F489697
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1082 | 413 | 1070 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300037466|Ga0395898_1217434|Ga0395898_1217434_35_667 |
| Length | 210 |
| Sequence | MCRAPRLPLKKTPRRRARPTPTAIRWTPIQRKNAEARPSIMNSPQYLLRPVNPGFIAFSFVLAFLFNLMPWGHMQWIPDLVALVLVFWNIHQPRRVGMVVAFLLGLLMDVHEARLLGEHAMAYTMLSYFAITIHRRVLWFSVLSQALHVLPLLVLAHAVPIVIRLLMGAHLPDWQVILPPLIEAALWPFANAFLLAPQRRPESVDETRPI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 2 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 5 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 6 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 7 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 8 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 9 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 10 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 11 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 12 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 13 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 14 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 20 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 21 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 22 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 23 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 24 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 25 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 26 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 27 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 28 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 29 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 42 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 43 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 49 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 51 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 58 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 93 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 94 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 124 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 129 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 210 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 213 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 217 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 228 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 240 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 241 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 244 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 245 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 246 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 247 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 248 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 249 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 250 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 251 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 252 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 253 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 254 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 255 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 256 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 257 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 258 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 259 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 260 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 261 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 266 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 267 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 268 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 269 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 363 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 364 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 365 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 366 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 367 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 368 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 371 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 372 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 373 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 374 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 375 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 376 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 377 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 378 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 379 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 380 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 381 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 382 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 383 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 384 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 385 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 386 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 391 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 393 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 395 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 400 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 401 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 403 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 405 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 407 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 408 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 409 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 410 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 412 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 413 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.52 |
| Metatranscriptomes | 0.37 |
| Isolates | 1.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.11 |
| Nodule | 0.92 |
| Rhizoplane | 4.16 |
| Rhizosphere | 65.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000160 | 3300001915 | Bacteria | 19320 |
| 2 | JGI24741J21665_1000841 | 3300001915 | Bacteria | 9246 |
| 3 | JGI24740J21852_10000483 | 3300001979 | Bacteria | 17148 |
| 4 | JGI24740J21852_10002060 | 3300001979 | Bacteria | 9194 |
| 5 | JGI24740J21852_10018241 | 3300001979 | Bacteria | 2495 |
| 6 | JGI24739J22299_10007062 | 3300001989 | Bacteria | 4226 |
| 7 | JGI24739J22299_10016571 | 3300001989 | Bacteria | 2666 |
| 8 | JGI24737J22298_10005221 | 3300001990 | Bacteria | 4494 |
| 9 | JGI24737J22298_10007151 | 3300001990 | Bacteria | 3779 |
| 10 | JGI24737J22298_10047344 | 3300001990 | Bacteria | 1311 |
| 11 | JGI24735J21928_10000874 | 3300002067 | Bacteria | 10756 |
| 12 | JGI24735J21928_10012528 | 3300002067 | Bacteria | 2679 |
| 13 | JGI24735J21928_10020332 | 3300002067 | Bacteria | 2034 |
| 14 | JGI24735J21928_10120673 | 3300002067 | Bacteria | 754 |
| 15 | JGI24738J21930_10008364 | 3300002075 | Bacteria | 2356 |
| 16 | JGI24738J21930_10067794 | 3300002075 | Bacteria | 737 |
| 17 | JGI25156J39149_1001638 | 3300002705 | Bacteria | 9108 |
