F489709

General Info

Members Datasets Scaffolds Average Seq Length
1083 497 2166 97

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10625062|Ga0070685_106250622
Length 102
Sequence MAYLTTFYWGWLLASALLGLAMGWISVVQHGEGVSKNVKRWLAVLAAALVAAALSRTVPGRFGYWLDLGLTMFALYLVGCAIGSWLRDWVVSRSAPALRDLP

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
104 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
105 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
108 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
210 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
211 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
212 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
219 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
220 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
221 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
222 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
228 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
233 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
234 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
235 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
238 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
239 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
242 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
243 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
244 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
245 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
246 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
251 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
252 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
253 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
254 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
255 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
256 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
257 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
258 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
259 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
263 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
271 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
272 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
273 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
274 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
275 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
276 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
277 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
278 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
279 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
280 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
281 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
282 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
283 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
286 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
287 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
288 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
289 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
290 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
291 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
292 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
293 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
294 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
297 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
298 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
299 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
302 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
303 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
307 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
308 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
309 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
310 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
311 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
312 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
313 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
314 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
315 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
316 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
317 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
318 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
319 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
320 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
321 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
322 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
323 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
324 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
325 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
326 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
331 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
332 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
333 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
334 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
338 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
339 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
340 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
341 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
342 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
343 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
344 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
345 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
346 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
347 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
348 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
349 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
350 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
351 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
352 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
353 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
354 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
355 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
356 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
357 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
358 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
359 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
360 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
361 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
362 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
363 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
364 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
365 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
366 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
367 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
368 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
369 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
370 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
371 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
372 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
373 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
374 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
375 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
376 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
377 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
378 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
379 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
380 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
389 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
390 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
391 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
392 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
393 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
394 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
395 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
396 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
397 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
398 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
399 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
400 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
401 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
402 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
411 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
412 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
413 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
414 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
415 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
417 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
418 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
419 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
420 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
423 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
424 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
425 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
426 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
427 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
428 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
429 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
430 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
431 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
432 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
433 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
434 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
435 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
436 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
437 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
438 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
439 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
440 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
441 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
442 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
443 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
444 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
445 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
446 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
447 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
448 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
449 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
450 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
451 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
452 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
453 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
454 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
455 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
456 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
457 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
458 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
459 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
460 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
461 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
462 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
463 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
