F489697

General Info

Members Datasets Scaffolds Average Seq Length
1082 413 1070 170

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_1217434|Ga0395898_1217434_35_667
Length 210
Sequence MCRAPRLPLKKTPRRRARPTPTAIRWTPIQRKNAEARPSIMNSPQYLLRPVNPGFIAFSFVLAFLFNLMPWGHMQWIPDLVALVLVFWNIHQPRRVGMVVAFLLGLLMDVHEARLLGEHAMAYTMLSYFAITIHRRVLWFSVLSQALHVLPLLVLAHAVPIVIRLLMGAHLPDWQVILPPLIEAALWPFANAFLLAPQRRPESVDETRPI

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2721755523 Delftia sp. HK171 Isolate Unclassified
9 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
10 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
11 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
12 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
20 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
21 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
30 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
31 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
32 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
33 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
34 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
35 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
36 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
37 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
38 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
39 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
40 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
41 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
42 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
43 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
48 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
140 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
143 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
199 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
200 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
202 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
208 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
217 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
228 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
240 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
241 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
242 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
243 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
244 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
247 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
248 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
249 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
250 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
251 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
252 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
253 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
256 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
257 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
258 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
259 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
260 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
261 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
267 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
276 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
277 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
290 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
293 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
294 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
295 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
298 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
301 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
302 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
305 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
306 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
309 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
310 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
311 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
312 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
313 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
314 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
317 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
318 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
327 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
328 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
329 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
330 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
331 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
332 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
333 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
334 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
335 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
336 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
337 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
340 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
341 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
342 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
343 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
344 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
345 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
346 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
347 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
348 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
351 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
352 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
353 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
354 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
355 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
356 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
357 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
358 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
359 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
360 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
361 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
362 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
363 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
364 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
365 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
366 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
367 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
368 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
369 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
370 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
371 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
372 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
373 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
374 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
375 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
376 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
377 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
380 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
381 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
382 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
383 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
384 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
385 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
386 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
387 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
388 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
391 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
392 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
393 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
394 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
395 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
398 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
399 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
400 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
401 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
402 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
403 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
404 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
405 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
406 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
407 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
408 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
409 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
410 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
411 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
412 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
413 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0.37
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.11
Nodule 0.92
Rhizoplane 4.16
Rhizosphere 65.9
Stem 0
Stem Tuber 0
Unclassified 10.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000160 3300001915 Bacteria 19320
2 JGI24741J21665_1000841 3300001915 Bacteria 9246
3 JGI24740J21852_10000483 3300001979 Bacteria 17148
4 JGI24740J21852_10002060 3300001979 Bacteria 9194
5 JGI24740J21852_10018241 3300001979 Bacteria 2495
6 JGI24739J22299_10007062 3300001989 Bacteria 4226
7 JGI24739J22299_10016571 3300001989 Bacteria 2666
8 JGI24737J22298_10005221 3300001990 Bacteria 4494
9 JGI24737J22298_10007151 3300001990 Bacteria 3779
10 JGI24737J22298_10047344 3300001990 Bacteria 1311
11 JGI24735J21928_10000874 3300002067 Bacteria 10756
12 JGI24735J21928_10012528 3300002067 Bacteria 2679
13 JGI24735J21928_10020332 3300002067 Bacteria 2034
14 JGI24735J21928_10120673 3300002067 Bacteria 754
15 JGI24738J21930_10008364 3300002075 Bacteria 2356
16 JGI24738J21930_10067794 3300002075 Bacteria 737
17 JGI25156J39149_1001638 3300002705 Bacteria 9108
18 JGI25156J39149_1011189 3300002705 Bacteria 2048
19 JGI25156J39149_1011412 3300002705 Bacteria 2012
20 JGI25156J39149_1014315 3300002705 Bacteria 1642
21 JGI25156J39149_1022758 3300002705 Bacteria 1058
22 JGI25154J39366_1000483 3300002738 Bacteria 20639
23 JGI25154J39366_1001034 3300002738 Bacteria 11127
24 JGI25157J39369_1000278 3300002741 Bacteria 37495
25 JGI25152J39213_1001024 3300002773 Bacteria 13383
26 JGI25150J39212_1007936 3300002774 Bacteria 2105
27 JGI25165J46597_1003927 3300003214 Bacteria 3424
28 JGI25153J46596_10014803 3300003215 Bacteria 3220
29 JGI25153J46596_10015636 3300003215 Bacteria 3080
30 rootL2_10059169 3300003322 Bacteria 7994
31 rootL2_10174862 3300003322 Bacteria 2087
32 rootH1_10054318 3300003323 Bacteria 3308
33 rootH1_10067675 3300003323 Bacteria 1910
34 rootH1_10281758 3300003323 Bacteria 1036
35 JGI25160J50197_1000016 3300003354 Bacteria 247819
36 Ga0055538_1001442 3300003751 Bacteria 4577
37 Ga0055538_1005363 3300003751 Bacteria 1338
38 Ga0055539_1000226 3300003752 Bacteria 39537
39 Ga0055533_1000738 3300003756 Bacteria 10533
40 Ga0055533_1003064 3300003756 Bacteria 3536
41 Ga0055533_1003745 3300003756 Bacteria 2947
42 Ga0055533_1003847 3300003756 Bacteria 2875
43 Ga0055532_1000022 3300003758 Bacteria 248737
44 Ga0055532_1000040 3300003758 Bacteria 198031
45 Ga0055525_1001187 3300003759 Bacteria 5869
46 Ga0055527_1000016 3300003760 Bacteria 248736
47 Ga0055527_1001527 3300003760 Bacteria 4746
48 Ga0055527_1002687 3300003760 Bacteria 2895
49 Ga0055527_1002714 3300003760 Bacteria 2876
50 Ga0055535_1000017 3300003761 Bacteria 248735
51 Ga0055535_1000029 3300003761 Bacteria 198031
52 Ga0055535_1005249 3300003761 Bacteria 2895
53 Ga0055535_1005280 3300003761 Bacteria 2876
54 Ga0055542_1000030 3300003762 Bacteria 248717
55 Ga0055542_1000850 3300003762 Bacteria 21415
56 Ga0055542_1005397 3300003762 Bacteria 2895
57 Ga0055542_1005452 3300003762 Bacteria 2876
58 Ga0055529_1000033 3300003763 Bacteria 248734
59 Ga0055529_1000055 3300003763 Bacteria 197545
60 Ga0055529_1003036 3300003763 Bacteria 2938
61 Ga0055526_1001136 3300003771 Bacteria 19296
62 Ga0055526_1002962 3300003771 Bacteria 11128
63 Ga0055526_1021340 3300003771 Bacteria 2256
64 Ga0055537_1003705 3300003773 Bacteria 4618
65 Ga0055537_1007755 3300003773 Bacteria 2548
66 Ga0055524_1000137 3300003775 Bacteria 87107
67 Ga0055524_1000491 3300003775 Bacteria 31117
68 Ga0055524_1001779 3300003775 Bacteria 11839
69 Ga0055524_1017950 3300003775 Bacteria 2477
70 Ga0055536_1004932 3300003781 Bacteria 6649
71 Ga0055534_1008631 3300003784 Bacteria 2291
72 Ga0055534_1008695 3300003784 Bacteria 2276
73 Ga0055528_1000675 3300003790 Bacteria 24729
74 Ga0055530_10001713 3300003791 Bacteria 15454
75 Ga0055540_1000042 3300003792 Bacteria 156410
76 Ga0055540_1006966 3300003792 Bacteria 4369
77 Ga0055531_10010420 3300003794 Bacteria 4620
78 Ga0055531_10020132 3300003794 Bacteria 2659
79 Ga0055541_1000556 3300003841 Bacteria 10113
80 Ga0055541_1007510 3300003841 Bacteria 1787
81 Ga0058692_1002295 3300003856 Bacteria 6467
82 Ga0055543_1003765 3300004625 Bacteria 4332
83 Ga0065165_1000079 3300005262 Bacteria 162095
84 Ga0065165_1000154 3300005262 Bacteria 119863
85 Ga0065165_1001510 3300005262 Bacteria 24595
86 Ga0065704_10365703 3300005289 Bacteria 791
87 Ga0070658_10022919 3300005327 Bacteria 5012
88 Ga0070658_10085807 3300005327 Bacteria 2589
89 Ga0070676_10010215 3300005328 Bacteria 5091
90 Ga0070683_101671087 3300005329 Bacteria 612
91 Ga0070666_10053601 3300005335 Bacteria 2721
92 Ga0070666_10125164 3300005335 Bacteria 1784
93 Ga0070682_100469392 3300005337 Bacteria 968
94 Ga0070682_100705625 3300005337 Bacteria 809
95 Ga0068868_100032328 3300005338 Bacteria 4025
96 Ga0070660_100000040 3300005339 Bacteria 75773
97 Ga0070660_100015711 3300005339 Bacteria 5474
98 Ga0070660_100646046 3300005339 Bacteria 886
99 Ga0070661_100000020 3300005344 Bacteria 132014
100 Ga0070661_100000143 3300005344 Bacteria 58391
101 Ga0070661_100083542 3300005344 Bacteria 2359
102 Ga0070661_100230024 3300005344 Bacteria 1425
103 Ga0070661_100362115 3300005344 Bacteria 1140
104 Ga0070668_100049841 3300005347 Bacteria 3222
105 Ga0070669_100154750 3300005353 Bacteria 1777
106 Ga0070669_100513354 3300005353 Bacteria 995
107 Ga0070671_100057929 3300005355 Bacteria 3225
108 Ga0070671_100655537 3300005355 Bacteria 909
109 Ga0070674_100491504 3300005356 Bacteria 1020
110 Ga0070659_100000268 3300005366 Bacteria 40889
111 Ga0070659_100001187 3300005366 Bacteria 18994
112 Ga0070659_100007886 3300005366 Bacteria 7753
113 Ga0070659_100767769 3300005366 Bacteria 837
114 Ga0070667_100030130 3300005367 Bacteria 4524
115 Ga0070667_100063812 3300005367 Bacteria 3123
116 Ga0070708_100531322 3300005445 Bacteria 1110
117 Ga0070663_100000001 3300005455 Bacteria 318372
118 Ga0070663_100022669 3300005455 Bacteria 4201
119 Ga0070663_100031245 3300005455 Bacteria 3659
120 Ga0070663_100288635 3300005455 Bacteria 1310
121 Ga0070663_100612739 3300005455 Bacteria 917
122 Ga0070678_100319076 3300005456 Bacteria 1326
123 Ga0068867_100000074 3300005459 Bacteria 61448
124 Ga0068867_100130849 3300005459 Bacteria 1950
125 Ga0070706_100001812 3300005467 Bacteria 22146
126 Ga0070698_100161166 3300005471 Bacteria 2187
127 Ga0070684_100090171 3300005535 Bacteria 2726
128 Ga0070684_100612382 3300005535 Bacteria 1013
129 Ga0068853_100212436 3300005539 Bacteria 1764
130 Ga0068853_100419554 3300005539 Bacteria 1255
131 Ga0070665_100205597 3300005548 Bacteria 1969
132 Ga0068855_100002940 3300005563 Bacteria 20816
133 Ga0068855_100071125 3300005563 Bacteria 4046
134 Ga0068855_100120027 3300005563 Bacteria 3010
135 Ga0068855_100174821 3300005563 Bacteria 2430
136 Ga0070664_100000006 3300005564 Bacteria 189856
137 Ga0070664_100012445 3300005564 Bacteria 6916
138 Ga0070664_100027245 3300005564 Bacteria 4748
139 Ga0070664_100398412 3300005564 Bacteria 1258
140 Ga0068857_100004217 3300005577 Bacteria 12113
141 Ga0068857_100022755 3300005577 Bacteria 5514
142 Ga0068857_100055164 3300005577 Bacteria 3527
143 Ga0068854_100000253 3300005578 Bacteria 36392
144 Ga0068854_100018676 3300005578 Bacteria 4658