| 18 | JGI25156J39149_1011189 | 3300002705 | Bacteria | 2048 |
| 19 | JGI25156J39149_1011412 | 3300002705 | Bacteria | 2012 |
| 20 | JGI25156J39149_1014315 | 3300002705 | Bacteria | 1642 |
| 21 | JGI25156J39149_1022758 | 3300002705 | Bacteria | 1058 |
| 22 | JGI25154J39366_1000483 | 3300002738 | Bacteria | 20639 |
| 23 | JGI25154J39366_1001034 | 3300002738 | Bacteria | 11127 |
| 24 | JGI25157J39369_1000278 | 3300002741 | Bacteria | 37495 |
| 25 | JGI25152J39213_1001024 | 3300002773 | Bacteria | 13383 |
| 26 | JGI25150J39212_1007936 | 3300002774 | Bacteria | 2105 |
| 27 | JGI25165J46597_1003927 | 3300003214 | Bacteria | 3424 |
| 28 | JGI25153J46596_10014803 | 3300003215 | Bacteria | 3220 |
| 29 | JGI25153J46596_10015636 | 3300003215 | Bacteria | 3080 |
| 30 | rootL2_10059169 | 3300003322 | Bacteria | 7994 |
| 31 | rootL2_10174862 | 3300003322 | Bacteria | 2087 |
| 32 | rootH1_10054318 | 3300003323 | Bacteria | 3308 |
| 33 | rootH1_10067675 | 3300003323 | Bacteria | 1910 |
| 34 | rootH1_10281758 | 3300003323 | Bacteria | 1036 |
| 35 | JGI25160J50197_1000016 | 3300003354 | Bacteria | 247819 |
| 36 | Ga0055538_1001442 | 3300003751 | Bacteria | 4577 |
| 37 | Ga0055538_1005363 | 3300003751 | Bacteria | 1338 |
| 38 | Ga0055539_1000226 | 3300003752 | Bacteria | 39537 |
| 39 | Ga0055533_1000738 | 3300003756 | Bacteria | 10533 |
| 40 | Ga0055533_1003064 | 3300003756 | Bacteria | 3536 |
| 41 | Ga0055533_1003745 | 3300003756 | Bacteria | 2947 |
| 42 | Ga0055533_1003847 | 3300003756 | Bacteria | 2875 |
| 43 | Ga0055532_1000022 | 3300003758 | Bacteria | 248737 |
| 44 | Ga0055532_1000040 | 3300003758 | Bacteria | 198031 |
| 45 | Ga0055525_1001187 | 3300003759 | Bacteria | 5869 |
| 46 | Ga0055527_1000016 | 3300003760 | Bacteria | 248736 |
| 47 | Ga0055527_1001527 | 3300003760 | Bacteria | 4746 |
| 48 | Ga0055527_1002687 | 3300003760 | Bacteria | 2895 |
| 49 | Ga0055527_1002714 | 3300003760 | Bacteria | 2876 |
| 50 | Ga0055535_1000017 | 3300003761 | Bacteria | 248735 |
| 51 | Ga0055535_1000029 | 3300003761 | Bacteria | 198031 |
| 52 | Ga0055535_1005249 | 3300003761 | Bacteria | 2895 |
| 53 | Ga0055535_1005280 | 3300003761 | Bacteria | 2876 |
| 54 | Ga0055542_1000030 | 3300003762 | Bacteria | 248717 |
| 55 | Ga0055542_1000850 | 3300003762 | Bacteria | 21415 |
| 56 | Ga0055542_1005397 | 3300003762 | Bacteria | 2895 |
| 57 | Ga0055542_1005452 | 3300003762 | Bacteria | 2876 |
| 58 | Ga0055529_1000033 | 3300003763 | Bacteria | 248734 |
| 59 | Ga0055529_1000055 | 3300003763 | Bacteria | 197545 |
| 60 | Ga0055529_1003036 | 3300003763 | Bacteria | 2938 |
| 61 | Ga0055526_1001136 | 3300003771 | Bacteria | 19296 |
| 62 | Ga0055526_1002962 | 3300003771 | Bacteria | 11128 |
| 63 | Ga0055526_1021340 | 3300003771 | Bacteria | 2256 |
| 64 | Ga0055537_1003705 | 3300003773 | Bacteria | 4618 |
| 65 | Ga0055537_1007755 | 3300003773 | Bacteria | 2548 |
| 66 | Ga0055524_1000137 | 3300003775 | Bacteria | 87107 |
| 67 | Ga0055524_1000491 | 3300003775 | Bacteria | 31117 |
| 68 | Ga0055524_1001779 | 3300003775 | Bacteria | 11839 |
| 69 | Ga0055524_1017950 | 3300003775 | Bacteria | 2477 |
| 70 | Ga0055536_1004932 | 3300003781 | Bacteria | 6649 |
| 71 | Ga0055534_1008631 | 3300003784 | Bacteria | 2291 |
| 72 | Ga0055534_1008695 | 3300003784 | Bacteria | 2276 |
| 73 | Ga0055528_1000675 | 3300003790 | Bacteria | 24729 |
| 74 | Ga0055530_10001713 | 3300003791 | Bacteria | 15454 |
| 75 | Ga0055540_1000042 | 3300003792 | Bacteria | 156410 |
| 76 | Ga0055540_1006966 | 3300003792 | Bacteria | 4369 |
| 77 | Ga0055531_10010420 | 3300003794 | Bacteria | 4620 |
| 78 | Ga0055531_10020132 | 3300003794 | Bacteria | 2659 |
| 79 | Ga0055541_1000556 | 3300003841 | Bacteria | 10113 |
| 80 | Ga0055541_1007510 | 3300003841 | Bacteria | 1787 |
| 81 | Ga0058692_1002295 | 3300003856 | Bacteria | 6467 |
| 82 | Ga0055543_1003765 | 3300004625 | Bacteria | 4332 |
| 83 | Ga0065165_1000079 | 3300005262 | Bacteria | 162095 |
| 84 | Ga0065165_1000154 | 3300005262 | Bacteria | 119863 |
| 85 | Ga0065165_1001510 | 3300005262 | Bacteria | 24595 |
| 86 | Ga0065704_10365703 | 3300005289 | Bacteria | 791 |
| 87 | Ga0070658_10022919 | 3300005327 | Bacteria | 5012 |
| 88 | Ga0070658_10085807 | 3300005327 | Bacteria | 2589 |
| 89 | Ga0070676_10010215 | 3300005328 | Bacteria | 5091 |
| 90 | Ga0070683_101671087 | 3300005329 | Bacteria | 612 |
| 91 | Ga0070666_10053601 | 3300005335 | Bacteria | 2721 |
| 92 | Ga0070666_10125164 | 3300005335 | Bacteria | 1784 |
| 93 | Ga0070682_100469392 | 3300005337 | Bacteria | 968 |
| 94 | Ga0070682_100705625 | 3300005337 | Bacteria | 809 |
| 95 | Ga0068868_100032328 | 3300005338 | Bacteria | 4025 |
| 96 | Ga0070660_100000040 | 3300005339 | Bacteria | 75773 |
| 97 | Ga0070660_100015711 | 3300005339 | Bacteria | 5474 |
| 98 | Ga0070660_100646046 | 3300005339 | Bacteria | 886 |
| 99 | Ga0070661_100000020 | 3300005344 | Bacteria | 132014 |
| 100 | Ga0070661_100000143 | 3300005344 | Bacteria | 58391 |
| 101 | Ga0070661_100083542 | 3300005344 | Bacteria | 2359 |
| 102 | Ga0070661_100230024 | 3300005344 | Bacteria | 1425 |
| 103 | Ga0070661_100362115 | 3300005344 | Bacteria | 1140 |
| 104 | Ga0070668_100049841 | 3300005347 | Bacteria | 3222 |
| 105 | Ga0070669_100154750 | 3300005353 | Bacteria | 1777 |
| 106 | Ga0070669_100513354 | 3300005353 | Bacteria | 995 |
| 107 | Ga0070671_100057929 | 3300005355 | Bacteria | 3225 |
| 108 | Ga0070671_100655537 | 3300005355 | Bacteria | 909 |
| 109 | Ga0070674_100491504 | 3300005356 | Bacteria | 1020 |
| 110 | Ga0070659_100000268 | 3300005366 | Bacteria | 40889 |
| 111 | Ga0070659_100001187 | 3300005366 | Bacteria | 18994 |
| 112 | Ga0070659_100007886 | 3300005366 | Bacteria | 7753 |
| 113 | Ga0070659_100767769 | 3300005366 | Bacteria | 837 |
| 114 | Ga0070667_100030130 | 3300005367 | Bacteria | 4524 |
| 115 | Ga0070667_100063812 | 3300005367 | Bacteria | 3123 |
| 116 | Ga0070708_100531322 | 3300005445 | Bacteria | 1110 |
| 117 | Ga0070663_100000001 | 3300005455 | Bacteria | 318372 |
| 118 | Ga0070663_100022669 | 3300005455 | Bacteria | 4201 |
| 119 | Ga0070663_100031245 | 3300005455 | Bacteria | 3659 |
| 120 | Ga0070663_100288635 | 3300005455 | Bacteria | 1310 |
| 121 | Ga0070663_100612739 | 3300005455 | Bacteria | 917 |
| 122 | Ga0070678_100319076 | 3300005456 | Bacteria | 1326 |
| 123 | Ga0068867_100000074 | 3300005459 | Bacteria | 61448 |
| 124 | Ga0068867_100130849 | 3300005459 | Bacteria | 1950 |
| 125 | Ga0070706_100001812 | 3300005467 | Bacteria | 22146 |
| 126 | Ga0070698_100161166 | 3300005471 | Bacteria | 2187 |
| 127 | Ga0070684_100090171 | 3300005535 | Bacteria | 2726 |
| 128 | Ga0070684_100612382 | 3300005535 | Bacteria | 1013 |
| 129 | Ga0068853_100212436 | 3300005539 | Bacteria | 1764 |
| 130 | Ga0068853_100419554 | 3300005539 | Bacteria | 1255 |
| 131 | Ga0070665_100205597 | 3300005548 | Bacteria | 1969 |
| 132 | Ga0068855_100002940 | 3300005563 | Bacteria | 20816 |
| 133 | Ga0068855_100071125 | 3300005563 | Bacteria | 4046 |
| 134 | Ga0068855_100120027 | 3300005563 | Bacteria | 3010 |
| 135 | Ga0068855_100174821 | 3300005563 | Bacteria | 2430 |
| 136 | Ga0070664_100000006 | 3300005564 | Bacteria | 189856 |