464 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
465 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
466 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
467 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
468 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
469 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
470 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
471 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
472 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
473 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
474 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
475 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
476 2791355199
477 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
478 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
479 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
480 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
481 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
482 2904699407
483 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
484 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
485 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
486 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
487 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
488 2922425934
489 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
490 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
491 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
492 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
493 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
494 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
495 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
496 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
497 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.62
Nodule 2.68
Rhizoplane 6.37
Rhizosphere 74.98
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_10625062 3300005466 Bacteria 778
2 CNAas_1005993 3300000532 Bacteria 781
3 JGI24750J21931_1017621 3300002070 Bacteria 978
4 JGI24748J21848_1033116 3300002074 Unclassified 643
5 JGI25165J46597_1025250 3300003214 Bacteria 770
6 rootH1_10041688 3300003323 Bacteria 3202
7 JGI25404J52841_10017928 3300003659 Bacteria 1534
8 JGI25404J52841_10020963 3300003659 Bacteria 1415
9 Ga0065707_10283436 3300005295 Bacteria 1042
10 Ga0070658_11077041 3300005327 Bacteria 699
11 Ga0070676_10338834 3300005328 Bacteria 1031
12 Ga0070676_10366967 3300005328 Bacteria 993
13 Ga0070676_10500138 3300005328 Bacteria 863
14 Ga0070676_10660764 3300005328 Bacteria 760
15 Ga0070676_11307409 3300005328 Bacteria 554
16 Ga0070683_101567661 3300005329 Bacteria 633
17 Ga0070690_100252562 3300005330 Bacteria 1248
18 Ga0070690_100315078 3300005330 Bacteria 1126
19 Ga0070670_100174228 3300005331 Bacteria 1867
20 Ga0070677_10269195 3300005333 Bacteria 854
21 Ga0068869_100021616 3300005334 Bacteria 4428
22 Ga0068869_100113202 3300005334 Bacteria 2066
23 Ga0068869_100222862 3300005334 Bacteria 1495
24 Ga0070666_10929593 3300005335 Bacteria 644
25 Ga0070666_11067624 3300005335 Bacteria 600
26 Ga0070666_11272161 3300005335 Bacteria 548
27 Ga0070680_100110849 3300005336 Bacteria 2284
28 Ga0070680_100546304 3300005336 Bacteria 993
29 Ga0070680_100912620 3300005336 Bacteria 758
30 Ga0070682_100591629 3300005337 Bacteria 875
31 Ga0068868_100196063 3300005338 Bacteria 1681
32 Ga0068868_100328088 3300005338 Bacteria 1305
33 Ga0068868_101022434 3300005338 Bacteria 757
34 Ga0070660_100187113 3300005339 Bacteria 1677
35 Ga0070689_100087109 3300005340 Bacteria 2456
36 Ga0070691_10378304 3300005341 Bacteria 793
37 Ga0070661_100050478 3300005344 Bacteria 3044
38 Ga0070661_100215826 3300005344 Bacteria 1470
39 Ga0070661_100282157 3300005344 Bacteria 1289
40 Ga0070661_100587028 3300005344 Bacteria 900
41 Ga0070668_100200199 3300005347 Bacteria 1639
42 Ga0070668_100298090 3300005347 Bacteria 1351
43 Ga0070668_100464471 3300005347 Bacteria 1090
44 Ga0070668_100851448 3300005347 Bacteria 812
45 Ga0070668_100969456 3300005347 Bacteria 763
46 Ga0070668_101033448 3300005347 Bacteria 739
47 Ga0070669_100073283 3300005353 Bacteria 2536
48 Ga0070669_100991418 3300005353 Bacteria 720
49 Ga0070675_100079027 3300005354 Bacteria 2740
50 Ga0070675_101034169 3300005354 Bacteria 754
51 Ga0070675_101138317 3300005354 Bacteria 718
52 Ga0070671_100035846 3300005355 Bacteria 4111
53 Ga0070671_100308940 3300005355 Bacteria 1347
54 Ga0070671_101082781 3300005355 Bacteria 704
55 Ga0070674_100028167 3300005356 Bacteria 3688
56 Ga0070674_100074542 3300005356 Bacteria 2408
57 Ga0070674_100233565 3300005356 Bacteria 1436
58 Ga0070674_100592587 3300005356 Bacteria 935
59 Ga0070674_100822513 3300005356 Bacteria 804
60 Ga0070673_100193672 3300005364 Bacteria 1747
61 Ga0070673_102112555 3300005364 Bacteria 535
62 Ga0070688_100242985 3300005365 Bacteria 1279
63 Ga0070688_100741956 3300005365 Bacteria 764
64 Ga0070659_100159893 3300005366 Bacteria 1841
65 Ga0070667_100070033 3300005367 Bacteria 2985
66 Ga0070667_101109350 3300005367 Bacteria 740
67 Ga0070703_10032218 3300005406 Bacteria 1591
68 Ga0070709_10003962 3300005434 Bacteria 7980
69 Ga0070714_100404744 3300005435 Bacteria 1290
70 Ga0070714_101760836 3300005435 Bacteria 605
71 Ga0070713_100031271 3300005436 Bacteria 4239
72 Ga0070713_100461775 3300005436 Bacteria 1194
73 Ga0070710_10003249 3300005437 Bacteria 7704
74 Ga0070701_10179658 3300005438 Bacteria 1238
75 Ga0070701_10890180 3300005438 Bacteria 614
76 Ga0070711_100003683 3300005439 Bacteria 8971
77 Ga0070700_100501649 3300005441 Bacteria 934
78 Ga0070700_100848545 3300005441 Bacteria 739
79 Ga0070694_100031961 3300005444 Bacteria 3454
80 Ga0070694_100483687 3300005444 Bacteria 983
81 Ga0070708_101145333 3300005445 Bacteria 728
82 Ga0070663_100006704 3300005455 Bacteria 6947
83 Ga0070663_100031868 3300005455 Bacteria 3627
84 Ga0070663_100049472 3300005455 Bacteria 2985
85 Ga0070663_100085522 3300005455 Bacteria 2327
86 Ga0070663_100116066 3300005455 Bacteria 2017
87 Ga0070663_100147815 3300005455 Bacteria 1799
88 Ga0070678_100111418 3300005456 Bacteria 2141
89 Ga0070678_100148423 3300005456 Bacteria 1885
90 Ga0070678_100158060 3300005456 Bacteria 1833
91 Ga0070678_100174110 3300005456 Bacteria 1755
92 Ga0070678_100327146 3300005456 Bacteria 1311
93 Ga0070678_100785419 3300005456 Bacteria 864
94 Ga0070678_101207059 3300005456 Bacteria 701
95 Ga0070678_101235620 3300005456 Bacteria 694
96 Ga0070662_100045046 3300005457 Bacteria 3163
97 Ga0070662_100094482 3300005457 Bacteria 2251
98 Ga0070662_100236004 3300005457 Bacteria 1465
99 Ga0070662_100971378 3300005457 Bacteria 726
100 Ga0070681_10046420 3300005458 Bacteria 4343
101 Ga0068867_100305134 3300005459 Bacteria 1314
102 Ga0068867_100737654 3300005459 Bacteria 873
103 Ga0070685_10681621 3300005466 Bacteria 748
104 Ga0070706_101089037 3300005467 Bacteria 736
105 Ga0070698_100047027 3300005471 Bacteria 4411
106 Ga0070699_100213534 3300005518 Bacteria 1718
107 Ga0070679_100163495 3300005530 Bacteria 2200
108 Ga0070679_102081176 3300005530 Bacteria 517
109 Ga0070684_100004411 3300005535 Bacteria 10711
110 Ga0070684_100369687 3300005535 Bacteria 1320
111 Ga0070684_101265692 3300005535 Bacteria 694
112 Ga0070684_101563973 3300005535 Bacteria 622
113 Ga0070697_100098950 3300005536 Bacteria 2421
114 Ga0068853_100058224 3300005539 Bacteria 3335
115 Ga0068853_100127068 3300005539 Bacteria 2278
116 Ga0068853_100784282 3300005539 Bacteria 912
117 Ga0068853_101017455 3300005539 Bacteria 798
118 Ga0068853_101242555 3300005539 Bacteria 719
119 Ga0068853_101487769 3300005539 Bacteria 656
120 Ga0068853_101616627 3300005539 Bacteria 628
121 Ga0070672_100050034 3300005543 Bacteria 3254
122 Ga0070672_100191235 3300005543 Bacteria 1709
123 Ga0070672_101449465 3300005543 Bacteria 615
124 Ga0070686_100448158 3300005544 Bacteria 992
125 Ga0070695_100452034 3300005545 Bacteria 984
126 Ga0070695_100556782 3300005545 Bacteria 894
127 Ga0070696_101114343 3300005546 Bacteria 664
128 Ga0070693_100141796 3300005547 Bacteria 1513
129 Ga0070693_100158169 3300005547 Bacteria 1441
130 Ga0070693_100727330 3300005547 Bacteria 729
131 Ga0070665_100006047 3300005548 Bacteria 12369
132 Ga0070665_100046934 3300005548 Bacteria 4335
133 Ga0070665_100088172 3300005548 Bacteria 3108
134 Ga0070665_100147132 3300005548 Bacteria 2359
135 Ga0070665_100242310 3300005548 Bacteria 1803
136 Ga0070665_100359203 3300005548 Bacteria 1462
137 Ga0070665_100449282 3300005548 Bacteria 1298
138 Ga0070665_100680563 3300005548 Bacteria 1042
139 Ga0070665_100995411 3300005548 Bacteria 851
140 Ga0070665_101064742 3300005548 Bacteria 820
141 Ga0070704_100996661 3300005549 Bacteria 757
142 Ga0068855_100142397 3300005563 Bacteria 2731
143 Ga0068855_101341858 3300005563 Bacteria 739
144 Ga0070664_100752603 3300005564 Bacteria 909
145 Ga0068857_100161780 3300005577 Bacteria 2031
146 Ga0068857_101466126 3300005577 Bacteria 665
147 Ga0068854_100050418 3300005578 Bacteria 2978
148 Ga0068854_100133533 3300005578 Bacteria 1898
149 Ga0068854_100350047 3300005578 Bacteria 1209
150 Ga0068856_100045441 3300005614 Bacteria 4324
151 Ga0068856_100218065 3300005614 Bacteria 1923
152 Ga0070702_100240942 3300005615 Bacteria 1220
153 Ga0070702_100357805 3300005615 Bacteria 1030
154 Ga0070702_100483500 3300005615 Bacteria 905
155 Ga0070702_100773885 3300005615 Bacteria 740
156 Ga0070702_101499734 3300005615 Bacteria 555
157 Ga0068852_100195806 3300005616 Bacteria 1910
158 Ga0068852_100211650 3300005616 Bacteria 1839
159 Ga0068852_100802086 3300005616 Bacteria 956
160 Ga0068852_100831125 3300005616 Bacteria 939
161 Ga0068859_100081687 3300005617 Bacteria 3274
162 Ga0068859_100103695 3300005617 Bacteria 2902
163 Ga0068859_100193831 3300005617 Bacteria 2116
164 Ga0068859_100489587 3300005617 Bacteria 1325
165 Ga0068864_100236351 3300005618 Bacteria 1692
166 Ga0068864_100380312 3300005618 Bacteria 1338
167 Ga0068866_10014019 3300005718 Bacteria 3529
168 Ga0068866_10068672 3300005718 Bacteria 1864
169 Ga0068866_10178015 3300005718 Bacteria 1254
170 Ga0068866_11147688 3300005718 Bacteria 559
171 Ga0068861_100114662 3300005719 Bacteria 2164
172 Ga0068861_100132658 3300005719 Bacteria 2023
173 Ga0068861_100455335 3300005719 Bacteria 1147
174 Ga0068861_100559489 3300005719 Bacteria 1043
175 Ga0068861_100873609 3300005719 Bacteria 849
176 Ga0068851_10299235 3300005834 Bacteria 925
177 Ga0068870_10062612 3300005840 Bacteria 2004
178 Ga0068863_100342051 3300005841 Bacteria 1455
179 Ga0068863_100452357 3300005841 Bacteria 1260
180 Ga0068863_101721265 3300005841 Bacteria 637
181 Ga0068858_100099908 3300005842 Bacteria 2706
182 Ga0068858_100553727 3300005842 Bacteria 1113
183 Ga0068860_100077344 3300005843 Bacteria 3164
184 Ga0068860_100134772 3300005843 Bacteria 2371
185 Ga0068860_100233815 3300005843 Bacteria 1786
186 Ga0068860_100260103 3300005843 Bacteria 1691
187 Ga0068860_100317765 3300005843 Bacteria 1528
188 Ga0068862_100306533 3300005844 Bacteria 1462
189 Ga0068862_101064457 3300005844 Bacteria 802
190 Ga0068862_101860252 3300005844 Bacteria 612
191 Ga0068862_101997501 3300005844 Bacteria 590
192 Ga0068862_102661352 3300005844 Bacteria 512
193 Ga0081455_10023941 3300005937 Bacteria 5669
194 Ga0081455_10148450 3300005937 Bacteria 1810
195 Ga0081538_10019994 3300005981 Bacteria 4950
