 | Ga0495683_0076343 | 3300047323 | Bacteria | 1639 |
| 838 | Ga0495683_0342624 | 3300047323 | Bacteria | 632 |
| 839 | Ga0495675_0012009 | 3300047444 | Bacteria | 5444 |
| 840 | Ga0495677_0090591 | 3300047445 | Bacteria | 1152 |
| 841 | Ga0495679_043384 | 3300047446 | Bacteria | 1383 |
| 842 | Ga0495673_0061791 | 3300047469 | Bacteria | 1602 |
| 843 | Ga0495673_0111052 | 3300047469 | Bacteria | 1096 |
| 844 | Ga0495681_0068534 | 3300047470 | Bacteria | 1614 |
| 845 | Ga0495681_0407177 | 3300047470 | Bacteria | 507 |
| 846 | Ga0495684_0000052 | 3300047471 | Bacteria | 85125 |
| 847 | Ga0495686_0215418 | 3300047472 | Bacteria | 1095 |
| 848 | Ga0495686_0304507 | 3300047472 | Bacteria | 878 |
| 849 | Ga0495686_0730832 | 3300047472 | Bacteria | 503 |
| 850 | Ga0495593_0000126 | 3300047673 | Bacteria | 37465 |
| 851 | Ga0495602_0010424 | 3300048088 | Bacteria | 9646 |
| 852 | Ga0495602_0524197 | 3300048088 | Bacteria | 825 |
| 853 | Ga0495614_0091053 | 3300048089 | Bacteria | 1327 |
| 854 | Ga0495615_0170665 | 3300048090 | Bacteria | 658 |
| 855 | Ga0495626_0265118 | 3300048091 | Bacteria | 686 |
| 856 | Ga0496100_0021406 | 3300048903 | Bacteria | 3893 |
| 857 | Ga0496100_0021807 | 3300048903 | Bacteria | 3865 |
| 858 | Ga0496100_0132672 | 3300048903 | Bacteria | 1756 |
| 859 | Ga0496100_0383208 | 3300048903 | Bacteria | 1068 |
| 860 | Ga0496101_0001512 | 3300048904 | Bacteria | 13914 |
| 861 | Ga0496101_0178464 | 3300048904 | Bacteria | 1635 |
| 862 | Ga0496101_0273877 | 3300048904 | Bacteria | 1318 |
| 863 | Ga0496102_0033502 | 3300048905 | Bacteria | 4617 |
| 864 | Ga0496102_0033895 | 3300048905 | Bacteria | 4591 |
| 865 | Ga0496102_0198935 | 3300048905 | Bacteria | 1889 |
| 866 | Ga0496102_0295226 | 3300048905 | Bacteria | 1527 |
| 867 | Ga0496102_0319248 | 3300048905 | Bacteria | 1463 |
| 868 | Ga0496102_0538555 | 3300048905 | Bacteria | 1090 |
| 869 | Ga0496102_0542080 | 3300048905 | Bacteria | 1086 |
| 870 | Ga0496103_0012371 | 3300048906 | Bacteria | 5062 |
| 871 | Ga0496103_0069769 | 3300048906 | Bacteria | 2198 |
| 872 | Ga0496103_0590072 | 3300048906 | Bacteria | 708 |
| 873 | Ga0496103_0879205 | 3300048906 | Bacteria | 562 |
| 874 | Ga0496104_1009227 | 3300048907 | Bacteria | 736 |
| 875 | Ga0496104_1293685 | 3300048907 | Bacteria | 632 |
| 876 | Ga0496105_0032534 | 3300048908 | Bacteria | 4280 |
| 877 | Ga0496105_0280558 | 3300048908 | Bacteria | 1343 |
| 878 | Ga0496105_0551231 | 3300048908 | Bacteria | 900 |
| 879 | Ga0496106_0038427 | 3300048909 | Bacteria | 3582 |
| 880 | Ga0496106_0056750 | 3300048909 | Bacteria | 2960 |
| 881 | Ga0496106_0059762 | 3300048909 | Bacteria | 2888 |
| 882 | Ga0496106_0277926 | 3300048909 | Bacteria | 1341 |
| 883 | Ga0496106_0438668 | 3300048909 | Bacteria | 1049 |
| 884 | Ga0496107_0050672 | 3300048910 | Bacteria | 2993 |
| 885 | Ga0496107_0164136 | 3300048910 | Bacteria | 1647 |
| 886 | Ga0496107_0464650 | 3300048910 | Bacteria | 939 |
| 887 | Ga0496108_0040448 | 3300048911 | Bacteria | 3887 |
| 888 | Ga0496108_0056204 | 3300048911 | Bacteria | 3306 |
| 889 | Ga0496109_0031405 | 3300048912 | Bacteria | 4766 |
| 890 | Ga0496109_0062268 | 3300048912 | Bacteria | 3411 |
| 891 | Ga0496109_0327331 | 3300048912 | Bacteria | 1446 |
| 892 | Ga0496109_0700257 | 3300048912 | Bacteria | 950 |
| 893 | Ga0496110_0082989 | 3300048913 | Bacteria | 2858 |
| 894 | Ga0496110_0084761 | 3300048913 | Bacteria | 2828 |
| 895 | Ga0496110_0179327 | 3300048913 | Bacteria | 1923 |
| 896 | Ga0496111_0016870 | 3300048914 | Bacteria | 5040 |
| 897 | Ga0496111_0692845 | 3300048914 | Bacteria | 741 |
| 898 | Ga0496112_0123281 | 3300048915 | Bacteria | 2562 |
| 899 | Ga0496112_0150606 | 3300048915 | Bacteria | 2293 |
| 900 | Ga0496112_0164382 | 3300048915 | Bacteria | 2185 |
| 901 | Ga0496112_1047994 | 3300048915 | Bacteria | 734 |
| 902 | Ga0496113_0002928 | 3300048916 | Bacteria | 10075 |
| 903 | Ga0496113_0089701 | 3300048916 | Bacteria | 2367 |
| 904 | Ga0496113_0188813 | 3300048916 | Bacteria | 1635 |
| 905 | Ga0496113_0801082 | 3300048916 | Bacteria | 749 |
| 906 | Ga0496114_0032370 | 3300048917 | Bacteria | 4303 |
| 907 | Ga0496114_0056698 | 3300048917 | Bacteria | 3270 |
| 908 | Ga0496114_0199508 | 3300048917 | Bacteria | 1752 |
| 909 | Ga0496114_0398277 | 3300048917 | Bacteria | 1219 |
| 910 | Ga0496114_0858829 | 3300048917 | Bacteria | 788 |
| 911 | Ga0496115_0005545 | 3300048918 | Bacteria | 9183 |
| 912 | Ga0496115_0012554 | 3300048918 | Bacteria | 6382 |
| 913 | Ga0496115_0157169 | 3300048918 | Bacteria | 1878 |
| 914 | Ga0496115_0185972 | 3300048918 | Bacteria | 1717 |
| 915 | Ga0496115_0765283 | 3300048918 | Bacteria | 754 |
| 916 | Ga0496116_0094414 | 3300048919 | Bacteria | 1808 |
| 917 | Ga0496117_0161014 | 3300048920 | Bacteria | 1315 |
| 918 | Ga0496118_0146029 | 3300048921 | Bacteria | 1489 |
| 919 | Ga0496118_0467257 | 3300048921 | Bacteria | 636 |
| 920 | Ga0496119_0058080 | 3300048922 | Bacteria | 2334 |
| 921 | Ga0496119_0167217 | 3300048922 | Bacteria | 1164 |
| 922 | Ga0496119_0531289 | 3300048922 | Bacteria | 543 |
| 923 | Ga0496120_0420744 | 3300048923 | Bacteria | 587 |
| 924 | Ga0496121_0024127 | 3300048924 | Bacteria | 5826 |
| 925 | Ga0496121_0025355 | 3300048924 | Bacteria | 5630 |
| 926 | Ga0496121_0058780 | 3300048924 | Bacteria | 3175 |
| 927 | Ga0496121_0161254 | 3300048924 | Bacteria | 1639 |
| 928 | Ga0496121_0254981 | 3300048924 | Bacteria | 1214 |
| 929 | Ga0496121_0383874 | 3300048924 | Bacteria | 925 |
| 930 | Ga0496124_0035110 | 3300048927 | Bacteria | 4390 |
| 931 | Ga0496124_0433735 | 3300048927 | Bacteria | 901 |
| 932 | Ga0496124_0711490 | 3300048927 | Bacteria | 635 |
| 933 | Ga0496125_0148640 | 3300048928 | Bacteria | 1614 |
| 934 | Ga0496125_0256772 | 3300048928 | Bacteria | 1098 |
| 935 | Ga0496126_0010541 | 3300048929 | Bacteria | 9677 |
| 936 | Ga0496126_0020133 | 3300048929 | Bacteria | 6549 |
| 937 | Ga0496126_0044803 | 3300048929 | Bacteria | 4071 |
| 938 | Ga0496126_0151219 | 3300048929 | Bacteria | 1989 |
| 939 | Ga0496126_0585094 | 3300048929 | Bacteria | 881 |
| 940 | Ga0496126_0836504 | 3300048929 | Bacteria | 703 |
| 941 | Ga0495678_072488 | 3300049459 | Bacteria | 1258 |
| 942 | Ga0495682_0038197 | 3300049460 | Bacteria | 1765 |
| 943 | Ga0501032_0662617 | 3300049569 | Bacteria | 662 |
| 944 | Ga0501034_0628916 | 3300049571 | Bacteria | 977 |
| 945 | Ga0501043_0495050 | 3300049579 | Bacteria | 914 |