| 137 | Ga0070664_100012445 | 3300005564 | Bacteria | 6916 |
| 138 | Ga0070664_100027245 | 3300005564 | Bacteria | 4748 |
| 139 | Ga0070664_100398412 | 3300005564 | Bacteria | 1258 |
| 140 | Ga0068857_100004217 | 3300005577 | Bacteria | 12113 |
| 141 | Ga0068857_100022755 | 3300005577 | Bacteria | 5514 |
| 142 | Ga0068857_100055164 | 3300005577 | Bacteria | 3527 |
| 143 | Ga0068854_100000253 | 3300005578 | Bacteria | 36392 |
| 144 | Ga0068854_100018676 | 3300005578 | Bacteria | 4658 |
| 145 | Ga0068854_100175418 | 3300005578 | Bacteria | 1671 |
| 146 | Ga0068856_100000032 | 3300005614 | Bacteria | 124895 |
| 147 | Ga0068856_100001787 | 3300005614 | Bacteria | 22472 |
| 148 | Ga0068856_100161563 | 3300005614 | Bacteria | 2250 |
| 149 | Ga0068852_100015742 | 3300005616 | Bacteria | 5878 |
| 150 | Ga0068852_100078143 | 3300005616 | Bacteria | 2927 |
| 151 | Ga0068852_100137779 | 3300005616 | Bacteria | 2255 |
| 152 | Ga0068852_100174110 | 3300005616 | Bacteria | 2019 |
| 153 | Ga0068852_100276979 | 3300005616 | Bacteria | 1616 |
| 154 | Ga0068852_100629817 | 3300005616 | Bacteria | 1079 |
| 155 | Ga0068858_100796155 | 3300005842 | Bacteria | 922 |
| 156 | Ga0075365_10029150 | 3300006038 | Bacteria | 3525 |
| 157 | Ga0075368_10019756 | 3300006042 | Bacteria | 2544 |
| 158 | Ga0075363_100110369 | 3300006048 | Bacteria | 1528 |
| 159 | Ga0075364_10084728 | 3300006051 | Bacteria | 2098 |
| 160 | Ga0075362_10021573 | 3300006177 | Bacteria | 2705 |
| 161 | Ga0075367_10017001 | 3300006178 | Bacteria | 3984 |
| 162 | Ga0075369_10025355 | 3300006186 | Bacteria | 2464 |
| 163 | Ga0075369_10167546 | 3300006186 | Bacteria | 1008 |
| 164 | Ga0075366_10014653 | 3300006195 | Bacteria | 4481 |
| 165 | Ga0075366_10018236 | 3300006195 | Bacteria | 4050 |
| 166 | Ga0075366_10070966 | 3300006195 | Bacteria | 2075 |
| 167 | Ga0075366_10740241 | 3300006195 | Bacteria | 611 |
| 168 | Ga0075370_10003868 | 3300006353 | Bacteria | 7175 |
| 169 | Ga0075370_10014273 | 3300006353 | Bacteria | 4236 |
| 170 | Ga0075370_10050713 | 3300006353 | Bacteria | 2354 |
| 171 | Ga0075370_10054197 | 3300006353 | Bacteria | 2277 |
| 172 | Ga0075429_100000549 | 3300006880 | Bacteria | 28660 |
| 173 | Ga0099823_1000002 | 3300006944 | Bacteria | 212272 |
| 174 | Ga0079104_1000012 | 3300006946 | Bacteria | 355143 |
| 175 | Ga0079104_1000170 | 3300006946 | Bacteria | 92339 |
| 176 | Ga0079104_1044618 | 3300006946 | Bacteria | 1015 |
| 177 | Ga0099826_10000007 | 3300006948 | Bacteria | 393518 |
| 178 | Ga0105251_10000211 | 3300009011 | Bacteria | 59154 |
| 179 | Ga0105251_10000590 | 3300009011 | Bacteria | 33310 |
| 180 | Ga0105251_10076603 | 3300009011 | Bacteria | 1552 |
| 181 | Ga0105251_10175552 | 3300009011 | Bacteria | 965 |
| 182 | Ga0105251_10246479 | 3300009011 | Bacteria | 805 |
| 183 | Ga0105250_10000214 | 3300009092 | Bacteria | 47939 |
| 184 | Ga0105250_10013006 | 3300009092 | Bacteria | 3426 |
| 185 | Ga0105250_10054686 | 3300009092 | Bacteria | 1601 |
| 186 | Ga0105240_10016797 | 3300009093 | Bacteria | 9898 |
| 187 | Ga0105240_10029981 | 3300009093 | Bacteria | 7076 |
| 188 | Ga0105240_10070126 | 3300009093 | Bacteria | 4336 |
| 189 | Ga0105240_10099364 | 3300009093 | Bacteria | 3542 |
| 190 | Ga0105240_10121875 | 3300009093 | Bacteria | 3139 |
| 191 | Ga0105240_10172849 | 3300009093 | Bacteria | 2557 |
| 192 | Ga0105240_10226734 | 3300009093 | Bacteria | 2174 |
| 193 | Ga0105240_10242884 | 3300009093 | Bacteria | 2087 |
| 194 | Ga0105240_10939479 | 3300009093 | Bacteria | 928 |
| 195 | Ga0111539_11710783 | 3300009094 | Bacteria | 729 |
| 196 | Ga0105247_10317823 | 3300009101 | Bacteria | 1085 |
| 197 | Ga0105243_10002697 | 3300009148 | Bacteria | 14746 |
| 198 | Ga0105243_10032598 | 3300009148 | Bacteria | 4026 |
| 199 | Ga0105241_10405709 | 3300009174 | Bacteria | 1196 |
| 200 | Ga0105241_10503318 | 3300009174 | Bacteria | 1080 |
| 201 | Ga0105241_10661861 | 3300009174 | Bacteria | 949 |
| 202 | Ga0105242_10000638 | 3300009176 | Bacteria | 27494 |
| 203 | Ga0105248_10092474 | 3300009177 | Bacteria | 3407 |
| 204 | Ga0105237_10040988 | 3300009545 | Bacteria | 4671 |
| 205 | Ga0105237_10095994 | 3300009545 | Bacteria | 2955 |
| 206 | Ga0105237_10101517 | 3300009545 | Bacteria | 2869 |
| 207 | Ga0105238_10031527 | 3300009551 | Bacteria | 5397 |
| 208 | Ga0105238_10282687 | 3300009551 | Bacteria | 1641 |
| 209 | Ga0105238_10430880 | 3300009551 | Bacteria | 1314 |
| 210 | Ga0105238_10527426 | 3300009551 | Bacteria | 1184 |
| 211 | Ga0105249_10128221 | 3300009553 | Bacteria | 2419 |
| 212 | Ga0105249_10509432 | 3300009553 | Bacteria | 1250 |
| 213 | Ga0105239_10012282 | 3300010375 | Bacteria | 9540 |
| 214 | Ga0105239_10022235 | 3300010375 | Bacteria | 6989 |
| 215 | Ga0105239_10155541 | 3300010375 | Bacteria | 2553 |
| 216 | Ga0105239_11172256 | 3300010375 | Bacteria | 885 |
| 217 | Ga0105246_10678738 | 3300011119 | Bacteria | 900 |
| 218 | Ga0157319_1000007 | 3300012497 | Bacteria | 318528 |
| 219 | Ga0157373_10007276 | 3300013100 | Bacteria | 8249 |
| 220 | Ga0157373_10083227 | 3300013100 | Bacteria | 2255 |
| 221 | Ga0157371_10000106 | 3300013102 | Bacteria | 126567 |
| 222 | Ga0157370_10000062 | 3300013104 | Bacteria | 115487 |
| 223 | Ga0157370_10003076 | 3300013104 | Bacteria | 19768 |
| 224 | Ga0157370_10005074 | 3300013104 | Bacteria | 14849 |
| 225 | Ga0157370_11117372 | 3300013104 | Bacteria | 712 |
| 226 | Ga0157369_10001436 | 3300013105 | Bacteria | 29230 |
| 227 | Ga0157369_10014753 | 3300013105 | Bacteria | 8816 |
| 228 | Ga0157369_10021633 | 3300013105 | Bacteria | 7193 |
| 229 | Ga0157369_10053770 | 3300013105 | Bacteria | 4350 |
| 230 | Ga0157369_10061885 | 3300013105 | Bacteria | 4034 |
| 231 | Ga0157369_10224563 | 3300013105 | Bacteria | 1965 |
| 232 | Ga0157369_10241322 | 3300013105 | Bacteria | 1887 |
| 233 | Ga0157369_10453783 | 3300013105 | Bacteria | 1327 |
| 234 | Ga0157374_10003540 | 3300013296 | Bacteria | 13142 |
| 235 | Ga0157378_10321976 | 3300013297 | Bacteria | 1502 |
| 236 | Ga0163162_10000587 | 3300013306 | Bacteria | 33749 |
| 237 | Ga0163162_11737185 | 3300013306 | Bacteria | 713 |
| 238 | Ga0157372_10000108 | 3300013307 | Bacteria | 86863 |
| 239 | Ga0157372_10002116 | 3300013307 | Bacteria | 21593 |
| 240 | Ga0163163_11371033 | 3300014325 | Bacteria | 769 |
| 241 | Ga0182008_10033036 | 3300014497 | Bacteria | 2597 |
| 242 | Ga0182008_10103131 | 3300014497 | Bacteria | 1411 |
| 243 | Ga0157377_10000006 | 3300014745 | Bacteria | 419853 |
| 244 | Ga0182006_1004867 | 3300015261 | Bacteria | 6513 |
| 245 | Ga0182006_1013126 | 3300015261 | Bacteria | 3603 |
| 246 | Ga0182007_10000169 | 3300015262 | Bacteria | 44843 |
| 247 | Ga0182007_10123969 | 3300015262 | Bacteria | 866 |
| 248 | Ga0183361_10001 | 3300016635 | Bacteria | 908583 |
| 249 | Ga0206356_11010258 | 3300020070 | Bacteria | 4042 |
| 250 | Ga0206351_10205994 | 3300020077 | Bacteria | 7799 |
| 251 | Ga0206354_10019202 | 3300020081 | Bacteria | 2247 |
| 252 | Ga0154015_1595496 | 3300020610 | Bacteria | 4773 |
| 253 | Ga0213872_10020599 | 3300021361 | Bacteria | 3040 |
| 254 | Ga0213872_10321660 | 3300021361 | Bacteria | 639 |