145 Ga0068854_100175418 3300005578 Bacteria 1671
146 Ga0068856_100000032 3300005614 Bacteria 124895
147 Ga0068856_100001787 3300005614 Bacteria 22472
148 Ga0068856_100161563 3300005614 Bacteria 2250
149 Ga0068852_100015742 3300005616 Bacteria 5878
150 Ga0068852_100078143 3300005616 Bacteria 2927
151 Ga0068852_100137779 3300005616 Bacteria 2255
152 Ga0068852_100174110 3300005616 Bacteria 2019
153 Ga0068852_100276979 3300005616 Bacteria 1616
154 Ga0068852_100629817 3300005616 Bacteria 1079
155 Ga0068858_100796155 3300005842 Bacteria 922
156 Ga0075365_10029150 3300006038 Bacteria 3525
157 Ga0075368_10019756 3300006042 Bacteria 2544
158 Ga0075363_100110369 3300006048 Bacteria 1528
159 Ga0075364_10084728 3300006051 Bacteria 2098
160 Ga0075362_10021573 3300006177 Bacteria 2705
161 Ga0075367_10017001 3300006178 Bacteria 3984
162 Ga0075369_10025355 3300006186 Bacteria 2464
163 Ga0075369_10167546 3300006186 Bacteria 1008
164 Ga0075366_10014653 3300006195 Bacteria 4481
165 Ga0075366_10018236 3300006195 Bacteria 4050
166 Ga0075366_10070966 3300006195 Bacteria 2075
167 Ga0075366_10740241 3300006195 Bacteria 611
168 Ga0075370_10003868 3300006353 Bacteria 7175
169 Ga0075370_10014273 3300006353 Bacteria 4236
170 Ga0075370_10050713 3300006353 Bacteria 2354
171 Ga0075370_10054197 3300006353 Bacteria 2277
172 Ga0075429_100000549 3300006880 Bacteria 28660
173 Ga0099823_1000002 3300006944 Bacteria 212272
174 Ga0079104_1000012 3300006946 Bacteria 355143
175 Ga0079104_1000170 3300006946 Bacteria 92339
176 Ga0079104_1044618 3300006946 Bacteria 1015
177 Ga0099826_10000007 3300006948 Bacteria 393518
178 Ga0105251_10000211 3300009011 Bacteria 59154
179 Ga0105251_10000590 3300009011 Bacteria 33310
180 Ga0105251_10076603 3300009011 Bacteria 1552
181 Ga0105251_10175552 3300009011 Bacteria 965
182 Ga0105251_10246479 3300009011 Bacteria 805
183 Ga0105250_10000214 3300009092 Bacteria 47939
184 Ga0105250_10013006 3300009092 Bacteria 3426
185 Ga0105250_10054686 3300009092 Bacteria 1601
186 Ga0105240_10016797 3300009093 Bacteria 9898
187 Ga0105240_10029981 3300009093 Bacteria 7076
188 Ga0105240_10070126 3300009093 Bacteria 4336
189 Ga0105240_10099364 3300009093 Bacteria 3542
190 Ga0105240_10121875 3300009093 Bacteria 3139
191 Ga0105240_10172849 3300009093 Bacteria 2557
192 Ga0105240_10226734 3300009093 Bacteria 2174
193 Ga0105240_10242884 3300009093 Bacteria 2087
194 Ga0105240_10939479 3300009093 Bacteria 928
195 Ga0111539_11710783 3300009094 Bacteria 729
196 Ga0105247_10317823 3300009101 Bacteria 1085
197 Ga0105243_10002697 3300009148 Bacteria 14746
198 Ga0105243_10032598 3300009148 Bacteria 4026
199 Ga0105241_10405709 3300009174 Bacteria 1196
200 Ga0105241_10503318 3300009174 Bacteria 1080
201 Ga0105241_10661861 3300009174 Bacteria 949
202 Ga0105242_10000638 3300009176 Bacteria 27494
203 Ga0105248_10092474 3300009177 Bacteria 3407
204 Ga0105237_10040988 3300009545 Bacteria 4671
205 Ga0105237_10095994 3300009545 Bacteria 2955
206 Ga0105237_10101517 3300009545 Bacteria 2869
207 Ga0105238_10031527 3300009551 Bacteria 5397
208 Ga0105238_10282687 3300009551 Bacteria 1641
209 Ga0105238_10430880 3300009551 Bacteria 1314
210 Ga0105238_10527426 3300009551 Bacteria 1184
211 Ga0105249_10128221 3300009553 Bacteria 2419
212 Ga0105249_10509432 3300009553 Bacteria 1250
213 Ga0105239_10012282 3300010375 Bacteria 9540
214 Ga0105239_10022235 3300010375 Bacteria 6989
215 Ga0105239_10155541 3300010375 Bacteria 2553
216 Ga0105239_11172256 3300010375 Bacteria 885
217 Ga0105246_10678738 3300011119 Bacteria 900
218 Ga0157319_1000007 3300012497 Bacteria 318528
219 Ga0157373_10007276 3300013100 Bacteria 8249
220 Ga0157373_10083227 3300013100 Bacteria 2255
221 Ga0157371_10000106 3300013102 Bacteria 126567
222 Ga0157370_10000062 3300013104 Bacteria 115487
223 Ga0157370_10003076 3300013104 Bacteria 19768
224 Ga0157370_10005074 3300013104 Bacteria 14849
225 Ga0157370_11117372 3300013104 Bacteria 712
226 Ga0157369_10001436 3300013105 Bacteria 29230
227 Ga0157369_10014753 3300013105 Bacteria 8816
228 Ga0157369_10021633 3300013105 Bacteria 7193
229 Ga0157369_10053770 3300013105 Bacteria 4350
230 Ga0157369_10061885 3300013105 Bacteria 4034
231 Ga0157369_10224563 3300013105 Bacteria 1965
232 Ga0157369_10241322 3300013105 Bacteria 1887
233 Ga0157369_10453783 3300013105 Bacteria 1327
234 Ga0157374_10003540 3300013296 Bacteria 13142
235 Ga0157378_10321976 3300013297 Bacteria 1502
236 Ga0163162_10000587 3300013306 Bacteria 33749
237 Ga0163162_11737185 3300013306 Bacteria 713
238 Ga0157372_10000108 3300013307 Bacteria 86863
239 Ga0157372_10002116 3300013307 Bacteria 21593
240 Ga0163163_11371033 3300014325 Bacteria 769
241 Ga0182008_10033036 3300014497 Bacteria 2597
242 Ga0182008_10103131 3300014497 Bacteria 1411
243 Ga0157377_10000006 3300014745 Bacteria 419853
244 Ga0182006_1004867 3300015261 Bacteria 6513
245 Ga0182006_1013126 3300015261 Bacteria 3603
246 Ga0182007_10000169 3300015262 Bacteria 44843
247 Ga0182007_10123969 3300015262 Bacteria 866
248 Ga0183361_10001 3300016635 Bacteria 908583
249 Ga0206356_11010258 3300020070 Bacteria 4042
250 Ga0206351_10205994 3300020077 Bacteria 7799
251 Ga0206354_10019202 3300020081 Bacteria 2247
252 Ga0154015_1595496 3300020610 Bacteria 4773
253 Ga0213872_10020599 3300021361 Bacteria 3040
254 Ga0213872_10321660 3300021361 Bacteria 639
255 Ga0209784_100006 3300025224 Bacteria 930704
256 Ga0209784_100452 3300025224 Bacteria 17499
257 Ga0209566_100002 3300025225 Bacteria 2614868
258 Ga0209566_100218 3300025225 Bacteria 57142
259 Ga0209566_100702 3300025225 Bacteria 19336
260 Ga0209566_101348 3300025225 Bacteria 7765
261 Ga0209566_106577 3300025225 Bacteria 1363
262 Ga0209674_100010 3300025226 Bacteria 1038638
263 Ga0209674_100017 3300025226 Bacteria 689087
264 Ga0209674_100060 3300025226 Bacteria 282102
265 Ga0209674_100076 3300025226 Bacteria 210323
266 Ga0209674_100324 3300025226 Bacteria 30278
267 Ga0209674_101404 3300025226 Bacteria 6446
268 Ga0209672_100001 3300025228 Bacteria 2828210
269 Ga0209672_100041 3300025228 Bacteria 278535
270 Ga0209672_100071 3300025228 Bacteria 169941
271 Ga0209672_102120 3300025228 Bacteria 5277
272 Ga0209147_100018 3300025229 Bacteria 515719
273 Ga0209147_100022 3300025229 Bacteria 443906
274 Ga0209147_100226 3300025229 Bacteria 56753
275 Ga0209147_100401 3300025229 Bacteria 29477
276 Ga0209563_100041 3300025230 Bacteria 407467
277 Ga0209563_100740 3300025230 Bacteria 10064
278 Ga0207427_102710 3300025231 Bacteria 4442
279 Ga0209258_100028 3300025242 Bacteria 515719
280 Ga0209258_100033 3300025242 Bacteria 443845
281 Ga0209258_100309 3300025242 Bacteria 76791
282 Ga0209258_100418 3300025242 Bacteria 50581
283 Ga0207425_1002645 3300025245 Bacteria 6181
284 Ga0207425_1057356 3300025245 Bacteria 694
285 Ga0209646_1000012 3300025246 Bacteria 573300
286 Ga0209646_1000043 3300025246 Bacteria 343652
287 Ga0209026_1000004 3300025250 Bacteria 949012
288 Ga0209026_1017580 3300025250 Bacteria 1140
289 Ga0209677_100007 3300025253 Bacteria 1021332
290 Ga0209677_101750 3300025253 Bacteria 9018
291 Ga0209677_106440 3300025253 Bacteria 2777
292 Ga0209148_1000046 3300025254 Bacteria 443881
293 Ga0209148_1000134 3300025254 Bacteria 169941
294 Ga0209148_1000162 3300025254 Bacteria 138642
295 Ga0209148_1005487 3300025254 Bacteria 2900
296 Ga0209759_1000003 3300025256 Bacteria 792130
297 Ga0209759_1000067 3300025256 Bacteria 183764
298 Ga0209759_1000092 3300025256 Bacteria 161238
299 Ga0209759_1000184 3300025256 Bacteria 100691
300 Ga0209759_1001030 3300025256 Bacteria 18717
301 Ga0209759_1001470 3300025256 Bacteria 13148
302 Ga0209759_1006172 3300025256 Bacteria 4074
303 Ga0209759_1011903 3300025256 Bacteria 2440
304 Ga0209759_1012277 3300025256 Bacteria 2382
305 Ga0209129_1000035 3300025258 Bacteria 329303
306 Ga0209233_1000050 3300025261 Bacteria 450736
307 Ga0209565_1000106 3300025263 Bacteria 122574
308 Ga0209565_1015667 3300025263 Bacteria 1704
309 Ga0209455_1000038 3300025272 Bacteria 443899
310 Ga0209455_1000065 3300025272 Bacteria 321272
311 Ga0209455_1000315 3300025272 Bacteria 48626
312 Ga0209455_1008018 3300025272 Bacteria 2917
313 Ga0209673_1000102 3300025273 Bacteria 189583
314 Ga0209673_1007570 3300025273 Bacteria 4973
315 Ga0209673_1011280 3300025273 Bacteria 3694
316 Ga0209673_1014156 3300025273 Bacteria 3101
317 Ga0209673_1015533 3300025273 Bacteria 2887
318 Ga0209673_1022806 3300025273 Bacteria 2149
319 Ga0209130_1009929 3300025284 Bacteria 2665
320 Ga0209675_1000168 3300025291 Bacteria 79360
321 Ga0209675_1000363 3300025291 Bacteria 38568
322 Ga0209675_1006967 3300025291 Bacteria 4428
323 Ga0209676_1000036 3300025292 Bacteria 457623
324 Ga0209025_1000110 3300025294 Bacteria 220002
325 Ga0209025_1000462 3300025294 Bacteria 79379
326 Ga0209025_1001247 3300025294 Bacteria 35308
327 Ga0209025_1006182 3300025294 Bacteria 9413
328 Ga0209564_1000024 3300025295 Bacteria 535041
329 Ga0209564_1000030 3300025295 Bacteria 503296
330 Ga0209564_1001348 3300025295 Bacteria 26048
331 Ga0209564_1003869 3300025295 Bacteria 9641
332 Ga0209564_1005611 3300025295 Bacteria 7064
333 Ga0209564_1006456 3300025295 Bacteria 6317
334 Ga0209564_1009644 3300025295 Bacteria 4563
335 Ga0209758_1000066 3300025297 Bacteria 298620
336 Ga0209758_1000248 3300025297 Bacteria 110671
337 Ga0209050_1000556 3300025298 Bacteria 61372
338 Ga0209050_1000614 3300025298 Bacteria 56080
339 Ga0209050_1008170 3300025298 Bacteria 5663
340 Ga0209050_1008250 3300025298 Bacteria 5615
341 Ga0209256_1000030 3300025299 Bacteria 414828
342 Ga0209256_1000197 3300025299 Bacteria 114432
343 Ga0209256_1000220 3300025299 Bacteria 106021
344 Ga0209256_1000469 3300025299 Bacteria 60701
345 Ga0209256_1003387 3300025299 Bacteria 11247
346 Ga0209256_1021865 3300025299 Bacteria 1951
347 Ga0207426_1000007 3300025302 Bacteria 971011
348 Ga0207426_1002079 3300025302 Bacteria 13873
349 Ga0209051_1000004 3300025303 Bacteria 1155596
350 Ga0209051_1002061 3300025303 Bacteria 15247
351 Ga0209051_1003541 3300025303 Bacteria 10175
352 Ga0209051_1024073 3300025303 Bacteria 2515
353 Ga0209257_1000063 3300025304 Bacteria 359089
354 Ga0209257_1002434 3300025304 Bacteria 18517
355 Ga0209257_1004130 3300025304 Bacteria 11575
356 Ga0209257_1031974 3300025304 Bacteria 1674
357 Ga0207696_1026972 3300025711 Bacteria 1774
358 Ga0207713_1000137 3300025735 Bacteria 111281
359 Ga0207713_1049881 3300025735 Bacteria 1675
360 Ga0207713_1108016 3300025735 Bacteria 950
361 Ga0207713_1150573 3300025735 Bacteria 751
362 Ga0207680_10084046 3300025903 Bacteria 2007
363 Ga0207680_10168249 3300025903 Bacteria 1475
364 Ga0207680_10374127 3300025903 Bacteria 1003
365 Ga0207647_10000216 3300025904 Bacteria 47083
366 Ga0207647_10004229 3300025904 Bacteria 10642
367 Ga0207647_10011182 3300025904 Bacteria 6306
368 Ga0207647_10021006 3300025904 Bacteria 4365
369 Ga0207647_10089085 3300025904 Bacteria 1842
370 Ga0207647_10229705 3300025904 Bacteria 1068
371 Ga0207645_10016258 3300025907 Bacteria 4928
372 Ga0207705_10005161 3300025909 Bacteria 9790
373 Ga0207705_10037796 3300025909 Bacteria 3454
374 Ga0207705_10320970 3300025909 Bacteria 1190
375 Ga0207684_10065777 3300025910 Bacteria 3078
376 Ga0207654_10266819 3300025911 Bacteria 1153
377 Ga0207654_10749404 3300025911 Bacteria 703
378 Ga0207695_10019161 3300025913 Bacteria 7884
379 Ga0207695_10035571 3300025913 Bacteria 5399
380 Ga0207695_10062843 3300025913 Bacteria 3831
381 Ga0207695_10130634 3300025913 Bacteria 2470
382 Ga0207695_10226377 3300025913 Bacteria 1776
383 Ga0207695_10265284 3300025913 Bacteria 1614
384 Ga0207695_10692617 3300025913 Bacteria 900
385 Ga0207671_10059265 3300025914 Bacteria 2839
386 Ga0207671_10245574 3300025914 Bacteria 1407
387 Ga0207671_10395458 3300025914 Bacteria 1099
388 Ga0207657_10000044 3300025919 Bacteria 116398
389 Ga0207657_10009206 3300025919 Bacteria 9955
390 Ga0207657_10206367 3300025919 Bacteria 1579
391 Ga0207657_10622836 3300025919 Bacteria 841
392 Ga0207649_10000636 3300025920 Bacteria 23444
393 Ga0207649_10007131 3300025920 Bacteria 6077
394 Ga0207649_10028729 3300025920 Bacteria 3277
395 Ga0207649_10148298 3300025920 Bacteria 1613
396 Ga0207646_10025442 3300025922 Bacteria 5414
397 Ga0207681_10046278 3300025923 Bacteria 2926
398 Ga0207694_10004421 3300025924 Bacteria 10990
399 Ga0207694_10363183 3300025924 Bacteria 1200
400 Ga0207694_10428874 3300025924 Bacteria 1102
401 Ga0207650_10255989 3300025925 Bacteria 1419
402 Ga0207659_10171436 3300025926 Bacteria 1712
403 Ga0207644_10392234 3300025931 Bacteria 1133
404 Ga0207644_10666691 3300025931 Bacteria 866
405 Ga0207690_10000046 3300025932 Bacteria 116358
406 Ga0207690_10001085 3300025932 Bacteria 17371
407 Ga0207690_10002717 3300025932 Bacteria 10679
408 Ga0207706_10183589 3300025933 Bacteria 1837
409 Ga0207686_10006359 3300025934 Bacteria 6356
410 Ga0207709_10000599 3300025935 Bacteria 30037
411 Ga0207711_10036836 3300025941 Bacteria 4152
412 Ga0207661_11066830 3300025944 Bacteria 744
413 Ga0207679_10000012 3300025945 Bacteria 339773
414 Ga0207679_10000107 3300025945 Bacteria 68403
415 Ga0207679_10103628 3300025945 Bacteria 2230
416 Ga0207679_10147977 3300025945 Bacteria 1907
417 Ga0207667_10003134 3300025949 Bacteria 20466
418 Ga0207667_10012254 3300025949 Bacteria 9900
419 Ga0207667_10034287 3300025949 Bacteria 5451
420 Ga0207667_10116761 3300025949 Bacteria 2750
421 Ga0207667_10177509 3300025949 Bacteria 2188
422 Ga0207712_10324177 3300025961 Bacteria 1272
423 Ga0207668_10098962 3300025972 Bacteria 2162
424 Ga0207640_10000012 3300025981 Bacteria 242060
425 Ga0207640_10007735 3300025981 Bacteria 5938
426 Ga0207640_10107318 3300025981 Bacteria 1971
427 Ga0207658_10046242 3300025986 Bacteria 3177
428 Ga0207658_10096082 3300025986 Bacteria 2310
429 Ga0207703_10523097 3300026035 Bacteria 1116
430 Ga0207639_10170680 3300026041 Bacteria 1842
431 Ga0207639_10443322 3300026041 Bacteria 1177
432 Ga0207639_10587781 3300026041 Bacteria 1026
433 Ga0207678_10000009 3300026067 Bacteria 156690
434 Ga0207678_10000286 3300026067 Bacteria 45712
435 Ga0207678_10003470 3300026067 Bacteria 14193
436 Ga0207678_10094921 3300026067 Bacteria 2549
437 Ga0207678_10133310 3300026067 Bacteria 2120
438 Ga0207678_10180375 3300026067 Bacteria 1803
439 Ga0207702_10000028 3300026078 Bacteria 183005
440 Ga0207702_10000033 3300026078 Bacteria 166621
441 Ga0207641_10417029 3300026088 Bacteria 1292
442 Ga0207648_10000039 3300026089 Bacteria 118860
443 Ga0207648_10039290 3300026089 Bacteria 4161
444 Ga0207674_10012807 3300026116 Bacteria 9363
445 Ga0207674_10017935 3300026116 Bacteria 7714
446 Ga0207683_10467220 3300026121 Bacteria 1164
447 Ga0207698_10028878 3300026142 Bacteria 3963
448 Ga0207698_10044239 3300026142 Bacteria 3344
449 Ga0207698_10082320 3300026142 Bacteria 2601
450 Ga0209281_1000039 3300027111 Bacteria 355150
451 Ga0209281_1000072 3300027111 Bacteria 273114
452 Ga0209281_1032752 3300027111 Bacteria 917
453 Ga0209389_1004640 3300027296 Bacteria 11506
454 Ga0209371_1000145 3300027312 Bacteria 116135
455 Ga0209371_1003991 3300027312 Bacteria 6715
456 Ga0209371_1005262 3300027312 Bacteria 5215
457 Ga0209282_1000061 3300027666 Bacteria 96444
458 Ga0209974_10001718 3300027876 Bacteria 7948
459 Ga0268265_10576516 3300028380 Bacteria 1072
460 Ga0307517_10003885 3300028786 Bacteria 23168
461 Ga0307517_10182552 3300028786 Bacteria 1351
462 Ga0307517_10425588 3300028786 Bacteria 695
463 Ga0307515_10000013 3300028794 Bacteria 568456
464 Ga0307515_10000179 3300028794 Bacteria 156716
465 Ga0307515_10000239 3300028794 Bacteria 135971
466 Ga0307515_10001166 3300028794 Bacteria 60153
467 Ga0307515_10019026 3300028794 Bacteria 12392
468 Ga0307515_10049706 3300028794 Bacteria 6299
469 Ga0307515_10140165 3300028794 Bacteria 2599
470 Ga0265338_10000087 3300028800 Bacteria 174926
471 Ga0268256_1000128 3300030500 Bacteria 108651
472 Ga0268256_1003719 3300030500 Bacteria 6715
473 Ga0268256_1006515 3300030500 Bacteria 4324
474 Ga0265328_10005564 3300031239 Bacteria 5390
475 Ga0265328_10083473 3300031239 Bacteria 1178
476 Ga0265325_10017793 3300031241 Bacteria 3948
477 Ga0265340_10037151 3300031247 Bacteria 2413