| 946 | Ga0501046_0045521 | 3300049580 | Bacteria | 3486 |
| 947 | Ga0501047_0017816 | 3300049581 | Bacteria | 6804 |
| 948 | Ga0501067_0075522 | 3300049583 | Bacteria | 1867 |
| 949 | Ga0501068_0181816 | 3300049584 | Bacteria | 1330 |
| 950 | Ga0501069_0715564 | 3300049585 | Bacteria | 604 |
| 951 | Ga0501073_0044960 | 3300049589 | Bacteria | 3112 |
| 952 | Ga0501074_0039204 | 3300049590 | Bacteria | 3431 |
| 953 | Ga0501075_0672839 | 3300049591 | Bacteria | 789 |
| 954 | Ga0501079_1361530 | 3300049741 | Bacteria | 558 |
| 955 | Ga0501080_0009144 | 3300049742 | Bacteria | 9021 |
| 956 | Ga0501035_0429847 | 3300049822 | Bacteria | 1095 |
| 957 | Ga0501045_0331924 | 3300049824 | Bacteria | 1132 |
| 958 | nmdc:mga03683_59832_c1 | 3300050489 | Bacteria | 1608 |
| 959 | nmdc:mga03683_65968_c1 | 3300050489 | Bacteria | 1538 |
| 960 | nmdc:mga03n38_14534_c1 | 3300050490 | Bacteria | 3020 |
| 961 | nmdc:mga03n38_160367_c1 | 3300050490 | Bacteria | 1138 |
| 962 | nmdc:mga03n38_247658_c1 | 3300050490 | Bacteria | 940 |
| 963 | nmdc:mga03n38_298821_c1 | 3300050490 | Bacteria | 864 |
| 964 | nmdc:mga03n38_856169_c1 | 3300050490 | Bacteria | 532 |
| 965 | nmdc:mga03n38_946287_c1 | 3300050490 | Bacteria | 508 |
| 966 | nmdc:mga00v17_24823_c1 | 3300050491 | Bacteria | 3479 |
| 967 | nmdc:mga00v17_3320_c1 | 3300050491 | Bacteria | 8295 |
| 968 | nmdc:mga0yw44_1054796_c1 | 3300050492 | Bacteria | 550 |
| 969 | nmdc:mga0yw44_138210_c1 | 3300050492 | Bacteria | 1582 |
| 970 | nmdc:mga0yw44_145311_c1 | 3300050492 | Bacteria | 1544 |
| 971 | nmdc:mga0yw44_209617_c1 | 3300050492 | Bacteria | 1289 |
| 972 | nmdc:mga0yw44_280742_c1 | 3300050492 | Bacteria | 1113 |
| 973 | nmdc:mga0yw44_29183_c1 | 3300050492 | Bacteria | 3183 |
| 974 | nmdc:mga0yw44_791994_c1 | 3300050492 | Bacteria | 644 |
| 975 | nmdc:mga0k408_121414_c1 | 3300050493 | Bacteria | 1548 |
| 976 | nmdc:mga0k408_281160_c1 | 3300050493 | Bacteria | 993 |
| 977 | nmdc:mga0k408_409445_c1 | 3300050493 | Bacteria | 807 |
| 978 | nmdc:mga0k408_451528_c1 | 3300050493 | Bacteria | 763 |
| 979 | nmdc:mga0k408_566032_c1 | 3300050493 | Bacteria | 671 |
| 980 | nmdc:mga0k408_84163_c1 | 3300050493 | Bacteria | 1866 |
| 981 | nmdc:mga06z11_52627_c1 | 3300050494 | Bacteria | 2090 |
| 982 | nmdc:mga06z11_603137_c1 | 3300050494 | Bacteria | 668 |
| 983 | nmdc:mga06z11_8453_c1 | 3300050494 | Bacteria | 4293 |
| 984 | nmdc:mga06z11_870847_c1 | 3300050494 | Bacteria | 549 |
| 985 | nmdc:mga04h51_150570_c1 | 3300050495 | Bacteria | 889 |
| 986 | nmdc:mga04h51_72475_c1 | 3300050495 | Bacteria | 1206 |
| 987 | nmdc:mga07m45_14522_c1 | 3300050496 | Bacteria | 4197 |
| 988 | nmdc:mga07m45_442553_c1 | 3300050496 | Bacteria | 754 |
| 989 | nmdc:mga07m45_567485_c1 | 3300050496 | Bacteria | 656 |
| 990 | nmdc:mga05p37_108944_c1 | 3300050507 | Bacteria | 3407 |
| 991 | nmdc:mga09592_807967_c1 | 3300050508 | Bacteria | 793 |
| 992 | nmdc:mga06r32_866156_c1 | 3300050510 | Bacteria | 861 |
| 993 | nmdc:mga08y16_1055318_c1 | 3300050511 | Bacteria | 790 |
| 994 | nmdc:mga08y16_454773_c1 | 3300050511 | Bacteria | 1305 |
| 995 | nmdc:mga08y16_785429_c1 | 3300050511 | Bacteria | 946 |
| 996 | nmdc:mga0n895_71870_c1 | 3300050512 | Bacteria | 3431 |
| 997 | nmdc:mga0rr50_223423_c1 | 3300050513 | Bacteria | 1556 |
| 998 | nmdc:mga08x19_1201975_c1 | 3300050514 | Bacteria | 537 |
| 999 | nmdc:mga0a205_694597_c1 | 3300050515 | Bacteria | 867 |
| 1000 | nmdc:mga0sz30_164762_c1 | 3300050516 | Bacteria | 982 |
| 1001 | nmdc:mga0sz30_472159_c1 | 3300050516 | Bacteria | 564 |
| 1002 | nmdc:mga0sz30_82064_c1 | 3300050516 | Bacteria | 1396 |
| 1003 | Ga0495601_0009158 | 3300053077 | Bacteria | 5848 |
| 1004 | Ga0495601_0065866 | 3300053077 | Bacteria | 2306 |
| 1005 | Ga0495601_0174222 | 3300053077 | Bacteria | 1406 |
| 1006 | Ga0495601_0294966 | 3300053077 | Bacteria | 1057 |
| 1007 | Ga0500610_0222259 | 3300053079 | Bacteria | 893 |
| 1008 | Ga0500635_0114836 | 3300053080 | Bacteria | 1003 |
| 1009 | Ga0495655_0080185 | 3300053083 | Bacteria | 931 |
| 1010 | Ga0495595_0001810 | 3300053084 | Bacteria | 8330 |
| 1011 | Ga0495595_0003500 | 3300053084 | Bacteria | 6234 |
| 1012 | Ga0495619_0000458 | 3300053085 | Bacteria | 27498 |
| 1013 | Ga0495619_0036103 | 3300053085 | Bacteria | 3217 |
| 1014 | Ga0495619_0379632 | 3300053085 | Bacteria | 977 |
| 1015 | Ga0500643_008568 | 3300053087 | Bacteria | 4009 |
| 1016 | Ga0500581_090287 | 3300053089 | Bacteria | 1519 |
| 1017 | Ga0500646_0382550 | 3300053090 | Bacteria | 517 |
| 1018 | Ga0500583_0180690 | 3300053092 | Bacteria | 1050 |
| 1019 | Ga0500583_0259058 | 3300053092 | Bacteria | 857 |
| 1020 | Ga0500583_0292914 | 3300053092 | Bacteria | 797 |
| 1021 | Ga0500651_0477564 | 3300053093 | Bacteria | 690 |
| 1022 | Ga0500641_0050832 | 3300053096 | Bacteria | 1704 |
| 1023 | Ga0500650_0250026 | 3300053098 | Bacteria | 795 |
| 1024 | Ga0500650_0354165 | 3300053098 | Bacteria | 641 |
| 1025 | Ga0500556_0108718 | 3300053104 | Bacteria | 1074 |
| 1026 | Ga0500594_0034745 | 3300053118 | Bacteria | 1348 |
| 1027 | Ga0500595_008603 | 3300053119 | Bacteria | 4164 |
| 1028 | Ga0500617_158167 | 3300053124 | Bacteria | 887 |
| 1029 | Ga0500642_0143799 | 3300053130 | Bacteria | 1119 |
| 1030 | Ga0500642_0374802 | 3300053130 | Bacteria | 627 |
| 1031 | Ga0500658_0177344 | 3300053134 | Bacteria | 969 |
| 1032 | Ga0500658_0219962 | 3300053134 | Bacteria | 870 |
| 1033 | Ga0500568_0395917 | 3300053139 | Bacteria | 500 |
| 1034 | Ga0500577_0154493 | 3300053142 | Bacteria | 974 |
| 1035 | Ga0500588_0060467 | 3300053146 | Bacteria | 1212 |
| 1036 | Ga0500589_021026 | 3300053147 | Bacteria | 2987 |
| 1037 | Ga0500589_092741 | 3300053147 | Bacteria | 1326 |
| 1038 | Ga0500589_110798 | 3300053147 | Bacteria | 1177 |
| 1039 | Ga0500590_134072 | 3300053148 | Bacteria | 1142 |
| 1040 | Ga0500604_0054722 | 3300053151 | Bacteria | 1239 |
| 1041 | Ga0500604_0149677 | 3300053151 | Bacteria | 792 |
| 1042 | Ga0500634_0045550 | 3300053161 | Bacteria | 2373 |
| 1043 | Ga0500634_0352965 | 3300053161 | Bacteria | 560 |
| 1044 | Ga0500638_034112 | 3300053162 | Bacteria | 2462 |
| 1045 | Ga0500636_0029007 | 3300053177 | Bacteria | 3267 |
| 1046 | Ga0500636_0087827 | 3300053177 | Bacteria | 1784 |
| 1047 | Ga0500636_0513243 | 3300053177 | Bacteria | 527 |
| 1048 | Ga0500645_174334 | 3300053730 | Bacteria | 586 |
| 1049 | Ga0500609_005864 | 3300053731 | Bacteria | 1677 |