| 255 | Ga0209784_100006 | 3300025224 | Bacteria | 930704 |
| 256 | Ga0209784_100452 | 3300025224 | Bacteria | 17499 |
| 257 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 258 | Ga0209566_100218 | 3300025225 | Bacteria | 57142 |
| 259 | Ga0209566_100702 | 3300025225 | Bacteria | 19336 |
| 260 | Ga0209566_101348 | 3300025225 | Bacteria | 7765 |
| 261 | Ga0209566_106577 | 3300025225 | Bacteria | 1363 |
| 262 | Ga0209674_100010 | 3300025226 | Bacteria | 1038638 |
| 263 | Ga0209674_100017 | 3300025226 | Bacteria | 689087 |
| 264 | Ga0209674_100060 | 3300025226 | Bacteria | 282102 |
| 265 | Ga0209674_100076 | 3300025226 | Bacteria | 210323 |
| 266 | Ga0209674_100324 | 3300025226 | Bacteria | 30278 |
| 267 | Ga0209674_101404 | 3300025226 | Bacteria | 6446 |
| 268 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 269 | Ga0209672_100041 | 3300025228 | Bacteria | 278535 |
| 270 | Ga0209672_100071 | 3300025228 | Bacteria | 169941 |
| 271 | Ga0209672_102120 | 3300025228 | Bacteria | 5277 |
| 272 | Ga0209147_100018 | 3300025229 | Bacteria | 515719 |
| 273 | Ga0209147_100022 | 3300025229 | Bacteria | 443906 |
| 274 | Ga0209147_100226 | 3300025229 | Bacteria | 56753 |
| 275 | Ga0209147_100401 | 3300025229 | Bacteria | 29477 |
| 276 | Ga0209563_100041 | 3300025230 | Bacteria | 407467 |
| 277 | Ga0209563_100740 | 3300025230 | Bacteria | 10064 |
| 278 | Ga0207427_102710 | 3300025231 | Bacteria | 4442 |
| 279 | Ga0209258_100028 | 3300025242 | Bacteria | 515719 |
| 280 | Ga0209258_100033 | 3300025242 | Bacteria | 443845 |
| 281 | Ga0209258_100309 | 3300025242 | Bacteria | 76791 |
| 282 | Ga0209258_100418 | 3300025242 | Bacteria | 50581 |
| 283 | Ga0207425_1002645 | 3300025245 | Bacteria | 6181 |
| 284 | Ga0207425_1057356 | 3300025245 | Bacteria | 694 |
| 285 | Ga0209646_1000012 | 3300025246 | Bacteria | 573300 |
| 286 | Ga0209646_1000043 | 3300025246 | Bacteria | 343652 |
| 287 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 288 | Ga0209026_1017580 | 3300025250 | Bacteria | 1140 |
| 289 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 290 | Ga0209677_101750 | 3300025253 | Bacteria | 9018 |
| 291 | Ga0209677_106440 | 3300025253 | Bacteria | 2777 |
| 292 | Ga0209148_1000046 | 3300025254 | Bacteria | 443881 |
| 293 | Ga0209148_1000134 | 3300025254 | Bacteria | 169941 |
| 294 | Ga0209148_1000162 | 3300025254 | Bacteria | 138642 |
| 295 | Ga0209148_1005487 | 3300025254 | Bacteria | 2900 |
| 296 | Ga0209759_1000003 | 3300025256 | Bacteria | 792130 |
| 297 | Ga0209759_1000067 | 3300025256 | Bacteria | 183764 |
| 298 | Ga0209759_1000092 | 3300025256 | Bacteria | 161238 |
| 299 | Ga0209759_1000184 | 3300025256 | Bacteria | 100691 |
| 300 | Ga0209759_1001030 | 3300025256 | Bacteria | 18717 |
| 301 | Ga0209759_1001470 | 3300025256 | Bacteria | 13148 |
| 302 | Ga0209759_1006172 | 3300025256 | Bacteria | 4074 |
| 303 | Ga0209759_1011903 | 3300025256 | Bacteria | 2440 |
| 304 | Ga0209759_1012277 | 3300025256 | Bacteria | 2382 |
| 305 | Ga0209129_1000035 | 3300025258 | Bacteria | 329303 |
| 306 | Ga0209233_1000050 | 3300025261 | Bacteria | 450736 |
| 307 | Ga0209565_1000106 | 3300025263 | Bacteria | 122574 |
| 308 | Ga0209565_1015667 | 3300025263 | Bacteria | 1704 |
| 309 | Ga0209455_1000038 | 3300025272 | Bacteria | 443899 |
| 310 | Ga0209455_1000065 | 3300025272 | Bacteria | 321272 |
| 311 | Ga0209455_1000315 | 3300025272 | Bacteria | 48626 |
| 312 | Ga0209455_1008018 | 3300025272 | Bacteria | 2917 |
| 313 | Ga0209673_1000102 | 3300025273 | Bacteria | 189583 |
| 314 | Ga0209673_1007570 | 3300025273 | Bacteria | 4973 |
| 315 | Ga0209673_1011280 | 3300025273 | Bacteria | 3694 |
| 316 | Ga0209673_1014156 | 3300025273 | Bacteria | 3101 |
| 317 | Ga0209673_1015533 | 3300025273 | Bacteria | 2887 |
| 318 | Ga0209673_1022806 | 3300025273 | Bacteria | 2149 |
| 319 | Ga0209130_1009929 | 3300025284 | Bacteria | 2665 |
| 320 | Ga0209675_1000168 | 3300025291 | Bacteria | 79360 |
| 321 | Ga0209675_1000363 | 3300025291 | Bacteria | 38568 |
| 322 | Ga0209675_1006967 | 3300025291 | Bacteria | 4428 |
| 323 | Ga0209676_1000036 | 3300025292 | Bacteria | 457623 |
| 324 | Ga0209025_1000110 | 3300025294 | Bacteria | 220002 |
| 325 | Ga0209025_1000462 | 3300025294 | Bacteria | 79379 |
| 326 | Ga0209025_1001247 | 3300025294 | Bacteria | 35308 |
| 327 | Ga0209025_1006182 | 3300025294 | Bacteria | 9413 |
| 328 | Ga0209564_1000024 | 3300025295 | Bacteria | 535041 |
| 329 | Ga0209564_1000030 | 3300025295 | Bacteria | 503296 |
| 330 | Ga0209564_1001348 | 3300025295 | Bacteria | 26048 |
| 331 | Ga0209564_1003869 | 3300025295 | Bacteria | 9641 |
| 332 | Ga0209564_1005611 | 3300025295 | Bacteria | 7064 |
| 333 | Ga0209564_1006456 | 3300025295 | Bacteria | 6317 |
| 334 | Ga0209564_1009644 | 3300025295 | Bacteria | 4563 |
| 335 | Ga0209758_1000066 | 3300025297 | Bacteria | 298620 |
| 336 | Ga0209758_1000248 | 3300025297 | Bacteria | 110671 |
| 337 | Ga0209050_1000556 | 3300025298 | Bacteria | 61372 |
| 338 | Ga0209050_1000614 | 3300025298 | Bacteria | 56080 |
| 339 | Ga0209050_1008170 | 3300025298 | Bacteria | 5663 |
| 340 | Ga0209050_1008250 | 3300025298 | Bacteria | 5615 |
| 341 | Ga0209256_1000030 | 3300025299 | Bacteria | 414828 |
| 342 | Ga0209256_1000197 | 3300025299 | Bacteria | 114432 |
| 343 | Ga0209256_1000220 | 3300025299 | Bacteria | 106021 |
| 344 | Ga0209256_1000469 | 3300025299 | Bacteria | 60701 |
| 345 | Ga0209256_1003387 | 3300025299 | Bacteria | 11247 |
| 346 | Ga0209256_1021865 | 3300025299 | Bacteria | 1951 |
| 347 | Ga0207426_1000007 | 3300025302 | Bacteria | 971011 |
| 348 | Ga0207426_1002079 | 3300025302 | Bacteria | 13873 |
| 349 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 350 | Ga0209051_1002061 | 3300025303 | Bacteria | 15247 |
| 351 | Ga0209051_1003541 | 3300025303 | Bacteria | 10175 |
| 352 | Ga0209051_1024073 | 3300025303 | Bacteria | 2515 |
| 353 | Ga0209257_1000063 | 3300025304 | Bacteria | 359089 |
| 354 | Ga0209257_1002434 | 3300025304 | Bacteria | 18517 |
| 355 | Ga0209257_1004130 | 3300025304 | Bacteria | 11575 |
| 356 | Ga0209257_1031974 | 3300025304 | Bacteria | 1674 |
| 357 | Ga0207696_1026972 | 3300025711 | Bacteria | 1774 |
| 358 | Ga0207713_1000137 | 3300025735 | Bacteria | 111281 |
| 359 | Ga0207713_1049881 | 3300025735 | Bacteria | 1675 |
| 360 | Ga0207713_1108016 | 3300025735 | Bacteria | 950 |
| 361 | Ga0207713_1150573 | 3300025735 | Bacteria | 751 |
| 362 | Ga0207680_10084046 | 3300025903 | Bacteria | 2007 |
| 363 | Ga0207680_10168249 | 3300025903 | Bacteria | 1475 |
| 364 | Ga0207680_10374127 | 3300025903 | Bacteria | 1003 |
| 365 | Ga0207647_10000216 | 3300025904 | Bacteria | 47083 |
| 366 | Ga0207647_10004229 | 3300025904 | Bacteria | 10642 |
| 367 | Ga0207647_10011182 | 3300025904 | Bacteria | 6306 |
| 368 | Ga0207647_10021006 | 3300025904 | Bacteria | 4365 |
| 369 | Ga0207647_10089085 | 3300025904 | Bacteria | 1842 |
| 370 | Ga0207647_10229705 | 3300025904 | Bacteria | 1068 |
| 371 | Ga0207645_10016258 | 3300025907 | Bacteria | 4928 |
| 372 | Ga0207705_10005161 | 3300025909 | Bacteria | 9790 |
| 373 | Ga0207705_10037796 | 3300025909 | Bacteria | 3454 |