478 Ga0265327_10000147 3300031251 Bacteria 153254
479 Ga0307513_10025671 3300031456 Bacteria 6818
480 Ga0307513_10031954 3300031456 Bacteria 5948
481 Ga0307513_10137233 3300031456 Bacteria 2379
482 Ga0307509_10095836 3300031507 Bacteria 3021
483 Ga0307509_10147894 3300031507 Bacteria 2271
484 Ga0307509_10170107 3300031507 Bacteria 2060
485 Ga0307408_100000298 3300031548 Bacteria 47947
486 Ga0307408_100002033 3300031548 Bacteria 14565
487 Ga0307408_100542698 3300031548 Bacteria 1025
488 Ga0307508_10000048 3300031616 Bacteria 137587
489 Ga0307508_10000122 3300031616 Bacteria 92612
490 Ga0307508_10010633 3300031616 Bacteria 8413
491 Ga0307514_10000595 3300031649 Bacteria 67797
492 Ga0307514_10022005 3300031649 Bacteria 5190
493 Ga0307514_10026307 3300031649 Bacteria 4706
494 Ga0307514_10140682 3300031649 Bacteria 1641
495 Ga0307514_10300458 3300031649 Bacteria 900
496 Ga0307516_10000723 3300031730 Bacteria 45058
497 Ga0307516_10002560 3300031730 Bacteria 24182
498 Ga0307516_10005879 3300031730 Bacteria 14519
499 Ga0307516_10051506 3300031730 Bacteria 4035
500 Ga0307516_10331408 3300031730 Bacteria 1191
501 Ga0307516_10442238 3300031730 Bacteria 957
502 Ga0307516_10539279 3300031730 Bacteria 820
503 Ga0307516_10661095 3300031730 Bacteria 700
504 Ga0307405_10006050 3300031731 Bacteria 5918
505 Ga0307405_10270003 3300031731 Bacteria 1275
506 Ga0307405_10614616 3300031731 Bacteria 889
507 Ga0307410_10115502 3300031852 Bacteria 1949
508 Ga0307406_10006328 3300031901 Bacteria 6532
509 Ga0307412_10000011 3300031911 Bacteria 405842
510 Ga0307412_10203691 3300031911 Bacteria 1504
511 Ga0307412_10472554 3300031911 Bacteria 1038
512 Ga0307409_100006395 3300031995 Bacteria 6918
513 Ga0307416_100046596 3300032002 Bacteria 3423
514 Ga0307411_10087012 3300032005 Bacteria 2169
515 Ga0307411_11391360 3300032005 Bacteria 642
516 Ga0307507_10014209 3300033179 Bacteria 9527
517 Ga0307510_10173162 3300033180 Bacteria 1733
518 Ga0373938_0040706 3300034957 Bacteria 1031
519 Ga0373928_0054127 3300035084 Bacteria 955
520 Ga0373931_0008015 3300035691 Bacteria 4998
521 Ga0373927_0258380 3300035695 Unclassified 1145
522 Ga0395899_0000421 3300037312 Bacteria 49097
523 Ga0395899_0003093 3300037312 Bacteria 13244
524 Ga0395899_0178662 3300037312 Bacteria 1491
525 Ga0395900_0000159 3300037418 Bacteria 111486
526 Ga0395900_0000445 3300037418 Bacteria 59139
527 Ga0395900_0011343 3300037418 Bacteria 9117
528 Ga0395900_0051796 3300037418 Bacteria 4227
529 Ga0395900_0089267 3300037418 Bacteria 3168
530 Ga0395900_0102691 3300037418 Bacteria 2937
531 Ga0395898_0000425 3300037466 Bacteria 89768
532 Ga0395898_0002174 3300037466 Bacteria 24017
533 Ga0395898_0005757 3300037466 Bacteria 13337
534 Ga0395898_0045538 3300037466 Bacteria 4312
535 Ga0395898_0610299 3300037466 Bacteria 1034
536 Ga0395898_1217434 3300037466 Bacteria 684
537 Ga0395905_0000079 3300037471 Bacteria 160663
538 Ga0395905_0016607 3300037471 Bacteria 6996
539 Ga0395905_0016928 3300037471 Bacteria 6924
540 Ga0395905_0032505 3300037471 Bacteria 4907
541 Ga0395905_0054569 3300037471 Bacteria 3739
542 Ga0395901_0000017 3300038443 Bacteria 345003
543 Ga0395901_0000109 3300038443 Bacteria 112882
544 Ga0395901_0009637 3300038443 Bacteria 9798
545 Ga0395901_0065312 3300038443 Bacteria 3788
546 Ga0436365_0055475 3300039437 Bacteria 931
547 Ga0436360_1271525 3300039438 Bacteria 1554
548 Ga0436361_0276814 3300039447 Bacteria 3203
549 Ga0436361_0357138 3300039447 Bacteria 585
550 Ga0436361_0474915 3300039447 Bacteria 5639
551 Ga0439436_0124971 3300041404 Bacteria 720
552 Ga0439465_0058776 3300041413 Bacteria 1271
553 Ga0451800_1689085 3300041459 Bacteria 1607
554 Ga0451807_1399310 3300041486 Bacteria 855
555 Ga0451807_2771500 3300041486 Bacteria 986
556 Ga0451839_1646275 3300041496 Bacteria 779
557 Ga0451841_0602513 3300041498 Bacteria 1107
558 Ga0451853_3184930 3300041512 Bacteria 1426
559 Ga0439431_0009103 3300041997 Bacteria 2238
560 Ga0439448_0000197 3300042005 Bacteria 12508
561 Ga0450914_019216 3300042118 Bacteria 748
562 Ga0450919_000557 3300042121 Bacteria 4687
563 Ga0450888_015827 3300042126 Bacteria 924
564 Ga0439458_0060548 3300042157 Bacteria 945
565 Ga0439459_0001457 3300042438 Bacteria 3491
566 Ga0450918_000035 3300042531 Bacteria 27883
567 Ga0451577_0002691 3300042876 Bacteria 20720
568 Ga0451577_0011641 3300042876 Bacteria 8305
569 Ga0451577_0021420 3300042876 Bacteria 5916
570 Ga0451577_0051158 3300042876 Bacteria 3688
571 Ga0451577_0206362 3300042876 Bacteria 1774
572 Ga0451577_0267325 3300042876 Bacteria 1549
573 Ga0451577_0363728 3300042876 Bacteria 1312
574 Ga0451577_0494385 3300042876 Bacteria 1111
575 Ga0466969_0000493 3300044656 Bacteria 21548
576 Ga0466969_0037388 3300044656 Bacteria 2448
577 Ga0466969_0049749 3300044656 Bacteria 2067
578 Ga0466969_0160165 3300044656 Bacteria 1034
579 Ga0466969_0189302 3300044656 Bacteria 940
580 Ga0466972_0103660 3300044658 Bacteria 1345
581 Ga0466972_0142132 3300044658 Bacteria 1129
582 Ga0466973_0089504 3300044659 Bacteria 2657
583 Ga0466977_0000673 3300044666 Bacteria 12021
584 Ga0466978_0016741 3300044671 Bacteria 4239
585 Ga0466978_0448168 3300044671 Bacteria 679
586 Ga0453683_0321818 3300044673 Bacteria 991
587 Ga0453683_0660378 3300044673 Bacteria 684
588 Ga0453683_0667859 3300044673 Bacteria 680
589 Ga0466965_0003295 3300044683 Bacteria 7063
590 Ga0466965_0004833 3300044683 Bacteria 6011
591 Ga0466965_0096356 3300044683 Bacteria 1509
592 Ga0466965_0286824 3300044683 Bacteria 890
593 Ga0466966_0000431 3300044684 Bacteria 26967
594 Ga0466966_0006383 3300044684 Bacteria 7796
595 Ga0466966_0013580 3300044684 Bacteria 5388
596 Ga0466966_0278330 3300044684 Bacteria 1006
597 Ga0466961_0000698 3300044693 Bacteria 21199
598 Ga0466961_0001496 3300044693 Bacteria 14495
599 Ga0466961_0038919 3300044693 Bacteria 3049
600 Ga0466961_0044697 3300044693 Bacteria 2834
601 Ga0466961_0049456 3300044693 Bacteria 2687
602 Ga0466961_0175587 3300044693 Bacteria 1331
603 Ga0466961_0180486 3300044693 Bacteria 1311
604 Ga0466963_0014335 3300044694 Bacteria 4886
605 Ga0466963_0028670 3300044694 Bacteria 3577
606 Ga0466963_0050273 3300044694 Bacteria 2759
607 Ga0466963_0335880 3300044694 Bacteria 1064
608 Ga0466964_0047790 3300044706 Bacteria 1747
609 Ga0453684_0000222 3300044712 Bacteria 249870
610 Ga0453684_0000566 3300044712 Bacteria 138895
611 Ga0453684_0000659 3300044712 Bacteria 123941
612 Ga0453684_0001598 3300044712 Bacteria 62237
613 Ga0453684_0143536 3300044712 Bacteria 2847
614 Ga0453684_0163016 3300044712 Bacteria 2635
615 Ga0466971_0001521 3300044719 Bacteria 9780
616 Ga0466971_0007298 3300044719 Bacteria 4812
617 Ga0466971_0031567 3300044719 Bacteria 2372
618 Ga0466971_0131728 3300044719 Bacteria 1161
619 Ga0466968_0062191 3300044735 Bacteria 1611
620 Ga0466970_0122243 3300044765 Bacteria 1426
621 Ga0466970_0305069 3300044765 Bacteria 898
622 Ga0466957_0037134 3300044842 Bacteria 2932
623 Ga0466957_0039769 3300044842 Bacteria 2838
624 Ga0466957_0090802 3300044842 Bacteria 1913
625 Ga0466957_0339861 3300044842 Bacteria 1016
626 Ga0466957_0359606 3300044842 Bacteria 989
627 Ga0466957_0554382 3300044842 Bacteria 801
628 Ga0466959_0001907 3300045049 Bacteria 13111
629 Ga0466959_0012308 3300045049 Bacteria 6177
630 Ga0466959_0017092 3300045049 Bacteria 5311
631 Ga0466959_0063301 3300045049 Bacteria 2686
632 Ga0466959_0318101 3300045049 Bacteria 1064
633 Ga0451576_0000169 3300045051 Bacteria 164329
634 Ga0451576_0143833 3300045051 Bacteria 2486
635 Ga0451576_0206374 3300045051 Bacteria 2052
636 Ga0451576_0502204 3300045051 Bacteria 1274
637 Ga0451576_1030071 3300045051 Bacteria 862
638 Ga0466958_0007430 3300045836 Bacteria 6029
639 Ga0466958_0015060 3300045836 Bacteria 4424
640 Ga0466958_0134903 3300045836 Bacteria 1552
641 Ga0466958_0168946 3300045836 Bacteria 1384
642 Ga0466967_0146710 3300045976 Bacteria 2201
643 Ga0495592_0050852 3300046454 Bacteria 3078
644 Ga0495592_0067818 3300046454 Bacteria 2605
645 Ga0495592_0089242 3300046454 Bacteria 2214
646 Ga0495603_0009839 3300046455 Bacteria 5786
647 Ga0495603_0017889 3300046455 Bacteria 4289
648 Ga0495603_0126336 3300046455 Bacteria 1490
649 Ga0495590_0004166 3300046457 Bacteria 5852
650 Ga0495590_0008265 3300046457 Bacteria 3977
651 Ga0495590_0012809 3300046457 Bacteria 3098
652 Ga0495590_0021061 3300046457 Bacteria 2313
653 Ga0495629_0000350 3300046459 Bacteria 39162
654 Ga0495629_0000676 3300046459 Bacteria 27681
655 Ga0495629_0001209 3300046459 Bacteria 20272
656 Ga0495629_0011325 3300046459 Bacteria 6478
657 Ga0495629_0117026 3300046459 Bacteria 1857
658 Ga0495629_0323723 3300046459 Bacteria 1053
659 Ga0495629_0398243 3300046459 Bacteria 936
660 Ga0495638_0012433 3300046460 Bacteria 5836
661 Ga0495638_0073743 3300046460 Bacteria 2082
662 Ga0495641_0018783 3300046461 Bacteria 3558
663 Ga0495641_0048066 3300046461 Bacteria 1957
664 Ga0495651_0018210 3300046462 Bacteria 5438
665 Ga0495651_0091459 3300046462 Bacteria 2280
666 Ga0495653_0013167 3300046463 Bacteria 6744
667 Ga0495653_0026233 3300046463 Bacteria 4675
668 Ga0495653_0075356 3300046463 Bacteria 2511
669 Ga0495653_0085820 3300046463 Bacteria 2314
670 Ga0495650_0003448 3300046471 Bacteria 11529
671 Ga0495650_0009266 3300046471 Bacteria 5621
672 Ga0495650_0023967 3300046471 Bacteria 2892
673 Ga0495650_0025851 3300046471 Bacteria 2742
674 Ga0495650_0028449 3300046471 Bacteria 2565
675 Ga0495650_0033224 3300046471 Bacteria 2298
676 Ga0495650_0041177 3300046471 Bacteria 1977
677 Ga0495580_0000001 3300046472 Bacteria 180598
678 Ga0495580_0009533 3300046472 Bacteria 7631
679 Ga0495580_0019500 3300046472 Bacteria 5038
680 Ga0495580_0030923 3300046472 Bacteria 3872
681 Ga0495580_0099457 3300046472 Bacteria 2023
682 Ga0495580_0120524 3300046472 Bacteria 1821
683 Ga0495580_0225977 3300046472 Bacteria 1285
684 Ga0495580_0275515 3300046472 Bacteria 1148
685 Ga0495580_0334625 3300046472 Bacteria 1027
686 Ga0495582_0002692 3300046473 Bacteria 9920
687 Ga0495582_0012374 3300046473 Bacteria 4700
688 Ga0495605_0011540 3300046474 Bacteria 4921
689 Ga0495605_0013340 3300046474 Bacteria 4531
690 Ga0495605_0028772 3300046474 Bacteria 2866
691 Ga0495605_0043489 3300046474 Bacteria 2226
692 Ga0495605_0138791 3300046474 Bacteria 1092
693 Ga0495605_0258373 3300046474 Bacteria 744
694 Ga0495662_0025265 3300046476 Bacteria 2868
695 Ga0495664_0002647 3300046477 Bacteria 9631
696 Ga0495664_0016595 3300046477 Bacteria 4197
697 Ga0495664_0082556 3300046477 Bacteria 1927
698 Ga0495664_0127317 3300046477 Bacteria 1541
699 Ga0495664_0148094 3300046477 Bacteria 1424
700 Ga0495664_0181461 3300046477 Bacteria 1276
701 Ga0495664_0370809 3300046477 Bacteria 861
702 Ga0495584_0028382 3300046491 Bacteria 2836
703 Ga0495585_0024408 3300046492 Bacteria 3467
704 Ga0495585_0073044 3300046492 Bacteria 1868
705 Ga0495594_0053840 3300046499 Bacteria 2217
706 Ga0495596_0022238 3300046500 Bacteria 2582
707 Ga0495596_0025511 3300046500 Bacteria 2389
708 Ga0495596_0031853 3300046500 Bacteria 2104
709 Ga0495596_0051645 3300046500 Bacteria 1610
710 Ga0495607_0000044 3300046501 Bacteria 125410
711 Ga0495607_0058822 3300046501 Bacteria 2195
712 Ga0495583_0011505 3300046506 Bacteria 5074
713 Ga0495583_0097030 3300046506 Bacteria 1262
714 Ga0495583_0131706 3300046506 Bacteria 1046
715 Ga0495606_0016268 3300046507 Bacteria 5680
716 Ga0495606_0020827 3300046507 Bacteria 4820
717 Ga0495606_0058889 3300046507 Bacteria 2466
718 Ga0495606_0072777 3300046507 Bacteria 2158
719 Ga0495606_0093316 3300046507 Bacteria 1846
720 Ga0495606_0101390 3300046507 Bacteria 1752
721 Ga0495606_0241107 3300046507 Bacteria 1008
722 Ga0495606_0377099 3300046507 Bacteria 745
723 Ga0495608_0062016 3300046511 Bacteria 2457
724 Ga0495608_0194132 3300046511 Bacteria 1281
725 Ga0495608_0194515 3300046511 Bacteria 1279
726 Ga0495610_0030270 3300046512 Bacteria 2839
727 Ga0495610_0049719 3300046512 Bacteria 2051
728 Ga0495610_0057701 3300046512 Bacteria 1861
729 Ga0495610_0125608 3300046512 Bacteria 1119
730 Ga0495610_0135091 3300046512 Bacteria 1067
731 Ga0495616_0007919 3300046513 Bacteria 6333
732 Ga0495618_0003677 3300046514 Bacteria 9509
733 Ga0495618_0054176 3300046514 Bacteria 2537
734 Ga0495618_0368817 3300046514 Bacteria 882
735 Ga0495620_0015323 3300046515 Bacteria 3874
736 Ga0495620_0020708 3300046515 Bacteria 3208
737 Ga0495620_0065208 3300046515 Bacteria 1504
738 Ga0495628_0000262 3300046516 Bacteria 46877
739 Ga0495628_0023102 3300046516 Bacteria 5106
740 Ga0495628_0026203 3300046516 Bacteria 4758
741 Ga0495628_0046943 3300046516 Bacteria 3428
742 Ga0495628_0351805 3300046516 Bacteria 1083
743 Ga0495630_0004146 3300046517 Bacteria 10151
744 Ga0495630_0049487 3300046517 Bacteria 3145
745 Ga0495630_0057140 3300046517 Bacteria 2924
746 Ga0495630_0063604 3300046517 Bacteria 2772
747 Ga0495631_0085976 3300046518 Bacteria 1355
748 Ga0495632_0005415 3300046519 Bacteria 8442
749 Ga0495632_0021619 3300046519 Bacteria 3464
750 Ga0495643_0192830 3300046522 Bacteria 983
751 Ga0495643_0239942 3300046522 Bacteria 851
752 Ga0495644_0125517 3300046523 Bacteria 977
753 Ga0495648_0012471 3300046524 Bacteria 6338
754 Ga0495648_0012802 3300046524 Bacteria 6228
755 Ga0495648_0019099 3300046524 Bacteria 4832
756 Ga0495648_0095490 3300046524 Bacteria 1654
757 Ga0495666_0004161 3300046526 Bacteria 7299
758 Ga0495666_0006932 3300046526 Bacteria 5692
759 Ga0495666_0010532 3300046526 Bacteria 4608
760 Ga0495642_0043013 3300046528 Bacteria 1842
761 Ga0495642_0052150 3300046528 Bacteria 1684
762 Ga0495642_0067527 3300046528 Bacteria 1491
763 Ga0495642_0129195 3300046528 Bacteria 1087
764 Ga0495642_0136903 3300046528 Bacteria 1056
765 Ga0495652_0017575 3300046529 Bacteria 6380
766 Ga0495652_0023307 3300046529 Bacteria 5488
767 Ga0495652_0025263 3300046529 Bacteria 5257
768 Ga0495652_0060455 3300046529 Bacteria 3202
769 Ga0495654_0043090 3300046530 Bacteria 2238
770 Ga0495654_0180336 3300046530 Bacteria 915
771 Ga0495665_0003952 3300046531 Bacteria 8015
772 Ga0495665_0011526 3300046531 Bacteria 4785
773 Ga0495665_0013158 3300046531 Bacteria 4478
774 Ga0495665_0014545 3300046531 Bacteria 4243
775 Ga0495665_0027170 3300046531 Bacteria 3073
776 Ga0495640_0005464 3300046533 Bacteria 10109
777 Ga0495640_0026890 3300046533 Bacteria 4152
778 Ga0495640_0047455 3300046533 Bacteria 2972
779 Ga0495586_0001325 3300046535 Bacteria 13758
780 Ga0495587_0043356 3300046536 Bacteria 2679
781 Ga0495609_0032863 3300046538 Bacteria 2355
782 Ga0495597_0003643 3300046542 Bacteria 8851
783 Ga0495597_0030019 3300046542 Bacteria 2479
784 Ga0495597_0242185 3300046542 Bacteria 711
785 Ga0495645_0003095 3300046543 Bacteria 11267
786 Ga0495645_0034987 3300046543 Bacteria 3662
787 Ga0495645_0050757 3300046543 Bacteria 3019
788 Ga0495645_0082140 3300046543 Bacteria 2311
789 Ga0495622_0000323 3300046557 Bacteria 35189
790 Ga0495622_0072903 3300046557 Bacteria 1584
791 Ga0495667_0091605 3300046559 Bacteria 1969
792 Ga0495667_0306212 3300046559 Bacteria 1006
793 Ga0495668_0579891 3300046616 Bacteria 619
794 Ga0495634_0012324 3300046642 Bacteria 6195
795 Ga0495634_0017115 3300046642 Bacteria 5176
796 Ga0495634_0021353 3300046642 Bacteria 4577
797 Ga0495634_0123088 3300046642 Bacteria 1660
798 Ga0495611_0026094 3300046648 Bacteria 2549
799 Ga0495611_0055137 3300046648 Bacteria 1798
800 Ga0495625_0006884 3300046660 Bacteria 10036
801 Ga0495625_0118480 3300046660 Bacteria 1804
802 Ga0495635_0000381 3300046663 Bacteria 28175
803 Ga0495635_0009189 3300046663 Bacteria 6902
804 Ga0495635_0011998 3300046663 Bacteria 6072
805 Ga0495661_0014497 3300046665 Bacteria 5279
806 Ga0495661_0021507 3300046665 Bacteria 4205
807 Ga0495661_0045087 3300046665 Bacteria 2698
808 Ga0495661_0142680 3300046665 Bacteria 1301
809 Ga0495657_0032130 3300046675 Bacteria 3666
810 Ga0495599_0026415 3300046678 Bacteria 3638
811 Ga0495599_0050372 3300046678 Bacteria 2609
812 Ga0495599_0057819 3300046678 Bacteria 2426
813 Ga0495599_0481510 3300046678 Bacteria 732
814 Ga0495623_0002662 3300046679 Bacteria 11799
815 Ga0495623_0003990 3300046679 Bacteria 9716
816 Ga0495646_0001984 3300046680 Bacteria 12344