| 1050 | Ga0500656_002657 | 3300053732 | Bacteria | 1632 |
| 1051 | Ga0530510_0260710 | 3300061734 | Bacteria | 1293 |
| 1052 | 2513656433 | 2513237096 | Bacteria | 8722461 |
| 1053 | 2513694850 | 2513237101 | Bacteria | 7952346 |
| 1054 | 2513715622 | 2513237104 | Bacteria | 10034502 |
| 1055 | 2513858989 | 2513237137 | Bacteria | 9558895 |
| 1056 | 2513917388 | 2513237145 | Bacteria | 8979722 |
| 1057 | 2517889605 | 2517572143 | Bacteria | 9484767 |
| 1058 | 2524535629 | 2524023228 | Bacteria | 10118060 |
| 1059 | 2671121204 | 2667528175 | Bacteria | 7532676 |
| 1060 | 2723842094 | 2721755755 | Bacteria | 8322773 |
| 1061 | 2728749210 | 2728368998 | Bacteria | 8720350 |
| 1062 | 2793077353 | |||
| 1063 | 2874610286 | 2874604998 | Bacteria | 7834745 |
| 1064 | 2876812757 | 2876808645 | Bacteria | 8824342 |
| 1065 | 2879111606 | 2879110137 | Bacteria | 8907982 |
| 1066 | 2885378009 | 2885374607 | Bacteria | 8927485 |
| 1067 | 2903754951 | 2903748898 | Bacteria | 9972761 |
| 1068 | 2904709443 | |||
| 1069 | 2906641117 | 2906635258 | Bacteria | 8601019 |
| 1070 | 2906665673 | 2906660503 | Bacteria | 8595048 |
| 1071 | 2908746156 | 2908739725 | Bacteria | 8628932 |
| 1072 | 2922366887 | 2922361189 | Bacteria | 7436256 |
| 1073 | 2922391939 | 2922386360 | Bacteria | 7017218 |
| 1074 | 2922433466 | |||
| 1075 | 3005483163 | 3005474847 | Bacteria | 9259049 |
| 1076 | 8006935527 | 8006933436 | Bacteria | 10410654 |
| 1077 | 8006971518 | 8006964411 | Bacteria | 8966052 |
| 1078 | 8006975454 | 8006973647 | Bacteria | 10679141 |
| 1079 | 8006985860 | 8006984368 | Bacteria | 9651211 |
| 1080 | 8007001481 | 8006994254 | Bacteria | 8309700 |
| 1081 | 8019563283 | 8019555841 | Bacteria | 9642137 |
| 1082 | 8019573363 | 8019565922 | Bacteria | 9639779 |
| 1083 | 8056679340 | 8056673599 | Bacteria | 7871253 |
| 1084 | Ga0070685_10625062 | |||
| 1085 | CNAas_1005993 | |||
| 1086 | JGI24750J21931_1017621 | |||
| 1087 | JGI24748J21848_1033116 | |||
| 1088 | JGI25165J46597_1025250 | |||
| 1089 | rootH1_10041688 | |||
| 1090 | JGI25404J52841_10017928 | |||
| 1091 | JGI25404J52841_10020963 | |||
| 1092 | Ga0065707_10283436 | |||
| 1093 | Ga0070658_11077041 | |||
| 1094 | Ga0070676_10338834 | |||
| 1095 | Ga0070676_10366967 | |||
| 1096 | Ga0070676_10500138 | |||
| 1097 | Ga0070676_10660764 | |||
| 1098 | Ga0070676_11307409 | |||
| 1099 | Ga0070683_101567661 | |||
| 1100 | Ga0070690_100252562 | |||
| 1101 | Ga0070690_100315078 | |||
| 1102 | Ga0070670_100174228 | |||
| 1103 | Ga0070677_10269195 | |||
| 1104 | Ga0068869_100021616 | |||
| 1105 | Ga0068869_100113202 | |||
| 1106 | Ga0068869_100222862 | |||
| 1107 | Ga0070666_10929593 | |||
| 1108 | Ga0070666_11067624 | |||
| 1109 | Ga0070666_11272161 | |||
| 1110 | Ga0070680_100110849 | |||
| 1111 | Ga0070680_100546304 | |||
| 1112 | Ga0070680_100912620 | |||
| 1113 | Ga0070682_100591629 | |||
| 1114 | Ga0068868_100196063 | |||
| 1115 | Ga0068868_100328088 | |||
| 1116 | Ga0068868_101022434 | |||
| 1117 | Ga0070660_100187113 | |||
| 1118 | Ga0070689_100087109 | |||
| 1119 | Ga0070691_10378304 | |||
| 1120 | Ga0070661_100050478 | |||
| 1121 | Ga0070661_100215826 | |||
| 1122 | Ga0070661_100282157 | |||
| 1123 | Ga0070661_100587028 | |||
| 1124 | Ga0070668_100200199 | |||
| 1125 | Ga0070668_100298090 | |||
| 1126 | Ga0070668_100464471 | |||
| 1127 | Ga0070668_100851448 | |||
| 1128 | Ga0070668_100969456 | |||
| 1129 | Ga0070668_101033448 | |||
| 1130 | Ga0070669_100073283 | |||
| 1131 | Ga0070669_100991418 | |||
| 1132 | Ga0070675_100079027 | |||
| 1133 | Ga0070675_101034169 | |||
| 1134 | Ga0070675_101138317 | |||
| 1135 | Ga0070671_100035846 | |||
| 1136 | Ga0070671_100308940 | |||
| 1137 | Ga0070671_101082781 | |||
| 1138 | Ga0070674_100028167 | |||
| 1139 | Ga0070674_100074542 | |||
| 1140 | Ga0070674_100233565 | |||
| 1141 | Ga0070674_100592587 | |||
| 1142 | Ga0070674_100822513 | |||
| 1143 | Ga0070673_100193672 | |||
| 1144 | Ga0070673_102112555 | |||
| 1145 | Ga0070688_100242985 | |||
| 1146 | Ga0070688_100741956 | |||
| 1147 | Ga0070659_100159893 | |||
| 1148 | Ga0070667_100070033 | |||
| 1149 | Ga0070667_101109350 | |||
| 1150 | Ga0070703_10032218 | |||
| 1151 | Ga0070709_10003962 | |||
| 1152 | Ga0070714_100404744 | |||
| 1153 | Ga0070714_101760836 | |||
| 1154 | Ga0070713_100031271 | |||
| 1155 | Ga0070713_100461775 | |||
| 1156 | Ga0070710_10003249 | |||
| 1157 | Ga0070701_10179658 | |||
| 1158 | Ga0070701_10890180 | |||
| 1159 | Ga0070711_100003683 | |||
| 1160 | Ga0070700_100501649 | |||
| 1161 | Ga0070700_100848545 | |||
| 1162 | Ga0070694_100031961 | |||
| 1163 | Ga0070694_100483687 | |||
| 1164 | Ga0070708_101145333 | |||
| 1165 | Ga0070663_100006704 | |||
| 1166 | Ga0070663_100031868 | |||
| 1167 | Ga0070663_100049472 | |||
| 1168 | Ga0070663_100085522 | |||
| 1169 | Ga0070663_100116066 | |||
| 1170 | Ga0070663_100147815 | |||
| 1171 | Ga0070678_100111418 | |||
| 1172 | Ga0070678_100148423 | |||
| 1173 | Ga0070678_100158060 | |||
| 1174 | Ga0070678_100174110 | |||
| 1175 | Ga0070678_100327146 | |||
| 1176 | Ga0070678_100785419 | |||
| 1177 | Ga0070678_101207059 | |||
| 1178 | Ga0070678_101235620 | |||
| 1179 | Ga0070662_100045046 | |||
| 1180 | Ga0070662_100094482 | |||
| 1181 | Ga0070662_100236004 | |||
| 1182 | Ga0070662_100971378 | |||
| 1183 | Ga0070681_10046420 | |||
| 1184 | Ga0068867_100305134 | |||
| 1185 | Ga0068867_100737654 | |||
| 1186 | Ga0070685_10681621 | |||
| 1187 | Ga0070706_101089037 | |||
| 1188 | Ga0070698_100047027 | |||
| 1189 | Ga0070699_100213534 | |||
| 1190 | Ga0070679_100163495 | |||
| 1191 | Ga0070679_102081176 | |||
| 1192 | Ga0070684_100004411 | |||
| 1193 | Ga0070684_100369687 | |||
| 1194 | Ga0070684_101265692 | |||
| 1195 | Ga0070684_101563973 | |||
| 1196 | Ga0070697_100098950 | |||
| 1197 | Ga0068853_100058224 | |||
| 1198 | Ga0068853_100127068 | |||
| 1199 | Ga0068853_100784282 | |||
| 1200 | Ga0068853_101017455 | |||
| 1201 | Ga0068853_101242555 | |||
| 1202 | Ga0068853_101487769 | |||
| 1203 | Ga0068853_101616627 | |||
| 1204 | Ga0070672_100050034 | |||
| 1205 | Ga0070672_100191235 | |||
| 1206 | Ga0070672_101449465 | |||
| 1207 | Ga0070686_100448158 | |||
| 1208 | Ga0070695_100452034 | |||
| 1209 | Ga0070695_100556782 | |||
| 1210 | Ga0070696_101114343 | |||
| 1211 | Ga0070693_100141796 | |||
| 1212 | Ga0070693_100158169 | |||
| 1213 | Ga0070693_100727330 | |||
| 1214 | Ga0070665_100006047 | |||