| 374 | Ga0207705_10320970 | 3300025909 | Bacteria | 1190 |
| 375 | Ga0207684_10065777 | 3300025910 | Bacteria | 3078 |
| 376 | Ga0207654_10266819 | 3300025911 | Bacteria | 1153 |
| 377 | Ga0207654_10749404 | 3300025911 | Bacteria | 703 |
| 378 | Ga0207695_10019161 | 3300025913 | Bacteria | 7884 |
| 379 | Ga0207695_10035571 | 3300025913 | Bacteria | 5399 |
| 380 | Ga0207695_10062843 | 3300025913 | Bacteria | 3831 |
| 381 | Ga0207695_10130634 | 3300025913 | Bacteria | 2470 |
| 382 | Ga0207695_10226377 | 3300025913 | Bacteria | 1776 |
| 383 | Ga0207695_10265284 | 3300025913 | Bacteria | 1614 |
| 384 | Ga0207695_10692617 | 3300025913 | Bacteria | 900 |
| 385 | Ga0207671_10059265 | 3300025914 | Bacteria | 2839 |
| 386 | Ga0207671_10245574 | 3300025914 | Bacteria | 1407 |
| 387 | Ga0207671_10395458 | 3300025914 | Bacteria | 1099 |
| 388 | Ga0207657_10000044 | 3300025919 | Bacteria | 116398 |
| 389 | Ga0207657_10009206 | 3300025919 | Bacteria | 9955 |
| 390 | Ga0207657_10206367 | 3300025919 | Bacteria | 1579 |
| 391 | Ga0207657_10622836 | 3300025919 | Bacteria | 841 |
| 392 | Ga0207649_10000636 | 3300025920 | Bacteria | 23444 |
| 393 | Ga0207649_10007131 | 3300025920 | Bacteria | 6077 |
| 394 | Ga0207649_10028729 | 3300025920 | Bacteria | 3277 |
| 395 | Ga0207649_10148298 | 3300025920 | Bacteria | 1613 |
| 396 | Ga0207646_10025442 | 3300025922 | Bacteria | 5414 |
| 397 | Ga0207681_10046278 | 3300025923 | Bacteria | 2926 |
| 398 | Ga0207694_10004421 | 3300025924 | Bacteria | 10990 |
| 399 | Ga0207694_10363183 | 3300025924 | Bacteria | 1200 |
| 400 | Ga0207694_10428874 | 3300025924 | Bacteria | 1102 |
| 401 | Ga0207650_10255989 | 3300025925 | Bacteria | 1419 |
| 402 | Ga0207659_10171436 | 3300025926 | Bacteria | 1712 |
| 403 | Ga0207644_10392234 | 3300025931 | Bacteria | 1133 |
| 404 | Ga0207644_10666691 | 3300025931 | Bacteria | 866 |
| 405 | Ga0207690_10000046 | 3300025932 | Bacteria | 116358 |
| 406 | Ga0207690_10001085 | 3300025932 | Bacteria | 17371 |
| 407 | Ga0207690_10002717 | 3300025932 | Bacteria | 10679 |
| 408 | Ga0207706_10183589 | 3300025933 | Bacteria | 1837 |
| 409 | Ga0207686_10006359 | 3300025934 | Bacteria | 6356 |
| 410 | Ga0207709_10000599 | 3300025935 | Bacteria | 30037 |
| 411 | Ga0207711_10036836 | 3300025941 | Bacteria | 4152 |
| 412 | Ga0207661_11066830 | 3300025944 | Bacteria | 744 |
| 413 | Ga0207679_10000012 | 3300025945 | Bacteria | 339773 |
| 414 | Ga0207679_10000107 | 3300025945 | Bacteria | 68403 |
| 415 | Ga0207679_10103628 | 3300025945 | Bacteria | 2230 |
| 416 | Ga0207679_10147977 | 3300025945 | Bacteria | 1907 |
| 417 | Ga0207667_10003134 | 3300025949 | Bacteria | 20466 |
| 418 | Ga0207667_10012254 | 3300025949 | Bacteria | 9900 |
| 419 | Ga0207667_10034287 | 3300025949 | Bacteria | 5451 |
| 420 | Ga0207667_10116761 | 3300025949 | Bacteria | 2750 |
| 421 | Ga0207667_10177509 | 3300025949 | Bacteria | 2188 |
| 422 | Ga0207712_10324177 | 3300025961 | Bacteria | 1272 |
| 423 | Ga0207668_10098962 | 3300025972 | Bacteria | 2162 |
| 424 | Ga0207640_10000012 | 3300025981 | Bacteria | 242060 |
| 425 | Ga0207640_10007735 | 3300025981 | Bacteria | 5938 |
| 426 | Ga0207640_10107318 | 3300025981 | Bacteria | 1971 |
| 427 | Ga0207658_10046242 | 3300025986 | Bacteria | 3177 |
| 428 | Ga0207658_10096082 | 3300025986 | Bacteria | 2310 |
| 429 | Ga0207703_10523097 | 3300026035 | Bacteria | 1116 |
| 430 | Ga0207639_10170680 | 3300026041 | Bacteria | 1842 |
| 431 | Ga0207639_10443322 | 3300026041 | Bacteria | 1177 |
| 432 | Ga0207639_10587781 | 3300026041 | Bacteria | 1026 |
| 433 | Ga0207678_10000009 | 3300026067 | Bacteria | 156690 |
| 434 | Ga0207678_10000286 | 3300026067 | Bacteria | 45712 |
| 435 | Ga0207678_10003470 | 3300026067 | Bacteria | 14193 |
| 436 | Ga0207678_10094921 | 3300026067 | Bacteria | 2549 |
| 437 | Ga0207678_10133310 | 3300026067 | Bacteria | 2120 |
| 438 | Ga0207678_10180375 | 3300026067 | Bacteria | 1803 |
| 439 | Ga0207702_10000028 | 3300026078 | Bacteria | 183005 |
| 440 | Ga0207702_10000033 | 3300026078 | Bacteria | 166621 |
| 441 | Ga0207641_10417029 | 3300026088 | Bacteria | 1292 |
| 442 | Ga0207648_10000039 | 3300026089 | Bacteria | 118860 |
| 443 | Ga0207648_10039290 | 3300026089 | Bacteria | 4161 |
| 444 | Ga0207674_10012807 | 3300026116 | Bacteria | 9363 |
| 445 | Ga0207674_10017935 | 3300026116 | Bacteria | 7714 |
| 446 | Ga0207683_10467220 | 3300026121 | Bacteria | 1164 |
| 447 | Ga0207698_10028878 | 3300026142 | Bacteria | 3963 |
| 448 | Ga0207698_10044239 | 3300026142 | Bacteria | 3344 |
| 449 | Ga0207698_10082320 | 3300026142 | Bacteria | 2601 |
| 450 | Ga0209281_1000039 | 3300027111 | Bacteria | 355150 |
| 451 | Ga0209281_1000072 | 3300027111 | Bacteria | 273114 |
| 452 | Ga0209281_1032752 | 3300027111 | Bacteria | 917 |
| 453 | Ga0209389_1004640 | 3300027296 | Bacteria | 11506 |
| 454 | Ga0209371_1000145 | 3300027312 | Bacteria | 116135 |
| 455 | Ga0209371_1003991 | 3300027312 | Bacteria | 6715 |
| 456 | Ga0209371_1005262 | 3300027312 | Bacteria | 5215 |
| 457 | Ga0209282_1000061 | 3300027666 | Bacteria | 96444 |
| 458 | Ga0209974_10001718 | 3300027876 | Bacteria | 7948 |
| 459 | Ga0268265_10576516 | 3300028380 | Bacteria | 1072 |
| 460 | Ga0307517_10003885 | 3300028786 | Bacteria | 23168 |
| 461 | Ga0307517_10182552 | 3300028786 | Bacteria | 1351 |
| 462 | Ga0307517_10425588 | 3300028786 | Bacteria | 695 |
| 463 | Ga0307515_10000013 | 3300028794 | Bacteria | 568456 |
| 464 | Ga0307515_10000179 | 3300028794 | Bacteria | 156716 |
| 465 | Ga0307515_10000239 | 3300028794 | Bacteria | 135971 |
| 466 | Ga0307515_10001166 | 3300028794 | Bacteria | 60153 |
| 467 | Ga0307515_10019026 | 3300028794 | Bacteria | 12392 |
| 468 | Ga0307515_10049706 | 3300028794 | Bacteria | 6299 |
| 469 | Ga0307515_10140165 | 3300028794 | Bacteria | 2599 |
| 470 | Ga0265338_10000087 | 3300028800 | Bacteria | 174926 |
| 471 | Ga0268256_1000128 | 3300030500 | Bacteria | 108651 |
| 472 | Ga0268256_1003719 | 3300030500 | Bacteria | 6715 |
| 473 | Ga0268256_1006515 | 3300030500 | Bacteria | 4324 |
| 474 | Ga0265328_10005564 | 3300031239 | Bacteria | 5390 |
| 475 | Ga0265328_10083473 | 3300031239 | Bacteria | 1178 |
| 476 | Ga0265325_10017793 | 3300031241 | Bacteria | 3948 |
| 477 | Ga0265340_10037151 | 3300031247 | Bacteria | 2413 |
| 478 | Ga0265327_10000147 | 3300031251 | Bacteria | 153254 |
| 479 | Ga0307513_10025671 | 3300031456 | Bacteria | 6818 |
| 480 | Ga0307513_10031954 | 3300031456 | Bacteria | 5948 |
| 481 | Ga0307513_10137233 | 3300031456 | Bacteria | 2379 |
| 482 | Ga0307509_10095836 | 3300031507 | Bacteria | 3021 |
| 483 | Ga0307509_10147894 | 3300031507 | Bacteria | 2271 |
| 484 | Ga0307509_10170107 | 3300031507 | Bacteria | 2060 |
| 485 | Ga0307408_100000298 | 3300031548 | Bacteria | 47947 |
| 486 | Ga0307408_100002033 | 3300031548 | Bacteria | 14565 |
| 487 | Ga0307408_100542698 | 3300031548 | Bacteria | 1025 |
| 488 | Ga0307508_10000048 | 3300031616 | Bacteria | 137587 |
| 489 | Ga0307508_10000122 | 3300031616 | Bacteria | 92612 |
| 490 | Ga0307508_10010633 | 3300031616 | Bacteria | 8413 |
| 491 | Ga0307514_10000595 | 3300031649 | Bacteria | 67797 |