817 Ga0495646_0008866 3300046680 Bacteria 6387
818 Ga0495646_0016544 3300046680 Bacteria 4682
819 Ga0495646_0073419 3300046680 Bacteria 2009
820 Ga0495646_0409117 3300046680 Bacteria 704
821 Ga0495669_0087605 3300046684 Bacteria 1435
822 Ga0495669_0156277 3300046684 Bacteria 1081
823 Ga0495669_0199567 3300046684 Bacteria 956
824 Ga0495669_0240464 3300046684 Bacteria 869
825 Ga0495669_0279988 3300046684 Bacteria 802
826 Ga0495669_0297907 3300046684 Bacteria 777
827 Ga0495613_0010036 3300046689 Bacteria 7034
828 Ga0495613_0029195 3300046689 Bacteria 4101
829 Ga0495613_0290063 3300046689 Bacteria 1135
830 Ga0495624_0004047 3300046690 Bacteria 10783
831 Ga0495624_0015178 3300046690 Bacteria 5211
832 Ga0495624_0041103 3300046690 Bacteria 2959
833 Ga0495624_0072943 3300046690 Bacteria 2134
834 Ga0495624_0081472 3300046690 Bacteria 2004
835 Ga0495624_0276904 3300046690 Bacteria 1013
836 Ga0495670_0027374 3300046691 Bacteria 2824
837 Ga0495670_0059758 3300046691 Bacteria 1914
838 Ga0495671_0011561 3300046692 Bacteria 4850
839 Ga0495671_0035689 3300046692 Bacteria 2523
840 Ga0495671_0190862 3300046692 Bacteria 995
841 Ga0495649_0023864 3300046694 Bacteria 3415
842 Ga0495649_0032962 3300046694 Bacteria 2852
843 Ga0495649_0044504 3300046694 Bacteria 2423
844 Ga0495649_0058728 3300046694 Bacteria 2072
845 Ga0495649_0061512 3300046694 Bacteria 2018
846 Ga0495649_0064137 3300046694 Bacteria 1973
847 Ga0495649_0104511 3300046694 Bacteria 1504
848 Ga0495649_0198861 3300046694 Bacteria 1041
849 Ga0495589_0003622 3300046794 Bacteria 8341
850 Ga0495589_0038158 3300046794 Bacteria 2406
851 Ga0495589_0119675 3300046794 Bacteria 1268
852 Ga0495600_0008130 3300046809 Bacteria 6437
853 Ga0495600_0043890 3300046809 Bacteria 2916
854 Ga0495660_0017159 3300046810 Bacteria 4170
855 Ga0495660_0101677 3300046810 Bacteria 1479
856 Ga0495660_0127836 3300046810 Bacteria 1278
857 Ga0495660_0166222 3300046810 Bacteria 1078
858 Ga0495581_0001082 3300047315 Bacteria 14814
859 Ga0495581_0009759 3300047315 Bacteria 5556
860 Ga0495581_0015272 3300047315 Bacteria 4458
861 Ga0495604_0001718 3300047317 Bacteria 17961
862 Ga0495604_0003130 3300047317 Bacteria 13230
863 Ga0495604_0026680 3300047317 Bacteria 4597
864 Ga0495604_0028005 3300047317 Bacteria 4481
865 Ga0495604_0072782 3300047317 Bacteria 2596
866 Ga0495604_0323952 3300047317 Bacteria 1029
867 Ga0495636_0156271 3300047318 Bacteria 1026
868 Ga0495674_0000665 3300047319 Bacteria 32277
869 Ga0495674_0023044 3300047319 Bacteria 5737
870 Ga0495674_0030932 3300047319 Bacteria 4864
871 Ga0495674_0413173 3300047319 Bacteria 1088
872 Ga0495672_0001486 3300047320 Bacteria 22986
873 Ga0495672_0066950 3300047320 Bacteria 2047
874 Ga0495672_0113097 3300047320 Bacteria 1454
875 Ga0495672_0145062 3300047320 Bacteria 1236
876 Ga0495672_0149118 3300047320 Bacteria 1214
877 Ga0495676_0087719 3300047321 Bacteria 2336
878 Ga0495676_0147631 3300047321 Bacteria 1677
879 Ga0495676_0217238 3300047321 Bacteria 1319
880 Ga0495680_0011970 3300047322 Bacteria 7656
881 Ga0495680_0030485 3300047322 Bacteria 4403
882 Ga0495680_0133286 3300047322 Bacteria 1823
883 Ga0495680_0204936 3300047322 Bacteria 1414
884 Ga0495683_0000838 3300047323 Bacteria 21880
885 Ga0495683_0008256 3300047323 Bacteria 5579
886 Ga0495683_0009032 3300047323 Bacteria 5313
887 Ga0495683_0026883 3300047323 Bacteria 2944
888 Ga0495683_0054747 3300047323 Bacteria 1987
889 Ga0495683_0115112 3300047323 Bacteria 1280
890 Ga0495683_0172316 3300047323 Bacteria 994
891 Ga0495687_000134 3300047443 Bacteria 113646
892 Ga0495687_001929 3300047443 Bacteria 17770
893 Ga0495687_004091 3300047443 Bacteria 10090
894 Ga0495687_070709 3300047443 Bacteria 1400
895 Ga0495675_0000784 3300047444 Bacteria 19640
896 Ga0495675_0075902 3300047444 Bacteria 2118
897 Ga0495675_0080487 3300047444 Bacteria 2051
898 Ga0495675_0513857 3300047444 Bacteria 686
899 Ga0495679_000342 3300047446 Bacteria 36534
900 Ga0495679_002089 3300047446 Bacteria 10523
901 Ga0495679_005909 3300047446 Bacteria 5362
902 Ga0495679_062146 3300047446 Bacteria 1093
903 Ga0495679_064720 3300047446 Bacteria 1065
904 Ga0495685_036583 3300047447 Bacteria 1685
905 Ga0495685_122517 3300047447 Bacteria 853
906 Ga0495685_164772 3300047447 Bacteria 717
907 Ga0495673_0012012 3300047469 Bacteria 4620
908 Ga0495673_0040757 3300047469 Bacteria 2094
909 Ga0495673_0155236 3300047469 Bacteria 882
910 Ga0495673_0164301 3300047469 Bacteria 850
911 Ga0495681_0124459 3300047470 Bacteria 1103
912 Ga0495681_0181291 3300047470 Bacteria 865
913 Ga0495684_0014068 3300047471 Bacteria 6154
914 Ga0495684_0083650 3300047471 Bacteria 2420
915 Ga0495684_0100571 3300047471 Bacteria 2186
916 Ga0495686_0000129 3300047472 Bacteria 155797
917 Ga0495686_0055686 3300047472 Bacteria 2472
918 Ga0495686_0408225 3300047472 Bacteria 728
919 Ga0495593_0005757 3300047673 Bacteria 7311
920 Ga0495593_0005997 3300047673 Bacteria 7154
921 Ga0495593_0019899 3300047673 Bacteria 3760
922 Ga0495593_0022040 3300047673 Bacteria 3554
923 Ga0495602_0004174 3300048088 Bacteria 15032
924 Ga0495602_0022647 3300048088 Bacteria 6143
925 Ga0495602_0026745 3300048088 Bacteria 5559
926 Ga0495602_0029768 3300048088 Bacteria 5191
927 Ga0495602_0031238 3300048088 Bacteria 5038
928 Ga0495602_0171340 3300048088 Bacteria 1684
929 Ga0495602_0221440 3300048088 Bacteria 1428
930 Ga0495614_0000057 3300048089 Bacteria 34749
931 Ga0495614_0029300 3300048089 Bacteria 2369
932 Ga0495614_0033692 3300048089 Bacteria 2203
933 Ga0495614_0040117 3300048089 Bacteria 2009
934 Ga0495614_0089178 3300048089 Bacteria 1341
935 Ga0495626_0050164 3300048091 Bacteria 1929
936 Ga0495626_0051127 3300048091 Bacteria 1907
937 Ga0495626_0095624 3300048091 Bacteria 1301
938 Ga0495626_0123898 3300048091 Bacteria 1108
939 Ga0496100_0001212 3300048903 Bacteria 12531
940 Ga0496100_0033632 3300048903 Bacteria 3209
941 Ga0496100_0125277 3300048903 Bacteria 1802
942 Ga0496101_0002850 3300048904 Bacteria 10629
943 Ga0496101_0028498 3300048904 Bacteria 3898
944 Ga0496101_0237834 3300048904 Bacteria 1417
945 Ga0496102_0000553 3300048905 Bacteria 40140
946 Ga0496102_0002084 3300048905 Bacteria 17195
947 Ga0496102_0006527 3300048905 Bacteria 9953
948 Ga0496102_0013289 3300048905 Bacteria 7130
949 Ga0496102_0199999 3300048905 Bacteria 1883
950 Ga0496103_0003408 3300048906 Bacteria 9719
951 Ga0496103_0005875 3300048906 Bacteria 7333
952 Ga0496103_0043638 3300048906 Bacteria 2761
953 Ga0496103_0084148 3300048906 Bacteria 2003
954 Ga0496104_0147490 3300048907 Bacteria 2259
955 Ga0496104_0420091 3300048907 Bacteria 1249
956 Ga0496104_0440929 3300048907 Bacteria 1214
957 Ga0496104_0541019 3300048907 Bacteria 1075
958 Ga0496105_0020961 3300048908 Bacteria 5286
959 Ga0496105_0149655 3300048908 Bacteria 1919
960 Ga0496105_0171652 3300048908 Bacteria 1777
961 Ga0496106_0074298 3300048909 Bacteria 2602
962 Ga0496106_0084304 3300048909 Bacteria 2445
963 Ga0496106_0123160 3300048909 Bacteria 2028
964 Ga0496106_0184218 3300048909 Bacteria 1658
965 Ga0496106_0702728 3300048909 Bacteria 806
966 Ga0496107_0130532 3300048910 Bacteria 1855
967 Ga0496107_0612445 3300048910 Bacteria 804
968 Ga0496108_0122725 3300048911 Bacteria 2229
969 Ga0496109_0204587 3300048912 Bacteria 1856
970 Ga0496110_0025088 3300048913 Bacteria 5090
971 Ga0496110_0116706 3300048913 Bacteria 2403
972 Ga0496110_0638809 3300048913 Bacteria 964
973 Ga0496111_0011978 3300048914 Bacteria 5862
974 Ga0496112_0017022 3300048915 Bacteria 6824
975 Ga0496113_0008792 3300048916 Bacteria 6597
976 Ga0496113_0279930 3300048916 Bacteria 1334
977 Ga0496113_0546976 3300048916 Bacteria 929
978 Ga0496114_0026593 3300048917 Bacteria 4738
979 Ga0496115_0097632 3300048918 Bacteria 2406
980 Ga0496115_0441894 3300048918 Bacteria 1052
981 Ga0496116_0001320 3300048919 Bacteria 28280
982 Ga0496116_0007863 3300048919 Bacteria 9357
983 Ga0496116_0088130 3300048919 Bacteria 1897
984 Ga0496116_0167305 3300048919 Bacteria 1196
985 Ga0496117_0001476 3300048920 Bacteria 33776
986 Ga0496117_0012055 3300048920 Bacteria 7673
987 Ga0496117_0044221 3300048920 Bacteria 3228
988 Ga0496117_0067052 3300048920 Bacteria 2431
989 Ga0496117_0071784 3300048920 Bacteria 2318
990 Ga0496118_0001841 3300048921 Bacteria 30372
991 Ga0496118_0002994 3300048921 Bacteria 21830
992 Ga0496118_0003375 3300048921 Bacteria 20179
993 Ga0496118_0012483 3300048921 Bacteria 8145
994 Ga0496118_0034000 3300048921 Bacteria 4170
995 Ga0496118_0069117 3300048921 Bacteria 2560
996 Ga0496118_0206663 3300048921 Bacteria 1157
997 Ga0496119_0135213 3300048922 Bacteria 1338
998 Ga0496119_0284089 3300048922 Bacteria 822
999 Ga0496121_0000639 3300048924 Bacteria 65359
1000 Ga0496121_0003125 3300048924 Bacteria 23912
1001 Ga0496121_0006587 3300048924 Bacteria 14324
1002 Ga0496122_0007397 3300048925 Bacteria 12226
1003 Ga0496122_0076979 3300048925 Bacteria 2345
1004 Ga0496122_0096034 3300048925 Bacteria 2000
1005 Ga0496123_0006456 3300048926 Bacteria 11351
1006 Ga0496123_0020775 3300048926 Bacteria 5124
1007 Ga0496123_0054577 3300048926 Bacteria 2629
1008 Ga0496124_0026467 3300048927 Bacteria 5229
1009 Ga0496124_0031878 3300048927 Bacteria 4661
1010 Ga0496124_0038979 3300048927 Bacteria 4122
1011 Ga0496124_0085965 3300048927 Bacteria 2576
1012 Ga0496124_0191792 3300048927 Bacteria 1563
1013 Ga0496124_0230306 3300048927 Bacteria 1386
1014 Ga0496125_0005643 3300048928 Bacteria 13816
1015 Ga0496125_0006190 3300048928 Bacteria 13033
1016 Ga0496125_0055564 3300048928 Bacteria 3224
1017 Ga0496125_0244728 3300048928 Bacteria 1136
1018 Ga0496125_0272698 3300048928 Bacteria 1053
1019 Ga0496125_0584346 3300048928 Bacteria 613
1020 Ga0496126_0006608 3300048929 Bacteria 12910
1021 Ga0496126_0028891 3300048929 Bacteria 5275
1022 Ga0496126_0043956 3300048929 Bacteria 4117
1023 Ga0496126_0308190 3300048929 Bacteria 1304
1024 Ga0495678_057979 3300049459 Bacteria 1465
1025 Ga0495682_0087142 3300049460 Bacteria 1122
1026 Ga0501034_0057285 3300049571 Bacteria 3918
1027 Ga0501043_0253363 3300049579 Bacteria 1355
1028 Ga0501209_003792 3300049656 Bacteria 2547
1029 nmdc:mga03683_135476_c1 3300050489 Bacteria 1104
1030 nmdc:mga03n38_135792_c1 3300050490 Bacteria 1224
1031 nmdc:mga0yw44_74458_c1 3300050492 Bacteria 2115
1032 nmdc:mga0k408_13599_c1 3300050493 Bacteria 4468
1033 nmdc:mga0k408_16514_c2 3300050493 Bacteria 2586
1034 nmdc:mga0k408_258628_c1 3300050493 Bacteria 1039
1035 nmdc:mga0k408_4060_c1 3300050493 Bacteria 7766
1036 nmdc:mga0k408_42694_c1 3300050493 Bacteria 2612
1037 nmdc:mga0k408_658079_c1 3300050493 Bacteria 616
1038 nmdc:mga06z11_118662_c1 3300050494 Bacteria 1473
1039 nmdc:mga06z11_202107_c1 3300050494 Bacteria 1155
1040 nmdc:mga06z11_78203_c1 3300050494 Bacteria 1768
1041 nmdc:mga07m45_115998_c1 3300050496 Bacteria 1544
1042 nmdc:mga07m45_2182_c1 3300050496 Bacteria 9130
1043 nmdc:mga07m45_314695_c1 3300050496 Bacteria 910
1044 nmdc:mga07m45_35723_c1 3300050496 Bacteria 1118
1045 nmdc:mga07m45_3941_c1 3300050496 Bacteria 7214
1046 nmdc:mga07m45_47644_c1 3300050496 Bacteria 2410
1047 nmdc:mga07m45_59232_c1 3300050496 Bacteria 2167
1048 nmdc:mga07m45_78892_c1 3300050496 Bacteria 1879
1049 nmdc:mga09592_14541_c1 3300050508 Bacteria 4822
1050 nmdc:mga0qj67_12586_c1 3300050509 Bacteria 6377
1051 Ga0500635_0000318 3300053080 Bacteria 16609
1052 Ga0500578_0017157 3300053086 Bacteria 4653
1053 Ga0500644_0013621 3300053088 Bacteria 2275
1054 Ga0500593_002980 3300053117 Bacteria 6307
1055 Ga0500618_031351 3300053125 Bacteria 1246
1056 Ga0500621_195489 3300053126 Bacteria 721
1057 Ga0500658_0126800 3300053134 Bacteria 1135
1058 Ga0500559_0000207 3300053136 Bacteria 46949
1059 Ga0500568_0081383 3300053139 Bacteria 1229
1060 Ga0500568_0163032 3300053139 Bacteria 822
1061 Ga0500590_039858 3300053148 Bacteria 2421
1062 Ga0500622_0022765 3300053156 Bacteria 3318
1063 Ga0500636_0054911 3300053177 Bacteria 2335
1064 Ga0500570_125006 3300053724 Bacteria 996
1065 Ga0500587_000950 3300053739 Bacteria 3899
1066 Ga0500587_002321 3300053739 Bacteria 2706
1067 Ga0466962_0002580 3300061719 Bacteria 8604
1068 Ga0466962_0008800 3300061719 Bacteria 4839
1069 Ga0466962_0022861 3300061719 Bacteria 3004
1070 Ga0466962_0040446 3300061719 Bacteria 2231

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10010215 Ga0070676_100102153 158
2 3300005338 Ga0068868_100032328 Ga0068868_1000323282 158
3 3300005355 Ga0070671_100057929 Ga0070671_1000579292 158
4 3300005459 Ga0068867_100130849 Ga0068867_1001308492 158
5 3300005548 Ga0070665_100205597 Ga0070665_1002055972 158
6 3300005578 Ga0068854_100175418 Ga0068854_1001754182 158
7 3300005616 Ga0068852_100137779 Ga0068852_1001377792 158
8 3300025907 Ga0207645_10016258 Ga0207645_100162583 158
9 3300025931 Ga0207644_10392234 Ga0207644_103922342 158
10 3300025981 Ga0207640_10107318 Ga0207640_101073183 158
11 3300026089 Ga0207648_10039290 Ga0207648_100392902 158
12 3300044712 Ga0453684_0000566 Ga0453684_0000566_59203_59724 159
13 3300048088 Ga0495602_0221440 Ga0495602_0221440_112_633 159
14 3300048904 Ga0496101_0237834 Ga0496101_0237834_408_923 159
15 3300048909 Ga0496106_0702728 Ga0496106_0702728_40_555 161
16 3300002705 JGI25156J39149_1001638 JGI25156J39149_10016386 162
17 3300002738 JGI25154J39366_1001034 JGI25154J39366_10010342 162
18 3300002741 JGI25157J39369_1000278 JGI25157J39369_10002782 162
19 3300005344 Ga0070661_100083542 Ga0070661_1000835422 162
20 3300005535 Ga0070684_100090171 Ga0070684_1000901712 162
21 3300005539 Ga0068853_100419554 Ga0068853_1004195541 162
22 3300005563 Ga0068855_100174821 Ga0068855_1001748212 162
23 3300005577 Ga0068857_100004217 Ga0068857_1000042173 162
24 3300005578 Ga0068854_100018676 Ga0068854_1000186762 162
25 3300005614 Ga0068856_100001787 Ga0068856_10000178715 162
26 3300005616 Ga0068852_100174110 Ga0068852_1001741102 162
27 3300009093 Ga0105240_10070126 Ga0105240_100701263 162
28 3300009174 Ga0105241_10405709 Ga0105241_104057092 162
29 3300009545 Ga0105237_10101517 Ga0105237_101015172 162
30 3300009551 Ga0105238_10527426 Ga0105238_105274262 162
31 3300010375 Ga0105239_10155541 Ga0105239_101555413 162
32 3300013105 Ga0157369_10053770 Ga0157369_100537702 162
33 3300025246 Ga0209646_1000012 Ga0209646_1000012136 162
34 3300025250 Ga0209026_1000004 Ga0209026_1000004481 162
35 3300025253 Ga0209677_101750 Ga0209677_1017507 162
36 3300025256 Ga0209759_1000003 Ga0209759_1000003244 162
37 3300025256 Ga0209759_1000067 Ga0209759_1000067171 162
38 3300025913 Ga0207695_10130634 Ga0207695_101306342 162
39 3300025914 Ga0207671_10245574 Ga0207671_102455742 162
40 3300025949 Ga0207667_10177509 Ga0207667_101775092 162
41 3300025981 Ga0207640_10007735 Ga0207640_100077355 162
42 3300026041 Ga0207639_10587781 Ga0207639_105877812 162
43 3300026078 Ga0207702_10000033 Ga0207702_100000338 162
44 3300026116 Ga0207674_10017935 Ga0207674_100179354 162
45 3300026142 Ga0207698_10082320 Ga0207698_100823202 162
46 3300031730 Ga0307516_10442238 Ga0307516_104422382 162
47 iso_pu_bacteria 2574179768 2574429959 167
48 iso_pu_bacteria 2585428062 2587757849 167
49 iso_pu_bacteria 2588253510 2588292658 167
50 iso_pu_bacteria 2643221592 2643967238 167
51 iso_pu_bacteria 2643221625 2644140069 167
52 iso_pu_bacteria 2643221644 2644245981 167
53 iso_pu_bacteria 2643221648 2644271309 167
54 iso_pu_bacteria 2891633521 2891635151 167
55 iso_pu_bacteria 2721755523 2722881184 168
56 iso_pu_bacteria 2839138175 2839141080 168
57 iso_pu_bacteria 2886848708 2886849921 168
58 3300001915 JGI24741J21665_1000160 JGI24741J21665_10001602 170
59 3300001915 JGI24741J21665_1000841 JGI24741J21665_10008412 170
60 3300001979 JGI24740J21852_10000483 JGI24740J21852_100004838 170
61 3300001979 JGI24740J21852_10002060 JGI24740J21852_100020607 170
62 3300001979 JGI24740J21852_10018241 JGI24740J21852_100182412 170
63 3300001989 JGI24739J22299_10007062 JGI24739J22299_100070623 170
64 3300001989 JGI24739J22299_10016571 JGI24739J22299_100165711 170
65 3300001990 JGI24737J22298_10005221 JGI24737J22298_100052213 170
66 3300001990 JGI24737J22298_10007151 JGI24737J22298_100071511 170
67 3300001990 JGI24737J22298_10047344 JGI24737J22298_100473442 170
68 3300002067 JGI24735J21928_10000874 JGI24735J21928_100008745 170