196 Ga0081540_1005122 3300005983 Bacteria 9825
197 Ga0081540_1008650 3300005983 Bacteria 7094
198 Ga0081540_1010370 3300005983 Bacteria 6318
199 Ga0081540_1028568 3300005983 Bacteria 3129
200 Ga0081540_1112096 3300005983 Bacteria 1150
201 Ga0081539_10061245 3300005985 Bacteria 2063
202 Ga0081539_10095727 3300005985 Bacteria 1525
203 Ga0075365_10211511 3300006038 Bacteria 1359
204 Ga0075365_10253956 3300006038 Bacteria 1236
205 Ga0075365_10340808 3300006038 Bacteria 1056
206 Ga0075365_10960146 3300006038 Bacteria 602
207 Ga0075368_10041864 3300006042 Bacteria 1800
208 Ga0075368_10073537 3300006042 Bacteria 1383
209 Ga0075368_10120613 3300006042 Bacteria 1086
210 Ga0075368_10139054 3300006042 Bacteria 1011
211 Ga0075363_100019573 3300006048 Bacteria 3385
212 Ga0075363_100204972 3300006048 Bacteria 1127
213 Ga0075363_100219456 3300006048 Bacteria 1089
214 Ga0075363_100323392 3300006048 Bacteria 897
215 Ga0075363_100422567 3300006048 Bacteria 785
216 Ga0075364_10043408 3300006051 Bacteria 2923
217 Ga0075364_10111208 3300006051 Bacteria 1828
218 Ga0075364_10191119 3300006051 Bacteria 1386
219 Ga0075364_10667330 3300006051 Bacteria 710
220 Ga0075432_10318984 3300006058 Bacteria 650
221 Ga0070716_100191696 3300006173 Bacteria 1351
222 Ga0070716_100355337 3300006173 Bacteria 1039
223 Ga0070716_101749369 3300006173 Bacteria 514
224 Ga0070712_100002748 3300006175 Bacteria 10879
225 Ga0070712_100071562 3300006175 Bacteria 2481
226 Ga0070712_100410939 3300006175 Bacteria 1120
227 Ga0075362_10048946 3300006177 Bacteria 1887
228 Ga0075362_10212115 3300006177 Bacteria 944
229 Ga0075362_10545911 3300006177 Bacteria 596
230 Ga0075367_10008917 3300006178 Bacteria 5219
231 Ga0075367_10066140 3300006178 Bacteria 2165
232 Ga0075367_10179835 3300006178 Bacteria 1318
233 Ga0075367_10237592 3300006178 Bacteria 1141
234 Ga0075367_10293843 3300006178 Bacteria 1022
235 Ga0075367_10403583 3300006178 Bacteria 864
236 Ga0075369_10063424 3300006186 Bacteria 1616
237 Ga0075369_10087263 3300006186 Bacteria 1389
238 Ga0075369_10156760 3300006186 Bacteria 1042
239 Ga0075366_10043943 3300006195 Bacteria 2647
240 Ga0075366_10205804 3300006195 Bacteria 1197
241 Ga0075366_10335194 3300006195 Bacteria 927
242 Ga0075366_10580541 3300006195 Bacteria 694
243 Ga0097621_100091765 3300006237 Bacteria 2543
244 Ga0097621_100132654 3300006237 Bacteria 2121
245 Ga0097621_101074854 3300006237 Bacteria 755
246 Ga0075370_10012018 3300006353 Bacteria 4564
247 Ga0075370_10106281 3300006353 Bacteria 1627
248 Ga0068871_100233636 3300006358 Bacteria 1597
249 Ga0068871_100251773 3300006358 Bacteria 1539
250 Ga0068871_100745820 3300006358 Bacteria 900
251 Ga0068871_101217757 3300006358 Bacteria 706
252 Ga0075428_100916099 3300006844 Bacteria 929
253 Ga0075428_101013454 3300006844 Bacteria 879
254 Ga0075431_100303669 3300006847 Bacteria 1612
255 Ga0075433_11507387 3300006852 Bacteria 581
256 Ga0068865_100010829 3300006881 Bacteria 5689
257 Ga0068865_100156758 3300006881 Bacteria 1732
258 Ga0068865_100307186 3300006881 Bacteria 1271
259 Ga0068865_100505252 3300006881 Bacteria 1008
260 Ga0068865_100906333 3300006881 Bacteria 767
261 Ga0068865_101426112 3300006881 Bacteria 619
262 Ga0075436_100134548 3300006914 Bacteria 1735
263 Ga0075436_100528411 3300006914 Bacteria 865
264 Ga0097620_100081686 3300006931 Bacteria 3274
265 Ga0097620_100103699 3300006931 Bacteria 2902
266 Ga0097620_100193831 3300006931 Bacteria 2116
267 Ga0097620_100489632 3300006931 Bacteria 1325
268 Ga0099825_1023278 3300006941 Bacteria 3829
269 Ga0099824_1033392 3300006942 Bacteria 1745
270 Ga0099822_1000191 3300006943 Bacteria 46107
271 Ga0075435_100086775 3300007076 Bacteria 2578
272 Ga0099794_10025181 3300007265 Bacteria 2738
273 Ga0099795_10017094 3300007788 Bacteria 2307
274 Ga0099795_10082459 3300007788 Bacteria 1233
275 Ga0105250_10091244 3300009092 Bacteria 1239
276 Ga0105240_10099049 3300009093 Bacteria 3549
277 Ga0105240_11904592 3300009093 Bacteria 619
278 Ga0111539_10057611 3300009094 Bacteria 4613
279 Ga0111539_10834437 3300009094 Bacteria 1072
280 Ga0105245_10215836 3300009098 Bacteria 1849
281 Ga0105245_10438015 3300009098 Bacteria 1313
282 Ga0105245_10547433 3300009098 Bacteria 1179
283 Ga0105245_10632651 3300009098 Bacteria 1099
284 Ga0105245_11844071 3300009098 Bacteria 658
285 Ga0105247_10251361 3300009101 Bacteria 1208
286 Ga0105247_10273958 3300009101 Bacteria 1162
287 Ga0105247_10378583 3300009101 Bacteria 1003
288 Ga0105247_10574522 3300009101 Bacteria 832
289 Ga0105247_10759387 3300009101 Bacteria 736
290 Ga0114129_10119006 3300009147 Bacteria 3638
291 Ga0105243_10089029 3300009148 Bacteria 2537
292 Ga0105243_10249223 3300009148 Bacteria 1585
293 Ga0105243_10562342 3300009148 Bacteria 1092
294 Ga0105243_11077275 3300009148 Bacteria 811
295 Ga0105241_10111539 3300009174 Bacteria 2190
296 Ga0105241_10196422 3300009174 Bacteria 1682
297 Ga0105242_10051398 3300009176 Bacteria 3358
298 Ga0105242_10569940 3300009176 Bacteria 1089
299 Ga0105242_10587599 3300009176 Bacteria 1074
300 Ga0105242_11751136 3300009176 Bacteria 659
301 Ga0105248_10052096 3300009177 Bacteria 4593
302 Ga0105248_10059734 3300009177 Bacteria 4283
303 Ga0105248_10252605 3300009177 Bacteria 1984
304 Ga0105248_10380194 3300009177 Bacteria 1590
305 Ga0105248_10466140 3300009177 Bacteria 1424
306 Ga0105248_10495624 3300009177 Bacteria 1377
307 Ga0105248_10714438 3300009177 Bacteria 1131
308 Ga0105237_10280693 3300009545 Bacteria 1668
309 Ga0105237_10356602 3300009545 Bacteria 1467
310 Ga0105237_10903743 3300009545 Bacteria 890
311 Ga0105237_11465768 3300009545 Bacteria 689
312 Ga0105238_10120163 3300009551 Bacteria 2607
313 Ga0105238_10123963 3300009551 Bacteria 2563
314 Ga0105238_11606265 3300009551 Bacteria 680
315 Ga0105238_12876263 3300009551 Bacteria 518
316 Ga0105249_10038661 3300009553 Bacteria 4330
317 Ga0105249_10166891 3300009553 Bacteria 2132
318 Ga0105249_10333447 3300009553 Bacteria 1531
319 Ga0105249_10875378 3300009553 Bacteria 964
320 Ga0105249_12175814 3300009553 Bacteria 627
321 Ga0099796_10047206 3300010159 Bacteria 1481
322 Ga0105239_10045817 3300010375 Bacteria 4792
323 Ga0105239_10045962 3300010375 Bacteria 4785
324 Ga0105239_10078073 3300010375 Bacteria 3644
325 Ga0105239_10154693 3300010375 Bacteria 2560
326 Ga0105239_11298562 3300010375 Bacteria 839
327 Ga0105239_11416789 3300010375 Bacteria 802
328 Ga0105239_12891748 3300010375 Bacteria 560
329 Ga0105239_13101289 3300010375 Bacteria 541
330 Ga0105246_10083619 3300011119 Bacteria 2281
331 Ga0105246_10192462 3300011119 Bacteria 1580
332 Ga0105246_10218545 3300011119 Bacteria 1492
333 Ga0105246_10514215 3300011119 Bacteria 1019
334 Ga0105246_10880933 3300011119 Bacteria 801
335 Ga0157369_10007714 3300013105 Bacteria 12380
336 Ga0157374_10020275 3300013296 Bacteria 5896
337 Ga0157374_10508924 3300013296 Bacteria 1209
338 Ga0157374_10902248 3300013296 Bacteria 901
339 Ga0157374_11458196 3300013296 Bacteria 707
340 Ga0157374_11849640 3300013296 Bacteria 629
341 Ga0157374_12292734 3300013296 Bacteria 567
342 Ga0157378_10015483 3300013297 Bacteria 6681
343 Ga0157378_10093522 3300013297 Bacteria 2737
344 Ga0157378_10889525 3300013297 Bacteria 921
345 Ga0163162_10102095 3300013306 Bacteria 2961
346 Ga0163162_10114346 3300013306 Bacteria 2798
347 Ga0163162_10115742 3300013306 Bacteria 2781
348 Ga0163162_10496912 3300013306 Bacteria 1350
349 Ga0163162_11263824 3300013306 Bacteria 838
350 Ga0163162_13025924 3300013306 Bacteria 540
351 Ga0157372_11742165 3300013307 Bacteria 717
352 Ga0157375_10094761 3300013308 Bacteria 3055
353 Ga0157375_10269525 3300013308 Bacteria 1864
354 Ga0157375_10331276 3300013308 Bacteria 1687
355 Ga0157375_11874071 3300013308 Bacteria 712
356 Ga0157375_12030473 3300013308 Bacteria 684
357 Ga0157375_13344226 3300013308 Bacteria 534
358 Ga0163163_10363328 3300014325 Bacteria 1504
359 Ga0163163_10617738 3300014325 Bacteria 1147
360 Ga0163163_10827272 3300014325 Bacteria 989
361 Ga0163163_10948772 3300014325 Bacteria 923
362 Ga0163163_11340026 3300014325 Bacteria 778
363 Ga0163163_11656935 3300014325 Bacteria 700
364 Ga0163163_11830600 3300014325 Bacteria 667
365 Ga0163163_13290015 3300014325 Bacteria 504
366 Ga0157380_10566922 3300014326 Bacteria 1117
367 Ga0157380_10693656 3300014326 Bacteria 1022
368 Ga0157380_10716500 3300014326 Bacteria 1007
369 Ga0157380_11106285 3300014326 Bacteria 832
370 Ga0157380_11728683 3300014326 Bacteria 683
371 Ga0182008_10263735 3300014497 Bacteria 892
372 Ga0157377_10190270 3300014745 Bacteria 1296
373 Ga0157377_11361730 3300014745 Bacteria 558
374 Ga0157379_10155773 3300014968 Bacteria 2061
375 Ga0157379_10351469 3300014968 Bacteria 1350
376 Ga0157379_10365434 3300014968 Bacteria 1323
377 Ga0157379_12423835 3300014968 Bacteria 524
378 Ga0157376_10004288 3300014969 Bacteria 9905
379 Ga0157376_10604754 3300014969 Bacteria 1092
380 Ga0157376_10989445 3300014969 Bacteria 863
381 Ga0157376_11133347 3300014969 Bacteria 809
382 Ga0157376_11230187 3300014969 Bacteria 777
383 Ga0157376_11681043 3300014969 Bacteria 670
384 Ga0182007_10351718 3300015262 Bacteria 553
385 Ga0163161_10043682 3300017792 Bacteria 3227
386 Ga0163161_10285992 3300017792 Bacteria 1295
387 Ga0163161_10558316 3300017792 Bacteria 939
388 Ga0213876_10344846 3300021384 Bacteria 792
389 Ga0209677_125228 3300025253 Bacteria 643
390 Ga0209025_1132440 3300025294 Bacteria 722
391 Ga0209758_1004214 3300025297 Bacteria 12185
392 Ga0209758_1022090 3300025297 Bacteria 2936
393 Ga0207697_10131220 3300025315 Bacteria 1083
394 Ga0207696_1027263 3300025711 Bacteria 1761
395 Ga0207653_10028554 3300025885 Bacteria 1795
396 Ga0207682_10177584 3300025893 Bacteria 971
397 Ga0207692_10003473 3300025898 Bacteria 6163
398 Ga0207692_10430837 3300025898 Bacteria 827
399 Ga0207642_10125500 3300025899 Bacteria 1331
400 Ga0207710_10049499 3300025900 Bacteria 1883
401 Ga0207710_10157869 3300025900 Bacteria 1103
402 Ga0207710_10178232 3300025900 Bacteria 1042
403 Ga0207688_10010595 3300025901 Bacteria 5013
404 Ga0207688_10027797 3300025901 Bacteria 3111
405 Ga0207688_10126798 3300025901 Bacteria 1493
406 Ga0207680_10622183 3300025903 Bacteria 772
407 Ga0207680_10773742 3300025903 Bacteria 688
408 Ga0207680_11146224 3300025903 Bacteria 555
409 Ga0207647_10006138 3300025904 Bacteria 8753
410 Ga0207685_10175751 3300025905 Bacteria 989
411 Ga0207699_10005053 3300025906 Bacteria 6310
412 Ga0207645_10209212 3300025907 Bacteria 1284
413 Ga0207645_10269804 3300025907 Bacteria 1128
414 Ga0207645_10475068 3300025907 Bacteria 845
415 Ga0207643_10027305 3300025908 Bacteria 3164
416 Ga0207643_10373065 3300025908 Bacteria 898
417 Ga0207705_10704342 3300025909 Bacteria 785
418 Ga0207684_11112591 3300025910 Bacteria 657
419 Ga0207654_10050940 3300025911 Bacteria 2381
420 Ga0207654_10576763 3300025911 Bacteria 801
421 Ga0207707_10333055 3300025912 Bacteria 1309
422 Ga0207671_10509091 3300025914 Bacteria 960
423 Ga0207671_10548875 3300025914 Bacteria 921
424 Ga0207693_10004152 3300025915 Bacteria 12287
425 Ga0207693_10068856 3300025915 Bacteria 2770
426 Ga0207693_10659459 3300025915 Bacteria 812
427 Ga0207663_10006381 3300025916 Bacteria 6031
428 Ga0207663_10878683 3300025916 Bacteria 716
429 Ga0207660_10270447 3300025917 Bacteria 1346
430 Ga0207662_10628210 3300025918 Bacteria 749
431 Ga0207657_10094263 3300025919 Bacteria 2493
432 Ga0207649_10060489 3300025920 Bacteria 2381