| 1215 | Ga0070665_100046934 | |||
| 1216 | Ga0070665_100088172 | |||
| 1217 | Ga0070665_100147132 | |||
| 1218 | Ga0070665_100242310 | |||
| 1219 | Ga0070665_100359203 | |||
| 1220 | Ga0070665_100449282 | |||
| 1221 | Ga0070665_100680563 | |||
| 1222 | Ga0070665_100995411 | |||
| 1223 | Ga0070665_101064742 | |||
| 1224 | Ga0070704_100996661 | |||
| 1225 | Ga0068855_100142397 | |||
| 1226 | Ga0068855_101341858 | |||
| 1227 | Ga0070664_100752603 | |||
| 1228 | Ga0068857_100161780 | |||
| 1229 | Ga0068857_101466126 | |||
| 1230 | Ga0068854_100050418 | |||
| 1231 | Ga0068854_100133533 | |||
| 1232 | Ga0068854_100350047 | |||
| 1233 | Ga0068856_100045441 | |||
| 1234 | Ga0068856_100218065 | |||
| 1235 | Ga0070702_100240942 | |||
| 1236 | Ga0070702_100357805 | |||
| 1237 | Ga0070702_100483500 | |||
| 1238 | Ga0070702_100773885 | |||
| 1239 | Ga0070702_101499734 | |||
| 1240 | Ga0068852_100195806 | |||
| 1241 | Ga0068852_100211650 | |||
| 1242 | Ga0068852_100802086 | |||
| 1243 | Ga0068852_100831125 | |||
| 1244 | Ga0068859_100081687 | |||
| 1245 | Ga0068859_100103695 | |||
| 1246 | Ga0068859_100193831 | |||
| 1247 | Ga0068859_100489587 | |||
| 1248 | Ga0068864_100236351 | |||
| 1249 | Ga0068864_100380312 | |||
| 1250 | Ga0068866_10014019 | |||
| 1251 | Ga0068866_10068672 | |||
| 1252 | Ga0068866_10178015 | |||
| 1253 | Ga0068866_11147688 | |||
| 1254 | Ga0068861_100114662 | |||
| 1255 | Ga0068861_100132658 | |||
| 1256 | Ga0068861_100455335 | |||
| 1257 | Ga0068861_100559489 | |||
| 1258 | Ga0068861_100873609 | |||
| 1259 | Ga0068851_10299235 | |||
| 1260 | Ga0068870_10062612 | |||
| 1261 | Ga0068863_100342051 | |||
| 1262 | Ga0068863_100452357 | |||
| 1263 | Ga0068863_101721265 | |||
| 1264 | Ga0068858_100099908 | |||
| 1265 | Ga0068858_100553727 | |||
| 1266 | Ga0068860_100077344 | |||
| 1267 | Ga0068860_100134772 | |||
| 1268 | Ga0068860_100233815 | |||
| 1269 | Ga0068860_100260103 | |||
| 1270 | Ga0068860_100317765 | |||
| 1271 | Ga0068862_100306533 | |||
| 1272 | Ga0068862_101064457 | |||
| 1273 | Ga0068862_101860252 | |||
| 1274 | Ga0068862_101997501 | |||
| 1275 | Ga0068862_102661352 | |||
| 1276 | Ga0081455_10023941 | |||
| 1277 | Ga0081455_10148450 | |||
| 1278 | Ga0081538_10019994 | |||
| 1279 | Ga0081540_1005122 | |||
| 1280 | Ga0081540_1008650 | |||
| 1281 | Ga0081540_1010370 | |||
| 1282 | Ga0081540_1028568 | |||
| 1283 | Ga0081540_1112096 | |||
| 1284 | Ga0081539_10061245 | |||
| 1285 | Ga0081539_10095727 | |||
| 1286 | Ga0075365_10211511 | |||
| 1287 | Ga0075365_10253956 | |||
| 1288 | Ga0075365_10340808 | |||
| 1289 | Ga0075365_10960146 | |||
| 1290 | Ga0075368_10041864 | |||
| 1291 | Ga0075368_10073537 | |||
| 1292 | Ga0075368_10120613 | |||
| 1293 | Ga0075368_10139054 | |||
| 1294 | Ga0075363_100019573 | |||
| 1295 | Ga0075363_100204972 | |||
| 1296 | Ga0075363_100219456 | |||
| 1297 | Ga0075363_100323392 | |||
| 1298 | Ga0075363_100422567 | |||
| 1299 | Ga0075364_10043408 | |||
| 1300 | Ga0075364_10111208 | |||
| 1301 | Ga0075364_10191119 | |||
| 1302 | Ga0075364_10667330 | |||
| 1303 | Ga0075432_10318984 | |||
| 1304 | Ga0070716_100191696 | |||
| 1305 | Ga0070716_100355337 | |||
| 1306 | Ga0070716_101749369 | |||
| 1307 | Ga0070712_100002748 | |||
| 1308 | Ga0070712_100071562 | |||
| 1309 | Ga0070712_100410939 | |||
| 1310 | Ga0075362_10048946 | |||
| 1311 | Ga0075362_10212115 | |||
| 1312 | Ga0075362_10545911 | |||
| 1313 | Ga0075367_10008917 | |||
| 1314 | Ga0075367_10066140 | |||
| 1315 | Ga0075367_10179835 | |||
| 1316 | Ga0075367_10237592 | |||
| 1317 | Ga0075367_10293843 | |||
| 1318 | Ga0075367_10403583 | |||
| 1319 | Ga0075369_10063424 | |||
| 1320 | Ga0075369_10087263 | |||
| 1321 | Ga0075369_10156760 | |||
| 1322 | Ga0075366_10043943 | |||
| 1323 | Ga0075366_10205804 | |||
| 1324 | Ga0075366_10335194 | |||
| 1325 | Ga0075366_10580541 | |||
| 1326 | Ga0097621_100091765 | |||
| 1327 | Ga0097621_100132654 | |||
| 1328 | Ga0097621_101074854 | |||
| 1329 | Ga0075370_10012018 | |||
| 1330 | Ga0075370_10106281 | |||
| 1331 | Ga0068871_100233636 | |||
| 1332 | Ga0068871_100251773 | |||
| 1333 | Ga0068871_100745820 | |||
| 1334 | Ga0068871_101217757 | |||
| 1335 | Ga0075428_100916099 | |||
| 1336 | Ga0075428_101013454 | |||
| 1337 | Ga0075431_100303669 | |||
| 1338 | Ga0075433_11507387 | |||
| 1339 | Ga0068865_100010829 | |||
| 1340 | Ga0068865_100156758 | |||
| 1341 | Ga0068865_100307186 | |||
| 1342 | Ga0068865_100505252 | |||
| 1343 | Ga0068865_100906333 | |||
| 1344 | Ga0068865_101426112 | |||
| 1345 | Ga0075436_100134548 | |||
| 1346 | Ga0075436_100528411 | |||
| 1347 | Ga0097620_100081686 | |||
| 1348 | Ga0097620_100103699 | |||
| 1349 | Ga0097620_100193831 | |||
| 1350 | Ga0097620_100489632 | |||
| 1351 | Ga0099825_1023278 | |||
| 1352 | Ga0099824_1033392 | |||
| 1353 | Ga0099822_1000191 | |||
| 1354 | Ga0075435_100086775 | |||
| 1355 | Ga0099794_10025181 | |||
| 1356 | Ga0099795_10017094 | |||
| 1357 | Ga0099795_10082459 | |||
| 1358 | Ga0105250_10091244 | |||
| 1359 | Ga0105240_10099049 | |||
| 1360 | Ga0105240_11904592 | |||
| 1361 | Ga0111539_10057611 | |||
| 1362 | Ga0111539_10834437 | |||
| 1363 | Ga0105245_10215836 | |||
| 1364 | Ga0105245_10438015 | |||
| 1365 | Ga0105245_10547433 | |||
| 1366 | Ga0105245_10632651 | |||
| 1367 | Ga0105245_11844071 | |||
| 1368 | Ga0105247_10251361 | |||
| 1369 | Ga0105247_10273958 | |||
| 1370 | Ga0105247_10378583 | |||
| 1371 | Ga0105247_10574522 | |||
| 1372 | Ga0105247_10759387 | |||
| 1373 | Ga0114129_10119006 | |||
| 1374 | Ga0105243_10089029 | |||
| 1375 | Ga0105243_10249223 | |||
| 1376 | Ga0105243_10562342 | |||
| 1377 | Ga0105243_11077275 | |||
| 1378 | Ga0105241_10111539 | |||
| 1379 | Ga0105241_10196422 | |||
| 1380 | Ga0105242_10051398 | |||
| 1381 | Ga0105242_10569940 | |||
| 1382 | Ga0105242_10587599 | |||
| 1383 | Ga0105242_11751136 | |||
| 1384 | Ga0105248_10052096 | |||
| 1385 | Ga0105248_10059734 | |||
| 1386 | Ga0105248_10252605 | |||
| 1387 | Ga0105248_10380194 | |||
| 1388 | Ga0105248_10466140 | |||
| 1389 | Ga0105248_10495624 | |||
| 1390 | Ga0105248_10714438 | |||
| 1391 | Ga0105237_10280693 | |||
| 1392 | Ga0105237_10356602 | |||
| 1393 | Ga0105237_10903743 | |||
| 1394 | Ga0105237_11465768 | |||
| 1395 | Ga0105238_10120163 | |||
| 1396 | Ga0105238_10123963 | |||
| 1397 | Ga0105238_11606265 | |||
| 1398 | Ga0105238_12876263 | |||
| 1399 | Ga0105249_10038661 | |||
| 1400 | Ga0105249_10166891 | |||