69 3300002067 JGI24735J21928_10012528 JGI24735J21928_100125282 170
70 3300002067 JGI24735J21928_10020332 JGI24735J21928_100203322 170
71 3300002067 JGI24735J21928_10120673 JGI24735J21928_101206731 170
72 3300002075 JGI24738J21930_10008364 JGI24738J21930_100083642 170
73 3300002075 JGI24738J21930_10067794 JGI24738J21930_100677941 170
74 3300002705 JGI25156J39149_1011189 JGI25156J39149_10111892 170
75 3300002705 JGI25156J39149_1011412 JGI25156J39149_10114122 170
76 3300002705 JGI25156J39149_1014315 JGI25156J39149_10143152 170
77 3300002705 JGI25156J39149_1022758 JGI25156J39149_10227582 170
78 3300002738 JGI25154J39366_1000483 JGI25154J39366_10004832 170
79 3300002773 JGI25152J39213_1001024 JGI25152J39213_100102410 170
80 3300002774 JGI25150J39212_1007936 JGI25150J39212_10079361 170
81 3300003214 JGI25165J46597_1003927 JGI25165J46597_10039273 170
82 3300003215 JGI25153J46596_10014803 JGI25153J46596_100148032 170
83 3300003215 JGI25153J46596_10015636 JGI25153J46596_100156363 170
84 3300003322 rootL2_10059169 rootL2_100591695 170
85 3300003322 rootL2_10174862 rootL2_101748622 170
86 3300003323 rootH1_10054318 rootH1_100543183 170
87 3300003323 rootH1_10067675 rootH1_100676752 170
88 3300003323 rootH1_10281758 rootH1_102817581 170
89 3300003354 JGI25160J50197_1000016 JGI25160J50197_100001636 170
90 3300003751 Ga0055538_1001442 Ga0055538_10014421 170
91 3300003751 Ga0055538_1005363 Ga0055538_10053632 170
92 3300003752 Ga0055539_1000226 Ga0055539_100022616 170
93 3300003756 Ga0055533_1000738 Ga0055533_10007388 170
94 3300003756 Ga0055533_1003064 Ga0055533_10030642 170
95 3300003756 Ga0055533_1003745 Ga0055533_10037452 170
96 3300003756 Ga0055533_1003847 Ga0055533_10038472 170
97 3300003758 Ga0055532_1000022 Ga0055532_1000022148 170
98 3300003758 Ga0055532_1000040 Ga0055532_100004081 170
99 3300003759 Ga0055525_1001187 Ga0055525_10011872 170
100 3300003760 Ga0055527_1000016 Ga0055527_1000016148 170
101 3300003760 Ga0055527_1001527 Ga0055527_10015274 170
102 3300003760 Ga0055527_1002687 Ga0055527_10026872 170
103 3300003760 Ga0055527_1002714 Ga0055527_10027142 170
104 3300003761 Ga0055535_1000017 Ga0055535_1000017148 170
105 3300003761 Ga0055535_1000029 Ga0055535_100002981 170
106 3300003761 Ga0055535_1005249 Ga0055535_10052492 170
107 3300003761 Ga0055535_1005280 Ga0055535_10052802 170
108 3300003762 Ga0055542_1000030 Ga0055542_100003092 170
109 3300003762 Ga0055542_1000850 Ga0055542_100085015 170
110 3300003762 Ga0055542_1005397 Ga0055542_10053972 170
111 3300003762 Ga0055542_1005452 Ga0055542_10054522 170
112 3300003763 Ga0055529_1000033 Ga0055529_100003392 170
113 3300003763 Ga0055529_1000055 Ga0055529_1000055102 170
114 3300003763 Ga0055529_1003036 Ga0055529_10030362 170
115 3300003771 Ga0055526_1001136 Ga0055526_100113611 170
116 3300003771 Ga0055526_1002962 Ga0055526_100296210 170
117 3300003771 Ga0055526_1021340 Ga0055526_10213403 170
118 3300003773 Ga0055537_1003705 Ga0055537_10037052 170
119 3300003773 Ga0055537_1007755 Ga0055537_10077553 170
120 3300003775 Ga0055524_1000137 Ga0055524_100013726 170
121 3300003775 Ga0055524_1000491 Ga0055524_100049129 170
122 3300003775 Ga0055524_1001779 Ga0055524_10017793 170
123 3300003775 Ga0055524_1017950 Ga0055524_10179502 170
124 3300003781 Ga0055536_1004932 Ga0055536_10049324 170
125 3300003784 Ga0055534_1008631 Ga0055534_10086313 170
126 3300003784 Ga0055534_1008695 Ga0055534_10086951 170
127 3300003790 Ga0055528_1000675 Ga0055528_100067513 170
128 3300003791 Ga0055530_10001713 Ga0055530_100017136 170
129 3300003792 Ga0055540_1000042 Ga0055540_100004262 170
130 3300003792 Ga0055540_1006966 Ga0055540_10069663 170
131 3300003794 Ga0055531_10010420 Ga0055531_100104204 170
132 3300003794 Ga0055531_10020132 Ga0055531_100201322 170
133 3300003841 Ga0055541_1000556 Ga0055541_10005563 170
134 3300003841 Ga0055541_1007510 Ga0055541_10075102 170
135 3300003856 Ga0058692_1002295 Ga0058692_10022952 170
136 3300004625 Ga0055543_1003765 Ga0055543_10037652 170
137 3300005262 Ga0065165_1000079 Ga0065165_100007922 170
138 3300005262 Ga0065165_1000154 Ga0065165_100015436 170
139 3300005262 Ga0065165_1001510 Ga0065165_100151020 170
140 3300005289 Ga0065704_10365703 Ga0065704_103657031 170
141 3300005327 Ga0070658_10022919 Ga0070658_100229195 170
142 3300005327 Ga0070658_10085807 Ga0070658_100858072 170
143 3300005329 Ga0070683_101671087 Ga0070683_1016710871 170
144 3300005335 Ga0070666_10053601 Ga0070666_100536011 170
145 3300005335 Ga0070666_10125164 Ga0070666_101251642 170
146 3300005337 Ga0070682_100469392 Ga0070682_1004693921 170
147 3300005337 Ga0070682_100705625 Ga0070682_1007056251 170
148 3300005339 Ga0070660_100000040 Ga0070660_10000004073 170
149 3300005339 Ga0070660_100015711 Ga0070660_1000157115 170
150 3300005339 Ga0070660_100646046 Ga0070660_1006460461 170
151 3300005344 Ga0070661_100000020 Ga0070661_1000000206 170
152 3300005344 Ga0070661_100000143 Ga0070661_10000014350 170
153 3300005344 Ga0070661_100230024 Ga0070661_1002300241 170
154 3300005344 Ga0070661_100362115 Ga0070661_1003621152 170
155 3300005347 Ga0070668_100049841 Ga0070668_1000498412 170
156 3300005353 Ga0070669_100154750 Ga0070669_1001547502 170
157 3300005353 Ga0070669_100513354 Ga0070669_1005133541 170
158 3300005355 Ga0070671_100655537 Ga0070671_1006555371 170
159 3300005356 Ga0070674_100491504 Ga0070674_1004915042 170
160 3300005366 Ga0070659_100000268 Ga0070659_10000026835 170
161 3300005366 Ga0070659_100001187 Ga0070659_10000118711 170
162 3300005366 Ga0070659_100007886 Ga0070659_1000078862 170
163 3300005366 Ga0070659_100767769 Ga0070659_1007677691 170
164 3300005367 Ga0070667_100030130 Ga0070667_1000301306 170
165 3300005367 Ga0070667_100063812 Ga0070667_1000638122 170
166 3300005445 Ga0070708_100531322 Ga0070708_1005313221 170
167 3300005455 Ga0070663_100000001 Ga0070663_100000001219 170
168 3300005455 Ga0070663_100022669 Ga0070663_1000226694 170
169 3300005455 Ga0070663_100031245 Ga0070663_1000312453 170
170 3300005455 Ga0070663_100288635 Ga0070663_1002886351 170
171 3300005455 Ga0070663_100612739 Ga0070663_1006127391 170
172 3300005456 Ga0070678_100319076 Ga0070678_1003190761 170
173 3300005459 Ga0068867_100000074 Ga0068867_10000007415 170
174 3300005467 Ga0070706_100001812 Ga0070706_10000181217 170
175 3300005471 Ga0070698_100161166 Ga0070698_1001611662 170
176 3300005535 Ga0070684_100612382 Ga0070684_1006123821 170
177 3300005539 Ga0068853_100212436 Ga0068853_1002124362 170
178 3300005563 Ga0068855_100002940 Ga0068855_10000294017 170
179 3300005563 Ga0068855_100071125 Ga0068855_1000711253 170
180 3300005563 Ga0068855_100120027 Ga0068855_1001200273 170
181 3300005564 Ga0070664_100000006 Ga0070664_10000000696 170
182 3300005564 Ga0070664_100012445 Ga0070664_1000124453 170
183 3300005564 Ga0070664_100027245 Ga0070664_1000272452 170
184 3300005564 Ga0070664_100398412 Ga0070664_1003984121 170
185 3300005577 Ga0068857_100022755 Ga0068857_1000227553 170
186 3300005577 Ga0068857_100055164 Ga0068857_1000551642 170
187 3300005578 Ga0068854_100000253 Ga0068854_1000002536 170
188 3300005614 Ga0068856_100000032 Ga0068856_10000003258 170
189 3300005614 Ga0068856_100161563 Ga0068856_1001615631 170
190 3300005616 Ga0068852_100015742 Ga0068852_1000157426 170
191 3300005616 Ga0068852_100078143 Ga0068852_1000781432 170
192 3300005616 Ga0068852_100276979 Ga0068852_1002769792 170
193 3300005616 Ga0068852_100629817 Ga0068852_1006298172 170
194 3300005842 Ga0068858_100796155 Ga0068858_1007961551 170
195 3300006038 Ga0075365_10029150 Ga0075365_100291503 170
196 3300006042 Ga0075368_10019756 Ga0075368_100197562 170
197 3300006048 Ga0075363_100110369 Ga0075363_1001103692 170
198 3300006051 Ga0075364_10084728 Ga0075364_100847282 170
199 3300006177 Ga0075362_10021573 Ga0075362_100215733 170
200 3300006178 Ga0075367_10017001 Ga0075367_100170012 170
201 3300006186 Ga0075369_10025355 Ga0075369_100253552 170
202 3300006186 Ga0075369_10167546 Ga0075369_101675462 170
203 3300006195 Ga0075366_10014653 Ga0075366_100146532 170
204 3300006195 Ga0075366_10018236 Ga0075366_100182363 170
205 3300006195 Ga0075366_10070966 Ga0075366_100709662 170
206 3300006195 Ga0075366_10740241 Ga0075366_107402411 170
207 3300006353 Ga0075370_10003868 Ga0075370_100038685 170
208 3300006353 Ga0075370_10014273 Ga0075370_100142733 170
209 3300006353 Ga0075370_10050713 Ga0075370_100507132 170
210 3300006353 Ga0075370_10054197 Ga0075370_100541973 170
211 3300006880 Ga0075429_100000549 Ga0075429_10000054916 170
212 3300006944 Ga0099823_1000002 Ga0099823_1000002120 170
213 3300006946 Ga0079104_1000012 Ga0079104_100001280 170
214 3300006946 Ga0079104_1000170 Ga0079104_100017062 170
215 3300006946 Ga0079104_1044618 Ga0079104_10446182 170
216 3300006948 Ga0099826_10000007 Ga0099826_1000000787 170
217 3300009011 Ga0105251_10000211 Ga0105251_1000021147 170
218 3300009011 Ga0105251_10000590 Ga0105251_1000059034 170
219 3300009011 Ga0105251_10076603 Ga0105251_100766032 170
220 3300009011 Ga0105251_10175552 Ga0105251_101755522 170
221 3300009011 Ga0105251_10246479 Ga0105251_102464792 170
222 3300009092 Ga0105250_10000214 Ga0105250_1000021413 170
223 3300009092 Ga0105250_10013006 Ga0105250_100130063 170
224 3300009092 Ga0105250_10054686 Ga0105250_100546862 170
225 3300009093 Ga0105240_10016797 Ga0105240_100167976 170
226 3300009093 Ga0105240_10029981 Ga0105240_100299816 170
227 3300009093 Ga0105240_10099364 Ga0105240_100993642 170
228 3300009093 Ga0105240_10121875 Ga0105240_101218751 170
229 3300009093 Ga0105240_10172849 Ga0105240_101728491 170
230 3300009093 Ga0105240_10226734 Ga0105240_102267342 170
231 3300009093 Ga0105240_10242884 Ga0105240_102428843 170
232 3300009093 Ga0105240_10939479 Ga0105240_109394791 170
233 3300009094 Ga0111539_11710783 Ga0111539_117107831 170
234 3300009101 Ga0105247_10317823 Ga0105247_103178232 170
235 3300009148 Ga0105243_10002697 Ga0105243_100026979 170
236 3300009148 Ga0105243_10032598 Ga0105243_100325983 170
237 3300009174 Ga0105241_10503318 Ga0105241_105033182 170
238 3300009174 Ga0105241_10661861 Ga0105241_106618612 170
239 3300009176 Ga0105242_10000638 Ga0105242_100006383 170
240 3300009177 Ga0105248_10092474 Ga0105248_100924742 170
241 3300009545 Ga0105237_10040988 Ga0105237_100409882 170
242 3300009545 Ga0105237_10095994 Ga0105237_100959942 170
243 3300009551 Ga0105238_10031527 Ga0105238_100315273 170
244 3300009551 Ga0105238_10282687 Ga0105238_102826872 170
245 3300009551 Ga0105238_10430880 Ga0105238_104308802 170
246 3300009553 Ga0105249_10128221 Ga0105249_101282212 170
247 3300009553 Ga0105249_10509432 Ga0105249_105094321 170
248 3300010375 Ga0105239_10012282 Ga0105239_100122825 170
249 3300010375 Ga0105239_10022235 Ga0105239_100222352 170
250 3300010375 Ga0105239_11172256 Ga0105239_111722562 170
251 3300011119 Ga0105246_10678738 Ga0105246_106787382 170
252 3300012497 Ga0157319_1000007 Ga0157319_100000782 170
253 3300013100 Ga0157373_10007276 Ga0157373_100072764 170
254 3300013100 Ga0157373_10083227 Ga0157373_100832273 170
255 3300013102 Ga0157371_10000106 Ga0157371_1000010681 170
256 3300013104 Ga0157370_10000062 Ga0157370_1000006273 170
257 3300013104 Ga0157370_10003076 Ga0157370_100030766 170
258 3300013104 Ga0157370_10005074 Ga0157370_100050743 170
259 3300013104 Ga0157370_11117372 Ga0157370_111173722 170
260 3300013105 Ga0157369_10001436 Ga0157369_100014366 170
261 3300013105 Ga0157369_10014753 Ga0157369_100147536 170
262 3300013105 Ga0157369_10021633 Ga0157369_100216333 170
263 3300013105 Ga0157369_10061885 Ga0157369_100618853 170
264 3300013105 Ga0157369_10224563 Ga0157369_102245631 170
265 3300013105 Ga0157369_10241322 Ga0157369_102413222 170
266 3300013105 Ga0157369_10453783 Ga0157369_104537832 170
267 3300013296 Ga0157374_10003540 Ga0157374_100035408 170
268 3300013297 Ga0157378_10321976 Ga0157378_103219762 170
269 3300013306 Ga0163162_10000587 Ga0163162_1000058728 170
270 3300013306 Ga0163162_11737185 Ga0163162_117371852 170
271 3300013307 Ga0157372_10000108 Ga0157372_1000010836 170
272 3300013307 Ga0157372_10002116 Ga0157372_1000211617 170
273 3300014325 Ga0163163_11371033 Ga0163163_113710331 170
274 3300014497 Ga0182008_10033036 Ga0182008_100330362 170
275 3300014497 Ga0182008_10103131 Ga0182008_101031312 170
276 3300014745 Ga0157377_10000006 Ga0157377_100000066 170
277 3300015261 Ga0182006_1004867 Ga0182006_10048675 170
278 3300015261 Ga0182006_1013126 Ga0182006_10131262 170
279 3300015262 Ga0182007_10000169 Ga0182007_1000016930 170
280 3300015262 Ga0182007_10123969 Ga0182007_101239692 170
281 3300016635 Ga0183361_10001 Ga0183361_10001521 170
282 3300020070 Ga0206356_11010258 Ga0206356_110102585 170
283 3300020077 Ga0206351_10205994 Ga0206351_102059942 170
284 3300020081 Ga0206354_10019202 Ga0206354_100192022 170
285 3300020610 Ga0154015_1595496 Ga0154015_15954963 170
286 3300021361 Ga0213872_10020599 Ga0213872_100205992 170
287 3300021361 Ga0213872_10321660 Ga0213872_103216601 170
288 3300025224 Ga0209784_100006 Ga0209784_100006438 170
289 3300025224 Ga0209784_100452 Ga0209784_10045213 170
290 3300025225 Ga0209566_100002 Ga0209566_100002438 170
291 3300025225 Ga0209566_100218 Ga0209566_10021833 170
292 3300025225 Ga0209566_100702 Ga0209566_1007022 170
293 3300025225 Ga0209566_101348 Ga0209566_1013482 170
294 3300025225 Ga0209566_106577 Ga0209566_1065772 170
295 3300025226 Ga0209674_100010 Ga0209674_100010699 170
296 3300025226 Ga0209674_100017 Ga0209674_100017240 170
297 3300025226 Ga0209674_100060 Ga0209674_100060133 170
298 3300025226 Ga0209674_100076 Ga0209674_100076136 170
299 3300025226 Ga0209674_100324 Ga0209674_10032421 170
300 3300025226 Ga0209674_101404 Ga0209674_1014045 170
301 3300025228 Ga0209672_100001 Ga0209672_1000012186 170
302 3300025228 Ga0209672_100041 Ga0209672_100041221 170
303 3300025228 Ga0209672_100071 Ga0209672_100071141 170
304 3300025228 Ga0209672_102120 Ga0209672_1021203 170
305 3300025229 Ga0209147_100018 Ga0209147_10001882 170
306 3300025229 Ga0209147_100022 Ga0209147_100022322 170
307 3300025229 Ga0209147_100226 Ga0209147_10022654 170
308 3300025229 Ga0209147_100401 Ga0209147_10040129 170
309 3300025230 Ga0209563_100041 Ga0209563_10004134 170
310 3300025230 Ga0209563_100740 Ga0209563_1007404 170
311 3300025231 Ga0207427_102710 Ga0207427_1027102 170
312 3300025242 Ga0209258_100028 Ga0209258_10002882 170
313 3300025242 Ga0209258_100033 Ga0209258_10003391 170
314 3300025242 Ga0209258_100309 Ga0209258_10030923 170
315 3300025242 Ga0209258_100418 Ga0209258_10041829 170
316 3300025245 Ga0207425_1002645 Ga0207425_10026455 170
317 3300025245 Ga0207425_1057356 Ga0207425_10573562 170
318 3300025246 Ga0209646_1000043 Ga0209646_100004388 170
319 3300025250 Ga0209026_1017580 Ga0209026_10175802 170
320 3300025253 Ga0209677_100007 Ga0209677_100007438 170
321 3300025253 Ga0209677_106440 Ga0209677_1064402 170
322 3300025254 Ga0209148_1000046 Ga0209148_1000046323 170
323 3300025254 Ga0209148_1000134 Ga0209148_100013429 170
324 3300025254 Ga0209148_1000162 Ga0209148_100016249 170
325 3300025254 Ga0209148_1005487 Ga0209148_10054872 170
326 3300025256 Ga0209759_1000092 Ga0209759_10000928 170
327 3300025256 Ga0209759_1000184 Ga0209759_100018474 170
328 3300025256 Ga0209759_1001030 Ga0209759_100103010 170
329 3300025256 Ga0209759_1001470 Ga0209759_10014703 170
330 3300025256 Ga0209759_1006172 Ga0209759_10061725 170
331 3300025256 Ga0209759_1011903 Ga0209759_10119033 170
332 3300025256 Ga0209759_1012277 Ga0209759_10122772 170
333 3300025258 Ga0209129_1000035 Ga0209129_1000035219 170
334 3300025261 Ga0209233_1000050 Ga0209233_1000050315 170
335 3300025263 Ga0209565_1000106 Ga0209565_100010631 170
336 3300025263 Ga0209565_1015667 Ga0209565_10156672 170
337 3300025272 Ga0209455_1000038 Ga0209455_1000038323 170
338 3300025272 Ga0209455_1000065 Ga0209455_100006582 170
339 3300025272 Ga0209455_1000315 Ga0209455_100031529 170
340 3300025272 Ga0209455_1008018 Ga0209455_10080182 170
341 3300025273 Ga0209673_1000102 Ga0209673_100010281 170
342 3300025273 Ga0209673_1007570 Ga0209673_10075702 170
343 3300025273 Ga0209673_1011280 Ga0209673_10112803 170