433 Ga0207649_10457161 3300025920 Bacteria 965
434 Ga0207652_10521305 3300025921 Bacteria 1069
435 Ga0207681_10362754 3300025923 Bacteria 1162
436 Ga0207681_10836809 3300025923 Bacteria 769
437 Ga0207694_10197597 3300025924 Bacteria 1635
438 Ga0207694_10890167 3300025924 Bacteria 753
439 Ga0207694_11259125 3300025924 Bacteria 626
440 Ga0207650_10987184 3300025925 Bacteria 716
441 Ga0207659_10103723 3300025926 Bacteria 2149
442 Ga0207687_10046156 3300025927 Bacteria 3015
443 Ga0207687_10506660 3300025927 Bacteria 1008
444 Ga0207687_10508010 3300025927 Bacteria 1007
445 Ga0207687_10850452 3300025927 Bacteria 779
446 Ga0207687_11213563 3300025927 Bacteria 648
447 Ga0207700_10039017 3300025928 Bacteria 3452
448 Ga0207700_10095690 3300025928 Bacteria 2356
449 Ga0207700_10470232 3300025928 Bacteria 1110
450 Ga0207664_10322313 3300025929 Bacteria 1364
451 Ga0207664_11100170 3300025929 Bacteria 710
452 Ga0207644_10070746 3300025931 Bacteria 2551
453 Ga0207690_10086087 3300025932 Bacteria 2207
454 Ga0207706_10067855 3300025933 Bacteria 3139
455 Ga0207706_10129850 3300025933 Bacteria 2216
456 Ga0207706_10422663 3300025933 Bacteria 1154
457 Ga0207706_10848389 3300025933 Bacteria 774
458 Ga0207686_10155370 3300025934 Bacteria 1597
459 Ga0207686_10489309 3300025934 Bacteria 953
460 Ga0207686_10552917 3300025934 Bacteria 900
461 Ga0207686_11769778 3300025934 Bacteria 511
462 Ga0207709_10158090 3300025935 Bacteria 1578
463 Ga0207709_10278282 3300025935 Bacteria 1235
464 Ga0207709_11019656 3300025935 Bacteria 677
465 Ga0207709_11163532 3300025935 Bacteria 635
466 Ga0207670_10380526 3300025936 Bacteria 1124
467 Ga0207670_10902061 3300025936 Bacteria 740
468 Ga0207669_10352911 3300025937 Bacteria 1137
469 Ga0207669_10481356 3300025937 Bacteria 989
470 Ga0207669_10912389 3300025937 Bacteria 734
471 Ga0207704_10185027 3300025938 Bacteria 1509
472 Ga0207704_10254222 3300025938 Bacteria 1321
473 Ga0207704_10347113 3300025938 Bacteria 1154
474 Ga0207704_10406919 3300025938 Bacteria 1075
475 Ga0207704_11052582 3300025938 Bacteria 690
476 Ga0207665_10239425 3300025939 Bacteria 1336
477 Ga0207665_10279087 3300025939 Bacteria 1243
478 Ga0207691_10109437 3300025940 Bacteria 2458
479 Ga0207691_10115524 3300025940 Bacteria 2383
480 Ga0207691_10195566 3300025940 Bacteria 1762
481 Ga0207691_10297606 3300025940 Bacteria 1387
482 Ga0207711_10278108 3300025941 Bacteria 1541
483 Ga0207711_10329868 3300025941 Bacteria 1411
484 Ga0207711_10524654 3300025941 Bacteria 1104
485 Ga0207711_11900261 3300025941 Bacteria 538
486 Ga0207689_10205379 3300025942 Bacteria 1627
487 Ga0207689_10368714 3300025942 Bacteria 1195
488 Ga0207689_10868064 3300025942 Bacteria 761
489 Ga0207689_10891136 3300025942 Bacteria 751
490 Ga0207661_10226869 3300025944 Bacteria 1653
491 Ga0207661_11382664 3300025944 Bacteria 646
492 Ga0207679_10030722 3300025945 Bacteria 3754
493 Ga0207679_10048765 3300025945 Bacteria 3085
494 Ga0207679_10622680 3300025945 Bacteria 974
495 Ga0207667_10155171 3300025949 Bacteria 2356
496 Ga0207667_11078485 3300025949 Bacteria 787
497 Ga0207651_10172599 3300025960 Bacteria 1707
498 Ga0207651_10636927 3300025960 Bacteria 935
499 Ga0207712_10091075 3300025961 Bacteria 2246
500 Ga0207712_10774911 3300025961 Bacteria 842
501 Ga0207712_11371803 3300025961 Bacteria 632
502 Ga0207668_10013241 3300025972 Bacteria 5072
503 Ga0207668_10159359 3300025972 Bacteria 1756
504 Ga0207668_10273689 3300025972 Bacteria 1381
505 Ga0207668_10310679 3300025972 Bacteria 1304
506 Ga0207668_10758392 3300025972 Bacteria 856
507 Ga0207668_11572912 3300025972 Bacteria 593
508 Ga0207640_10567451 3300025981 Bacteria 956
509 Ga0207640_10850945 3300025981 Bacteria 793
510 Ga0207640_11868026 3300025981 Bacteria 543
511 Ga0207658_10225666 3300025986 Bacteria 1578
512 Ga0207677_10342501 3300026023 Bacteria 1249
513 Ga0207677_11924720 3300026023 Bacteria 549
514 Ga0207703_10041893 3300026035 Bacteria 3671
515 Ga0207703_10197653 3300026035 Bacteria 1785
516 Ga0207703_10549605 3300026035 Bacteria 1089
517 Ga0207703_10784961 3300026035 Bacteria 909
518 Ga0207639_10008358 3300026041 Bacteria 7095
519 Ga0207639_10102877 3300026041 Bacteria 2313
520 Ga0207639_10276341 3300026041 Bacteria 1475
521 Ga0207639_10944362 3300026041 Bacteria 807
522 Ga0207639_10984807 3300026041 Bacteria 789
523 Ga0207639_11989112 3300026041 Bacteria 542
524 Ga0207678_10015601 3300026067 Bacteria 6679
525 Ga0207678_10043029 3300026067 Bacteria 3909
526 Ga0207678_10097713 3300026067 Bacteria 2509
527 Ga0207678_10262800 3300026067 Bacteria 1479
528 Ga0207678_10353158 3300026067 Bacteria 1268
529 Ga0207678_10355248 3300026067 Bacteria 1264
530 Ga0207678_10401734 3300026067 Bacteria 1186
531 Ga0207708_10210470 3300026075 Bacteria 1554
532 Ga0207708_10518042 3300026075 Bacteria 1002
533 Ga0207708_10990108 3300026075 Bacteria 730
534 Ga0207702_10026010 3300026078 Bacteria 4859
535 Ga0207702_11398066 3300026078 Bacteria 694
536 Ga0207641_10274476 3300026088 Bacteria 1583
537 Ga0207641_10276717 3300026088 Bacteria 1577
538 Ga0207641_11022579 3300026088 Bacteria 823
539 Ga0207648_10060782 3300026089 Bacteria 3295
540 Ga0207648_10076280 3300026089 Bacteria 2922
541 Ga0207648_10308751 3300026089 Bacteria 1419
542 Ga0207648_10902915 3300026089 Bacteria 825
543 Ga0207648_11227210 3300026089 Bacteria 704
544 Ga0207676_10221684 3300026095 Bacteria 1685
545 Ga0207674_10064470 3300026116 Bacteria 3695
546 Ga0207674_10596281 3300026116 Bacteria 1067
547 Ga0207674_10599365 3300026116 Bacteria 1064
548 Ga0207675_100084466 3300026118 Bacteria 2979
549 Ga0207675_100415238 3300026118 Bacteria 1328
550 Ga0207675_100720203 3300026118 Bacteria 1008
551 Ga0207675_101057761 3300026118 Bacteria 831
552 Ga0207683_10062959 3300026121 Bacteria 3267
553 Ga0207683_10069102 3300026121 Bacteria 3119
554 Ga0207683_10113570 3300026121 Bacteria 2426
555 Ga0207683_10251011 3300026121 Bacteria 1615
556 Ga0207683_10273786 3300026121 Bacteria 1542
557 Ga0207683_10370723 3300026121 Bacteria 1315
558 Ga0207698_10197728 3300026142 Bacteria 1797
559 Ga0207698_10241921 3300026142 Bacteria 1645
560 Ga0207698_10243963 3300026142 Bacteria 1639
561 Ga0207698_10391484 3300026142 Bacteria 1325
562 Ga0209589_1000055 3300027357 Bacteria 111890
563 Ga0209489_100128 3300027361 Bacteria 111890
564 Ga0209700_100137 3300027363 Bacteria 111890
565 Ga0209179_1064309 3300027512 Bacteria 799
566 Ga0209179_1128566 3300027512 Bacteria 566
567 Ga0209813_10128399 3300027866 Bacteria 889
568 Ga0209813_10128717 3300027866 Bacteria 888
569 Ga0207428_10220540 3300027907 Bacteria 1422
570 Ga0268266_10001893 3300028379 Bacteria 23597
571 Ga0268266_10010934 3300028379 Bacteria 7899
572 Ga0268266_10020070 3300028379 Bacteria 5696
573 Ga0268266_10060966 3300028379 Bacteria 3252
574 Ga0268266_10061647 3300028379 Bacteria 3235
575 Ga0268266_10223094 3300028379 Bacteria 1733
576 Ga0268266_10316498 3300028379 Bacteria 1459
577 Ga0268266_11101948 3300028379 Bacteria 768
578 Ga0268265_10060512 3300028380 Bacteria 2902
579 Ga0268265_10073561 3300028380 Bacteria 2669
580 Ga0268265_10196619 3300028380 Bacteria 1745
581 Ga0268265_10492698 3300028380 Bacteria 1153
582 Ga0268265_11209364 3300028380 Bacteria 753
583 Ga0268265_11267247 3300028380 Bacteria 736
584 Ga0268264_10091485 3300028381 Bacteria 2624
585 Ga0268264_10141336 3300028381 Bacteria 2147
586 Ga0268264_11535631 3300028381 Bacteria 676
587 Ga0307517_10007163 3300028786 Bacteria 16350
588 Ga0307517_10239533 3300028786 Bacteria 1078
589 Ga0307515_10037445 3300028794 Bacteria 7801
590 Ga0307515_10313545 3300028794 Bacteria 1241
591 Ga0307512_10104489 3300030522 Bacteria 1900
592 Ga0265330_10009605 3300031235 Bacteria 4590
593 Ga0265330_10014019 3300031235 Bacteria 3722
594 Ga0265328_10101253 3300031239 Bacteria 1067
595 Ga0265340_10013754 3300031247 Bacteria 4244
596 Ga0265316_10038043 3300031344 Bacteria 3880
597 Ga0265316_10135129 3300031344 Bacteria 1856
598 Ga0307513_10105731 3300031456 Bacteria 2823
599 Ga0307513_10116572 3300031456 Bacteria 2649
600 Ga0307513_10730428 3300031456 Bacteria 696
601 Ga0307408_100093076 3300031548 Bacteria 2280
602 Ga0307408_100268596 3300031548 Bacteria 1415
603 Ga0307408_100549943 3300031548 Bacteria 1018
604 Ga0307408_101138755 3300031548 Bacteria 725
605 Ga0307408_102363302 3300031548 Bacteria 515
606 Ga0307508_10026412 3300031616 Bacteria 5263
607 Ga0307514_10320590 3300031649 Bacteria 851
608 Ga0265342_10136272 3300031712 Bacteria 1372
609 Ga0307516_10002153 3300031730 Bacteria 26718
610 Ga0307516_10033701 3300031730 Bacteria 5153
611 Ga0307516_10038892 3300031730 Bacteria 4743
612 Ga0307516_10232620 3300031730 Bacteria 1546
613 Ga0307516_10520583 3300031730 Bacteria 843
614 Ga0307405_10087782 3300031731 Bacteria 2051
615 Ga0307405_10160054 3300031731 Bacteria 1593
616 Ga0307405_10507376 3300031731 Bacteria 968
617 Ga0307406_10098745 3300031901 Bacteria 1983
618 Ga0307406_10341238 3300031901 Bacteria 1167
619 Ga0307406_11457624 3300031901 Bacteria 601
620 Ga0307407_10395947 3300031903 Bacteria 990
621 Ga0307407_10610292 3300031903 Bacteria 813
622 Ga0307412_10102251 3300031911 Bacteria 2029
623 Ga0307412_10189714 3300031911 Bacteria 1553
624 Ga0307412_10925364 3300031911 Bacteria 766
625 Ga0307409_100296235 3300031995 Bacteria 1502
626 Ga0307416_100035338 3300032002 Bacteria 3815
627 Ga0307416_100114693 3300032002 Bacteria 2384
628 Ga0307416_100279052 3300032002 Bacteria 1646
629 Ga0307416_100302237 3300032002 Bacteria 1591
630 Ga0307416_100508001 3300032002 Bacteria 1271
631 Ga0307416_100713568 3300032002 Bacteria 1093
632 Ga0307414_11034754 3300032004 Bacteria 757
633 Ga0307411_10136013 3300032005 Bacteria 1804
634 Ga0307411_10202581 3300032005 Bacteria 1525
635 Ga0307415_100243316 3300032126 Bacteria 1457
636 Ga0307415_100652738 3300032126 Bacteria 943
637 Ga0307510_10007834 3300033180 Bacteria 12735
638 Ga0307510_10096261 3300033180 Bacteria 2776
639 Ga0315911_1000076 3300033442 Bacteria 14517
640 Ga0373930_0005846 3300034816 Bacteria 2060
641 Ga0373958_0161831 3300034819 Bacteria 566
642 Ga0373929_0099883 3300035085 Bacteria 730
643 Ga0373934_0017039 3300035086 Bacteria 2769
644 Ga0373940_0359277 3300035088 Bacteria 513
645 Ga0373923_0004715 3300035111 Bacteria 4552
646 Ga0373932_0012313 3300035112 Bacteria 2105
647 Ga0373936_0091591 3300035113 Bacteria 1275
648 Ga0373939_0143798 3300035114 Bacteria 862
649 Ga0373945_0150553 3300035116 Bacteria 943
650 Ga0373953_0013127 3300035117 Bacteria 2950
651 Ga0373954_0001537 3300035118 Bacteria 9390
652 Ga0373956_0007238 3300035119 Bacteria 4468
653 Ga0373957_0027090 3300035120 Bacteria 2079
654 Ga0373943_0167207 3300035170 Bacteria 1201
655 Ga0373946_0030362 3300035171 Bacteria 2157
656 Ga0373955_0000421 3300035172 Bacteria 17923
657 Ga0373924_0005265 3300035410 Bacteria 4573
658 Ga0373931_0002773 3300035691 Bacteria 7796
659 Ga0373935_0055204 3300035692 Bacteria 2531
660 Ga0373927_0106329 3300035695 Bacteria 1827
661 Ga0373933_0012141 3300035724 Bacteria 4757
662 Ga0373937_0017372 3300036401 Bacteria 6407
663 Ga0373925_0643718 3300037068 Bacteria 873
664 Ga0373925_0754851 3300037068 Bacteria 802
665 Ga0395900_0827956 3300037418 Bacteria 852
666 Ga0395898_0141730 3300037466 Bacteria 2301
667 Ga0395905_0018502 3300037471 Bacteria 6613
668 Ga0395905_0792214 3300037471 Bacteria 851
669 Ga0436365_1432829 3300039437 Bacteria 1102