| 492 | Ga0307514_10022005 | 3300031649 | Bacteria | 5190 |
| 493 | Ga0307514_10026307 | 3300031649 | Bacteria | 4706 |
| 494 | Ga0307514_10140682 | 3300031649 | Bacteria | 1641 |
| 495 | Ga0307514_10300458 | 3300031649 | Bacteria | 900 |
| 496 | Ga0307516_10000723 | 3300031730 | Bacteria | 45058 |
| 497 | Ga0307516_10002560 | 3300031730 | Bacteria | 24182 |
| 498 | Ga0307516_10005879 | 3300031730 | Bacteria | 14519 |
| 499 | Ga0307516_10051506 | 3300031730 | Bacteria | 4035 |
| 500 | Ga0307516_10331408 | 3300031730 | Bacteria | 1191 |
| 501 | Ga0307516_10442238 | 3300031730 | Bacteria | 957 |
| 502 | Ga0307516_10539279 | 3300031730 | Bacteria | 820 |
| 503 | Ga0307516_10661095 | 3300031730 | Bacteria | 700 |
| 504 | Ga0307405_10006050 | 3300031731 | Bacteria | 5918 |
| 505 | Ga0307405_10270003 | 3300031731 | Bacteria | 1275 |
| 506 | Ga0307405_10614616 | 3300031731 | Bacteria | 889 |
| 507 | Ga0307410_10115502 | 3300031852 | Bacteria | 1949 |
| 508 | Ga0307406_10006328 | 3300031901 | Bacteria | 6532 |
| 509 | Ga0307412_10000011 | 3300031911 | Bacteria | 405842 |
| 510 | Ga0307412_10203691 | 3300031911 | Bacteria | 1504 |
| 511 | Ga0307412_10472554 | 3300031911 | Bacteria | 1038 |
| 512 | Ga0307409_100006395 | 3300031995 | Bacteria | 6918 |
| 513 | Ga0307416_100046596 | 3300032002 | Bacteria | 3423 |
| 514 | Ga0307411_10087012 | 3300032005 | Bacteria | 2169 |
| 515 | Ga0307411_11391360 | 3300032005 | Bacteria | 642 |
| 516 | Ga0307507_10014209 | 3300033179 | Bacteria | 9527 |
| 517 | Ga0307510_10173162 | 3300033180 | Bacteria | 1733 |
| 518 | Ga0373938_0040706 | 3300034957 | Bacteria | 1031 |
| 519 | Ga0373928_0054127 | 3300035084 | Bacteria | 955 |
| 520 | Ga0373931_0008015 | 3300035691 | Bacteria | 4998 |
| 521 | Ga0373927_0258380 | 3300035695 | Unclassified | 1145 |
| 522 | Ga0395899_0000421 | 3300037312 | Bacteria | 49097 |
| 523 | Ga0395899_0003093 | 3300037312 | Bacteria | 13244 |
| 524 | Ga0395899_0178662 | 3300037312 | Bacteria | 1491 |
| 525 | Ga0395900_0000159 | 3300037418 | Bacteria | 111486 |
| 526 | Ga0395900_0000445 | 3300037418 | Bacteria | 59139 |
| 527 | Ga0395900_0011343 | 3300037418 | Bacteria | 9117 |
| 528 | Ga0395900_0051796 | 3300037418 | Bacteria | 4227 |
| 529 | Ga0395900_0089267 | 3300037418 | Bacteria | 3168 |
| 530 | Ga0395900_0102691 | 3300037418 | Bacteria | 2937 |
| 531 | Ga0395898_0000425 | 3300037466 | Bacteria | 89768 |
| 532 | Ga0395898_0002174 | 3300037466 | Bacteria | 24017 |
| 533 | Ga0395898_0005757 | 3300037466 | Bacteria | 13337 |
| 534 | Ga0395898_0045538 | 3300037466 | Bacteria | 4312 |
| 535 | Ga0395898_0610299 | 3300037466 | Bacteria | 1034 |
| 536 | Ga0395898_1217434 | 3300037466 | Bacteria | 684 |
| 537 | Ga0395905_0000079 | 3300037471 | Bacteria | 160663 |
| 538 | Ga0395905_0016607 | 3300037471 | Bacteria | 6996 |
| 539 | Ga0395905_0016928 | 3300037471 | Bacteria | 6924 |
| 540 | Ga0395905_0032505 | 3300037471 | Bacteria | 4907 |
| 541 | Ga0395905_0054569 | 3300037471 | Bacteria | 3739 |
| 542 | Ga0395901_0000017 | 3300038443 | Bacteria | 345003 |
| 543 | Ga0395901_0000109 | 3300038443 | Bacteria | 112882 |
| 544 | Ga0395901_0009637 | 3300038443 | Bacteria | 9798 |
| 545 | Ga0395901_0065312 | 3300038443 | Bacteria | 3788 |
| 546 | Ga0436365_0055475 | 3300039437 | Bacteria | 931 |
| 547 | Ga0436360_1271525 | 3300039438 | Bacteria | 1554 |
| 548 | Ga0436361_0276814 | 3300039447 | Bacteria | 3203 |
| 549 | Ga0436361_0357138 | 3300039447 | Bacteria | 585 |
| 550 | Ga0436361_0474915 | 3300039447 | Bacteria | 5639 |
| 551 | Ga0439436_0124971 | 3300041404 | Bacteria | 720 |
| 552 | Ga0439465_0058776 | 3300041413 | Bacteria | 1271 |
| 553 | Ga0451800_1689085 | 3300041459 | Bacteria | 1607 |
| 554 | Ga0451807_1399310 | 3300041486 | Bacteria | 855 |
| 555 | Ga0451807_2771500 | 3300041486 | Bacteria | 986 |
| 556 | Ga0451839_1646275 | 3300041496 | Bacteria | 779 |
| 557 | Ga0451841_0602513 | 3300041498 | Bacteria | 1107 |
| 558 | Ga0451853_3184930 | 3300041512 | Bacteria | 1426 |
| 559 | Ga0439431_0009103 | 3300041997 | Bacteria | 2238 |
| 560 | Ga0439448_0000197 | 3300042005 | Bacteria | 12508 |
| 561 | Ga0450914_019216 | 3300042118 | Bacteria | 748 |
| 562 | Ga0450919_000557 | 3300042121 | Bacteria | 4687 |
| 563 | Ga0450888_015827 | 3300042126 | Bacteria | 924 |
| 564 | Ga0439458_0060548 | 3300042157 | Bacteria | 945 |
| 565 | Ga0439459_0001457 | 3300042438 | Bacteria | 3491 |
| 566 | Ga0450918_000035 | 3300042531 | Bacteria | 27883 |
| 567 | Ga0451577_0002691 | 3300042876 | Bacteria | 20720 |
| 568 | Ga0451577_0011641 | 3300042876 | Bacteria | 8305 |
| 569 | Ga0451577_0021420 | 3300042876 | Bacteria | 5916 |
| 570 | Ga0451577_0051158 | 3300042876 | Bacteria | 3688 |
| 571 | Ga0451577_0206362 | 3300042876 | Bacteria | 1774 |
| 572 | Ga0451577_0267325 | 3300042876 | Bacteria | 1549 |
| 573 | Ga0451577_0363728 | 3300042876 | Bacteria | 1312 |
| 574 | Ga0451577_0494385 | 3300042876 | Bacteria | 1111 |
| 575 | Ga0466969_0000493 | 3300044656 | Bacteria | 21548 |
| 576 | Ga0466969_0037388 | 3300044656 | Bacteria | 2448 |
| 577 | Ga0466969_0049749 | 3300044656 | Bacteria | 2067 |
| 578 | Ga0466969_0160165 | 3300044656 | Bacteria | 1034 |
| 579 | Ga0466969_0189302 | 3300044656 | Bacteria | 940 |
| 580 | Ga0466972_0103660 | 3300044658 | Bacteria | 1345 |
| 581 | Ga0466972_0142132 | 3300044658 | Bacteria | 1129 |
| 582 | Ga0466973_0089504 | 3300044659 | Bacteria | 2657 |
| 583 | Ga0466977_0000673 | 3300044666 | Bacteria | 12021 |
| 584 | Ga0466978_0016741 | 3300044671 | Bacteria | 4239 |
| 585 | Ga0466978_0448168 | 3300044671 | Bacteria | 679 |
| 586 | Ga0453683_0321818 | 3300044673 | Bacteria | 991 |
| 587 | Ga0453683_0660378 | 3300044673 | Bacteria | 684 |
| 588 | Ga0453683_0667859 | 3300044673 | Bacteria | 680 |
| 589 | Ga0466965_0003295 | 3300044683 | Bacteria | 7063 |
| 590 | Ga0466965_0004833 | 3300044683 | Bacteria | 6011 |
| 591 | Ga0466965_0096356 | 3300044683 | Bacteria | 1509 |
| 592 | Ga0466965_0286824 | 3300044683 | Bacteria | 890 |
| 593 | Ga0466966_0000431 | 3300044684 | Bacteria | 26967 |
| 594 | Ga0466966_0006383 | 3300044684 | Bacteria | 7796 |
| 595 | Ga0466966_0013580 | 3300044684 | Bacteria | 5388 |
| 596 | Ga0466966_0278330 | 3300044684 | Bacteria | 1006 |
| 597 | Ga0466961_0000698 | 3300044693 | Bacteria | 21199 |
| 598 | Ga0466961_0001496 | 3300044693 | Bacteria | 14495 |
| 599 | Ga0466961_0038919 | 3300044693 | Bacteria | 3049 |
| 600 | Ga0466961_0044697 | 3300044693 | Bacteria | 2834 |
| 601 | Ga0466961_0049456 | 3300044693 | Bacteria | 2687 |
| 602 | Ga0466961_0175587 | 3300044693 | Bacteria | 1331 |
| 603 | Ga0466961_0180486 | 3300044693 | Bacteria | 1311 |
| 604 | Ga0466963_0014335 | 3300044694 | Bacteria | 4886 |
| 605 | Ga0466963_0028670 | 3300044694 | Bacteria | 3577 |
| 606 | Ga0466963_0050273 | 3300044694 | Bacteria | 2759 |
| 607 | Ga0466963_0335880 | 3300044694 | Bacteria | 1064 |
| 608 | Ga0466964_0047790 | 3300044706 | Bacteria | 1747 |
| 609 | Ga0453684_0000222 | 3300044712 | Bacteria | 249870 |
| 610 | Ga0453684_0000566 | 3300044712 | Bacteria | 138895 |
| 611 | Ga0453684_0000659 | 3300044712 | Bacteria | 123941 |