| 1401 | Ga0105249_10333447 | |||
| 1402 | Ga0105249_10875378 | |||
| 1403 | Ga0105249_12175814 | |||
| 1404 | Ga0099796_10047206 | |||
| 1405 | Ga0105239_10045817 | |||
| 1406 | Ga0105239_10045962 | |||
| 1407 | Ga0105239_10078073 | |||
| 1408 | Ga0105239_10154693 | |||
| 1409 | Ga0105239_11298562 | |||
| 1410 | Ga0105239_11416789 | |||
| 1411 | Ga0105239_12891748 | |||
| 1412 | Ga0105239_13101289 | |||
| 1413 | Ga0105246_10083619 | |||
| 1414 | Ga0105246_10192462 | |||
| 1415 | Ga0105246_10218545 | |||
| 1416 | Ga0105246_10514215 | |||
| 1417 | Ga0105246_10880933 | |||
| 1418 | Ga0157369_10007714 | |||
| 1419 | Ga0157374_10020275 | |||
| 1420 | Ga0157374_10508924 | |||
| 1421 | Ga0157374_10902248 | |||
| 1422 | Ga0157374_11458196 | |||
| 1423 | Ga0157374_11849640 | |||
| 1424 | Ga0157374_12292734 | |||
| 1425 | Ga0157378_10015483 | |||
| 1426 | Ga0157378_10093522 | |||
| 1427 | Ga0157378_10889525 | |||
| 1428 | Ga0163162_10102095 | |||
| 1429 | Ga0163162_10114346 | |||
| 1430 | Ga0163162_10115742 | |||
| 1431 | Ga0163162_10496912 | |||
| 1432 | Ga0163162_11263824 | |||
| 1433 | Ga0163162_13025924 | |||
| 1434 | Ga0157372_11742165 | |||
| 1435 | Ga0157375_10094761 | |||
| 1436 | Ga0157375_10269525 | |||
| 1437 | Ga0157375_10331276 | |||
| 1438 | Ga0157375_11874071 | |||
| 1439 | Ga0157375_12030473 | |||
| 1440 | Ga0157375_13344226 | |||
| 1441 | Ga0163163_10363328 | |||
| 1442 | Ga0163163_10617738 | |||
| 1443 | Ga0163163_10827272 | |||
| 1444 | Ga0163163_10948772 | |||
| 1445 | Ga0163163_11340026 | |||
| 1446 | Ga0163163_11656935 | |||
| 1447 | Ga0163163_11830600 | |||
| 1448 | Ga0163163_13290015 | |||
| 1449 | Ga0157380_10566922 | |||
| 1450 | Ga0157380_10693656 | |||
| 1451 | Ga0157380_10716500 | |||
| 1452 | Ga0157380_11106285 | |||
| 1453 | Ga0157380_11728683 | |||
| 1454 | Ga0182008_10263735 | |||
| 1455 | Ga0157377_10190270 | |||
| 1456 | Ga0157377_11361730 | |||
| 1457 | Ga0157379_10155773 | |||
| 1458 | Ga0157379_10351469 | |||
| 1459 | Ga0157379_10365434 | |||
| 1460 | Ga0157379_12423835 | |||
| 1461 | Ga0157376_10004288 | |||
| 1462 | Ga0157376_10604754 | |||
| 1463 | Ga0157376_10989445 | |||
| 1464 | Ga0157376_11133347 | |||
| 1465 | Ga0157376_11230187 | |||
| 1466 | Ga0157376_11681043 | |||
| 1467 | Ga0182007_10351718 | |||
| 1468 | Ga0163161_10043682 | |||
| 1469 | Ga0163161_10285992 | |||
| 1470 | Ga0163161_10558316 | |||
| 1471 | Ga0213876_10344846 | |||
| 1472 | Ga0209677_125228 | |||
| 1473 | Ga0209025_1132440 | |||
| 1474 | Ga0209758_1004214 | |||
| 1475 | Ga0209758_1022090 | |||
| 1476 | Ga0207697_10131220 | |||
| 1477 | Ga0207696_1027263 | |||
| 1478 | Ga0207653_10028554 | |||
| 1479 | Ga0207682_10177584 | |||
| 1480 | Ga0207692_10003473 | |||
| 1481 | Ga0207692_10430837 | |||
| 1482 | Ga0207642_10125500 | |||
| 1483 | Ga0207710_10049499 | |||
| 1484 | Ga0207710_10157869 | |||
| 1485 | Ga0207710_10178232 | |||
| 1486 | Ga0207688_10010595 | |||
| 1487 | Ga0207688_10027797 | |||
| 1488 | Ga0207688_10126798 | |||
| 1489 | Ga0207680_10622183 | |||
| 1490 | Ga0207680_10773742 | |||
| 1491 | Ga0207680_11146224 | |||
| 1492 | Ga0207647_10006138 | |||
| 1493 | Ga0207685_10175751 | |||
| 1494 | Ga0207699_10005053 | |||
| 1495 | Ga0207645_10209212 | |||
| 1496 | Ga0207645_10269804 | |||
| 1497 | Ga0207645_10475068 | |||
| 1498 | Ga0207643_10027305 | |||
| 1499 | Ga0207643_10373065 | |||
| 1500 | Ga0207705_10704342 | |||
| 1501 | Ga0207684_11112591 | |||
| 1502 | Ga0207654_10050940 | |||
| 1503 | Ga0207654_10576763 | |||
| 1504 | Ga0207707_10333055 | |||
| 1505 | Ga0207671_10509091 | |||
| 1506 | Ga0207671_10548875 | |||
| 1507 | Ga0207693_10004152 | |||
| 1508 | Ga0207693_10068856 | |||
| 1509 | Ga0207693_10659459 | |||
| 1510 | Ga0207663_10006381 | |||
| 1511 | Ga0207663_10878683 | |||
| 1512 | Ga0207660_10270447 | |||
| 1513 | Ga0207662_10628210 | |||
| 1514 | Ga0207657_10094263 | |||
| 1515 | Ga0207649_10060489 | |||
| 1516 | Ga0207649_10457161 | |||
| 1517 | Ga0207652_10521305 | |||
| 1518 | Ga0207681_10362754 | |||
| 1519 | Ga0207681_10836809 | |||
| 1520 | Ga0207694_10197597 | |||
| 1521 | Ga0207694_10890167 | |||
| 1522 | Ga0207694_11259125 | |||
| 1523 | Ga0207650_10987184 | |||
| 1524 | Ga0207659_10103723 | |||
| 1525 | Ga0207687_10046156 | |||
| 1526 | Ga0207687_10506660 | |||
| 1527 | Ga0207687_10508010 | |||
| 1528 | Ga0207687_10850452 | |||
| 1529 | Ga0207687_11213563 | |||
| 1530 | Ga0207700_10039017 | |||
| 1531 | Ga0207700_10095690 | |||
| 1532 | Ga0207700_10470232 | |||
| 1533 | Ga0207664_10322313 | |||
| 1534 | Ga0207664_11100170 | |||
| 1535 | Ga0207644_10070746 | |||
| 1536 | Ga0207690_10086087 | |||
| 1537 | Ga0207706_10067855 | |||
| 1538 | Ga0207706_10129850 | |||
| 1539 | Ga0207706_10422663 | |||
| 1540 | Ga0207706_10848389 | |||
| 1541 | Ga0207686_10155370 | |||
| 1542 | Ga0207686_10489309 | |||
| 1543 | Ga0207686_10552917 | |||
| 1544 | Ga0207686_11769778 | |||
| 1545 | Ga0207709_10158090 | |||
| 1546 | Ga0207709_10278282 | |||
| 1547 | Ga0207709_11019656 | |||
| 1548 | Ga0207709_11163532 | |||
| 1549 | Ga0207670_10380526 | |||
| 1550 | Ga0207670_10902061 | |||
| 1551 | Ga0207669_10352911 | |||
| 1552 | Ga0207669_10481356 | |||
| 1553 | Ga0207669_10912389 | |||
| 1554 | Ga0207704_10185027 | |||
| 1555 | Ga0207704_10254222 | |||
| 1556 | Ga0207704_10347113 | |||
| 1557 | Ga0207704_10406919 | |||
| 1558 | Ga0207704_11052582 | |||
| 1559 | Ga0207665_10239425 | |||
| 1560 | Ga0207665_10279087 | |||
| 1561 | Ga0207691_10109437 | |||
| 1562 | Ga0207691_10115524 | |||
| 1563 | Ga0207691_10195566 | |||
| 1564 | Ga0207691_10297606 | |||
| 1565 | Ga0207711_10278108 | |||
| 1566 | Ga0207711_10329868 | |||
| 1567 | Ga0207711_10524654 | |||
| 1568 | Ga0207711_11900261 | |||
| 1569 | Ga0207689_10205379 | |||
| 1570 | Ga0207689_10368714 | |||
| 1571 | Ga0207689_10868064 | |||
| 1572 | Ga0207689_10891136 | |||
| 1573 | Ga0207661_10226869 | |||
| 1574 | Ga0207661_11382664 | |||
| 1575 | Ga0207679_10030722 | |||
| 1576 | Ga0207679_10048765 | |||
| 1577 | Ga0207679_10622680 | |||
| 1578 | Ga0207667_10155171 | |||
| 1579 | Ga0207667_11078485 | |||
| 1580 | Ga0207651_10172599 | |||
| 1581 | Ga0207651_10636927 | |||
| 1582 | Ga0207712_10091075 | |||
| 1583 | Ga0207712_10774911 | |||
| 1584 | Ga0207712_11371803 | |||
| 1585 | Ga0207668_10013241 | |||
| 1586 | Ga0207668_10159359 | |||
| 1587 | Ga0207668_10273689 | |||
| 1588 | Ga0207668_10310679 | |||
| 1589 | Ga0207668_10758392 | |||