670 Ga0439465_0212985 3300041413 Bacteria 707
671 Ga0451791_0937014 3300041451 Bacteria 518
672 Ga0451791_1187594 3300041451 Bacteria 1105
673 Ga0451791_1597070 3300041451 Bacteria 676
674 Ga0451793_0322342 3300041452 Bacteria 651
675 Ga0451793_0591189 3300041452 Bacteria 618
676 Ga0451797_1451936 3300041453 Bacteria 642
677 Ga0451798_0889967 3300041458 Bacteria 635
678 Ga0451800_0821725 3300041459 Bacteria 987
679 Ga0451843_0538096 3300041509 Bacteria 1206
680 Ga0451855_0326912 3300041511 Bacteria 654
681 Ga0451853_2025861 3300041512 Bacteria 576
682 Ga0451853_2279900 3300041512 Bacteria 579
683 Ga0439431_0051291 3300041997 Bacteria 1070
684 Ga0439463_169067 3300042016 Bacteria 567
685 Ga0439458_0073616 3300042157 Bacteria 865
686 Ga0439459_0023725 3300042438 Bacteria 1198
687 Ga0466963_0031196 3300044694 Bacteria 3444
688 Ga0466967_0828729 3300045976 Bacteria 919
689 Ga0495617_011757 3300046452 Bacteria 2985
690 Ga0495617_245138 3300046452 Bacteria 553
691 Ga0495627_060934 3300046453 Bacteria 1117
692 Ga0495592_0001087 3300046454 Bacteria 18850
693 Ga0495603_0251449 3300046455 Bacteria 1017
694 Ga0495603_0344861 3300046455 Bacteria 854
695 Ga0495603_0666955 3300046455 Bacteria 595
696 Ga0495591_136099 3300046458 Bacteria 594
697 Ga0495629_0000232 3300046459 Bacteria 49422
698 Ga0495638_0205673 3300046460 Bacteria 1108
699 Ga0495638_0362734 3300046460 Bacteria 761
700 Ga0495638_0475664 3300046460 Bacteria 633
701 Ga0495641_0045103 3300046461 Bacteria 2031
702 Ga0495651_0056910 3300046462 Bacteria 3002
703 Ga0495651_0084336 3300046462 Bacteria 2394
704 Ga0495653_0000575 3300046463 Bacteria 28178
705 Ga0495650_0166007 3300046471 Bacteria 784
706 Ga0495650_0191533 3300046471 Bacteria 714
707 Ga0495580_0062006 3300046472 Bacteria 2624
708 Ga0495582_0052731 3300046473 Bacteria 2243
709 Ga0495582_0641688 3300046473 Bacteria 614
710 Ga0495605_0196278 3300046474 Bacteria 881
711 Ga0495605_0319029 3300046474 Bacteria 655
712 Ga0495639_0026104 3300046475 Bacteria 2580
713 Ga0495639_0419831 3300046475 Bacteria 677
714 Ga0495664_0099957 3300046477 Bacteria 1747
715 Ga0495584_0154900 3300046491 Bacteria 1164
716 Ga0495584_0361259 3300046491 Bacteria 737
717 Ga0495584_0471173 3300046491 Bacteria 639
718 Ga0495585_0049317 3300046492 Bacteria 2338
719 Ga0495585_0070049 3300046492 Bacteria 1913
720 Ga0495585_0084017 3300046492 Bacteria 1722
721 Ga0495594_0096190 3300046499 Bacteria 1663
722 Ga0495594_0349173 3300046499 Bacteria 842
723 Ga0495594_0548169 3300046499 Bacteria 656
724 Ga0495606_0287303 3300046507 Bacteria 896
725 Ga0495606_0611888 3300046507 Bacteria 533
726 Ga0495608_0010274 3300046511 Bacteria 6530
727 Ga0495610_0226410 3300046512 Bacteria 752
728 Ga0495616_0245235 3300046513 Bacteria 771
729 Ga0495616_0326654 3300046513 Bacteria 643
730 Ga0495618_0085312 3300046514 Bacteria 2018
731 Ga0495620_0049974 3300046515 Bacteria 1786
732 Ga0495628_0021846 3300046516 Bacteria 5259
733 Ga0495628_0159962 3300046516 Bacteria 1712
734 Ga0495628_0459436 3300046516 Bacteria 924
735 Ga0495631_0101877 3300046518 Bacteria 1235
736 Ga0495631_0214324 3300046518 Bacteria 822
737 Ga0495632_0221208 3300046519 Bacteria 856
738 Ga0495632_0331705 3300046519 Bacteria 671
739 Ga0495637_0148877 3300046520 Bacteria 884
740 Ga0495643_0233037 3300046522 Bacteria 867
741 Ga0495644_0056399 3300046523 Bacteria 1476
742 Ga0495644_0208465 3300046523 Bacteria 754
743 Ga0495644_0325184 3300046523 Bacteria 603
744 Ga0495648_0000767 3300046524 Bacteria 34209
745 Ga0495648_0262289 3300046524 Bacteria 828
746 Ga0495648_0514572 3300046524 Bacteria 511
747 Ga0495663_0057218 3300046525 Bacteria 1219
748 Ga0495642_0144413 3300046528 Bacteria 1028
749 Ga0495642_0205083 3300046528 Bacteria 860
750 Ga0495652_0015475 3300046529 Bacteria 6829
751 Ga0495654_0251578 3300046530 Bacteria 736
752 Ga0495665_0246992 3300046531 Bacteria 919
753 Ga0495640_0012477 3300046533 Bacteria 6488
754 Ga0495587_0003955 3300046536 Bacteria 9827
755 Ga0495598_0007022 3300046537 Bacteria 2565
756 Ga0495598_0076620 3300046537 Bacteria 1064
757 Ga0495598_0261384 3300046537 Bacteria 644
758 Ga0495609_0032697 3300046538 Bacteria 2362
759 Ga0495609_0250597 3300046538 Bacteria 729
760 Ga0495621_0029247 3300046539 Bacteria 1877
761 Ga0495645_0034945 3300046543 Bacteria 3664
762 Ga0495622_0303227 3300046557 Bacteria 696
763 Ga0495633_0052304 3300046558 Bacteria 1924
764 Ga0495633_0301487 3300046558 Bacteria 728
765 Ga0495667_0001504 3300046559 Bacteria 15376
766 Ga0495656_0020292 3300046615 Bacteria 2576
767 Ga0495656_0097647 3300046615 Bacteria 1353
768 Ga0495656_0174697 3300046615 Bacteria 1052
769 Ga0495656_0251695 3300046615 Bacteria 892
770 Ga0495668_0107764 3300046616 Bacteria 1524
771 Ga0495668_0118052 3300046616 Bacteria 1451
772 Ga0495668_0208683 3300046616 Bacteria 1069
773 Ga0495668_0288341 3300046616 Bacteria 899
774 Ga0495668_0855326 3300046616 Bacteria 504
775 Ga0495634_0044765 3300046642 Bacteria 2994
776 Ga0495611_0290359 3300046648 Bacteria 754
777 Ga0495625_0121382 3300046660 Bacteria 1778
778 Ga0495625_0149403 3300046660 Bacteria 1571
779 Ga0495625_0251692 3300046660 Bacteria 1146
780 Ga0495625_0394530 3300046660 Bacteria 866
781 Ga0495625_0682651 3300046660 Bacteria 608
782 Ga0495625_0779557 3300046660 Bacteria 558
783 Ga0495625_0887667 3300046660 Bacteria 512
784 Ga0495635_0004681 3300046663 Bacteria 9498
785 Ga0495635_0202498 3300046663 Bacteria 1346
786 Ga0495635_0554567 3300046663 Bacteria 753
787 Ga0495659_0005622 3300046664 Bacteria 3949
788 Ga0495659_0058896 3300046664 Bacteria 1414
789 Ga0495661_0115165 3300046665 Bacteria 1493
790 Ga0495661_0276719 3300046665 Bacteria 847
791 Ga0495661_0350958 3300046665 Bacteria 726
792 Ga0495588_0052172 3300046674 Bacteria 2107
793 Ga0495588_0476097 3300046674 Bacteria 655
794 Ga0495657_0002790 3300046675 Bacteria 14529
795 Ga0495599_0000374 3300046678 Bacteria 26092
796 Ga0495623_0003450 3300046679 Bacteria 10460
797 Ga0495623_0100202 3300046679 Bacteria 1766
798 Ga0495646_0012512 3300046680 Bacteria 5394
799 Ga0495647_0110369 3300046681 Bacteria 1147
800 Ga0495647_0636201 3300046681 Bacteria 502
801 Ga0495658_0895544 3300046683 Bacteria 567
802 Ga0495669_0071854 3300046684 Bacteria 1578
803 Ga0495669_0088882 3300046684 Bacteria 1424
804 Ga0495669_0206828 3300046684 Bacteria 939
805 Ga0495669_0348144 3300046684 Bacteria 716
806 Ga0495669_0557729 3300046684 Bacteria 557
807 Ga0495613_0173806 3300046689 Bacteria 1528
808 Ga0495613_0361477 3300046689 Bacteria 995
809 Ga0495624_0441369 3300046690 Bacteria 780
810 Ga0495670_0106179 3300046691 Bacteria 1450
811 Ga0495670_0216270 3300046691 Bacteria 1017
812 Ga0495670_0406804 3300046691 Bacteria 735
813 Ga0495671_0058193 3300046692 Bacteria 1912
814 Ga0495649_0210466 3300046694 Bacteria 1007
815 Ga0495649_0379303 3300046694 Bacteria 712
816 Ga0495649_0670095 3300046694 Bacteria 509
817 Ga0495589_0140716 3300046794 Bacteria 1155
818 Ga0495589_0275926 3300046794 Bacteria 782
819 Ga0495589_0283989 3300046794 Bacteria 769
820 Ga0495589_0297304 3300046794 Bacteria 749
821 Ga0495589_0407574 3300046794 Bacteria 624
822 Ga0495600_0000970 3300046809 Bacteria 15447
823 Ga0495600_0380910 3300046809 Bacteria 880
824 Ga0495660_0147676 3300046810 Bacteria 1164
825 Ga0495581_0809334 3300047315 Bacteria 537
826 Ga0495604_0003086 3300047317 Bacteria 13324
827 Ga0495636_0054101 3300047318 Bacteria 1686
828 Ga0495636_0109509 3300047318 Bacteria 1214
829 Ga0495674_0146076 3300047319 Bacteria 1985
830 Ga0495674_0252273 3300047319 Bacteria 1452
831 Ga0495672_0024556 3300047320 Bacteria 3879
832 Ga0495672_0159882 3300047320 Bacteria 1159
833 Ga0495676_0043899 3300047321 Bacteria 3654
834 Ga0495676_0742707 3300047321 Bacteria 634
835 Ga0495680_0001718 3300047322 Bacteria 23247
836 Ga0495680_0330668 3300047322 Bacteria 1065
837 Ga0495683_0076343 3300047323 Bacteria 1639
838 Ga0495683_0342624 3300047323 Bacteria 632
839 Ga0495675_0012009 3300047444 Bacteria 5444
840 Ga0495677_0090591 3300047445 Bacteria 1152
841 Ga0495679_043384 3300047446 Bacteria 1383
842 Ga0495673_0061791 3300047469 Bacteria 1602
843 Ga0495673_0111052 3300047469 Bacteria 1096
844 Ga0495681_0068534 3300047470 Bacteria 1614
845 Ga0495681_0407177 3300047470 Bacteria 507
846 Ga0495684_0000052 3300047471 Bacteria 85125
847 Ga0495686_0215418 3300047472 Bacteria 1095
848 Ga0495686_0304507 3300047472 Bacteria 878
849 Ga0495686_0730832 3300047472 Bacteria 503
850 Ga0495593_0000126 3300047673 Bacteria 37465
851 Ga0495602_0010424 3300048088 Bacteria 9646
852 Ga0495602_0524197 3300048088 Bacteria 825
853 Ga0495614_0091053 3300048089 Bacteria 1327
854 Ga0495615_0170665 3300048090 Bacteria 658
855 Ga0495626_0265118 3300048091 Bacteria 686
856 Ga0496100_0021406 3300048903 Bacteria 3893
857 Ga0496100_0021807 3300048903 Bacteria 3865
858 Ga0496100_0132672 3300048903 Bacteria 1756
859 Ga0496100_0383208 3300048903 Bacteria 1068
860 Ga0496101_0001512 3300048904 Bacteria 13914
861 Ga0496101_0178464 3300048904 Bacteria 1635
862 Ga0496101_0273877 3300048904 Bacteria 1318
863 Ga0496102_0033502 3300048905 Bacteria 4617
864 Ga0496102_0033895 3300048905 Bacteria 4591
865 Ga0496102_0198935 3300048905 Bacteria 1889
866 Ga0496102_0295226 3300048905 Bacteria 1527
867 Ga0496102_0319248 3300048905 Bacteria 1463
868 Ga0496102_0538555 3300048905 Bacteria 1090
869 Ga0496102_0542080 3300048905 Bacteria 1086
870 Ga0496103_0012371 3300048906 Bacteria 5062
871 Ga0496103_0069769 3300048906 Bacteria 2198
872 Ga0496103_0590072 3300048906 Bacteria 708
873 Ga0496103_0879205 3300048906 Bacteria 562
874 Ga0496104_1009227 3300048907 Bacteria 736
875 Ga0496104_1293685 3300048907 Bacteria 632
876 Ga0496105_0032534 3300048908 Bacteria 4280
877 Ga0496105_0280558 3300048908 Bacteria 1343
878 Ga0496105_0551231 3300048908 Bacteria 900
879 Ga0496106_0038427 3300048909 Bacteria 3582
880 Ga0496106_0056750 3300048909 Bacteria 2960
881 Ga0496106_0059762 3300048909 Bacteria 2888
882 Ga0496106_0277926 3300048909 Bacteria 1341
883 Ga0496106_0438668 3300048909 Bacteria 1049
884 Ga0496107_0050672 3300048910 Bacteria 2993
885 Ga0496107_0164136 3300048910 Bacteria 1647
886 Ga0496107_0464650 3300048910 Bacteria 939
887 Ga0496108_0040448 3300048911 Bacteria 3887
888 Ga0496108_0056204 3300048911 Bacteria 3306
889 Ga0496109_0031405 3300048912 Bacteria 4766
890 Ga0496109_0062268 3300048912 Bacteria 3411
891 Ga0496109_0327331 3300048912 Bacteria 1446
892 Ga0496109_0700257 3300048912 Bacteria 950
893 Ga0496110_0082989 3300048913 Bacteria 2858
894 Ga0496110_0084761 3300048913 Bacteria 2828
895 Ga0496110_0179327 3300048913 Bacteria 1923
896 Ga0496111_0016870 3300048914 Bacteria 5040
897 Ga0496111_0692845 3300048914 Bacteria 741
898 Ga0496112_0123281 3300048915 Bacteria 2562
899 Ga0496112_0150606 3300048915 Bacteria 2293
900 Ga0496112_0164382 3300048915 Bacteria 2185
901 Ga0496112_1047994 3300048915 Bacteria 734
902 Ga0496113_0002928 3300048916 Bacteria 10075
903 Ga0496113_0089701 3300048916 Bacteria 2367
904 Ga0496113_0188813 3300048916 Bacteria 1635
905 Ga0496113_0801082 3300048916 Bacteria 749
906 Ga0496114_0032370 3300048917 Bacteria 4303
907 Ga0496114_0056698 3300048917 Bacteria 3270
908 Ga0496114_0199508 3300048917 Bacteria 1752
909 Ga0496114_0398277 3300048917 Bacteria 1219
910 Ga0496114_0858829 3300048917 Bacteria 788
911 Ga0496115_0005545 3300048918 Bacteria 9183
912 Ga0496115_0012554 3300048918 Bacteria 6382