| 612 | Ga0453684_0001598 | 3300044712 | Bacteria | 62237 |
| 613 | Ga0453684_0143536 | 3300044712 | Bacteria | 2847 |
| 614 | Ga0453684_0163016 | 3300044712 | Bacteria | 2635 |
| 615 | Ga0466971_0001521 | 3300044719 | Bacteria | 9780 |
| 616 | Ga0466971_0007298 | 3300044719 | Bacteria | 4812 |
| 617 | Ga0466971_0031567 | 3300044719 | Bacteria | 2372 |
| 618 | Ga0466971_0131728 | 3300044719 | Bacteria | 1161 |
| 619 | Ga0466968_0062191 | 3300044735 | Bacteria | 1611 |
| 620 | Ga0466970_0122243 | 3300044765 | Bacteria | 1426 |
| 621 | Ga0466970_0305069 | 3300044765 | Bacteria | 898 |
| 622 | Ga0466957_0037134 | 3300044842 | Bacteria | 2932 |
| 623 | Ga0466957_0039769 | 3300044842 | Bacteria | 2838 |
| 624 | Ga0466957_0090802 | 3300044842 | Bacteria | 1913 |
| 625 | Ga0466957_0339861 | 3300044842 | Bacteria | 1016 |
| 626 | Ga0466957_0359606 | 3300044842 | Bacteria | 989 |
| 627 | Ga0466957_0554382 | 3300044842 | Bacteria | 801 |
| 628 | Ga0466959_0001907 | 3300045049 | Bacteria | 13111 |
| 629 | Ga0466959_0012308 | 3300045049 | Bacteria | 6177 |
| 630 | Ga0466959_0017092 | 3300045049 | Bacteria | 5311 |
| 631 | Ga0466959_0063301 | 3300045049 | Bacteria | 2686 |
| 632 | Ga0466959_0318101 | 3300045049 | Bacteria | 1064 |
| 633 | Ga0451576_0000169 | 3300045051 | Bacteria | 164329 |
| 634 | Ga0451576_0143833 | 3300045051 | Bacteria | 2486 |
| 635 | Ga0451576_0206374 | 3300045051 | Bacteria | 2052 |
| 636 | Ga0451576_0502204 | 3300045051 | Bacteria | 1274 |
| 637 | Ga0451576_1030071 | 3300045051 | Bacteria | 862 |
| 638 | Ga0466958_0007430 | 3300045836 | Bacteria | 6029 |
| 639 | Ga0466958_0015060 | 3300045836 | Bacteria | 4424 |
| 640 | Ga0466958_0134903 | 3300045836 | Bacteria | 1552 |
| 641 | Ga0466958_0168946 | 3300045836 | Bacteria | 1384 |
| 642 | Ga0466967_0146710 | 3300045976 | Bacteria | 2201 |
| 643 | Ga0495592_0050852 | 3300046454 | Bacteria | 3078 |
| 644 | Ga0495592_0067818 | 3300046454 | Bacteria | 2605 |
| 645 | Ga0495592_0089242 | 3300046454 | Bacteria | 2214 |
| 646 | Ga0495603_0009839 | 3300046455 | Bacteria | 5786 |
| 647 | Ga0495603_0017889 | 3300046455 | Bacteria | 4289 |
| 648 | Ga0495603_0126336 | 3300046455 | Bacteria | 1490 |
| 649 | Ga0495590_0004166 | 3300046457 | Bacteria | 5852 |
| 650 | Ga0495590_0008265 | 3300046457 | Bacteria | 3977 |
| 651 | Ga0495590_0012809 | 3300046457 | Bacteria | 3098 |
| 652 | Ga0495590_0021061 | 3300046457 | Bacteria | 2313 |
| 653 | Ga0495629_0000350 | 3300046459 | Bacteria | 39162 |
| 654 | Ga0495629_0000676 | 3300046459 | Bacteria | 27681 |
| 655 | Ga0495629_0001209 | 3300046459 | Bacteria | 20272 |
| 656 | Ga0495629_0011325 | 3300046459 | Bacteria | 6478 |
| 657 | Ga0495629_0117026 | 3300046459 | Bacteria | 1857 |
| 658 | Ga0495629_0323723 | 3300046459 | Bacteria | 1053 |
| 659 | Ga0495629_0398243 | 3300046459 | Bacteria | 936 |
| 660 | Ga0495638_0012433 | 3300046460 | Bacteria | 5836 |
| 661 | Ga0495638_0073743 | 3300046460 | Bacteria | 2082 |
| 662 | Ga0495641_0018783 | 3300046461 | Bacteria | 3558 |
| 663 | Ga0495641_0048066 | 3300046461 | Bacteria | 1957 |
| 664 | Ga0495651_0018210 | 3300046462 | Bacteria | 5438 |
| 665 | Ga0495651_0091459 | 3300046462 | Bacteria | 2280 |
| 666 | Ga0495653_0013167 | 3300046463 | Bacteria | 6744 |
| 667 | Ga0495653_0026233 | 3300046463 | Bacteria | 4675 |
| 668 | Ga0495653_0075356 | 3300046463 | Bacteria | 2511 |
| 669 | Ga0495653_0085820 | 3300046463 | Bacteria | 2314 |
| 670 | Ga0495650_0003448 | 3300046471 | Bacteria | 11529 |
| 671 | Ga0495650_0009266 | 3300046471 | Bacteria | 5621 |
| 672 | Ga0495650_0023967 | 3300046471 | Bacteria | 2892 |
| 673 | Ga0495650_0025851 | 3300046471 | Bacteria | 2742 |
| 674 | Ga0495650_0028449 | 3300046471 | Bacteria | 2565 |
| 675 | Ga0495650_0033224 | 3300046471 | Bacteria | 2298 |
| 676 | Ga0495650_0041177 | 3300046471 | Bacteria | 1977 |
| 677 | Ga0495580_0000001 | 3300046472 | Bacteria | 180598 |
| 678 | Ga0495580_0009533 | 3300046472 | Bacteria | 7631 |
| 679 | Ga0495580_0019500 | 3300046472 | Bacteria | 5038 |
| 680 | Ga0495580_0030923 | 3300046472 | Bacteria | 3872 |
| 681 | Ga0495580_0099457 | 3300046472 | Bacteria | 2023 |
| 682 | Ga0495580_0120524 | 3300046472 | Bacteria | 1821 |
| 683 | Ga0495580_0225977 | 3300046472 | Bacteria | 1285 |
| 684 | Ga0495580_0275515 | 3300046472 | Bacteria | 1148 |
| 685 | Ga0495580_0334625 | 3300046472 | Bacteria | 1027 |
| 686 | Ga0495582_0002692 | 3300046473 | Bacteria | 9920 |
| 687 | Ga0495582_0012374 | 3300046473 | Bacteria | 4700 |
| 688 | Ga0495605_0011540 | 3300046474 | Bacteria | 4921 |
| 689 | Ga0495605_0013340 | 3300046474 | Bacteria | 4531 |
| 690 | Ga0495605_0028772 | 3300046474 | Bacteria | 2866 |
| 691 | Ga0495605_0043489 | 3300046474 | Bacteria | 2226 |
| 692 | Ga0495605_0138791 | 3300046474 | Bacteria | 1092 |
| 693 | Ga0495605_0258373 | 3300046474 | Bacteria | 744 |
| 694 | Ga0495662_0025265 | 3300046476 | Bacteria | 2868 |
| 695 | Ga0495664_0002647 | 3300046477 | Bacteria | 9631 |
| 696 | Ga0495664_0016595 | 3300046477 | Bacteria | 4197 |
| 697 | Ga0495664_0082556 | 3300046477 | Bacteria | 1927 |
| 698 | Ga0495664_0127317 | 3300046477 | Bacteria | 1541 |
| 699 | Ga0495664_0148094 | 3300046477 | Bacteria | 1424 |
| 700 | Ga0495664_0181461 | 3300046477 | Bacteria | 1276 |
| 701 | Ga0495664_0370809 | 3300046477 | Bacteria | 861 |
| 702 | Ga0495584_0028382 | 3300046491 | Bacteria | 2836 |
| 703 | Ga0495585_0024408 | 3300046492 | Bacteria | 3467 |
| 704 | Ga0495585_0073044 | 3300046492 | Bacteria | 1868 |
| 705 | Ga0495594_0053840 | 3300046499 | Bacteria | 2217 |
| 706 | Ga0495596_0022238 | 3300046500 | Bacteria | 2582 |
| 707 | Ga0495596_0025511 | 3300046500 | Bacteria | 2389 |
| 708 | Ga0495596_0031853 | 3300046500 | Bacteria | 2104 |
| 709 | Ga0495596_0051645 | 3300046500 | Bacteria | 1610 |
| 710 | Ga0495607_0000044 | 3300046501 | Bacteria | 125410 |
| 711 | Ga0495607_0058822 | 3300046501 | Bacteria | 2195 |
| 712 | Ga0495583_0011505 | 3300046506 | Bacteria | 5074 |
| 713 | Ga0495583_0097030 | 3300046506 | Bacteria | 1262 |
| 714 | Ga0495583_0131706 | 3300046506 | Bacteria | 1046 |
| 715 | Ga0495606_0016268 | 3300046507 | Bacteria | 5680 |
| 716 | Ga0495606_0020827 | 3300046507 | Bacteria | 4820 |
| 717 | Ga0495606_0058889 | 3300046507 | Bacteria | 2466 |
| 718 | Ga0495606_0072777 | 3300046507 | Bacteria | 2158 |
| 719 | Ga0495606_0093316 | 3300046507 | Bacteria | 1846 |
| 720 | Ga0495606_0101390 | 3300046507 | Bacteria | 1752 |
| 721 | Ga0495606_0241107 | 3300046507 | Bacteria | 1008 |
| 722 | Ga0495606_0377099 | 3300046507 | Bacteria | 745 |
| 723 | Ga0495608_0062016 | 3300046511 | Bacteria | 2457 |
| 724 | Ga0495608_0194132 | 3300046511 | Bacteria | 1281 |
| 725 | Ga0495608_0194515 | 3300046511 | Bacteria | 1279 |
| 726 | Ga0495610_0030270 | 3300046512 | Bacteria | 2839 |
| 727 | Ga0495610_0049719 | 3300046512 | Bacteria | 2051 |
| 728 | Ga0495610_0057701 | 3300046512 | Bacteria | 1861 |
| 729 | Ga0495610_0125608 | 3300046512 | Bacteria | 1119 |
| 730 | Ga0495610_0135091 | 3300046512 | Bacteria | 1067 |
| 731 | Ga0495616_0007919 | 3300046513 | Bacteria | 6333 |
| 732 | Ga0495618_0003677 | 3300046514 | Bacteria | 9509 |