| 1590 | Ga0207668_11572912 | |||
| 1591 | Ga0207640_10567451 | |||
| 1592 | Ga0207640_10850945 | |||
| 1593 | Ga0207640_11868026 | |||
| 1594 | Ga0207658_10225666 | |||
| 1595 | Ga0207677_10342501 | |||
| 1596 | Ga0207677_11924720 | |||
| 1597 | Ga0207703_10041893 | |||
| 1598 | Ga0207703_10197653 | |||
| 1599 | Ga0207703_10549605 | |||
| 1600 | Ga0207703_10784961 | |||
| 1601 | Ga0207639_10008358 | |||
| 1602 | Ga0207639_10102877 | |||
| 1603 | Ga0207639_10276341 | |||
| 1604 | Ga0207639_10944362 | |||
| 1605 | Ga0207639_10984807 | |||
| 1606 | Ga0207639_11989112 | |||
| 1607 | Ga0207678_10015601 | |||
| 1608 | Ga0207678_10043029 | |||
| 1609 | Ga0207678_10097713 | |||
| 1610 | Ga0207678_10262800 | |||
| 1611 | Ga0207678_10353158 | |||
| 1612 | Ga0207678_10355248 | |||
| 1613 | Ga0207678_10401734 | |||
| 1614 | Ga0207708_10210470 | |||
| 1615 | Ga0207708_10518042 | |||
| 1616 | Ga0207708_10990108 | |||
| 1617 | Ga0207702_10026010 | |||
| 1618 | Ga0207702_11398066 | |||
| 1619 | Ga0207641_10274476 | |||
| 1620 | Ga0207641_10276717 | |||
| 1621 | Ga0207641_11022579 | |||
| 1622 | Ga0207648_10060782 | |||
| 1623 | Ga0207648_10076280 | |||
| 1624 | Ga0207648_10308751 | |||
| 1625 | Ga0207648_10902915 | |||
| 1626 | Ga0207648_11227210 | |||
| 1627 | Ga0207676_10221684 | |||
| 1628 | Ga0207674_10064470 | |||
| 1629 | Ga0207674_10596281 | |||
| 1630 | Ga0207674_10599365 | |||
| 1631 | Ga0207675_100084466 | |||
| 1632 | Ga0207675_100415238 | |||
| 1633 | Ga0207675_100720203 | |||
| 1634 | Ga0207675_101057761 | |||
| 1635 | Ga0207683_10062959 | |||
| 1636 | Ga0207683_10069102 | |||
| 1637 | Ga0207683_10113570 | |||
| 1638 | Ga0207683_10251011 | |||
| 1639 | Ga0207683_10273786 | |||
| 1640 | Ga0207683_10370723 | |||
| 1641 | Ga0207698_10197728 | |||
| 1642 | Ga0207698_10241921 | |||
| 1643 | Ga0207698_10243963 | |||
| 1644 | Ga0207698_10391484 | |||
| 1645 | Ga0209589_1000055 | |||
| 1646 | Ga0209489_100128 | |||
| 1647 | Ga0209700_100137 | |||
| 1648 | Ga0209179_1064309 | |||
| 1649 | Ga0209179_1128566 | |||
| 1650 | Ga0209813_10128399 | |||
| 1651 | Ga0209813_10128717 | |||
| 1652 | Ga0207428_10220540 | |||
| 1653 | Ga0268266_10001893 | |||
| 1654 | Ga0268266_10010934 | |||
| 1655 | Ga0268266_10020070 | |||
| 1656 | Ga0268266_10060966 | |||
| 1657 | Ga0268266_10061647 | |||
| 1658 | Ga0268266_10223094 | |||
| 1659 | Ga0268266_10316498 | |||
| 1660 | Ga0268266_11101948 | |||
| 1661 | Ga0268265_10060512 | |||
| 1662 | Ga0268265_10073561 | |||
| 1663 | Ga0268265_10196619 | |||
| 1664 | Ga0268265_10492698 | |||
| 1665 | Ga0268265_11209364 | |||
| 1666 | Ga0268265_11267247 | |||
| 1667 | Ga0268264_10091485 | |||
| 1668 | Ga0268264_10141336 | |||
| 1669 | Ga0268264_11535631 | |||
| 1670 | Ga0307517_10007163 | |||
| 1671 | Ga0307517_10239533 | |||
| 1672 | Ga0307515_10037445 | |||
| 1673 | Ga0307515_10313545 | |||
| 1674 | Ga0307512_10104489 | |||
| 1675 | Ga0265330_10009605 | |||
| 1676 | Ga0265330_10014019 | |||
| 1677 | Ga0265328_10101253 | |||
| 1678 | Ga0265340_10013754 | |||
| 1679 | Ga0265316_10038043 | |||
| 1680 | Ga0265316_10135129 | |||
| 1681 | Ga0307513_10105731 | |||
| 1682 | Ga0307513_10116572 | |||
| 1683 | Ga0307513_10730428 | |||
| 1684 | Ga0307408_100093076 | |||
| 1685 | Ga0307408_100268596 | |||
| 1686 | Ga0307408_100549943 | |||
| 1687 | Ga0307408_101138755 | |||
| 1688 | Ga0307408_102363302 | |||
| 1689 | Ga0307508_10026412 | |||
| 1690 | Ga0307514_10320590 | |||
| 1691 | Ga0265342_10136272 | |||
| 1692 | Ga0307516_10002153 | |||
| 1693 | Ga0307516_10033701 | |||
| 1694 | Ga0307516_10038892 | |||
| 1695 | Ga0307516_10232620 | |||
| 1696 | Ga0307516_10520583 | |||
| 1697 | Ga0307405_10087782 | |||
| 1698 | Ga0307405_10160054 | |||
| 1699 | Ga0307405_10507376 | |||
| 1700 | Ga0307406_10098745 | |||
| 1701 | Ga0307406_10341238 | |||
| 1702 | Ga0307406_11457624 | |||
| 1703 | Ga0307407_10395947 | |||
| 1704 | Ga0307407_10610292 | |||
| 1705 | Ga0307412_10102251 | |||
| 1706 | Ga0307412_10189714 | |||
| 1707 | Ga0307412_10925364 | |||
| 1708 | Ga0307409_100296235 | |||
| 1709 | Ga0307416_100035338 | |||
| 1710 | Ga0307416_100114693 | |||
| 1711 | Ga0307416_100279052 | |||
| 1712 | Ga0307416_100302237 | |||
| 1713 | Ga0307416_100508001 | |||
| 1714 | Ga0307416_100713568 | |||
| 1715 | Ga0307414_11034754 | |||
| 1716 | Ga0307411_10136013 | |||
| 1717 | Ga0307411_10202581 | |||
| 1718 | Ga0307415_100243316 | |||
| 1719 | Ga0307415_100652738 | |||
| 1720 | Ga0307510_10007834 | |||
| 1721 | Ga0307510_10096261 | |||
| 1722 | Ga0315911_1000076 | |||
| 1723 | Ga0373930_0005846 | |||
| 1724 | Ga0373958_0161831 | |||
| 1725 | Ga0373929_0099883 | |||
| 1726 | Ga0373934_0017039 | |||
| 1727 | Ga0373940_0359277 | |||
| 1728 | Ga0373923_0004715 | |||
| 1729 | Ga0373932_0012313 | |||
| 1730 | Ga0373936_0091591 | |||
| 1731 | Ga0373939_0143798 | |||
| 1732 | Ga0373945_0150553 | |||
| 1733 | Ga0373953_0013127 | |||
| 1734 | Ga0373954_0001537 | |||
| 1735 | Ga0373956_0007238 | |||
| 1736 | Ga0373957_0027090 | |||
| 1737 | Ga0373943_0167207 | |||
| 1738 | Ga0373946_0030362 | |||
| 1739 | Ga0373955_0000421 | |||
| 1740 | Ga0373924_0005265 | |||
| 1741 | Ga0373931_0002773 | |||
| 1742 | Ga0373935_0055204 | |||
| 1743 | Ga0373927_0106329 | |||
| 1744 | Ga0373933_0012141 | |||
| 1745 | Ga0373937_0017372 | |||
| 1746 | Ga0373925_0643718 | |||
| 1747 | Ga0373925_0754851 | |||
| 1748 | Ga0395900_0827956 | |||
| 1749 | Ga0395898_0141730 | |||
| 1750 | Ga0395905_0018502 | |||
| 1751 | Ga0395905_0792214 | |||
| 1752 | Ga0436365_1432829 | |||
| 1753 | Ga0439465_0212985 | |||
| 1754 | Ga0451791_0937014 | |||
| 1755 | Ga0451791_1187594 | |||
| 1756 | Ga0451791_1597070 | |||
| 1757 | Ga0451793_0322342 | |||
| 1758 | Ga0451793_0591189 | |||
| 1759 | Ga0451797_1451936 | |||
| 1760 | Ga0451798_0889967 | |||
| 1761 | Ga0451800_0821725 | |||
| 1762 | Ga0451843_0538096 | |||
| 1763 | Ga0451855_0326912 | |||
| 1764 | Ga0451853_2025861 | |||
| 1765 | Ga0451853_2279900 | |||
| 1766 | Ga0439431_0051291 | |||
| 1767 | Ga0439463_169067 | |||
| 1768 | Ga0439458_0073616 | |||
| 1769 | Ga0439459_0023725 | |||
| 1770 | Ga0466963_0031196 | |||
| 1771 | Ga0466967_0828729 | |||
| 1772 | Ga0495617_011757 | |||
| 1773 | Ga0495617_245138 | |||
| 1774 | Ga0495627_060934 | |||
| 1775 | Ga0495592_0001087 | |||
| 1776 | Ga0495603_0251449 | |||
| 1777 | Ga0495603_0344861 | |||
| 1778 | Ga0495603_0666955 | |||
| 1779 | Ga0495591_136099 | |||