344 3300025273 Ga0209673_1014156 Ga0209673_10141563 170
345 3300025273 Ga0209673_1015533 Ga0209673_10155332 170
346 3300025273 Ga0209673_1022806 Ga0209673_10228062 170
347 3300025284 Ga0209130_1009929 Ga0209130_10099292 170
348 3300025291 Ga0209675_1000168 Ga0209675_10001683 170
349 3300025291 Ga0209675_1000363 Ga0209675_10003633 170
350 3300025291 Ga0209675_1006967 Ga0209675_10069673 170
351 3300025292 Ga0209676_1000036 Ga0209676_1000036168 170
352 3300025294 Ga0209025_1000110 Ga0209025_100011050 170
353 3300025294 Ga0209025_1000462 Ga0209025_10004623 170
354 3300025294 Ga0209025_1001247 Ga0209025_100124735 170
355 3300025294 Ga0209025_1006182 Ga0209025_10061828 170
356 3300025295 Ga0209564_1000024 Ga0209564_1000024413 170
357 3300025295 Ga0209564_1000030 Ga0209564_1000030153 170
358 3300025295 Ga0209564_1001348 Ga0209564_100134826 170
359 3300025295 Ga0209564_1003869 Ga0209564_10038693 170
360 3300025295 Ga0209564_1005611 Ga0209564_10056113 170
361 3300025295 Ga0209564_1006456 Ga0209564_10064565 170
362 3300025295 Ga0209564_1009644 Ga0209564_10096443 170
363 3300025297 Ga0209758_1000066 Ga0209758_100006699 170
364 3300025297 Ga0209758_1000248 Ga0209758_100024867 170
365 3300025298 Ga0209050_1000556 Ga0209050_100055654 170
366 3300025298 Ga0209050_1000614 Ga0209050_100061441 170
367 3300025298 Ga0209050_1008170 Ga0209050_10081704 170
368 3300025298 Ga0209050_1008250 Ga0209050_10082502 170
369 3300025299 Ga0209256_1000030 Ga0209256_1000030235 170
370 3300025299 Ga0209256_1000197 Ga0209256_10001979 170
371 3300025299 Ga0209256_1000220 Ga0209256_100022068 170
372 3300025299 Ga0209256_1000469 Ga0209256_100046912 170
373 3300025299 Ga0209256_1003387 Ga0209256_10033878 170
374 3300025299 Ga0209256_1021865 Ga0209256_10218652 170
375 3300025302 Ga0207426_1000007 Ga0207426_1000007559 170
376 3300025302 Ga0207426_1002079 Ga0207426_10020795 170
377 3300025303 Ga0209051_1000004 Ga0209051_1000004654 170
378 3300025303 Ga0209051_1002061 Ga0209051_100206113 170
379 3300025303 Ga0209051_1003541 Ga0209051_10035411 170
380 3300025303 Ga0209051_1024073 Ga0209051_10240732 170
381 3300025304 Ga0209257_1000063 Ga0209257_1000063140 170
382 3300025304 Ga0209257_1002434 Ga0209257_10024343 170
383 3300025304 Ga0209257_1004130 Ga0209257_10041309 170
384 3300025304 Ga0209257_1031974 Ga0209257_10319742 170
385 3300025711 Ga0207696_1026972 Ga0207696_10269722 170
386 3300025735 Ga0207713_1000137 Ga0207713_100013763 170
387 3300025735 Ga0207713_1049881 Ga0207713_10498812 170
388 3300025735 Ga0207713_1108016 Ga0207713_11080162 170
389 3300025735 Ga0207713_1150573 Ga0207713_11505731 170
390 3300025903 Ga0207680_10084046 Ga0207680_100840462 170
391 3300025903 Ga0207680_10168249 Ga0207680_101682492 170
392 3300025903 Ga0207680_10374127 Ga0207680_103741272 170
393 3300025904 Ga0207647_10000216 Ga0207647_1000021644 170
394 3300025904 Ga0207647_10004229 Ga0207647_100042291 170
395 3300025904 Ga0207647_10011182 Ga0207647_100111825 170
396 3300025904 Ga0207647_10021006 Ga0207647_100210062 170
397 3300025904 Ga0207647_10089085 Ga0207647_100890851 170
398 3300025904 Ga0207647_10229705 Ga0207647_102297052 170
399 3300025909 Ga0207705_10005161 Ga0207705_100051612 170
400 3300025909 Ga0207705_10037796 Ga0207705_100377962 170
401 3300025909 Ga0207705_10320970 Ga0207705_103209702 170
402 3300025910 Ga0207684_10065777 Ga0207684_100657772 170
403 3300025911 Ga0207654_10266819 Ga0207654_102668192 170
404 3300025911 Ga0207654_10749404 Ga0207654_107494041 170
405 3300025913 Ga0207695_10019161 Ga0207695_100191614 170
406 3300025913 Ga0207695_10035571 Ga0207695_100355714 170
407 3300025913 Ga0207695_10062843 Ga0207695_100628433 170
408 3300025913 Ga0207695_10226377 Ga0207695_102263772 170
409 3300025913 Ga0207695_10265284 Ga0207695_102652842 170
410 3300025913 Ga0207695_10692617 Ga0207695_106926172 170
411 3300025914 Ga0207671_10059265 Ga0207671_100592652 170
412 3300025914 Ga0207671_10395458 Ga0207671_103954582 170
413 3300025919 Ga0207657_10000044 Ga0207657_1000004432 170
414 3300025919 Ga0207657_10009206 Ga0207657_100092069 170
415 3300025919 Ga0207657_10206367 Ga0207657_102063672 170
416 3300025919 Ga0207657_10622836 Ga0207657_106228361 170
417 3300025920 Ga0207649_10000636 Ga0207649_1000063612 170
418 3300025920 Ga0207649_10007131 Ga0207649_100071315 170
419 3300025920 Ga0207649_10028729 Ga0207649_100287292 170
420 3300025920 Ga0207649_10148298 Ga0207649_101482982 170
421 3300025922 Ga0207646_10025442 Ga0207646_100254424 170
422 3300025923 Ga0207681_10046278 Ga0207681_100462782 170
423 3300025924 Ga0207694_10004421 Ga0207694_100044212 170
424 3300025924 Ga0207694_10363183 Ga0207694_103631832 170
425 3300025924 Ga0207694_10428874 Ga0207694_104288742 170
426 3300025925 Ga0207650_10255989 Ga0207650_102559892 170
427 3300025926 Ga0207659_10171436 Ga0207659_101714362 170
428 3300025931 Ga0207644_10666691 Ga0207644_106666911 170
429 3300025932 Ga0207690_10000046 Ga0207690_1000004632 170
430 3300025932 Ga0207690_10001085 Ga0207690_1000108510 170
431 3300025932 Ga0207690_10002717 Ga0207690_100027177 170
432 3300025933 Ga0207706_10183589 Ga0207706_101835892 170
433 3300025934 Ga0207686_10006359 Ga0207686_100063593 170
434 3300025935 Ga0207709_10000599 Ga0207709_100005997 170
435 3300025941 Ga0207711_10036836 Ga0207711_100368363 170
436 3300025944 Ga0207661_11066830 Ga0207661_110668301 170
437 3300025945 Ga0207679_10000012 Ga0207679_1000001281 170
438 3300025945 Ga0207679_10000107 Ga0207679_1000010712 170
439 3300025945 Ga0207679_10103628 Ga0207679_101036282 170
440 3300025945 Ga0207679_10147977 Ga0207679_101479772 170
441 3300025949 Ga0207667_10003134 Ga0207667_1000313421 170
442 3300025949 Ga0207667_10012254 Ga0207667_100122547 170
443 3300025949 Ga0207667_10034287 Ga0207667_100342872 170
444 3300025949 Ga0207667_10116761 Ga0207667_101167612 170
445 3300025961 Ga0207712_10324177 Ga0207712_103241771 170
446 3300025972 Ga0207668_10098962 Ga0207668_100989622 170
447 3300025981 Ga0207640_10000012 Ga0207640_10000012179 170
448 3300025986 Ga0207658_10046242 Ga0207658_100462422 170
449 3300025986 Ga0207658_10096082 Ga0207658_100960822 170
450 3300026035 Ga0207703_10523097 Ga0207703_105230971 170
451 3300026041 Ga0207639_10170680 Ga0207639_101706802 170
452 3300026041 Ga0207639_10443322 Ga0207639_104433221 170
453 3300026067 Ga0207678_10000009 Ga0207678_1000000958 170
454 3300026067 Ga0207678_10000286 Ga0207678_1000028641 170
455 3300026067 Ga0207678_10003470 Ga0207678_1000347012 170
456 3300026067 Ga0207678_10094921 Ga0207678_100949212 170
457 3300026067 Ga0207678_10133310 Ga0207678_101333102 170
458 3300026067 Ga0207678_10180375 Ga0207678_101803752 170
459 3300026078 Ga0207702_10000028 Ga0207702_1000002881 170
460 3300026088 Ga0207641_10417029 Ga0207641_104170292 170
461 3300026089 Ga0207648_10000039 Ga0207648_1000003958 170
462 3300026116 Ga0207674_10012807 Ga0207674_100128075 170
463 3300026121 Ga0207683_10467220 Ga0207683_104672201 170
464 3300026142 Ga0207698_10028878 Ga0207698_100288783 170
465 3300026142 Ga0207698_10044239 Ga0207698_100442393 170
466 3300027111 Ga0209281_1000039 Ga0209281_1000039246 170
467 3300027111 Ga0209281_1000072 Ga0209281_1000072195 170
468 3300027111 Ga0209281_1032752 Ga0209281_10327522 170
469 3300027296 Ga0209389_1004640 Ga0209389_10046401 170
470 3300027312 Ga0209371_1000145 Ga0209371_100014574 170
471 3300027312 Ga0209371_1003991 Ga0209371_10039916 170
472 3300027312 Ga0209371_1005262 Ga0209371_10052622 170
473 3300027666 Ga0209282_1000061 Ga0209282_100006196 170
474 3300027876 Ga0209974_10001718 Ga0209974_100017186 170
475 3300028380 Ga0268265_10576516 Ga0268265_105765161 170
476 3300028786 Ga0307517_10003885 Ga0307517_1000388521 170
477 3300028786 Ga0307517_10182552 Ga0307517_101825522 170
478 3300028786 Ga0307517_10425588 Ga0307517_104255882 170
479 3300028794 Ga0307515_10000013 Ga0307515_10000013513 170
480 3300028794 Ga0307515_10000179 Ga0307515_10000179126 170
481 3300028794 Ga0307515_10000239 Ga0307515_10000239112 170
482 3300028794 Ga0307515_10001166 Ga0307515_1000116626 170
483 3300028794 Ga0307515_10019026 Ga0307515_1001902611 170
484 3300028794 Ga0307515_10049706 Ga0307515_100497065 170
485 3300028794 Ga0307515_10140165 Ga0307515_101401652 170
486 3300028800 Ga0265338_10000087 Ga0265338_1000008724 170
487 3300030500 Ga0268256_1000128 Ga0268256_100012835 170
488 3300030500 Ga0268256_1003719 Ga0268256_10037192 170
489 3300030500 Ga0268256_1006515 Ga0268256_10065154 170
490 3300031239 Ga0265328_10005564 Ga0265328_100055646 170
491 3300031239 Ga0265328_10083473 Ga0265328_100834732 170
492 3300031241 Ga0265325_10017793 Ga0265325_100177932 170
493 3300031247 Ga0265340_10037151 Ga0265340_100371512 170
494 3300031251 Ga0265327_10000147 Ga0265327_10000147124 170
495 3300031456 Ga0307513_10025671 Ga0307513_100256712 170
496 3300031456 Ga0307513_10031954 Ga0307513_100319543 170
497 3300031456 Ga0307513_10137233 Ga0307513_101372332 170
498 3300031507 Ga0307509_10095836 Ga0307509_100958362 170
499 3300031507 Ga0307509_10147894 Ga0307509_101478941 170
500 3300031507 Ga0307509_10170107 Ga0307509_101701072 170
501 3300031548 Ga0307408_100000298 Ga0307408_10000029844 170
502 3300031548 Ga0307408_100002033 Ga0307408_1000020339 170
503 3300031548 Ga0307408_100542698 Ga0307408_1005426982 170
504 3300031616 Ga0307508_10000048 Ga0307508_1000004835 170
505 3300031616 Ga0307508_10000122 Ga0307508_1000012268 170
506 3300031616 Ga0307508_10010633 Ga0307508_100106336 170
507 3300031649 Ga0307514_10000595 Ga0307514_1000059520 170
508 3300031649 Ga0307514_10022005 Ga0307514_100220055 170
509 3300031649 Ga0307514_10026307 Ga0307514_100263073 170
510 3300031649 Ga0307514_10140682 Ga0307514_101406822 170
511 3300031649 Ga0307514_10300458 Ga0307514_103004582 170
512 3300031730 Ga0307516_10000723 Ga0307516_100007238 170
513 3300031730 Ga0307516_10002560 Ga0307516_100025602 170
514 3300031730 Ga0307516_10005879 Ga0307516_1000587914 170
515 3300031730 Ga0307516_10051506 Ga0307516_100515062 170
516 3300031730 Ga0307516_10331408 Ga0307516_103314082 170
517 3300031730 Ga0307516_10539279 Ga0307516_105392792 170
518 3300031730 Ga0307516_10661095 Ga0307516_106610952 170
519 3300031731 Ga0307405_10006050 Ga0307405_100060503 170
520 3300031731 Ga0307405_10270003 Ga0307405_102700032 170
521 3300031731 Ga0307405_10614616 Ga0307405_106146162 170
522 3300031852 Ga0307410_10115502 Ga0307410_101155022 170
523 3300031901 Ga0307406_10006328 Ga0307406_100063285 170
524 3300031911 Ga0307412_10000011 Ga0307412_10000011311 170
525 3300031911 Ga0307412_10203691 Ga0307412_102036912 170
526 3300031911 Ga0307412_10472554 Ga0307412_104725542 170
527 3300031995 Ga0307409_100006395 Ga0307409_1000063956 170
528 3300032002 Ga0307416_100046596 Ga0307416_1000465962 170
529 3300032005 Ga0307411_10087012 Ga0307411_100870122 170
530 3300032005 Ga0307411_11391360 Ga0307411_113913602 170
531 3300033179 Ga0307507_10014209 Ga0307507_100142093 170
532 3300033180 Ga0307510_10173162 Ga0307510_101731621 170
533 3300034957 Ga0373938_0040706 Ga0373938_0040706_188_709 170
534 3300035084 Ga0373928_0054127 Ga0373928_0054127_364_891 170
535 3300035691 Ga0373931_0008015 Ga0373931_0008015_983_1510 170
536 3300035695 Ga0373927_0258380 Ga0373927_0258380_58_579 170
537 3300037312 Ga0395899_0000421 Ga0395899_0000421_29418_29930 170
538 3300037312 Ga0395899_0003093 Ga0395899_0003093_267_779 170
539 3300037312 Ga0395899_0178662 Ga0395899_0178662_320_832 170
540 3300037418 Ga0395900_0000159 Ga0395900_0000159_81557_82069 170
541 3300037418 Ga0395900_0000445 Ga0395900_0000445_23929_24441 170
542 3300037418 Ga0395900_0011343 Ga0395900_0011343_7404_7916 170
543 3300037418 Ga0395900_0051796 Ga0395900_0051796_1937_2449 170
544 3300037418 Ga0395900_0089267 Ga0395900_0089267_644_1156 170
545 3300037418 Ga0395900_0102691 Ga0395900_0102691_1041_1553 170
546 3300037466 Ga0395898_0000425 Ga0395898_0000425_7700_8212 170
547 3300037466 Ga0395898_0002174 Ga0395898_0002174_7798_8310 170
548 3300037466 Ga0395898_0005757 Ga0395898_0005757_5998_6510 170
549 3300037466 Ga0395898_0045538 Ga0395898_0045538_2026_2538 170
550 3300037466 Ga0395898_0610299 Ga0395898_0610299_299_820 170
551 3300037466 Ga0395898_1217434 Ga0395898_1217434_35_667 170
552 3300037471 Ga0395905_0000079 Ga0395905_0000079_22170_22682 170
553 3300037471 Ga0395905_0016607 Ga0395905_0016607_4429_4950 170
554 3300037471 Ga0395905_0016928 Ga0395905_0016928_4684_5196 170
555 3300037471 Ga0395905_0032505 Ga0395905_0032505_2521_3042 170
556 3300037471 Ga0395905_0054569 Ga0395905_0054569_2935_3456 170
557 3300038443 Ga0395901_0000017 Ga0395901_0000017_195998_196510 170
558 3300038443 Ga0395901_0000109 Ga0395901_0000109_27025_27537 170
559 3300038443 Ga0395901_0009637 Ga0395901_0009637_7726_8238 170
560 3300038443 Ga0395901_0065312 Ga0395901_0065312_1807_2319 170
561 3300039437 Ga0436365_0055475 Ga0436365_0055475_32_544 170
562 3300039438 Ga0436360_1271525 Ga0436360_1271525_979_1491 170
563 3300039447 Ga0436361_0276814 Ga0436361_0276814_430_942 170
564 3300039447 Ga0436361_0357138 Ga0436361_0357138_36_548 170
565 3300039447 Ga0436361_0474915 Ga0436361_0474915_3668_4180 170
566 3300041404 Ga0439436_0124971 Ga0439436_0124971_93_605 170
567 3300041413 Ga0439465_0058776 Ga0439465_0058776_153_674 170
568 3300041459 Ga0451800_1689085 Ga0451800_1689085_139_657 170
569 3300041486 Ga0451807_1399310 Ga0451807_1399310_108_629 170
570 3300041486 Ga0451807_2771500 Ga0451807_2771500_245_763 170
571 3300041496 Ga0451839_1646275 Ga0451839_1646275_83_601 170
572 3300041498 Ga0451841_0602513 Ga0451841_0602513_268_786 170
573 3300041512 Ga0451853_3184930 Ga0451853_3184930_579_1097 170
574 3300041997 Ga0439431_0009103 Ga0439431_0009103_1550_2071 170
575 3300042005 Ga0439448_0000197 Ga0439448_0000197_8734_9246 170
576 3300042118 Ga0450914_019216 Ga0450914_019216_123_641 170
577 3300042121 Ga0450919_000557 Ga0450919_000557_1228_1746 170
578 3300042126 Ga0450888_015827 Ga0450888_015827_70_591 170
579 3300042157 Ga0439458_0060548 Ga0439458_0060548_187_705 170
580 3300042438 Ga0439459_0001457 Ga0439459_0001457_2160_2681 170
581 3300042531 Ga0450918_000035 Ga0450918_000035_23393_23911 170
582 3300042876 Ga0451577_0002691 Ga0451577_0002691_18661_19182 170
583 3300042876 Ga0451577_0011641 Ga0451577_0011641_1547_2068 170
584 3300042876 Ga0451577_0021420 Ga0451577_0021420_3618_4139 170
585 3300042876 Ga0451577_0051158 Ga0451577_0051158_830_1351 170
586 3300042876 Ga0451577_0206362 Ga0451577_0206362_942_1463 170
587 3300042876 Ga0451577_0267325 Ga0451577_0267325_545_1111 170
588 3300042876 Ga0451577_0363728 Ga0451577_0363728_86_604 170
589 3300042876 Ga0451577_0494385 Ga0451577_0494385_295_813 170
590 3300044656 Ga0466969_0000493 Ga0466969_0000493_16923_17435 170
591 3300044656 Ga0466969_0037388 Ga0466969_0037388_1788_2300 170
592 3300044656 Ga0466969_0049749 Ga0466969_0049749_865_1377 170
593 3300044656 Ga0466969_0160165 Ga0466969_0160165_130_642 170
594 3300044656 Ga0466969_0189302 Ga0466969_0189302_318_830 170
595 3300044658 Ga0466972_0103660 Ga0466972_0103660_786_1298 170
596 3300044658 Ga0466972_0142132 Ga0466972_0142132_18_539 170
597 3300044659 Ga0466973_0089504 Ga0466973_0089504_1899_2411 170
598 3300044666 Ga0466977_0000673 Ga0466977_0000673_4098_4610 170
599 3300044671 Ga0466978_0016741 Ga0466978_0016741_393_905 170
600 3300044671 Ga0466978_0448168 Ga0466978_0448168_82_594 170
601 3300044673 Ga0453683_0321818 Ga0453683_0321818_404_925 170
602 3300044673 Ga0453683_0660378 Ga0453683_0660378_132_653 170
603 3300044673 Ga0453683_0667859 Ga0453683_0667859_28_549 170
604 3300044683 Ga0466965_0003295 Ga0466965_0003295_464_976 170
605 3300044683 Ga0466965_0004833 Ga0466965_0004833_4898_5410 170
606 3300044683 Ga0466965_0096356 Ga0466965_0096356_240_752 170
607 3300044683 Ga0466965_0286824 Ga0466965_0286824_181_693 170
608 3300044684 Ga0466966_0000431 Ga0466966_0000431_4548_5060 170
609 3300044684 Ga0466966_0006383 Ga0466966_0006383_2896_3408 170
610 3300044684 Ga0466966_0013580 Ga0466966_0013580_3091_3603 170
611 3300044684 Ga0466966_0278330 Ga0466966_0278330_384_896 170
612 3300044693 Ga0466961_0000698 Ga0466961_0000698_5454_5966 170