913 Ga0496115_0157169 3300048918 Bacteria 1878
914 Ga0496115_0185972 3300048918 Bacteria 1717
915 Ga0496115_0765283 3300048918 Bacteria 754
916 Ga0496116_0094414 3300048919 Bacteria 1808
917 Ga0496117_0161014 3300048920 Bacteria 1315
918 Ga0496118_0146029 3300048921 Bacteria 1489
919 Ga0496118_0467257 3300048921 Bacteria 636
920 Ga0496119_0058080 3300048922 Bacteria 2334
921 Ga0496119_0167217 3300048922 Bacteria 1164
922 Ga0496119_0531289 3300048922 Bacteria 543
923 Ga0496120_0420744 3300048923 Bacteria 587
924 Ga0496121_0024127 3300048924 Bacteria 5826
925 Ga0496121_0025355 3300048924 Bacteria 5630
926 Ga0496121_0058780 3300048924 Bacteria 3175
927 Ga0496121_0161254 3300048924 Bacteria 1639
928 Ga0496121_0254981 3300048924 Bacteria 1214
929 Ga0496121_0383874 3300048924 Bacteria 925
930 Ga0496124_0035110 3300048927 Bacteria 4390
931 Ga0496124_0433735 3300048927 Bacteria 901
932 Ga0496124_0711490 3300048927 Bacteria 635
933 Ga0496125_0148640 3300048928 Bacteria 1614
934 Ga0496125_0256772 3300048928 Bacteria 1098
935 Ga0496126_0010541 3300048929 Bacteria 9677
936 Ga0496126_0020133 3300048929 Bacteria 6549
937 Ga0496126_0044803 3300048929 Bacteria 4071
938 Ga0496126_0151219 3300048929 Bacteria 1989
939 Ga0496126_0585094 3300048929 Bacteria 881
940 Ga0496126_0836504 3300048929 Bacteria 703
941 Ga0495678_072488 3300049459 Bacteria 1258
942 Ga0495682_0038197 3300049460 Bacteria 1765
943 Ga0501032_0662617 3300049569 Bacteria 662
944 Ga0501034_0628916 3300049571 Bacteria 977
945 Ga0501043_0495050 3300049579 Bacteria 914
946 Ga0501046_0045521 3300049580 Bacteria 3486
947 Ga0501047_0017816 3300049581 Bacteria 6804
948 Ga0501067_0075522 3300049583 Bacteria 1867
949 Ga0501068_0181816 3300049584 Bacteria 1330
950 Ga0501069_0715564 3300049585 Bacteria 604
951 Ga0501073_0044960 3300049589 Bacteria 3112
952 Ga0501074_0039204 3300049590 Bacteria 3431
953 Ga0501075_0672839 3300049591 Bacteria 789
954 Ga0501079_1361530 3300049741 Bacteria 558
955 Ga0501080_0009144 3300049742 Bacteria 9021
956 Ga0501035_0429847 3300049822 Bacteria 1095
957 Ga0501045_0331924 3300049824 Bacteria 1132
958 nmdc:mga03683_59832_c1 3300050489 Bacteria 1608
959 nmdc:mga03683_65968_c1 3300050489 Bacteria 1538
960 nmdc:mga03n38_14534_c1 3300050490 Bacteria 3020
961 nmdc:mga03n38_160367_c1 3300050490 Bacteria 1138
962 nmdc:mga03n38_247658_c1 3300050490 Bacteria 940
963 nmdc:mga03n38_298821_c1 3300050490 Bacteria 864
964 nmdc:mga03n38_856169_c1 3300050490 Bacteria 532
965 nmdc:mga03n38_946287_c1 3300050490 Bacteria 508
966 nmdc:mga00v17_24823_c1 3300050491 Bacteria 3479
967 nmdc:mga00v17_3320_c1 3300050491 Bacteria 8295
968 nmdc:mga0yw44_1054796_c1 3300050492 Bacteria 550
969 nmdc:mga0yw44_138210_c1 3300050492 Bacteria 1582
970 nmdc:mga0yw44_145311_c1 3300050492 Bacteria 1544
971 nmdc:mga0yw44_209617_c1 3300050492 Bacteria 1289
972 nmdc:mga0yw44_280742_c1 3300050492 Bacteria 1113
973 nmdc:mga0yw44_29183_c1 3300050492 Bacteria 3183
974 nmdc:mga0yw44_791994_c1 3300050492 Bacteria 644
975 nmdc:mga0k408_121414_c1 3300050493 Bacteria 1548
976 nmdc:mga0k408_281160_c1 3300050493 Bacteria 993
977 nmdc:mga0k408_409445_c1 3300050493 Bacteria 807
978 nmdc:mga0k408_451528_c1 3300050493 Bacteria 763
979 nmdc:mga0k408_566032_c1 3300050493 Bacteria 671
980 nmdc:mga0k408_84163_c1 3300050493 Bacteria 1866
981 nmdc:mga06z11_52627_c1 3300050494 Bacteria 2090
982 nmdc:mga06z11_603137_c1 3300050494 Bacteria 668
983 nmdc:mga06z11_8453_c1 3300050494 Bacteria 4293
984 nmdc:mga06z11_870847_c1 3300050494 Bacteria 549
985 nmdc:mga04h51_150570_c1 3300050495 Bacteria 889
986 nmdc:mga04h51_72475_c1 3300050495 Bacteria 1206
987 nmdc:mga07m45_14522_c1 3300050496 Bacteria 4197
988 nmdc:mga07m45_442553_c1 3300050496 Bacteria 754
989 nmdc:mga07m45_567485_c1 3300050496 Bacteria 656
990 nmdc:mga05p37_108944_c1 3300050507 Bacteria 3407
991 nmdc:mga09592_807967_c1 3300050508 Bacteria 793
992 nmdc:mga06r32_866156_c1 3300050510 Bacteria 861
993 nmdc:mga08y16_1055318_c1 3300050511 Bacteria 790
994 nmdc:mga08y16_454773_c1 3300050511 Bacteria 1305
995 nmdc:mga08y16_785429_c1 3300050511 Bacteria 946
996 nmdc:mga0n895_71870_c1 3300050512 Bacteria 3431
997 nmdc:mga0rr50_223423_c1 3300050513 Bacteria 1556
998 nmdc:mga08x19_1201975_c1 3300050514 Bacteria 537
999 nmdc:mga0a205_694597_c1 3300050515 Bacteria 867
1000 nmdc:mga0sz30_164762_c1 3300050516 Bacteria 982
1001 nmdc:mga0sz30_472159_c1 3300050516 Bacteria 564
1002 nmdc:mga0sz30_82064_c1 3300050516 Bacteria 1396
1003 Ga0495601_0009158 3300053077 Bacteria 5848
1004 Ga0495601_0065866 3300053077 Bacteria 2306
1005 Ga0495601_0174222 3300053077 Bacteria 1406
1006 Ga0495601_0294966 3300053077 Bacteria 1057
1007 Ga0500610_0222259 3300053079 Bacteria 893
1008 Ga0500635_0114836 3300053080 Bacteria 1003
1009 Ga0495655_0080185 3300053083 Bacteria 931
1010 Ga0495595_0001810 3300053084 Bacteria 8330
1011 Ga0495595_0003500 3300053084 Bacteria 6234
1012 Ga0495619_0000458 3300053085 Bacteria 27498
1013 Ga0495619_0036103 3300053085 Bacteria 3217
1014 Ga0495619_0379632 3300053085 Bacteria 977
1015 Ga0500643_008568 3300053087 Bacteria 4009
1016 Ga0500581_090287 3300053089 Bacteria 1519
1017 Ga0500646_0382550 3300053090 Bacteria 517
1018 Ga0500583_0180690 3300053092 Bacteria 1050
1019 Ga0500583_0259058 3300053092 Bacteria 857
1020 Ga0500583_0292914 3300053092 Bacteria 797
1021 Ga0500651_0477564 3300053093 Bacteria 690
1022 Ga0500641_0050832 3300053096 Bacteria 1704
1023 Ga0500650_0250026 3300053098 Bacteria 795
1024 Ga0500650_0354165 3300053098 Bacteria 641
1025 Ga0500556_0108718 3300053104 Bacteria 1074
1026 Ga0500594_0034745 3300053118 Bacteria 1348
1027 Ga0500595_008603 3300053119 Bacteria 4164
1028 Ga0500617_158167 3300053124 Bacteria 887
1029 Ga0500642_0143799 3300053130 Bacteria 1119
1030 Ga0500642_0374802 3300053130 Bacteria 627
1031 Ga0500658_0177344 3300053134 Bacteria 969
1032 Ga0500658_0219962 3300053134 Bacteria 870
1033 Ga0500568_0395917 3300053139 Bacteria 500
1034 Ga0500577_0154493 3300053142 Bacteria 974
1035 Ga0500588_0060467 3300053146 Bacteria 1212
1036 Ga0500589_021026 3300053147 Bacteria 2987
1037 Ga0500589_092741 3300053147 Bacteria 1326
1038 Ga0500589_110798 3300053147 Bacteria 1177
1039 Ga0500590_134072 3300053148 Bacteria 1142
1040 Ga0500604_0054722 3300053151 Bacteria 1239
1041 Ga0500604_0149677 3300053151 Bacteria 792
1042 Ga0500634_0045550 3300053161 Bacteria 2373
1043 Ga0500634_0352965 3300053161 Bacteria 560
1044 Ga0500638_034112 3300053162 Bacteria 2462
1045 Ga0500636_0029007 3300053177 Bacteria 3267
1046 Ga0500636_0087827 3300053177 Bacteria 1784
1047 Ga0500636_0513243 3300053177 Bacteria 527
1048 Ga0500645_174334 3300053730 Bacteria 586
1049 Ga0500609_005864 3300053731 Bacteria 1677
1050 Ga0500656_002657 3300053732 Bacteria 1632
1051 Ga0530510_0260710 3300061734 Bacteria 1293
1052 2513656433 2513237096 Bacteria 8722461
1053 2513694850 2513237101 Bacteria 7952346
1054 2513715622 2513237104 Bacteria 10034502
1055 2513858989 2513237137 Bacteria 9558895
1056 2513917388 2513237145 Bacteria 8979722
1057 2517889605 2517572143 Bacteria 9484767
1058 2524535629 2524023228 Bacteria 10118060
1059 2671121204 2667528175 Bacteria 7532676
1060 2723842094 2721755755 Bacteria 8322773
1061 2728749210 2728368998 Bacteria 8720350
1062 2793077353
1063 2874610286 2874604998 Bacteria 7834745
1064 2876812757 2876808645 Bacteria 8824342
1065 2879111606 2879110137 Bacteria 8907982
1066 2885378009 2885374607 Bacteria 8927485
1067 2903754951 2903748898 Bacteria 9972761
1068 2904709443
1069 2906641117 2906635258 Bacteria 8601019
1070 2906665673 2906660503 Bacteria 8595048
1071 2908746156 2908739725 Bacteria 8628932
1072 2922366887 2922361189 Bacteria 7436256
1073 2922391939 2922386360 Bacteria 7017218
1074 2922433466
1075 3005483163 3005474847 Bacteria 9259049
1076 8006935527 8006933436 Bacteria 10410654
1077 8006971518 8006964411 Bacteria 8966052
1078 8006975454 8006973647 Bacteria 10679141
1079 8006985860 8006984368 Bacteria 9651211
1080 8007001481 8006994254 Bacteria 8309700
1081 8019563283 8019555841 Bacteria 9642137
1082 8019573363 8019565922 Bacteria 9639779
1083 8056679340 8056673599 Bacteria 7871253
1084 Ga0070685_10625062
1085 CNAas_1005993
1086 JGI24750J21931_1017621
1087 JGI24748J21848_1033116
1088 JGI25165J46597_1025250
1089 rootH1_10041688
1090 JGI25404J52841_10017928
1091 JGI25404J52841_10020963
1092 Ga0065707_10283436
1093 Ga0070658_11077041
1094 Ga0070676_10338834
1095 Ga0070676_10366967
1096 Ga0070676_10500138
1097 Ga0070676_10660764
1098 Ga0070676_11307409
1099 Ga0070683_101567661
1100 Ga0070690_100252562
1101 Ga0070690_100315078
1102 Ga0070670_100174228
1103 Ga0070677_10269195
1104 Ga0068869_100021616
1105 Ga0068869_100113202
1106 Ga0068869_100222862
1107 Ga0070666_10929593
1108 Ga0070666_11067624
1109 Ga0070666_11272161
1110 Ga0070680_100110849
1111 Ga0070680_100546304
1112 Ga0070680_100912620
1113 Ga0070682_100591629
1114 Ga0068868_100196063
1115 Ga0068868_100328088
1116 Ga0068868_101022434
1117 Ga0070660_100187113
1118 Ga0070689_100087109
1119 Ga0070691_10378304
1120 Ga0070661_100050478
1121 Ga0070661_100215826
1122 Ga0070661_100282157
1123 Ga0070661_100587028
1124 Ga0070668_100200199
1125 Ga0070668_100298090
1126 Ga0070668_100464471
1127 Ga0070668_100851448
1128 Ga0070668_100969456
1129 Ga0070668_101033448
1130 Ga0070669_100073283
1131 Ga0070669_100991418
1132 Ga0070675_100079027
1133 Ga0070675_101034169
1134 Ga0070675_101138317
1135 Ga0070671_100035846
1136 Ga0070671_100308940
1137 Ga0070671_101082781
1138 Ga0070674_100028167
1139 Ga0070674_100074542
1140 Ga0070674_100233565
1141 Ga0070674_100592587
1142 Ga0070674_100822513
1143 Ga0070673_100193672
1144 Ga0070673_102112555
1145 Ga0070688_100242985
1146 Ga0070688_100741956
1147 Ga0070659_100159893
1148 Ga0070667_100070033
1149 Ga0070667_101109350
1150 Ga0070703_10032218
1151 Ga0070709_10003962
1152 Ga0070714_100404744
1153 Ga0070714_101760836
1154 Ga0070713_100031271
1155 Ga0070713_100461775
1156 Ga0070710_10003249
1157 Ga0070701_10179658
1158 Ga0070701_10890180
1159 Ga0070711_100003683
1160 Ga0070700_100501649
1161 Ga0070700_100848545
1162 Ga0070694_100031961
1163 Ga0070694_100483687
1164 Ga0070708_101145333
1165 Ga0070663_100006704
1166 Ga0070663_100031868
1167 Ga0070663_100049472
1168 Ga0070663_100085522
1169 Ga0070663_100116066
1170 Ga0070663_100147815
1171 Ga0070678_100111418
1172 Ga0070678_100148423
1173 Ga0070678_100158060
1174 Ga0070678_100174110
1175 Ga0070678_100327146
1176 Ga0070678_100785419
1177 Ga0070678_101207059
1178 Ga0070678_101235620
1179 Ga0070662_100045046
1180 Ga0070662_100094482
1181 Ga0070662_100236004
1182 Ga0070662_100971378
1183 Ga0070681_10046420
1184 Ga0068867_100305134
1185 Ga0068867_100737654
1186 Ga0070685_10681621
1187 Ga0070706_101089037
1188 Ga0070698_100047027
1189 Ga0070699_100213534
1190 Ga0070679_100163495
1191 Ga0070679_102081176
1192 Ga0070684_100004411
1193 Ga0070684_100369687
1194 Ga0070684_101265692
1195 Ga0070684_101563973
1196 Ga0070697_100098950
1197 Ga0068853_100058224
1198 Ga0068853_100127068
1199 Ga0068853_100784282
1200 Ga0068853_101017455
1201 Ga0068853_101242555
1202 Ga0068853_101487769
1203 Ga0068853_101616627
1204 Ga0070672_100050034
1205 Ga0070672_100191235
1206 Ga0070672_101449465
1207 Ga0070686_100448158
1208 Ga0070695_100452034
1209 Ga0070695_100556782
1210 Ga0070696_101114343
1211 Ga0070693_100141796