| 1780 | Ga0495629_0000232 | |||
| 1781 | Ga0495638_0205673 | |||
| 1782 | Ga0495638_0362734 | |||
| 1783 | Ga0495638_0475664 | |||
| 1784 | Ga0495641_0045103 | |||
| 1785 | Ga0495651_0056910 | |||
| 1786 | Ga0495651_0084336 | |||
| 1787 | Ga0495653_0000575 | |||
| 1788 | Ga0495650_0166007 | |||
| 1789 | Ga0495650_0191533 | |||
| 1790 | Ga0495580_0062006 | |||
| 1791 | Ga0495582_0052731 | |||
| 1792 | Ga0495582_0641688 | |||
| 1793 | Ga0495605_0196278 | |||
| 1794 | Ga0495605_0319029 | |||
| 1795 | Ga0495639_0026104 | |||
| 1796 | Ga0495639_0419831 | |||
| 1797 | Ga0495664_0099957 | |||
| 1798 | Ga0495584_0154900 | |||
| 1799 | Ga0495584_0361259 | |||
| 1800 | Ga0495584_0471173 | |||
| 1801 | Ga0495585_0049317 | |||
| 1802 | Ga0495585_0070049 | |||
| 1803 | Ga0495585_0084017 | |||
| 1804 | Ga0495594_0096190 | |||
| 1805 | Ga0495594_0349173 | |||
| 1806 | Ga0495594_0548169 | |||
| 1807 | Ga0495606_0287303 | |||
| 1808 | Ga0495606_0611888 | |||
| 1809 | Ga0495608_0010274 | |||
| 1810 | Ga0495610_0226410 | |||
| 1811 | Ga0495616_0245235 | |||
| 1812 | Ga0495616_0326654 | |||
| 1813 | Ga0495618_0085312 | |||
| 1814 | Ga0495620_0049974 | |||
| 1815 | Ga0495628_0021846 | |||
| 1816 | Ga0495628_0159962 | |||
| 1817 | Ga0495628_0459436 | |||
| 1818 | Ga0495631_0101877 | |||
| 1819 | Ga0495631_0214324 | |||
| 1820 | Ga0495632_0221208 | |||
| 1821 | Ga0495632_0331705 | |||
| 1822 | Ga0495637_0148877 | |||
| 1823 | Ga0495643_0233037 | |||
| 1824 | Ga0495644_0056399 | |||
| 1825 | Ga0495644_0208465 | |||
| 1826 | Ga0495644_0325184 | |||
| 1827 | Ga0495648_0000767 | |||
| 1828 | Ga0495648_0262289 | |||
| 1829 | Ga0495648_0514572 | |||
| 1830 | Ga0495663_0057218 | |||
| 1831 | Ga0495642_0144413 | |||
| 1832 | Ga0495642_0205083 | |||
| 1833 | Ga0495652_0015475 | |||
| 1834 | Ga0495654_0251578 | |||
| 1835 | Ga0495665_0246992 | |||
| 1836 | Ga0495640_0012477 | |||
| 1837 | Ga0495587_0003955 | |||
| 1838 | Ga0495598_0007022 | |||
| 1839 | Ga0495598_0076620 | |||
| 1840 | Ga0495598_0261384 | |||
| 1841 | Ga0495609_0032697 | |||
| 1842 | Ga0495609_0250597 | |||
| 1843 | Ga0495621_0029247 | |||
| 1844 | Ga0495645_0034945 | |||
| 1845 | Ga0495622_0303227 | |||
| 1846 | Ga0495633_0052304 | |||
| 1847 | Ga0495633_0301487 | |||
| 1848 | Ga0495667_0001504 | |||
| 1849 | Ga0495656_0020292 | |||
| 1850 | Ga0495656_0097647 | |||
| 1851 | Ga0495656_0174697 | |||
| 1852 | Ga0495656_0251695 | |||
| 1853 | Ga0495668_0107764 | |||
| 1854 | Ga0495668_0118052 | |||
| 1855 | Ga0495668_0208683 | |||
| 1856 | Ga0495668_0288341 | |||
| 1857 | Ga0495668_0855326 | |||
| 1858 | Ga0495634_0044765 | |||
| 1859 | Ga0495611_0290359 | |||
| 1860 | Ga0495625_0121382 | |||
| 1861 | Ga0495625_0149403 | |||
| 1862 | Ga0495625_0251692 | |||
| 1863 | Ga0495625_0394530 | |||
| 1864 | Ga0495625_0682651 | |||
| 1865 | Ga0495625_0779557 | |||
| 1866 | Ga0495625_0887667 | |||
| 1867 | Ga0495635_0004681 | |||
| 1868 | Ga0495635_0202498 | |||
| 1869 | Ga0495635_0554567 | |||
| 1870 | Ga0495659_0005622 | |||
| 1871 | Ga0495659_0058896 | |||
| 1872 | Ga0495661_0115165 | |||
| 1873 | Ga0495661_0276719 | |||
| 1874 | Ga0495661_0350958 | |||
| 1875 | Ga0495588_0052172 | |||
| 1876 | Ga0495588_0476097 | |||
| 1877 | Ga0495657_0002790 | |||
| 1878 | Ga0495599_0000374 | |||
| 1879 | Ga0495623_0003450 | |||
| 1880 | Ga0495623_0100202 | |||
| 1881 | Ga0495646_0012512 | |||
| 1882 | Ga0495647_0110369 | |||
| 1883 | Ga0495647_0636201 | |||
| 1884 | Ga0495658_0895544 | |||
| 1885 | Ga0495669_0071854 | |||
| 1886 | Ga0495669_0088882 | |||
| 1887 | Ga0495669_0206828 | |||
| 1888 | Ga0495669_0348144 | |||
| 1889 | Ga0495669_0557729 | |||
| 1890 | Ga0495613_0173806 | |||
| 1891 | Ga0495613_0361477 | |||
| 1892 | Ga0495624_0441369 | |||
| 1893 | Ga0495670_0106179 | |||
| 1894 | Ga0495670_0216270 | |||
| 1895 | Ga0495670_0406804 | |||
| 1896 | Ga0495671_0058193 | |||
| 1897 | Ga0495649_0210466 | |||
| 1898 | Ga0495649_0379303 | |||
| 1899 | Ga0495649_0670095 | |||
| 1900 | Ga0495589_0140716 | |||
| 1901 | Ga0495589_0275926 | |||
| 1902 | Ga0495589_0283989 | |||
| 1903 | Ga0495589_0297304 | |||
| 1904 | Ga0495589_0407574 | |||
| 1905 | Ga0495600_0000970 | |||
| 1906 | Ga0495600_0380910 | |||
| 1907 | Ga0495660_0147676 | |||
| 1908 | Ga0495581_0809334 | |||
| 1909 | Ga0495604_0003086 | |||
| 1910 | Ga0495636_0054101 | |||
| 1911 | Ga0495636_0109509 | |||
| 1912 | Ga0495674_0146076 | |||
| 1913 | Ga0495674_0252273 | |||
| 1914 | Ga0495672_0024556 | |||
| 1915 | Ga0495672_0159882 | |||
| 1916 | Ga0495676_0043899 | |||
| 1917 | Ga0495676_0742707 | |||
| 1918 | Ga0495680_0001718 | |||
| 1919 | Ga0495680_0330668 | |||
| 1920 | Ga0495683_0076343 | |||
| 1921 | Ga0495683_0342624 | |||
| 1922 | Ga0495675_0012009 | |||
| 1923 | Ga0495677_0090591 | |||
| 1924 | Ga0495679_043384 | |||
| 1925 | Ga0495673_0061791 | |||
| 1926 | Ga0495673_0111052 | |||
| 1927 | Ga0495681_0068534 | |||
| 1928 | Ga0495681_0407177 | |||
| 1929 | Ga0495684_0000052 | |||
| 1930 | Ga0495686_0215418 | |||
| 1931 | Ga0495686_0304507 | |||
| 1932 | Ga0495686_0730832 | |||
| 1933 | Ga0495593_0000126 | |||
| 1934 | Ga0495602_0010424 | |||
| 1935 | Ga0495602_0524197 | |||
| 1936 | Ga0495614_0091053 | |||
| 1937 | Ga0495615_0170665 | |||
| 1938 | Ga0495626_0265118 | |||
| 1939 | Ga0496100_0021406 | |||
| 1940 | Ga0496100_0021807 | |||
| 1941 | Ga0496100_0132672 | |||
| 1942 | Ga0496100_0383208 | |||
| 1943 | Ga0496101_0001512 | |||
| 1944 | Ga0496101_0178464 | |||
| 1945 | Ga0496101_0273877 | |||
| 1946 | Ga0496102_0033502 | |||
| 1947 | Ga0496102_0033895 | |||
| 1948 | Ga0496102_0198935 | |||
| 1949 | Ga0496102_0295226 | |||
| 1950 | Ga0496102_0319248 | |||
| 1951 | Ga0496102_0538555 | |||
| 1952 | Ga0496102_0542080 | |||
| 1953 | Ga0496103_0012371 | |||
| 1954 | Ga0496103_0069769 | |||
| 1955 | Ga0496103_0590072 | |||
| 1956 | Ga0496103_0879205 | |||
| 1957 | Ga0496104_1009227 | |||
| 1958 | Ga0496104_1293685 | |||
| 1959 | Ga0496105_0032534 | |||
| 1960 | Ga0496105_0280558 | |||
| 1961 | Ga0496105_0551231 | |||
| 1962 | Ga0496106_0038427 | |||
| 1963 | Ga0496106_0056750 | |||
| 1964 | Ga0496106_0059762 | |||
| 1965 | Ga0496106_0277926 | |||
| 1966 | Ga0496106_0438668 | |||
| 1967 | Ga0496107_0050672 | |||
| 1968 | Ga0496107_0164136 | |||
| 1969 | Ga0496107_0464650 | |||
| 1970 | Ga0496108_0040448 | |||
| 1971 | Ga0496108_0056204 | |||
| 1972 | Ga0496109_0031405 | |||
| 1973 | Ga0496109_0062268 | |||