613 3300044693 Ga0466961_0001496 Ga0466961_0001496_11905_12417 170
614 3300044693 Ga0466961_0038919 Ga0466961_0038919_1761_2273 170
615 3300044693 Ga0466961_0044697 Ga0466961_0044697_143_655 170
616 3300044693 Ga0466961_0049456 Ga0466961_0049456_1230_1742 170
617 3300044693 Ga0466961_0175587 Ga0466961_0175587_697_1209 170
618 3300044693 Ga0466961_0180486 Ga0466961_0180486_530_1042 170
619 3300044694 Ga0466963_0014335 Ga0466963_0014335_2939_3451 170
620 3300044694 Ga0466963_0028670 Ga0466963_0028670_1928_2440 170
621 3300044694 Ga0466963_0050273 Ga0466963_0050273_1800_2312 170
622 3300044694 Ga0466963_0335880 Ga0466963_0335880_410_922 170
623 3300044706 Ga0466964_0047790 Ga0466964_0047790_688_1200 170
624 3300044712 Ga0453684_0000222 Ga0453684_0000222_7481_8002 170
625 3300044712 Ga0453684_0000659 Ga0453684_0000659_7461_7982 170
626 3300044712 Ga0453684_0001598 Ga0453684_0001598_36909_37430 170
627 3300044712 Ga0453684_0143536 Ga0453684_0143536_1876_2397 170
628 3300044712 Ga0453684_0163016 Ga0453684_0163016_1326_1847 170
629 3300044719 Ga0466971_0001521 Ga0466971_0001521_5572_6084 170
630 3300044719 Ga0466971_0007298 Ga0466971_0007298_1732_2244 170
631 3300044719 Ga0466971_0031567 Ga0466971_0031567_509_1021 170
632 3300044719 Ga0466971_0131728 Ga0466971_0131728_502_1014 170
633 3300044735 Ga0466968_0062191 Ga0466968_0062191_815_1327 170
634 3300044765 Ga0466970_0122243 Ga0466970_0122243_392_904 170
635 3300044765 Ga0466970_0305069 Ga0466970_0305069_78_590 170
636 3300044842 Ga0466957_0037134 Ga0466957_0037134_607_1119 170
637 3300044842 Ga0466957_0039769 Ga0466957_0039769_458_970 170
638 3300044842 Ga0466957_0090802 Ga0466957_0090802_910_1422 170
639 3300044842 Ga0466957_0339861 Ga0466957_0339861_366_878 170
640 3300044842 Ga0466957_0359606 Ga0466957_0359606_113_625 170
641 3300044842 Ga0466957_0554382 Ga0466957_0554382_193_705 170
642 3300045049 Ga0466959_0001907 Ga0466959_0001907_12088_12600 170
643 3300045049 Ga0466959_0012308 Ga0466959_0012308_3185_3697 170
644 3300045049 Ga0466959_0017092 Ga0466959_0017092_1044_1556 170
645 3300045049 Ga0466959_0063301 Ga0466959_0063301_1471_1983 170
646 3300045049 Ga0466959_0318101 Ga0466959_0318101_170_682 170
647 3300045051 Ga0451576_0000169 Ga0451576_0000169_1235_1756 170
648 3300045051 Ga0451576_0143833 Ga0451576_0143833_11_532 170
649 3300045051 Ga0451576_0206374 Ga0451576_0206374_903_1430 170
650 3300045051 Ga0451576_0502204 Ga0451576_0502204_369_890 170
651 3300045051 Ga0451576_1030071 Ga0451576_1030071_185_700 170
652 3300045836 Ga0466958_0007430 Ga0466958_0007430_1718_2230 170
653 3300045836 Ga0466958_0015060 Ga0466958_0015060_3711_4223 170
654 3300045836 Ga0466958_0134903 Ga0466958_0134903_355_867 170
655 3300045836 Ga0466958_0168946 Ga0466958_0168946_515_1027 170
656 3300045976 Ga0466967_0146710 Ga0466967_0146710_327_839 170
657 3300046454 Ga0495592_0050852 Ga0495592_0050852_1173_1685 170
658 3300046454 Ga0495592_0067818 Ga0495592_0067818_1821_2333 170
659 3300046454 Ga0495592_0089242 Ga0495592_0089242_1196_1708 170
660 3300046455 Ga0495603_0009839 Ga0495603_0009839_2163_2675 170
661 3300046455 Ga0495603_0017889 Ga0495603_0017889_429_941 170
662 3300046455 Ga0495603_0126336 Ga0495603_0126336_580_1092 170
663 3300046457 Ga0495590_0004166 Ga0495590_0004166_482_994 170
664 3300046457 Ga0495590_0008265 Ga0495590_0008265_2032_2553 170
665 3300046457 Ga0495590_0012809 Ga0495590_0012809_1832_2344 170
666 3300046457 Ga0495590_0021061 Ga0495590_0021061_419_931 170
667 3300046459 Ga0495629_0000350 Ga0495629_0000350_27859_28371 170
668 3300046459 Ga0495629_0000676 Ga0495629_0000676_12470_12982 170
669 3300046459 Ga0495629_0001209 Ga0495629_0001209_14184_14696 170
670 3300046459 Ga0495629_0011325 Ga0495629_0011325_5591_6103 170
671 3300046459 Ga0495629_0117026 Ga0495629_0117026_1300_1812 170
672 3300046459 Ga0495629_0323723 Ga0495629_0323723_82_594 170
673 3300046459 Ga0495629_0398243 Ga0495629_0398243_200_721 170
674 3300046460 Ga0495638_0012433 Ga0495638_0012433_4712_5224 170
675 3300046460 Ga0495638_0073743 Ga0495638_0073743_462_974 170
676 3300046461 Ga0495641_0018783 Ga0495641_0018783_970_1482 170
677 3300046461 Ga0495641_0048066 Ga0495641_0048066_1053_1565 170
678 3300046462 Ga0495651_0018210 Ga0495651_0018210_4530_5042 170
679 3300046462 Ga0495651_0091459 Ga0495651_0091459_1186_1698 170
680 3300046463 Ga0495653_0013167 Ga0495653_0013167_527_1039 170
681 3300046463 Ga0495653_0026233 Ga0495653_0026233_600_1112 170
682 3300046463 Ga0495653_0075356 Ga0495653_0075356_1524_2036 170
683 3300046463 Ga0495653_0085820 Ga0495653_0085820_954_1466 170
684 3300046471 Ga0495650_0003448 Ga0495650_0003448_82_594 170
685 3300046471 Ga0495650_0009266 Ga0495650_0009266_4933_5445 170
686 3300046471 Ga0495650_0023967 Ga0495650_0023967_2140_2652 170
687 3300046471 Ga0495650_0025851 Ga0495650_0025851_1150_1662 170
688 3300046471 Ga0495650_0028449 Ga0495650_0028449_398_910 170
689 3300046471 Ga0495650_0033224 Ga0495650_0033224_160_681 170
690 3300046471 Ga0495650_0041177 Ga0495650_0041177_955_1467 170
691 3300046472 Ga0495580_0000001 Ga0495580_0000001_55159_55671 170
692 3300046472 Ga0495580_0009533 Ga0495580_0009533_4108_4620 170
693 3300046472 Ga0495580_0019500 Ga0495580_0019500_4130_4642 170
694 3300046472 Ga0495580_0030923 Ga0495580_0030923_914_1426 170
695 3300046472 Ga0495580_0099457 Ga0495580_0099457_1163_1675 170
696 3300046472 Ga0495580_0120524 Ga0495580_0120524_910_1422 170
697 3300046472 Ga0495580_0225977 Ga0495580_0225977_246_758 170
698 3300046472 Ga0495580_0275515 Ga0495580_0275515_595_1107 170
699 3300046472 Ga0495580_0334625 Ga0495580_0334625_504_1016 170
700 3300046473 Ga0495582_0002692 Ga0495582_0002692_8285_8797 170
701 3300046473 Ga0495582_0012374 Ga0495582_0012374_3806_4318 170
702 3300046474 Ga0495605_0011540 Ga0495605_0011540_2761_3273 170
703 3300046474 Ga0495605_0013340 Ga0495605_0013340_2046_2558 170
704 3300046474 Ga0495605_0028772 Ga0495605_0028772_1648_2160 170
705 3300046474 Ga0495605_0043489 Ga0495605_0043489_488_1000 170
706 3300046474 Ga0495605_0138791 Ga0495605_0138791_204_716 170
707 3300046474 Ga0495605_0258373 Ga0495605_0258373_206_718 170
708 3300046476 Ga0495662_0025265 Ga0495662_0025265_582_1094 170
709 3300046477 Ga0495664_0002647 Ga0495664_0002647_2306_2818 170
710 3300046477 Ga0495664_0016595 Ga0495664_0016595_2207_2719 170
711 3300046477 Ga0495664_0082556 Ga0495664_0082556_258_770 170
712 3300046477 Ga0495664_0127317 Ga0495664_0127317_836_1348 170
713 3300046477 Ga0495664_0148094 Ga0495664_0148094_499_1011 170
714 3300046477 Ga0495664_0181461 Ga0495664_0181461_213_725 170
715 3300046477 Ga0495664_0370809 Ga0495664_0370809_218_730 170
716 3300046491 Ga0495584_0028382 Ga0495584_0028382_1847_2359 170
717 3300046492 Ga0495585_0024408 Ga0495585_0024408_2069_2593 170
718 3300046492 Ga0495585_0073044 Ga0495585_0073044_1172_1684 170
719 3300046499 Ga0495594_0053840 Ga0495594_0053840_1192_1704 170
720 3300046500 Ga0495596_0022238 Ga0495596_0022238_241_753 170
721 3300046500 Ga0495596_0025511 Ga0495596_0025511_1488_2000 170
722 3300046500 Ga0495596_0031853 Ga0495596_0031853_1323_1835 170
723 3300046500 Ga0495596_0051645 Ga0495596_0051645_125_637 170
724 3300046501 Ga0495607_0000044 Ga0495607_0000044_51824_52372 170
725 3300046501 Ga0495607_0058822 Ga0495607_0058822_308_820 170
726 3300046506 Ga0495583_0011505 Ga0495583_0011505_4541_5053 170
727 3300046506 Ga0495583_0097030 Ga0495583_0097030_583_1104 170
728 3300046506 Ga0495583_0131706 Ga0495583_0131706_306_818 170
729 3300046507 Ga0495606_0016268 Ga0495606_0016268_1873_2385 170
730 3300046507 Ga0495606_0020827 Ga0495606_0020827_3554_4066 170
731 3300046507 Ga0495606_0058889 Ga0495606_0058889_1858_2370 170
732 3300046507 Ga0495606_0072777 Ga0495606_0072777_186_698 170
733 3300046507 Ga0495606_0093316 Ga0495606_0093316_982_1494 170
734 3300046507 Ga0495606_0101390 Ga0495606_0101390_98_610 170
735 3300046507 Ga0495606_0241107 Ga0495606_0241107_107_631 170
736 3300046507 Ga0495606_0377099 Ga0495606_0377099_89_601 170
737 3300046511 Ga0495608_0062016 Ga0495608_0062016_1682_2194 170
738 3300046511 Ga0495608_0194132 Ga0495608_0194132_81_593 170
739 3300046511 Ga0495608_0194515 Ga0495608_0194515_59_571 170
740 3300046512 Ga0495610_0030270 Ga0495610_0030270_568_1080 170
741 3300046512 Ga0495610_0049719 Ga0495610_0049719_1242_1754 170
742 3300046512 Ga0495610_0057701 Ga0495610_0057701_257_778 170
743 3300046512 Ga0495610_0125608 Ga0495610_0125608_70_591 170
744 3300046512 Ga0495610_0135091 Ga0495610_0135091_314_832 170
745 3300046513 Ga0495616_0007919 Ga0495616_0007919_752_1264 170
746 3300046514 Ga0495618_0003677 Ga0495618_0003677_4489_5001 170
747 3300046514 Ga0495618_0054176 Ga0495618_0054176_235_747 170
748 3300046514 Ga0495618_0368817 Ga0495618_0368817_312_824 170
749 3300046515 Ga0495620_0015323 Ga0495620_0015323_323_835 170
750 3300046515 Ga0495620_0020708 Ga0495620_0020708_1835_2347 170
751 3300046515 Ga0495620_0065208 Ga0495620_0065208_244_756 170
752 3300046516 Ga0495628_0000262 Ga0495628_0000262_42891_43403 170
753 3300046516 Ga0495628_0023102 Ga0495628_0023102_4196_4708 170
754 3300046516 Ga0495628_0026203 Ga0495628_0026203_2546_3058 170
755 3300046516 Ga0495628_0046943 Ga0495628_0046943_1721_2233 170
756 3300046516 Ga0495628_0351805 Ga0495628_0351805_226_738 170
757 3300046517 Ga0495630_0004146 Ga0495630_0004146_4399_4911 170
758 3300046517 Ga0495630_0049487 Ga0495630_0049487_1370_1882 170
759 3300046517 Ga0495630_0057140 Ga0495630_0057140_2044_2556 170
760 3300046517 Ga0495630_0063604 Ga0495630_0063604_370_882 170
761 3300046518 Ga0495631_0085976 Ga0495631_0085976_141_662 170
762 3300046519 Ga0495632_0005415 Ga0495632_0005415_1316_1837 170
763 3300046519 Ga0495632_0021619 Ga0495632_0021619_2003_2521 170
764 3300046522 Ga0495643_0192830 Ga0495643_0192830_70_582 170
765 3300046522 Ga0495643_0239942 Ga0495643_0239942_225_737 170
766 3300046523 Ga0495644_0125517 Ga0495644_0125517_354_866 170
767 3300046524 Ga0495648_0012471 Ga0495648_0012471_5642_6154 170
768 3300046524 Ga0495648_0012802 Ga0495648_0012802_1724_2236 170
769 3300046524 Ga0495648_0019099 Ga0495648_0019099_3756_4268 170
770 3300046524 Ga0495648_0095490 Ga0495648_0095490_324_845 170
771 3300046526 Ga0495666_0004161 Ga0495666_0004161_323_835 170
772 3300046526 Ga0495666_0006932 Ga0495666_0006932_4922_5434 170
773 3300046526 Ga0495666_0010532 Ga0495666_0010532_997_1509 170
774 3300046528 Ga0495642_0043013 Ga0495642_0043013_438_950 170
775 3300046528 Ga0495642_0052150 Ga0495642_0052150_248_760 170
776 3300046528 Ga0495642_0067527 Ga0495642_0067527_922_1443 170
777 3300046528 Ga0495642_0129195 Ga0495642_0129195_40_561 170
778 3300046528 Ga0495642_0136903 Ga0495642_0136903_437_949 170
779 3300046529 Ga0495652_0017575 Ga0495652_0017575_4711_5223 170
780 3300046529 Ga0495652_0023307 Ga0495652_0023307_980_1492 170
781 3300046529 Ga0495652_0025263 Ga0495652_0025263_180_692 170
782 3300046529 Ga0495652_0060455 Ga0495652_0060455_1263_1775 170
783 3300046530 Ga0495654_0043090 Ga0495654_0043090_247_759 170
784 3300046530 Ga0495654_0180336 Ga0495654_0180336_316_828 170
785 3300046531 Ga0495665_0003952 Ga0495665_0003952_7292_7804 170
786 3300046531 Ga0495665_0011526 Ga0495665_0011526_1174_1686 170
787 3300046531 Ga0495665_0013158 Ga0495665_0013158_482_994 170
788 3300046531 Ga0495665_0014545 Ga0495665_0014545_511_1023 170
789 3300046531 Ga0495665_0027170 Ga0495665_0027170_287_799 170
790 3300046533 Ga0495640_0005464 Ga0495640_0005464_3414_3926 170
791 3300046533 Ga0495640_0026890 Ga0495640_0026890_224_736 170
792 3300046533 Ga0495640_0047455 Ga0495640_0047455_260_772 170
793 3300046535 Ga0495586_0001325 Ga0495586_0001325_8378_8890 170
794 3300046536 Ga0495587_0043356 Ga0495587_0043356_650_1162 170
795 3300046538 Ga0495609_0032863 Ga0495609_0032863_1485_1997 170
796 3300046542 Ga0495597_0003643 Ga0495597_0003643_1389_1910 170
797 3300046542 Ga0495597_0030019 Ga0495597_0030019_193_705 170
798 3300046542 Ga0495597_0242185 Ga0495597_0242185_37_549 170
799 3300046543 Ga0495645_0003095 Ga0495645_0003095_5945_6457 170
800 3300046543 Ga0495645_0034987 Ga0495645_0034987_1268_1780 170
801 3300046543 Ga0495645_0050757 Ga0495645_0050757_1126_1638 170
802 3300046543 Ga0495645_0082140 Ga0495645_0082140_1286_1798 170
803 3300046557 Ga0495622_0000323 Ga0495622_0000323_15101_15613 170
804 3300046557 Ga0495622_0072903 Ga0495622_0072903_319_831 170
805 3300046559 Ga0495667_0091605 Ga0495667_0091605_498_1010 170
806 3300046559 Ga0495667_0306212 Ga0495667_0306212_427_939 170
807 3300046616 Ga0495668_0579891 Ga0495668_0579891_26_547 170
808 3300046642 Ga0495634_0012324 Ga0495634_0012324_1268_1780 170
809 3300046642 Ga0495634_0017115 Ga0495634_0017115_1454_1966 170
810 3300046642 Ga0495634_0021353 Ga0495634_0021353_3579_4091 170
811 3300046642 Ga0495634_0123088 Ga0495634_0123088_149_661 170
812 3300046648 Ga0495611_0026094 Ga0495611_0026094_1379_1891 170
813 3300046648 Ga0495611_0055137 Ga0495611_0055137_630_1151 170
814 3300046660 Ga0495625_0006884 Ga0495625_0006884_8086_8604 170
815 3300046660 Ga0495625_0118480 Ga0495625_0118480_1205_1726 170
816 3300046663 Ga0495635_0000381 Ga0495635_0000381_18430_18942 170
817 3300046663 Ga0495635_0009189 Ga0495635_0009189_4493_5005 170
818 3300046663 Ga0495635_0011998 Ga0495635_0011998_5355_5867 170
819 3300046665 Ga0495661_0014497 Ga0495661_0014497_430_942 170
820 3300046665 Ga0495661_0021507 Ga0495661_0021507_226_738 170
821 3300046665 Ga0495661_0045087 Ga0495661_0045087_1589_2101 170
822 3300046665 Ga0495661_0142680 Ga0495661_0142680_322_834 170
823 3300046675 Ga0495657_0032130 Ga0495657_0032130_794_1306 170
824 3300046678 Ga0495599_0026415 Ga0495599_0026415_430_942 170
825 3300046678 Ga0495599_0050372 Ga0495599_0050372_1922_2434 170
826 3300046678 Ga0495599_0057819 Ga0495599_0057819_466_978 170
827 3300046678 Ga0495599_0481510 Ga0495599_0481510_210_722 170
828 3300046679 Ga0495623_0002662 Ga0495623_0002662_6047_6559 170
829 3300046679 Ga0495623_0003990 Ga0495623_0003990_5267_5779 170
830 3300046680 Ga0495646_0001984 Ga0495646_0001984_6459_6971 170
831 3300046680 Ga0495646_0008866 Ga0495646_0008866_1984_2496 170
832 3300046680 Ga0495646_0016544 Ga0495646_0016544_376_888 170
833 3300046680 Ga0495646_0073419 Ga0495646_0073419_382_894 170
834 3300046680 Ga0495646_0409117 Ga0495646_0409117_177_689 170
835 3300046684 Ga0495669_0087605 Ga0495669_0087605_667_1188 170
836 3300046684 Ga0495669_0156277 Ga0495669_0156277_310_822 170
837 3300046684 Ga0495669_0199567 Ga0495669_0199567_58_570 170
838 3300046684 Ga0495669_0240464 Ga0495669_0240464_299_811 170
839 3300046684 Ga0495669_0279988 Ga0495669_0279988_79_591 170
840 3300046684 Ga0495669_0297907 Ga0495669_0297907_58_570 170
841 3300046689 Ga0495613_0010036 Ga0495613_0010036_6135_6647 170
842 3300046689 Ga0495613_0029195 Ga0495613_0029195_241_753 170
843 3300046689 Ga0495613_0290063 Ga0495613_0290063_293_805 170
844 3300046690 Ga0495624_0004047 Ga0495624_0004047_4869_5381 170
845 3300046690 Ga0495624_0015178 Ga0495624_0015178_4464_4976 170
846 3300046690 Ga0495624_0041103 Ga0495624_0041103_276_788 170
847 3300046690 Ga0495624_0072943 Ga0495624_0072943_1174_1686 170
848 3300046690 Ga0495624_0081472 Ga0495624_0081472_1425_1937 170
849 3300046690 Ga0495624_0276904 Ga0495624_0276904_450_962 170
850 3300046691 Ga0495670_0027374 Ga0495670_0027374_1695_2207 170
851 3300046691 Ga0495670_0059758 Ga0495670_0059758_1184_1696 170
852 3300046692 Ga0495671_0011561 Ga0495671_0011561_867_1379 170
853 3300046692 Ga0495671_0035689 Ga0495671_0035689_1531_2043 170
854 3300046692 Ga0495671_0190862 Ga0495671_0190862_422_943 170
855 3300046694 Ga0495649_0023864 Ga0495649_0023864_624_1136 170
856 3300046694 Ga0495649_0032962 Ga0495649_0032962_723_1235 170
857 3300046694 Ga0495649_0044504 Ga0495649_0044504_1365_1886 170
858 3300046694 Ga0495649_0058728 Ga0495649_0058728_1193_1705 170
859 3300046694 Ga0495649_0061512 Ga0495649_0061512_604_1116 170
860 3300046694 Ga0495649_0064137 Ga0495649_0064137_182_694 170
861 3300046694 Ga0495649_0104511 Ga0495649_0104511_301_813 170
862 3300046694 Ga0495649_0198861 Ga0495649_0198861_265_777 170