1212 Ga0070693_100158169
1213 Ga0070693_100727330
1214 Ga0070665_100006047
1215 Ga0070665_100046934
1216 Ga0070665_100088172
1217 Ga0070665_100147132
1218 Ga0070665_100242310
1219 Ga0070665_100359203
1220 Ga0070665_100449282
1221 Ga0070665_100680563
1222 Ga0070665_100995411
1223 Ga0070665_101064742
1224 Ga0070704_100996661
1225 Ga0068855_100142397
1226 Ga0068855_101341858
1227 Ga0070664_100752603
1228 Ga0068857_100161780
1229 Ga0068857_101466126
1230 Ga0068854_100050418
1231 Ga0068854_100133533
1232 Ga0068854_100350047
1233 Ga0068856_100045441
1234 Ga0068856_100218065
1235 Ga0070702_100240942
1236 Ga0070702_100357805
1237 Ga0070702_100483500
1238 Ga0070702_100773885
1239 Ga0070702_101499734
1240 Ga0068852_100195806
1241 Ga0068852_100211650
1242 Ga0068852_100802086
1243 Ga0068852_100831125
1244 Ga0068859_100081687
1245 Ga0068859_100103695
1246 Ga0068859_100193831
1247 Ga0068859_100489587
1248 Ga0068864_100236351
1249 Ga0068864_100380312
1250 Ga0068866_10014019
1251 Ga0068866_10068672
1252 Ga0068866_10178015
1253 Ga0068866_11147688
1254 Ga0068861_100114662
1255 Ga0068861_100132658
1256 Ga0068861_100455335
1257 Ga0068861_100559489
1258 Ga0068861_100873609
1259 Ga0068851_10299235
1260 Ga0068870_10062612
1261 Ga0068863_100342051
1262 Ga0068863_100452357
1263 Ga0068863_101721265
1264 Ga0068858_100099908
1265 Ga0068858_100553727
1266 Ga0068860_100077344
1267 Ga0068860_100134772
1268 Ga0068860_100233815
1269 Ga0068860_100260103
1270 Ga0068860_100317765
1271 Ga0068862_100306533
1272 Ga0068862_101064457
1273 Ga0068862_101860252
1274 Ga0068862_101997501
1275 Ga0068862_102661352
1276 Ga0081455_10023941
1277 Ga0081455_10148450
1278 Ga0081538_10019994
1279 Ga0081540_1005122
1280 Ga0081540_1008650
1281 Ga0081540_1010370
1282 Ga0081540_1028568
1283 Ga0081540_1112096
1284 Ga0081539_10061245
1285 Ga0081539_10095727
1286 Ga0075365_10211511
1287 Ga0075365_10253956
1288 Ga0075365_10340808
1289 Ga0075365_10960146
1290 Ga0075368_10041864
1291 Ga0075368_10073537
1292 Ga0075368_10120613
1293 Ga0075368_10139054
1294 Ga0075363_100019573
1295 Ga0075363_100204972
1296 Ga0075363_100219456
1297 Ga0075363_100323392
1298 Ga0075363_100422567
1299 Ga0075364_10043408
1300 Ga0075364_10111208
1301 Ga0075364_10191119
1302 Ga0075364_10667330
1303 Ga0075432_10318984
1304 Ga0070716_100191696
1305 Ga0070716_100355337
1306 Ga0070716_101749369
1307 Ga0070712_100002748
1308 Ga0070712_100071562
1309 Ga0070712_100410939
1310 Ga0075362_10048946
1311 Ga0075362_10212115
1312 Ga0075362_10545911
1313 Ga0075367_10008917
1314 Ga0075367_10066140
1315 Ga0075367_10179835
1316 Ga0075367_10237592
1317 Ga0075367_10293843
1318 Ga0075367_10403583
1319 Ga0075369_10063424
1320 Ga0075369_10087263
1321 Ga0075369_10156760
1322 Ga0075366_10043943
1323 Ga0075366_10205804
1324 Ga0075366_10335194
1325 Ga0075366_10580541
1326 Ga0097621_100091765
1327 Ga0097621_100132654
1328 Ga0097621_101074854
1329 Ga0075370_10012018
1330 Ga0075370_10106281
1331 Ga0068871_100233636
1332 Ga0068871_100251773
1333 Ga0068871_100745820
1334 Ga0068871_101217757
1335 Ga0075428_100916099
1336 Ga0075428_101013454
1337 Ga0075431_100303669
1338 Ga0075433_11507387
1339 Ga0068865_100010829
1340 Ga0068865_100156758
1341 Ga0068865_100307186
1342 Ga0068865_100505252
1343 Ga0068865_100906333
1344 Ga0068865_101426112
1345 Ga0075436_100134548
1346 Ga0075436_100528411
1347 Ga0097620_100081686
1348 Ga0097620_100103699
1349 Ga0097620_100193831
1350 Ga0097620_100489632
1351 Ga0099825_1023278
1352 Ga0099824_1033392
1353 Ga0099822_1000191
1354 Ga0075435_100086775
1355 Ga0099794_10025181
1356 Ga0099795_10017094
1357 Ga0099795_10082459
1358 Ga0105250_10091244
1359 Ga0105240_10099049
1360 Ga0105240_11904592
1361 Ga0111539_10057611
1362 Ga0111539_10834437
1363 Ga0105245_10215836
1364 Ga0105245_10438015
1365 Ga0105245_10547433
1366 Ga0105245_10632651
1367 Ga0105245_11844071
1368 Ga0105247_10251361
1369 Ga0105247_10273958
1370 Ga0105247_10378583
1371 Ga0105247_10574522
1372 Ga0105247_10759387
1373 Ga0114129_10119006
1374 Ga0105243_10089029
1375 Ga0105243_10249223
1376 Ga0105243_10562342
1377 Ga0105243_11077275
1378 Ga0105241_10111539
1379 Ga0105241_10196422
1380 Ga0105242_10051398
1381 Ga0105242_10569940
1382 Ga0105242_10587599
1383 Ga0105242_11751136
1384 Ga0105248_10052096
1385 Ga0105248_10059734
1386 Ga0105248_10252605
1387 Ga0105248_10380194
1388 Ga0105248_10466140
1389 Ga0105248_10495624
1390 Ga0105248_10714438
1391 Ga0105237_10280693
1392 Ga0105237_10356602
1393 Ga0105237_10903743
1394 Ga0105237_11465768
1395 Ga0105238_10120163
1396 Ga0105238_10123963
1397 Ga0105238_11606265
1398 Ga0105238_12876263
1399 Ga0105249_10038661
1400 Ga0105249_10166891
1401 Ga0105249_10333447
1402 Ga0105249_10875378
1403 Ga0105249_12175814
1404 Ga0099796_10047206
1405 Ga0105239_10045817
1406 Ga0105239_10045962
1407 Ga0105239_10078073
1408 Ga0105239_10154693
1409 Ga0105239_11298562
1410 Ga0105239_11416789
1411 Ga0105239_12891748
1412 Ga0105239_13101289
1413 Ga0105246_10083619
1414 Ga0105246_10192462
1415 Ga0105246_10218545
1416 Ga0105246_10514215
1417 Ga0105246_10880933
1418 Ga0157369_10007714
1419 Ga0157374_10020275
1420 Ga0157374_10508924
1421 Ga0157374_10902248
1422 Ga0157374_11458196
1423 Ga0157374_11849640
1424 Ga0157374_12292734
1425 Ga0157378_10015483
1426 Ga0157378_10093522
1427 Ga0157378_10889525
1428 Ga0163162_10102095
1429 Ga0163162_10114346
1430 Ga0163162_10115742
1431 Ga0163162_10496912
1432 Ga0163162_11263824
1433 Ga0163162_13025924
1434 Ga0157372_11742165
1435 Ga0157375_10094761
1436 Ga0157375_10269525
1437 Ga0157375_10331276
1438 Ga0157375_11874071
1439 Ga0157375_12030473
1440 Ga0157375_13344226
1441 Ga0163163_10363328
1442 Ga0163163_10617738
1443 Ga0163163_10827272
1444 Ga0163163_10948772
1445 Ga0163163_11340026
1446 Ga0163163_11656935
1447 Ga0163163_11830600
1448 Ga0163163_13290015
1449 Ga0157380_10566922
1450 Ga0157380_10693656
1451 Ga0157380_10716500
1452 Ga0157380_11106285
1453 Ga0157380_11728683
1454 Ga0182008_10263735
1455 Ga0157377_10190270
1456 Ga0157377_11361730
1457 Ga0157379_10155773
1458 Ga0157379_10351469
1459 Ga0157379_10365434
1460 Ga0157379_12423835
1461 Ga0157376_10004288
1462 Ga0157376_10604754
1463 Ga0157376_10989445
1464 Ga0157376_11133347
1465 Ga0157376_11230187
1466 Ga0157376_11681043
1467 Ga0182007_10351718
1468 Ga0163161_10043682
1469 Ga0163161_10285992
1470 Ga0163161_10558316
1471 Ga0213876_10344846
1472 Ga0209677_125228
1473 Ga0209025_1132440
1474 Ga0209758_1004214
1475 Ga0209758_1022090
1476 Ga0207697_10131220
1477 Ga0207696_1027263
1478 Ga0207653_10028554
1479 Ga0207682_10177584
1480 Ga0207692_10003473
1481 Ga0207692_10430837
1482 Ga0207642_10125500
1483 Ga0207710_10049499
1484 Ga0207710_10157869
1485 Ga0207710_10178232
1486 Ga0207688_10010595
1487 Ga0207688_10027797
1488 Ga0207688_10126798
1489 Ga0207680_10622183
1490 Ga0207680_10773742
1491 Ga0207680_11146224
1492 Ga0207647_10006138
1493 Ga0207685_10175751
1494 Ga0207699_10005053
1495 Ga0207645_10209212
1496 Ga0207645_10269804
1497 Ga0207645_10475068
1498 Ga0207643_10027305
1499 Ga0207643_10373065
1500 Ga0207705_10704342
1501 Ga0207684_11112591
1502 Ga0207654_10050940
1503 Ga0207654_10576763
1504 Ga0207707_10333055
1505 Ga0207671_10509091
1506 Ga0207671_10548875
1507 Ga0207693_10004152
1508 Ga0207693_10068856
1509 Ga0207693_10659459
1510 Ga0207663_10006381
1511 Ga0207663_10878683
1512 Ga0207660_10270447
1513 Ga0207662_10628210
1514 Ga0207657_10094263
1515 Ga0207649_10060489
1516 Ga0207649_10457161
1517 Ga0207652_10521305
1518 Ga0207681_10362754
1519 Ga0207681_10836809
1520 Ga0207694_10197597
1521 Ga0207694_10890167
1522 Ga0207694_11259125
1523 Ga0207650_10987184
1524 Ga0207659_10103723
1525 Ga0207687_10046156
1526 Ga0207687_10506660
1527 Ga0207687_10508010
1528 Ga0207687_10850452
1529 Ga0207687_11213563
1530 Ga0207700_10039017
1531 Ga0207700_10095690
1532 Ga0207700_10470232
1533 Ga0207664_10322313
1534 Ga0207664_11100170
1535 Ga0207644_10070746
1536 Ga0207690_10086087
1537 Ga0207706_10067855
1538 Ga0207706_10129850
1539 Ga0207706_10422663
1540 Ga0207706_10848389
1541 Ga0207686_10155370
1542 Ga0207686_10489309
1543 Ga0207686_10552917
1544 Ga0207686_11769778
1545 Ga0207709_10158090
1546 Ga0207709_10278282
1547 Ga0207709_11019656
1548 Ga0207709_11163532
1549 Ga0207670_10380526
1550 Ga0207670_10902061
1551 Ga0207669_10352911
1552 Ga0207669_10481356
1553 Ga0207669_10912389
1554 Ga0207704_10185027
1555 Ga0207704_10254222
1556 Ga0207704_10347113
1557 Ga0207704_10406919
1558 Ga0207704_11052582
1559 Ga0207665_10239425
1560 Ga0207665_10279087
1561 Ga0207691_10109437
1562 Ga0207691_10115524
1563 Ga0207691_10195566
1564 Ga0207691_10297606
1565 Ga0207711_10278108
1566 Ga0207711_10329868
1567 Ga0207711_10524654
1568 Ga0207711_11900261
1569 Ga0207689_10205379
1570 Ga0207689_10368714
1571 Ga0207689_10868064
1572 Ga0207689_10891136
1573 Ga0207661_10226869
1574 Ga0207661_11382664
1575 Ga0207679_10030722
1576 Ga0207679_10048765
1577 Ga0207679_10622680
1578 Ga0207667_10155171
1579 Ga0207667_11078485
1580 Ga0207651_10172599
1581 Ga0207651_10636927
1582 Ga0207712_10091075
1583 Ga0207712_10774911
1584 Ga0207712_11371803
1585 Ga0207668_10013241
1586 Ga0207668_10159359
1587 Ga0207668_10273689
1588 Ga0207668_10310679
1589 Ga0207668_10758392
1590 Ga0207668_11572912
1591 Ga0207640_10567451
1592 Ga0207640_10850945
1593 Ga0207640_11868026
1594 Ga0207658_10225666
1595 Ga0207677_10342501
1596 Ga0207677_11924720
1597 Ga0207703_10041893
1598 Ga0207703_10197653
1599 Ga0207703_10549605
1600 Ga0207703_10784961
1601 Ga0207639_10008358
1602 Ga0207639_10102877
1603 Ga0207639_10276341
1604 Ga0207639_10944362
1605 Ga0207639_10984807
1606 Ga0207639_11989112
1607 Ga0207678_10015601
1608 Ga0207678_10043029
1609 Ga0207678_10097713
1610 Ga0207678_10262800
1611 Ga0207678_10353158
1612 Ga0207678_10355248
1613 Ga0207678_10401734
1614 Ga0207708_10210470
1615 Ga0207708_10518042
1616 Ga0207708_10990108
1617 Ga0207702_10026010
1618 Ga0207702_11398066
1619 Ga0207641_10274476
1620 Ga0207641_10276717
1621 Ga0207641_11022579
1622 Ga0207648_10060782
1623 Ga0207648_10076280
1624 Ga0207648_10308751
1625 Ga0207648_10902915
1626 Ga0207648_11227210
1627 Ga0207676_10221684
1628 Ga0207674_10064470
1629 Ga0207674_10596281
1630 Ga0207674_10599365
1631 Ga0207675_100084466
1632 Ga0207675_100415238
1633 Ga0207675_100720203
1634 Ga0207675_101057761
1635 Ga0207683_10062959
1636 Ga0207683_10069102
1637 Ga0207683_10113570
1638 Ga0207683_10251011
1639 Ga0207683_10273786
1640 Ga0207683_10370723
1641 Ga0207698_10197728
1642 Ga0207698_10241921
1643 Ga0207698_10243963
1644 Ga0207698_10391484
1645 Ga0209589_1000055
1646 Ga0209489_100128
1647 Ga0209700_100137
1648 Ga0209179_1064309
1649 Ga0209179_1128566
1650 Ga0209813_10128399
1651 Ga0209813_10128717
1652 Ga0207428_10220540
1653 Ga0268266_10001893
1654 Ga0268266_10010934
1655 Ga0268266_10020070
1656 Ga0268266_10060966
1657 Ga0268266_10061647
1658 Ga0268266_10223094
1659 Ga0268266_10316498
1660 Ga0268266_11101948
1661 Ga0268265_10060512
1662 Ga0268265_10073561
1663 Ga0268265_10196619
1664 Ga0268265_10492698
1665 Ga0268265_11209364
1666 Ga0268265_11267247
1667 Ga0268264_10091485
1668 Ga0268264_10141336
1669 Ga0268264_11535631
1670 Ga0307517_10007163
1671 Ga0307517_10239533
1672 Ga0307515_10037445
1673 Ga0307515_10313545
1674 Ga0307512_10104489
1675 Ga0265330_10009605
1676 Ga0265330_10014019
1677 Ga0265328_10101253
1678 Ga0265340_10013754
1679 Ga0265316_10038043