| 1974 | Ga0496109_0327331 | |||
| 1975 | Ga0496109_0700257 | |||
| 1976 | Ga0496110_0082989 | |||
| 1977 | Ga0496110_0084761 | |||
| 1978 | Ga0496110_0179327 | |||
| 1979 | Ga0496111_0016870 | |||
| 1980 | Ga0496111_0692845 | |||
| 1981 | Ga0496112_0123281 | |||
| 1982 | Ga0496112_0150606 | |||
| 1983 | Ga0496112_0164382 | |||
| 1984 | Ga0496112_1047994 | |||
| 1985 | Ga0496113_0002928 | |||
| 1986 | Ga0496113_0089701 | |||
| 1987 | Ga0496113_0188813 | |||
| 1988 | Ga0496113_0801082 | |||
| 1989 | Ga0496114_0032370 | |||
| 1990 | Ga0496114_0056698 | |||
| 1991 | Ga0496114_0199508 | |||
| 1992 | Ga0496114_0398277 | |||
| 1993 | Ga0496114_0858829 | |||
| 1994 | Ga0496115_0005545 | |||
| 1995 | Ga0496115_0012554 | |||
| 1996 | Ga0496115_0157169 | |||
| 1997 | Ga0496115_0185972 | |||
| 1998 | Ga0496115_0765283 | |||
| 1999 | Ga0496116_0094414 | |||
| 2000 | Ga0496117_0161014 | |||
| 2001 | Ga0496118_0146029 | |||
| 2002 | Ga0496118_0467257 | |||
| 2003 | Ga0496119_0058080 | |||
| 2004 | Ga0496119_0167217 | |||
| 2005 | Ga0496119_0531289 | |||
| 2006 | Ga0496120_0420744 | |||
| 2007 | Ga0496121_0024127 | |||
| 2008 | Ga0496121_0025355 | |||
| 2009 | Ga0496121_0058780 | |||
| 2010 | Ga0496121_0161254 | |||
| 2011 | Ga0496121_0254981 | |||
| 2012 | Ga0496121_0383874 | |||
| 2013 | Ga0496124_0035110 | |||
| 2014 | Ga0496124_0433735 | |||
| 2015 | Ga0496124_0711490 | |||
| 2016 | Ga0496125_0148640 | |||
| 2017 | Ga0496125_0256772 | |||
| 2018 | Ga0496126_0010541 | |||
| 2019 | Ga0496126_0020133 | |||
| 2020 | Ga0496126_0044803 | |||
| 2021 | Ga0496126_0151219 | |||
| 2022 | Ga0496126_0585094 | |||
| 2023 | Ga0496126_0836504 | |||
| 2024 | Ga0495678_072488 | |||
| 2025 | Ga0495682_0038197 | |||
| 2026 | Ga0501032_0662617 | |||
| 2027 | Ga0501034_0628916 | |||
| 2028 | Ga0501043_0495050 | |||
| 2029 | Ga0501046_0045521 | |||
| 2030 | Ga0501047_0017816 | |||
| 2031 | Ga0501067_0075522 | |||
| 2032 | Ga0501068_0181816 | |||
| 2033 | Ga0501069_0715564 | |||
| 2034 | Ga0501073_0044960 | |||
| 2035 | Ga0501074_0039204 | |||
| 2036 | Ga0501075_0672839 | |||
| 2037 | Ga0501079_1361530 | |||
| 2038 | Ga0501080_0009144 | |||
| 2039 | Ga0501035_0429847 | |||
| 2040 | Ga0501045_0331924 | |||
| 2041 | nmdc:mga03683_59832_c1 | |||
| 2042 | nmdc:mga03683_65968_c1 | |||
| 2043 | nmdc:mga03n38_14534_c1 | |||
| 2044 | nmdc:mga03n38_160367_c1 | |||
| 2045 | nmdc:mga03n38_247658_c1 | |||
| 2046 | nmdc:mga03n38_298821_c1 | |||
| 2047 | nmdc:mga03n38_856169_c1 | |||
| 2048 | nmdc:mga03n38_946287_c1 | |||
| 2049 | nmdc:mga00v17_24823_c1 | |||
| 2050 | nmdc:mga00v17_3320_c1 | |||
| 2051 | nmdc:mga0yw44_1054796_c1 | |||
| 2052 | nmdc:mga0yw44_138210_c1 | |||
| 2053 | nmdc:mga0yw44_145311_c1 | |||
| 2054 | nmdc:mga0yw44_209617_c1 | |||
| 2055 | nmdc:mga0yw44_280742_c1 | |||
| 2056 | nmdc:mga0yw44_29183_c1 | |||
| 2057 | nmdc:mga0yw44_791994_c1 | |||
| 2058 | nmdc:mga0k408_121414_c1 | |||
| 2059 | nmdc:mga0k408_281160_c1 | |||
| 2060 | nmdc:mga0k408_409445_c1 | |||
| 2061 | nmdc:mga0k408_451528_c1 | |||
| 2062 | nmdc:mga0k408_566032_c1 | |||
| 2063 | nmdc:mga0k408_84163_c1 | |||
| 2064 | nmdc:mga06z11_52627_c1 | |||
| 2065 | nmdc:mga06z11_603137_c1 | |||
| 2066 | nmdc:mga06z11_8453_c1 | |||
| 2067 | nmdc:mga06z11_870847_c1 | |||
| 2068 | nmdc:mga04h51_150570_c1 | |||
| 2069 | nmdc:mga04h51_72475_c1 | |||
| 2070 | nmdc:mga07m45_14522_c1 | |||
| 2071 | nmdc:mga07m45_442553_c1 | |||
| 2072 | nmdc:mga07m45_567485_c1 | |||
| 2073 | nmdc:mga05p37_108944_c1 | |||
| 2074 | nmdc:mga09592_807967_c1 | |||
| 2075 | nmdc:mga06r32_866156_c1 | |||
| 2076 | nmdc:mga08y16_1055318_c1 | |||
| 2077 | nmdc:mga08y16_454773_c1 | |||
| 2078 | nmdc:mga08y16_785429_c1 | |||
| 2079 | nmdc:mga0n895_71870_c1 | |||
| 2080 | nmdc:mga0rr50_223423_c1 | |||
| 2081 | nmdc:mga08x19_1201975_c1 | |||
| 2082 | nmdc:mga0a205_694597_c1 | |||
| 2083 | nmdc:mga0sz30_164762_c1 | |||
| 2084 | nmdc:mga0sz30_472159_c1 | |||
| 2085 | nmdc:mga0sz30_82064_c1 | |||
| 2086 | Ga0495601_0009158 | |||
| 2087 | Ga0495601_0065866 | |||
| 2088 | Ga0495601_0174222 | |||
| 2089 | Ga0495601_0294966 | |||
| 2090 | Ga0500610_0222259 | |||
| 2091 | Ga0500635_0114836 | |||
| 2092 | Ga0495655_0080185 | |||
| 2093 | Ga0495595_0001810 | |||
| 2094 | Ga0495595_0003500 | |||
| 2095 | Ga0495619_0000458 | |||
| 2096 | Ga0495619_0036103 | |||
| 2097 | Ga0495619_0379632 | |||
| 2098 | Ga0500643_008568 | |||
| 2099 | Ga0500581_090287 | |||
| 2100 | Ga0500646_0382550 | |||
| 2101 | Ga0500583_0180690 | |||
| 2102 | Ga0500583_0259058 | |||
| 2103 | Ga0500583_0292914 | |||
| 2104 | Ga0500651_0477564 | |||
| 2105 | Ga0500641_0050832 | |||
| 2106 | Ga0500650_0250026 | |||
| 2107 | Ga0500650_0354165 | |||
| 2108 | Ga0500556_0108718 | |||
| 2109 | Ga0500594_0034745 | |||
| 2110 | Ga0500595_008603 | |||
| 2111 | Ga0500617_158167 | |||
| 2112 | Ga0500642_0143799 | |||
| 2113 | Ga0500642_0374802 | |||
| 2114 | Ga0500658_0177344 | |||
| 2115 | Ga0500658_0219962 | |||
| 2116 | Ga0500568_0395917 | |||
| 2117 | Ga0500577_0154493 | |||
| 2118 | Ga0500588_0060467 | |||
| 2119 | Ga0500589_021026 | |||
| 2120 | Ga0500589_092741 | |||
| 2121 | Ga0500589_110798 | |||
| 2122 | Ga0500590_134072 | |||
| 2123 | Ga0500604_0054722 | |||
| 2124 | Ga0500604_0149677 | |||
| 2125 | Ga0500634_0045550 | |||
| 2126 | Ga0500634_0352965 | |||
| 2127 | Ga0500638_034112 | |||
| 2128 | Ga0500636_0029007 | |||
| 2129 | Ga0500636_0087827 | |||
| 2130 | Ga0500636_0513243 | |||
| 2131 | Ga0500645_174334 | |||
| 2132 | Ga0500609_005864 | |||
| 2133 | Ga0500656_002657 | |||
| 2134 | Ga0530510_0260710 | |||
| 2135 | 2513656433 | |||
| 2136 | 2513694850 | |||
| 2137 | 2513715622 | |||
| 2138 | 2513858989 | |||
| 2139 | 2513917388 | |||
| 2140 | 2517889605 | |||
| 2141 | 2524535629 | |||
| 2142 | 2671121204 | |||
| 2143 | 2723842094 | |||
| 2144 | 2728749210 | |||
| 2145 | 2793077353 | |||
| 2146 | 2874610286 | |||
| 2147 | 2876812757 | |||
| 2148 | 2879111606 | |||
| 2149 | 2885378009 | |||
| 2150 | 2903754951 | |||
| 2151 | 2904709443 | |||
| 2152 | 2906641117 | |||
| 2153 | 2906665673 | |||
| 2154 | 2908746156 | |||
| 2155 | 2922366887 | |||
| 2156 | 2922391939 | |||
| 2157 | 2922433466 | |||
| 2158 | 3005483163 | |||
| 2159 | 8006935527 | |||
| 2160 | 8006971518 | |||
| 2161 | 8006975454 | |||
| 2162 | 8006985860 | |||
| 2163 | 8007001481 | |||
| 2164 | 8019563283 | |||
| 2165 | 8019573363 | |||
| 2166 | 8056679340 |