863 3300046794 Ga0495589_0003622 Ga0495589_0003622_5987_6499 170
864 3300046794 Ga0495589_0038158 Ga0495589_0038158_895_1407 170
865 3300046794 Ga0495589_0119675 Ga0495589_0119675_246_758 170
866 3300046809 Ga0495600_0008130 Ga0495600_0008130_2232_2744 170
867 3300046809 Ga0495600_0043890 Ga0495600_0043890_286_798 170
868 3300046810 Ga0495660_0017159 Ga0495660_0017159_1459_1971 170
869 3300046810 Ga0495660_0101677 Ga0495660_0101677_96_608 170
870 3300046810 Ga0495660_0127836 Ga0495660_0127836_155_676 170
871 3300046810 Ga0495660_0166222 Ga0495660_0166222_112_624 170
872 3300047315 Ga0495581_0001082 Ga0495581_0001082_7880_8392 170
873 3300047315 Ga0495581_0009759 Ga0495581_0009759_4639_5151 170
874 3300047315 Ga0495581_0015272 Ga0495581_0015272_3694_4206 170
875 3300047317 Ga0495604_0001718 Ga0495604_0001718_16929_17441 170
876 3300047317 Ga0495604_0003130 Ga0495604_0003130_6036_6548 170
877 3300047317 Ga0495604_0026680 Ga0495604_0026680_3876_4388 170
878 3300047317 Ga0495604_0028005 Ga0495604_0028005_870_1382 170
879 3300047317 Ga0495604_0072782 Ga0495604_0072782_1369_1881 170
880 3300047317 Ga0495604_0323952 Ga0495604_0323952_105_617 170
881 3300047318 Ga0495636_0156271 Ga0495636_0156271_23_544 170
882 3300047319 Ga0495674_0000665 Ga0495674_0000665_28545_29057 170
883 3300047319 Ga0495674_0023044 Ga0495674_0023044_4381_4893 170
884 3300047319 Ga0495674_0030932 Ga0495674_0030932_2313_2825 170
885 3300047319 Ga0495674_0413173 Ga0495674_0413173_155_667 170
886 3300047320 Ga0495672_0001486 Ga0495672_0001486_17939_18451 170
887 3300047320 Ga0495672_0066950 Ga0495672_0066950_210_722 170
888 3300047320 Ga0495672_0113097 Ga0495672_0113097_363_875 170
889 3300047320 Ga0495672_0145062 Ga0495672_0145062_451_963 170
890 3300047320 Ga0495672_0149118 Ga0495672_0149118_150_662 170
891 3300047321 Ga0495676_0087719 Ga0495676_0087719_430_942 170
892 3300047321 Ga0495676_0147631 Ga0495676_0147631_845_1357 170
893 3300047321 Ga0495676_0217238 Ga0495676_0217238_230_742 170
894 3300047322 Ga0495680_0011970 Ga0495680_0011970_2129_2641 170
895 3300047322 Ga0495680_0030485 Ga0495680_0030485_543_1055 170
896 3300047322 Ga0495680_0133286 Ga0495680_0133286_594_1106 170
897 3300047322 Ga0495680_0204936 Ga0495680_0204936_332_844 170
898 3300047323 Ga0495683_0000838 Ga0495683_0000838_13955_14467 170
899 3300047323 Ga0495683_0008256 Ga0495683_0008256_3285_3797 170
900 3300047323 Ga0495683_0009032 Ga0495683_0009032_3212_3724 170
901 3300047323 Ga0495683_0026883 Ga0495683_0026883_1815_2327 170
902 3300047323 Ga0495683_0054747 Ga0495683_0054747_1034_1546 170
903 3300047323 Ga0495683_0115112 Ga0495683_0115112_276_788 170
904 3300047323 Ga0495683_0172316 Ga0495683_0172316_373_885 170
905 3300047443 Ga0495687_000134 Ga0495687_000134_17219_17731 170
906 3300047443 Ga0495687_001929 Ga0495687_001929_15695_16216 170
907 3300047443 Ga0495687_004091 Ga0495687_004091_8379_8900 170
908 3300047443 Ga0495687_070709 Ga0495687_070709_500_1012 170
909 3300047444 Ga0495675_0000784 Ga0495675_0000784_16459_16971 170
910 3300047444 Ga0495675_0075902 Ga0495675_0075902_1389_1901 170
911 3300047444 Ga0495675_0080487 Ga0495675_0080487_300_812 170
912 3300047444 Ga0495675_0513857 Ga0495675_0513857_65_577 170
913 3300047446 Ga0495679_000342 Ga0495679_000342_5963_6475 170
914 3300047446 Ga0495679_002089 Ga0495679_002089_1286_1798 170
915 3300047446 Ga0495679_005909 Ga0495679_005909_383_895 170
916 3300047446 Ga0495679_062146 Ga0495679_062146_36_548 170
917 3300047446 Ga0495679_064720 Ga0495679_064720_315_827 170
918 3300047447 Ga0495685_036583 Ga0495685_036583_1003_1515 170
919 3300047447 Ga0495685_122517 Ga0495685_122517_225_737 170
920 3300047447 Ga0495685_164772 Ga0495685_164772_43_555 170
921 3300047469 Ga0495673_0012012 Ga0495673_0012012_3722_4234 170
922 3300047469 Ga0495673_0040757 Ga0495673_0040757_680_1192 170
923 3300047469 Ga0495673_0155236 Ga0495673_0155236_323_844 170
924 3300047469 Ga0495673_0164301 Ga0495673_0164301_224_736 170
925 3300047470 Ga0495681_0124459 Ga0495681_0124459_485_997 170
926 3300047470 Ga0495681_0181291 Ga0495681_0181291_284_796 170
927 3300047471 Ga0495684_0014068 Ga0495684_0014068_5244_5756 170
928 3300047471 Ga0495684_0083650 Ga0495684_0083650_282_794 170
929 3300047471 Ga0495684_0100571 Ga0495684_0100571_1137_1649 170
930 3300047472 Ga0495686_0000129 Ga0495686_0000129_60708_61220 170
931 3300047472 Ga0495686_0055686 Ga0495686_0055686_331_843 170
932 3300047472 Ga0495686_0408225 Ga0495686_0408225_188_700 170
933 3300047673 Ga0495593_0005757 Ga0495593_0005757_6296_6808 170
934 3300047673 Ga0495593_0005997 Ga0495593_0005997_277_789 170
935 3300047673 Ga0495593_0019899 Ga0495593_0019899_992_1504 170
936 3300047673 Ga0495593_0022040 Ga0495593_0022040_1396_1908 170
937 3300048088 Ga0495602_0004174 Ga0495602_0004174_3485_3997 170
938 3300048088 Ga0495602_0022647 Ga0495602_0022647_574_1086 170
939 3300048088 Ga0495602_0026745 Ga0495602_0026745_235_747 170
940 3300048088 Ga0495602_0029768 Ga0495602_0029768_4431_4943 170
941 3300048088 Ga0495602_0031238 Ga0495602_0031238_3131_3643 170
942 3300048088 Ga0495602_0171340 Ga0495602_0171340_66_578 170
943 3300048089 Ga0495614_0000057 Ga0495614_0000057_3475_3987 170
944 3300048089 Ga0495614_0029300 Ga0495614_0029300_1673_2185 170
945 3300048089 Ga0495614_0033692 Ga0495614_0033692_1475_1987 170
946 3300048089 Ga0495614_0040117 Ga0495614_0040117_630_1142 170
947 3300048089 Ga0495614_0089178 Ga0495614_0089178_518_1030 170
948 3300048091 Ga0495626_0050164 Ga0495626_0050164_1070_1582 170
949 3300048091 Ga0495626_0051127 Ga0495626_0051127_894_1442 170
950 3300048091 Ga0495626_0095624 Ga0495626_0095624_756_1277 170
951 3300048091 Ga0495626_0123898 Ga0495626_0123898_380_892 170
952 3300048903 Ga0496100_0001212 Ga0496100_0001212_7146_7658 170
953 3300048903 Ga0496100_0033632 Ga0496100_0033632_416_928 170
954 3300048903 Ga0496100_0125277 Ga0496100_0125277_1200_1712 170
955 3300048904 Ga0496101_0002850 Ga0496101_0002850_8552_9064 170
956 3300048904 Ga0496101_0028498 Ga0496101_0028498_972_1484 170
957 3300048905 Ga0496102_0000553 Ga0496102_0000553_90_608 170
958 3300048905 Ga0496102_0002084 Ga0496102_0002084_11325_11837 170
959 3300048905 Ga0496102_0006527 Ga0496102_0006527_7737_8249 170
960 3300048905 Ga0496102_0013289 Ga0496102_0013289_5011_5523 170
961 3300048905 Ga0496102_0199999 Ga0496102_0199999_491_1003 170
962 3300048906 Ga0496103_0003408 Ga0496103_0003408_7446_7958 170
963 3300048906 Ga0496103_0005875 Ga0496103_0005875_6388_6900 170
964 3300048906 Ga0496103_0043638 Ga0496103_0043638_247_759 170
965 3300048906 Ga0496103_0084148 Ga0496103_0084148_1410_1922 170
966 3300048907 Ga0496104_0147490 Ga0496104_0147490_376_888 170
967 3300048907 Ga0496104_0420091 Ga0496104_0420091_458_970 170
968 3300048907 Ga0496104_0440929 Ga0496104_0440929_251_763 170
969 3300048907 Ga0496104_0541019 Ga0496104_0541019_165_677 170
970 3300048908 Ga0496105_0020961 Ga0496105_0020961_4666_5178 170
971 3300048908 Ga0496105_0149655 Ga0496105_0149655_1241_1765 170
972 3300048908 Ga0496105_0171652 Ga0496105_0171652_1077_1589 170
973 3300048909 Ga0496106_0074298 Ga0496106_0074298_1224_1745 170
974 3300048909 Ga0496106_0084304 Ga0496106_0084304_1388_1909 170
975 3300048909 Ga0496106_0123160 Ga0496106_0123160_1177_1689 170
976 3300048909 Ga0496106_0184218 Ga0496106_0184218_837_1349 170
977 3300048910 Ga0496107_0130532 Ga0496107_0130532_333_845 170
978 3300048910 Ga0496107_0612445 Ga0496107_0612445_50_562 170
979 3300048911 Ga0496108_0122725 Ga0496108_0122725_959_1471 170
980 3300048912 Ga0496109_0204587 Ga0496109_0204587_248_760 170
981 3300048913 Ga0496110_0025088 Ga0496110_0025088_1719_2231 170
982 3300048913 Ga0496110_0116706 Ga0496110_0116706_135_647 170
983 3300048913 Ga0496110_0638809 Ga0496110_0638809_104_628 170
984 3300048914 Ga0496111_0011978 Ga0496111_0011978_1441_1953 170
985 3300048915 Ga0496112_0017022 Ga0496112_0017022_6078_6590 170
986 3300048916 Ga0496113_0008792 Ga0496113_0008792_2201_2713 170
987 3300048916 Ga0496113_0279930 Ga0496113_0279930_241_762 170
988 3300048916 Ga0496113_0546976 Ga0496113_0546976_308_820 170
989 3300048917 Ga0496114_0026593 Ga0496114_0026593_2112_2624 170
990 3300048918 Ga0496115_0097632 Ga0496115_0097632_1862_2374 170
991 3300048918 Ga0496115_0441894 Ga0496115_0441894_294_806 170
992 3300048919 Ga0496116_0001320 Ga0496116_0001320_3597_4109 170
993 3300048919 Ga0496116_0007863 Ga0496116_0007863_321_833 170
994 3300048919 Ga0496116_0088130 Ga0496116_0088130_147_659 170
995 3300048919 Ga0496116_0167305 Ga0496116_0167305_272_784 170
996 3300048920 Ga0496117_0001476 Ga0496117_0001476_9792_10304 170
997 3300048920 Ga0496117_0012055 Ga0496117_0012055_6901_7413 170
998 3300048920 Ga0496117_0044221 Ga0496117_0044221_259_771 170
999 3300048920 Ga0496117_0067052 Ga0496117_0067052_1318_1830 170
1000 3300048920 Ga0496117_0071784 Ga0496117_0071784_465_977 170
1001 3300048921 Ga0496118_0001841 Ga0496118_0001841_443_955 170
1002 3300048921 Ga0496118_0002994 Ga0496118_0002994_7903_8415 170
1003 3300048921 Ga0496118_0003375 Ga0496118_0003375_2760_3272 170
1004 3300048921 Ga0496118_0012483 Ga0496118_0012483_7156_7668 170
1005 3300048921 Ga0496118_0034000 Ga0496118_0034000_987_1499 170
1006 3300048921 Ga0496118_0069117 Ga0496118_0069117_230_742 170
1007 3300048921 Ga0496118_0206663 Ga0496118_0206663_114_626 170
1008 3300048922 Ga0496119_0135213 Ga0496119_0135213_591_1103 170
1009 3300048922 Ga0496119_0284089 Ga0496119_0284089_68_580 170
1010 3300048924 Ga0496121_0000639 Ga0496121_0000639_53107_53619 170
1011 3300048924 Ga0496121_0003125 Ga0496121_0003125_451_963 170
1012 3300048924 Ga0496121_0006587 Ga0496121_0006587_9220_9732 170
1013 3300048925 Ga0496122_0007397 Ga0496122_0007397_5174_5686 170
1014 3300048925 Ga0496122_0076979 Ga0496122_0076979_467_979 170
1015 3300048925 Ga0496122_0096034 Ga0496122_0096034_46_564 170
1016 3300048926 Ga0496123_0006456 Ga0496123_0006456_1655_2167 170
1017 3300048926 Ga0496123_0020775 Ga0496123_0020775_3432_3950 170
1018 3300048926 Ga0496123_0054577 Ga0496123_0054577_707_1219 170
1019 3300048927 Ga0496124_0026467 Ga0496124_0026467_3541_4053 170
1020 3300048927 Ga0496124_0031878 Ga0496124_0031878_1281_1802 170
1021 3300048927 Ga0496124_0038979 Ga0496124_0038979_601_1122 170
1022 3300048927 Ga0496124_0085965 Ga0496124_0085965_1660_2172 170
1023 3300048927 Ga0496124_0191792 Ga0496124_0191792_617_1135 170
1024 3300048927 Ga0496124_0230306 Ga0496124_0230306_733_1245 170
1025 3300048928 Ga0496125_0005643 Ga0496125_0005643_2453_2965 170
1026 3300048928 Ga0496125_0006190 Ga0496125_0006190_2948_3466 170
1027 3300048928 Ga0496125_0055564 Ga0496125_0055564_1791_2303 170
1028 3300048928 Ga0496125_0244728 Ga0496125_0244728_459_980 170
1029 3300048928 Ga0496125_0272698 Ga0496125_0272698_285_797 170
1030 3300048928 Ga0496125_0584346 Ga0496125_0584346_35_556 170
1031 3300048929 Ga0496126_0006608 Ga0496126_0006608_432_944 170
1032 3300048929 Ga0496126_0028891 Ga0496126_0028891_4402_4914 170
1033 3300048929 Ga0496126_0043956 Ga0496126_0043956_718_1236 170
1034 3300048929 Ga0496126_0308190 Ga0496126_0308190_303_824 170
1035 3300049459 Ga0495678_057979 Ga0495678_057979_101_613 170
1036 3300049460 Ga0495682_0087142 Ga0495682_0087142_226_738 170
1037 3300049571 Ga0501034_0057285 Ga0501034_0057285_1680_2198 170
1038 3300049579 Ga0501043_0253363 Ga0501043_0253363_312_824 170
1039 3300049656 Ga0501209_003792 Ga0501209_003792_1230_1751 170
1040 3300050489 nmdc:mga03683_135476_c1 nmdc:mga03683_135476_c1_359_877 170
1041 3300050490 nmdc:mga03n38_135792_c1 nmdc:mga03n38_135792_c1_636_1157 170
1042 3300050492 nmdc:mga0yw44_74458_c1 nmdc:mga0yw44_74458_c1_623_1144 170
1043 3300050493 nmdc:mga0k408_13599_c1 nmdc:mga0k408_13599_c1_2080_2601 170
1044 3300050493 nmdc:mga0k408_16514_c2 nmdc:mga0k408_16514_c2_878_1399 170
1045 3300050493 nmdc:mga0k408_258628_c1 nmdc:mga0k408_258628_c1_469_990 170
1046 3300050493 nmdc:mga0k408_4060_c1 nmdc:mga0k408_4060_c1_5706_6227 170
1047 3300050493 nmdc:mga0k408_42694_c1 nmdc:mga0k408_42694_c1_288_809 170
1048 3300050493 nmdc:mga0k408_658079_c1 nmdc:mga0k408_658079_c1_56_574 170
1049 3300050494 nmdc:mga06z11_118662_c1 nmdc:mga06z11_118662_c1_917_1438 170
1050 3300050494 nmdc:mga06z11_202107_c1 nmdc:mga06z11_202107_c1_196_717 170
1051 3300050494 nmdc:mga06z11_78203_c1 nmdc:mga06z11_78203_c1_874_1395 170
1052 3300050496 nmdc:mga07m45_115998_c1 nmdc:mga07m45_115998_c1_558_1079 170
1053 3300050496 nmdc:mga07m45_2182_c1 nmdc:mga07m45_2182_c1_1547_2068 170
1054 3300050496 nmdc:mga07m45_314695_c1 nmdc:mga07m45_314695_c1_110_631 170
1055 3300050496 nmdc:mga07m45_35723_c1 nmdc:mga07m45_35723_c1_544_1065 170
1056 3300050496 nmdc:mga07m45_3941_c1 nmdc:mga07m45_3941_c1_1571_2092 170
1057 3300050496 nmdc:mga07m45_47644_c1 nmdc:mga07m45_47644_c1_1092_1613 170
1058 3300050496 nmdc:mga07m45_59232_c1 nmdc:mga07m45_59232_c1_837_1367 170
1059 3300050496 nmdc:mga07m45_78892_c1 nmdc:mga07m45_78892_c1_655_1176 170
1060 3300050508 nmdc:mga09592_14541_c1 nmdc:mga09592_14541_c1_1290_1811 170
1061 3300050509 nmdc:mga0qj67_12586_c1 nmdc:mga0qj67_12586_c1_815_1336 170
1062 3300053080 Ga0500635_0000318 Ga0500635_0000318_5986_6501 170
1063 3300053086 Ga0500578_0017157 Ga0500578_0017157_3085_3603 170
1064 3300053088 Ga0500644_0013621 Ga0500644_0013621_459_980 170
1065 3300053117 Ga0500593_002980 Ga0500593_002980_1267_1785 170
1066 3300053125 Ga0500618_031351 Ga0500618_031351_246_758 170
1067 3300053126 Ga0500621_195489 Ga0500621_195489_80_601 170
1068 3300053134 Ga0500658_0126800 Ga0500658_0126800_15_536 170
1069 3300053136 Ga0500559_0000207 Ga0500559_0000207_44535_45056 170
1070 3300053139 Ga0500568_0081383 Ga0500568_0081383_339_860 170
1071 3300053139 Ga0500568_0163032 Ga0500568_0163032_31_552 170
1072 3300053148 Ga0500590_039858 Ga0500590_039858_1079_1600 170
1073 3300053156 Ga0500622_0022765 Ga0500622_0022765_1457_1978 170
1074 3300053177 Ga0500636_0054911 Ga0500636_0054911_1462_1983 170
1075 3300053724 Ga0500570_125006 Ga0500570_125006_216_734 170
1076 3300053739 Ga0500587_000950 Ga0500587_000950_2768_3286 170
1077 3300053739 Ga0500587_002321 Ga0500587_002321_572_1093 170
1078 3300061719 Ga0466962_0002580 Ga0466962_0002580_4469_4981 170
1079 3300061719 Ga0466962_0008800 Ga0466962_0008800_2153_2665 170
1080 3300061719 Ga0466962_0022861 Ga0466962_0022861_736_1248 170
1081 3300061719 Ga0466962_0040446 Ga0466962_0040446_15_527 170
1082 iso_pu_bacteria 2857576091 2857578293 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04093

MreD

rod shape-determining protein MreD

48

196

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p5n-assembly1.cif.gz_B structure and mechanism of the s component of a bacterial ecf transporter 0.6108 15 160
7nnt-assembly1.cif.gz_C cryo-em structure of the folate-specific ecf transporter complex in ddm micelles 0.5482 7 157
3p5n-assembly1.cif.gz_B structure and mechanism of the s component of a bacterial ecf transporter 0.5444 15 160
5kc4-assembly2.cif.gz_E structure of tmribu, orthorhombic crystal form 0.5089 14 156
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.5051 14 156
ID Description Score Start End Superfamily
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9284 16 154 1.10.1760.20
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8472 16 154 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7552 16 154 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6489 16 154 1.10.1760.20
af_Q2G061_16_177_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5654 9 158 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A1W6Z419-F1-model_v4 Rod shape-determining protein MreD 0.957 9 157 GO:0005886
GO:0008360
AF-A0A6B2R0A9-F1-model_v4 Rod shape-determining protein MreD 0.9563 26 158 GO:0005886
GO:0008360
AF-A0A521Z556-F1-model_v4 Rod shape-determining protein MreD 0.9552 7 158 GO:0005886
GO:0008360
AF-R5PK45-F1-model_v4 deleted 0.9519 9 154
AF-Q7VSM8-F1-model_v4 Rod shape-determining protein 0.9507 17 158 GO:0005886
GO:0008360

Feature Viewer

pLDDT pTM Quality
90.51 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map