1680 Ga0265316_10135129
1681 Ga0307513_10105731
1682 Ga0307513_10116572
1683 Ga0307513_10730428
1684 Ga0307408_100093076
1685 Ga0307408_100268596
1686 Ga0307408_100549943
1687 Ga0307408_101138755
1688 Ga0307408_102363302
1689 Ga0307508_10026412
1690 Ga0307514_10320590
1691 Ga0265342_10136272
1692 Ga0307516_10002153
1693 Ga0307516_10033701
1694 Ga0307516_10038892
1695 Ga0307516_10232620
1696 Ga0307516_10520583
1697 Ga0307405_10087782
1698 Ga0307405_10160054
1699 Ga0307405_10507376
1700 Ga0307406_10098745
1701 Ga0307406_10341238
1702 Ga0307406_11457624
1703 Ga0307407_10395947
1704 Ga0307407_10610292
1705 Ga0307412_10102251
1706 Ga0307412_10189714
1707 Ga0307412_10925364
1708 Ga0307409_100296235
1709 Ga0307416_100035338
1710 Ga0307416_100114693
1711 Ga0307416_100279052
1712 Ga0307416_100302237
1713 Ga0307416_100508001
1714 Ga0307416_100713568
1715 Ga0307414_11034754
1716 Ga0307411_10136013
1717 Ga0307411_10202581
1718 Ga0307415_100243316
1719 Ga0307415_100652738
1720 Ga0307510_10007834
1721 Ga0307510_10096261
1722 Ga0315911_1000076
1723 Ga0373930_0005846
1724 Ga0373958_0161831
1725 Ga0373929_0099883
1726 Ga0373934_0017039
1727 Ga0373940_0359277
1728 Ga0373923_0004715
1729 Ga0373932_0012313
1730 Ga0373936_0091591
1731 Ga0373939_0143798
1732 Ga0373945_0150553
1733 Ga0373953_0013127
1734 Ga0373954_0001537
1735 Ga0373956_0007238
1736 Ga0373957_0027090
1737 Ga0373943_0167207
1738 Ga0373946_0030362
1739 Ga0373955_0000421
1740 Ga0373924_0005265
1741 Ga0373931_0002773
1742 Ga0373935_0055204
1743 Ga0373927_0106329
1744 Ga0373933_0012141
1745 Ga0373937_0017372
1746 Ga0373925_0643718
1747 Ga0373925_0754851
1748 Ga0395900_0827956
1749 Ga0395898_0141730
1750 Ga0395905_0018502
1751 Ga0395905_0792214
1752 Ga0436365_1432829
1753 Ga0439465_0212985
1754 Ga0451791_0937014
1755 Ga0451791_1187594
1756 Ga0451791_1597070
1757 Ga0451793_0322342
1758 Ga0451793_0591189
1759 Ga0451797_1451936
1760 Ga0451798_0889967
1761 Ga0451800_0821725
1762 Ga0451843_0538096
1763 Ga0451855_0326912
1764 Ga0451853_2025861
1765 Ga0451853_2279900
1766 Ga0439431_0051291
1767 Ga0439463_169067
1768 Ga0439458_0073616
1769 Ga0439459_0023725
1770 Ga0466963_0031196
1771 Ga0466967_0828729
1772 Ga0495617_011757
1773 Ga0495617_245138
1774 Ga0495627_060934
1775 Ga0495592_0001087
1776 Ga0495603_0251449
1777 Ga0495603_0344861
1778 Ga0495603_0666955
1779 Ga0495591_136099
1780 Ga0495629_0000232
1781 Ga0495638_0205673
1782 Ga0495638_0362734
1783 Ga0495638_0475664
1784 Ga0495641_0045103
1785 Ga0495651_0056910
1786 Ga0495651_0084336
1787 Ga0495653_0000575
1788 Ga0495650_0166007
1789 Ga0495650_0191533
1790 Ga0495580_0062006
1791 Ga0495582_0052731
1792 Ga0495582_0641688
1793 Ga0495605_0196278
1794 Ga0495605_0319029
1795 Ga0495639_0026104
1796 Ga0495639_0419831
1797 Ga0495664_0099957
1798 Ga0495584_0154900
1799 Ga0495584_0361259
1800 Ga0495584_0471173
1801 Ga0495585_0049317
1802 Ga0495585_0070049
1803 Ga0495585_0084017
1804 Ga0495594_0096190
1805 Ga0495594_0349173
1806 Ga0495594_0548169
1807 Ga0495606_0287303
1808 Ga0495606_0611888
1809 Ga0495608_0010274
1810 Ga0495610_0226410
1811 Ga0495616_0245235
1812 Ga0495616_0326654
1813 Ga0495618_0085312
1814 Ga0495620_0049974
1815 Ga0495628_0021846
1816 Ga0495628_0159962
1817 Ga0495628_0459436
1818 Ga0495631_0101877
1819 Ga0495631_0214324
1820 Ga0495632_0221208
1821 Ga0495632_0331705
1822 Ga0495637_0148877
1823 Ga0495643_0233037
1824 Ga0495644_0056399
1825 Ga0495644_0208465
1826 Ga0495644_0325184
1827 Ga0495648_0000767
1828 Ga0495648_0262289
1829 Ga0495648_0514572
1830 Ga0495663_0057218
1831 Ga0495642_0144413
1832 Ga0495642_0205083
1833 Ga0495652_0015475
1834 Ga0495654_0251578
1835 Ga0495665_0246992
1836 Ga0495640_0012477
1837 Ga0495587_0003955
1838 Ga0495598_0007022
1839 Ga0495598_0076620
1840 Ga0495598_0261384
1841 Ga0495609_0032697
1842 Ga0495609_0250597
1843 Ga0495621_0029247
1844 Ga0495645_0034945
1845 Ga0495622_0303227
1846 Ga0495633_0052304
1847 Ga0495633_0301487
1848 Ga0495667_0001504
1849 Ga0495656_0020292
1850 Ga0495656_0097647
1851 Ga0495656_0174697
1852 Ga0495656_0251695
1853 Ga0495668_0107764
1854 Ga0495668_0118052
1855 Ga0495668_0208683
1856 Ga0495668_0288341
1857 Ga0495668_0855326
1858 Ga0495634_0044765
1859 Ga0495611_0290359
1860 Ga0495625_0121382
1861 Ga0495625_0149403
1862 Ga0495625_0251692
1863 Ga0495625_0394530
1864 Ga0495625_0682651
1865 Ga0495625_0779557
1866 Ga0495625_0887667
1867 Ga0495635_0004681
1868 Ga0495635_0202498
1869 Ga0495635_0554567
1870 Ga0495659_0005622
1871 Ga0495659_0058896
1872 Ga0495661_0115165
1873 Ga0495661_0276719
1874 Ga0495661_0350958
1875 Ga0495588_0052172
1876 Ga0495588_0476097
1877 Ga0495657_0002790
1878 Ga0495599_0000374
1879 Ga0495623_0003450
1880 Ga0495623_0100202
1881 Ga0495646_0012512
1882 Ga0495647_0110369
1883 Ga0495647_0636201
1884 Ga0495658_0895544
1885 Ga0495669_0071854
1886 Ga0495669_0088882
1887 Ga0495669_0206828
1888 Ga0495669_0348144
1889 Ga0495669_0557729
1890 Ga0495613_0173806
1891 Ga0495613_0361477
1892 Ga0495624_0441369
1893 Ga0495670_0106179
1894 Ga0495670_0216270
1895 Ga0495670_0406804
1896 Ga0495671_0058193
1897 Ga0495649_0210466
1898 Ga0495649_0379303
1899 Ga0495649_0670095
1900 Ga0495589_0140716
1901 Ga0495589_0275926
1902 Ga0495589_0283989
1903 Ga0495589_0297304
1904 Ga0495589_0407574
1905 Ga0495600_0000970
1906 Ga0495600_0380910
1907 Ga0495660_0147676
1908 Ga0495581_0809334
1909 Ga0495604_0003086
1910 Ga0495636_0054101
1911 Ga0495636_0109509
1912 Ga0495674_0146076
1913 Ga0495674_0252273
1914 Ga0495672_0024556
1915 Ga0495672_0159882
1916 Ga0495676_0043899
1917 Ga0495676_0742707
1918 Ga0495680_0001718
1919 Ga0495680_0330668
1920 Ga0495683_0076343
1921 Ga0495683_0342624
1922 Ga0495675_0012009
1923 Ga0495677_0090591
1924 Ga0495679_043384
1925 Ga0495673_0061791
1926 Ga0495673_0111052
1927 Ga0495681_0068534
1928 Ga0495681_0407177
1929 Ga0495684_0000052
1930 Ga0495686_0215418
1931 Ga0495686_0304507
1932 Ga0495686_0730832
1933 Ga0495593_0000126
1934 Ga0495602_0010424
1935 Ga0495602_0524197
1936 Ga0495614_0091053
1937 Ga0495615_0170665
1938 Ga0495626_0265118
1939 Ga0496100_0021406
1940 Ga0496100_0021807
1941 Ga0496100_0132672
1942 Ga0496100_0383208
1943 Ga0496101_0001512
1944 Ga0496101_0178464
1945 Ga0496101_0273877
1946 Ga0496102_0033502
1947 Ga0496102_0033895
1948 Ga0496102_0198935
1949 Ga0496102_0295226
1950 Ga0496102_0319248
1951 Ga0496102_0538555
1952 Ga0496102_0542080
1953 Ga0496103_0012371
1954 Ga0496103_0069769
1955 Ga0496103_0590072
1956 Ga0496103_0879205
1957 Ga0496104_1009227
1958 Ga0496104_1293685
1959 Ga0496105_0032534
1960 Ga0496105_0280558
1961 Ga0496105_0551231
1962 Ga0496106_0038427
1963 Ga0496106_0056750
1964 Ga0496106_0059762
1965 Ga0496106_0277926
1966 Ga0496106_0438668
1967 Ga0496107_0050672
1968 Ga0496107_0164136
1969 Ga0496107_0464650
1970 Ga0496108_0040448
1971 Ga0496108_0056204
1972 Ga0496109_0031405
1973 Ga0496109_0062268
1974 Ga0496109_0327331
1975 Ga0496109_0700257
1976 Ga0496110_0082989
1977 Ga0496110_0084761
1978 Ga0496110_0179327
1979 Ga0496111_0016870
1980 Ga0496111_0692845
1981 Ga0496112_0123281
1982 Ga0496112_0150606
1983 Ga0496112_0164382
1984 Ga0496112_1047994
1985 Ga0496113_0002928
1986 Ga0496113_0089701
1987 Ga0496113_0188813
1988 Ga0496113_0801082
1989 Ga0496114_0032370
1990 Ga0496114_0056698
1991 Ga0496114_0199508
1992 Ga0496114_0398277
1993 Ga0496114_0858829
1994 Ga0496115_0005545
1995 Ga0496115_0012554
1996 Ga0496115_0157169
1997 Ga0496115_0185972
1998 Ga0496115_0765283
1999 Ga0496116_0094414
2000 Ga0496117_0161014
2001 Ga0496118_0146029
2002 Ga0496118_0467257
2003 Ga0496119_0058080
2004 Ga0496119_0167217
2005 Ga0496119_0531289
2006 Ga0496120_0420744
2007 Ga0496121_0024127
2008 Ga0496121_0025355
2009 Ga0496121_0058780
2010 Ga0496121_0161254
2011 Ga0496121_0254981
2012 Ga0496121_0383874
2013 Ga0496124_0035110
2014 Ga0496124_0433735
2015 Ga0496124_0711490
2016 Ga0496125_0148640
2017 Ga0496125_0256772
2018 Ga0496126_0010541
2019 Ga0496126_0020133
2020 Ga0496126_0044803
2021 Ga0496126_0151219
2022 Ga0496126_0585094
2023 Ga0496126_0836504
2024 Ga0495678_072488
2025 Ga0495682_0038197
2026 Ga0501032_0662617
2027 Ga0501034_0628916
2028 Ga0501043_0495050
2029 Ga0501046_0045521
2030 Ga0501047_0017816
2031 Ga0501067_0075522
2032 Ga0501068_0181816
2033 Ga0501069_0715564
2034 Ga0501073_0044960
2035 Ga0501074_0039204
2036 Ga0501075_0672839
2037 Ga0501079_1361530
2038 Ga0501080_0009144
2039 Ga0501035_0429847
2040 Ga0501045_0331924
2041 nmdc:mga03683_59832_c1
2042 nmdc:mga03683_65968_c1
2043 nmdc:mga03n38_14534_c1
2044 nmdc:mga03n38_160367_c1
2045 nmdc:mga03n38_247658_c1
2046 nmdc:mga03n38_298821_c1
2047 nmdc:mga03n38_856169_c1
2048 nmdc:mga03n38_946287_c1
2049 nmdc:mga00v17_24823_c1
2050 nmdc:mga00v17_3320_c1
2051 nmdc:mga0yw44_1054796_c1
2052 nmdc:mga0yw44_138210_c1
2053 nmdc:mga0yw44_145311_c1
2054 nmdc:mga0yw44_209617_c1
2055 nmdc:mga0yw44_280742_c1
2056 nmdc:mga0yw44_29183_c1
2057 nmdc:mga0yw44_791994_c1
2058 nmdc:mga0k408_121414_c1
2059 nmdc:mga0k408_281160_c1
2060 nmdc:mga0k408_409445_c1
2061 nmdc:mga0k408_451528_c1
2062 nmdc:mga0k408_566032_c1
2063 nmdc:mga0k408_84163_c1
2064 nmdc:mga06z11_52627_c1
2065 nmdc:mga06z11_603137_c1
2066 nmdc:mga06z11_8453_c1
2067 nmdc:mga06z11_870847_c1
2068 nmdc:mga04h51_150570_c1
2069 nmdc:mga04h51_72475_c1
2070 nmdc:mga07m45_14522_c1
2071 nmdc:mga07m45_442553_c1
2072 nmdc:mga07m45_567485_c1
2073 nmdc:mga05p37_108944_c1
2074 nmdc:mga09592_807967_c1
2075 nmdc:mga06r32_866156_c1
2076 nmdc:mga08y16_1055318_c1
2077 nmdc:mga08y16_454773_c1
2078 nmdc:mga08y16_785429_c1
2079 nmdc:mga0n895_71870_c1
2080 nmdc:mga0rr50_223423_c1
2081 nmdc:mga08x19_1201975_c1
2082 nmdc:mga0a205_694597_c1
2083 nmdc:mga0sz30_164762_c1
2084 nmdc:mga0sz30_472159_c1
2085 nmdc:mga0sz30_82064_c1
2086 Ga0495601_0009158
2087 Ga0495601_0065866
2088 Ga0495601_0174222
2089 Ga0495601_0294966
2090 Ga0500610_0222259
2091 Ga0500635_0114836
2092 Ga0495655_0080185
2093 Ga0495595_0001810
2094 Ga0495595_0003500
2095 Ga0495619_0000458
2096 Ga0495619_0036103
2097 Ga0495619_0379632
2098 Ga0500643_008568
2099 Ga0500581_090287
2100 Ga0500646_0382550
2101 Ga0500583_0180690
2102 Ga0500583_0259058
2103 Ga0500583_0292914
2104 Ga0500651_0477564
2105 Ga0500641_0050832
2106 Ga0500650_0250026
2107 Ga0500650_0354165
2108 Ga0500556_0108718
2109 Ga0500594_0034745
2110 Ga0500595_008603
2111 Ga0500617_158167
2112 Ga0500642_0143799
2113 Ga0500642_0374802
2114 Ga0500658_0177344
2115 Ga0500658_0219962
2116 Ga0500568_0395917
2117 Ga0500577_0154493
2118 Ga0500588_0060467
2119 Ga0500589_021026
2120 Ga0500589_092741
2121 Ga0500589_110798
2122 Ga0500590_134072
2123 Ga0500604_0054722
2124 Ga0500604_0149677
2125 Ga0500634_0045550
2126 Ga0500634_0352965
2127 Ga0500638_034112
2128 Ga0500636_0029007
2129 Ga0500636_0087827
2130 Ga0500636_0513243
2131 Ga0500645_174334
2132 Ga0500609_005864
2133 Ga0500656_002657
2134 Ga0530510_0260710
2135 2513656433
2136 2513694850
2137 2513715622
2138 2513858989
2139 2513917388
2140 2517889605
2141 2524535629
2142 2671121204
2143 2723842094
2144 2728749210
2145 2793077353
2146 2874610286
2147 2876812757
2148 2879111606
2149 2885378009
2150 2903754951
2151 2904709443
2152 2906641117
2153 2906665673
2154 2908746156
2155 2922366887
2156 2922391939
2157 2922433466
2158 3005483163
2159 8006935527
2160 8006971518
2161 8006975454
2162 8006985860
2163 8007001481
2164 8019563283
2165 8019573363
2166 8056679340

MSA Aligner

Family Sequences

Map