| 733 | Ga0495618_0054176 | 3300046514 | Bacteria | 2537 |
| 734 | Ga0495618_0368817 | 3300046514 | Bacteria | 882 |
| 735 | Ga0495620_0015323 | 3300046515 | Bacteria | 3874 |
| 736 | Ga0495620_0020708 | 3300046515 | Bacteria | 3208 |
| 737 | Ga0495620_0065208 | 3300046515 | Bacteria | 1504 |
| 738 | Ga0495628_0000262 | 3300046516 | Bacteria | 46877 |
| 739 | Ga0495628_0023102 | 3300046516 | Bacteria | 5106 |
| 740 | Ga0495628_0026203 | 3300046516 | Bacteria | 4758 |
| 741 | Ga0495628_0046943 | 3300046516 | Bacteria | 3428 |
| 742 | Ga0495628_0351805 | 3300046516 | Bacteria | 1083 |
| 743 | Ga0495630_0004146 | 3300046517 | Bacteria | 10151 |
| 744 | Ga0495630_0049487 | 3300046517 | Bacteria | 3145 |
| 745 | Ga0495630_0057140 | 3300046517 | Bacteria | 2924 |
| 746 | Ga0495630_0063604 | 3300046517 | Bacteria | 2772 |
| 747 | Ga0495631_0085976 | 3300046518 | Bacteria | 1355 |
| 748 | Ga0495632_0005415 | 3300046519 | Bacteria | 8442 |
| 749 | Ga0495632_0021619 | 3300046519 | Bacteria | 3464 |
| 750 | Ga0495643_0192830 | 3300046522 | Bacteria | 983 |
| 751 | Ga0495643_0239942 | 3300046522 | Bacteria | 851 |
| 752 | Ga0495644_0125517 | 3300046523 | Bacteria | 977 |
| 753 | Ga0495648_0012471 | 3300046524 | Bacteria | 6338 |
| 754 | Ga0495648_0012802 | 3300046524 | Bacteria | 6228 |
| 755 | Ga0495648_0019099 | 3300046524 | Bacteria | 4832 |
| 756 | Ga0495648_0095490 | 3300046524 | Bacteria | 1654 |
| 757 | Ga0495666_0004161 | 3300046526 | Bacteria | 7299 |
| 758 | Ga0495666_0006932 | 3300046526 | Bacteria | 5692 |
| 759 | Ga0495666_0010532 | 3300046526 | Bacteria | 4608 |
| 760 | Ga0495642_0043013 | 3300046528 | Bacteria | 1842 |
| 761 | Ga0495642_0052150 | 3300046528 | Bacteria | 1684 |
| 762 | Ga0495642_0067527 | 3300046528 | Bacteria | 1491 |
| 763 | Ga0495642_0129195 | 3300046528 | Bacteria | 1087 |
| 764 | Ga0495642_0136903 | 3300046528 | Bacteria | 1056 |
| 765 | Ga0495652_0017575 | 3300046529 | Bacteria | 6380 |
| 766 | Ga0495652_0023307 | 3300046529 | Bacteria | 5488 |
| 767 | Ga0495652_0025263 | 3300046529 | Bacteria | 5257 |
| 768 | Ga0495652_0060455 | 3300046529 | Bacteria | 3202 |
| 769 | Ga0495654_0043090 | 3300046530 | Bacteria | 2238 |
| 770 | Ga0495654_0180336 | 3300046530 | Bacteria | 915 |
| 771 | Ga0495665_0003952 | 3300046531 | Bacteria | 8015 |
| 772 | Ga0495665_0011526 | 3300046531 | Bacteria | 4785 |
| 773 | Ga0495665_0013158 | 3300046531 | Bacteria | 4478 |
| 774 | Ga0495665_0014545 | 3300046531 | Bacteria | 4243 |
| 775 | Ga0495665_0027170 | 3300046531 | Bacteria | 3073 |
| 776 | Ga0495640_0005464 | 3300046533 | Bacteria | 10109 |
| 777 | Ga0495640_0026890 | 3300046533 | Bacteria | 4152 |
| 778 | Ga0495640_0047455 | 3300046533 | Bacteria | 2972 |
| 779 | Ga0495586_0001325 | 3300046535 | Bacteria | 13758 |
| 780 | Ga0495587_0043356 | 3300046536 | Bacteria | 2679 |
| 781 | Ga0495609_0032863 | 3300046538 | Bacteria | 2355 |
| 782 | Ga0495597_0003643 | 3300046542 | Bacteria | 8851 |
| 783 | Ga0495597_0030019 | 3300046542 | Bacteria | 2479 |
| 784 | Ga0495597_0242185 | 3300046542 | Bacteria | 711 |
| 785 | Ga0495645_0003095 | 3300046543 | Bacteria | 11267 |
| 786 | Ga0495645_0034987 | 3300046543 | Bacteria | 3662 |
| 787 | Ga0495645_0050757 | 3300046543 | Bacteria | 3019 |
| 788 | Ga0495645_0082140 | 3300046543 | Bacteria | 2311 |
| 789 | Ga0495622_0000323 | 3300046557 | Bacteria | 35189 |
| 790 | Ga0495622_0072903 | 3300046557 | Bacteria | 1584 |
| 791 | Ga0495667_0091605 | 3300046559 | Bacteria | 1969 |
| 792 | Ga0495667_0306212 | 3300046559 | Bacteria | 1006 |
| 793 | Ga0495668_0579891 | 3300046616 | Bacteria | 619 |
| 794 | Ga0495634_0012324 | 3300046642 | Bacteria | 6195 |
| 795 | Ga0495634_0017115 | 3300046642 | Bacteria | 5176 |
| 796 | Ga0495634_0021353 | 3300046642 | Bacteria | 4577 |
| 797 | Ga0495634_0123088 | 3300046642 | Bacteria | 1660 |
| 798 | Ga0495611_0026094 | 3300046648 | Bacteria | 2549 |
| 799 | Ga0495611_0055137 | 3300046648 | Bacteria | 1798 |
| 800 | Ga0495625_0006884 | 3300046660 | Bacteria | 10036 |
| 801 | Ga0495625_0118480 | 3300046660 | Bacteria | 1804 |
| 802 | Ga0495635_0000381 | 3300046663 | Bacteria | 28175 |
| 803 | Ga0495635_0009189 | 3300046663 | Bacteria | 6902 |
| 804 | Ga0495635_0011998 | 3300046663 | Bacteria | 6072 |
| 805 | Ga0495661_0014497 | 3300046665 | Bacteria | 5279 |
| 806 | Ga0495661_0021507 | 3300046665 | Bacteria | 4205 |
| 807 | Ga0495661_0045087 | 3300046665 | Bacteria | 2698 |
| 808 | Ga0495661_0142680 | 3300046665 | Bacteria | 1301 |
| 809 | Ga0495657_0032130 | 3300046675 | Bacteria | 3666 |
| 810 | Ga0495599_0026415 | 3300046678 | Bacteria | 3638 |
| 811 | Ga0495599_0050372 | 3300046678 | Bacteria | 2609 |
| 812 | Ga0495599_0057819 | 3300046678 | Bacteria | 2426 |
| 813 | Ga0495599_0481510 | 3300046678 | Bacteria | 732 |
| 814 | Ga0495623_0002662 | 3300046679 | Bacteria | 11799 |
| 815 | Ga0495623_0003990 | 3300046679 | Bacteria | 9716 |
| 816 | Ga0495646_0001984 | 3300046680 | Bacteria | 12344 |
| 817 | Ga0495646_0008866 | 3300046680 | Bacteria | 6387 |
| 818 | Ga0495646_0016544 | 3300046680 | Bacteria | 4682 |
| 819 | Ga0495646_0073419 | 3300046680 | Bacteria | 2009 |
| 820 | Ga0495646_0409117 | 3300046680 | Bacteria | 704 |
| 821 | Ga0495669_0087605 | 3300046684 | Bacteria | 1435 |
| 822 | Ga0495669_0156277 | 3300046684 | Bacteria | 1081 |
| 823 | Ga0495669_0199567 | 3300046684 | Bacteria | 956 |
| 824 | Ga0495669_0240464 | 3300046684 | Bacteria | 869 |
| 825 | Ga0495669_0279988 | 3300046684 | Bacteria | 802 |
| 826 | Ga0495669_0297907 | 3300046684 | Bacteria | 777 |
| 827 | Ga0495613_0010036 | 3300046689 | Bacteria | 7034 |
| 828 | Ga0495613_0029195 | 3300046689 | Bacteria | 4101 |
| 829 | Ga0495613_0290063 | 3300046689 | Bacteria | 1135 |
| 830 | Ga0495624_0004047 | 3300046690 | Bacteria | 10783 |
| 831 | Ga0495624_0015178 | 3300046690 | Bacteria | 5211 |
| 832 | Ga0495624_0041103 | 3300046690 | Bacteria | 2959 |
| 833 | Ga0495624_0072943 | 3300046690 | Bacteria | 2134 |
| 834 | Ga0495624_0081472 | 3300046690 | Bacteria | 2004 |
| 835 | Ga0495624_0276904 | 3300046690 | Bacteria | 1013 |
| 836 | Ga0495670_0027374 | 3300046691 | Bacteria | 2824 |
| 837 | Ga0495670_0059758 | 3300046691 | Bacteria | 1914 |
| 838 | Ga0495671_0011561 | 3300046692 | Bacteria | 4850 |
| 839 | Ga0495671_0035689 | 3300046692 | Bacteria | 2523 |
| 840 | Ga0495671_0190862 | 3300046692 | Bacteria | 995 |
| 841 | Ga0495649_0023864 | 3300046694 | Bacteria | 3415 |
| 842 | Ga0495649_0032962 | 3300046694 | Bacteria | 2852 |
| 843 | Ga0495649_0044504 | 3300046694 | Bacteria | 2423 |
| 844 | Ga0495649_0058728 | 3300046694 | Bacteria | 2072 |
| 845 | Ga0495649_0061512 | 3300046694 | Bacteria | 2018 |
| 846 | Ga0495649_0064137 | 3300046694 | Bacteria | 1973 |
| 847 | Ga0495649_0104511 | 3300046694 | Bacteria | 1504 |
| 848 | Ga0495649_0198861 | 3300046694 | Bacteria | 1041 |
| 849 | Ga0495589_0003622 | 3300046794 | Bacteria | 8341 |
| 850 | Ga0495589_0038158 | 3300046794 | Bacteria | 2406 |
| 851 | Ga0495589_0119675 | 3300046794 | Bacteria | 1268 |
| 852 | Ga0495600_0008130 | 3300046809 | Bacteria | 6437 |
| 853 | Ga0495600_0043890 | 3300046809 | Bacteria | 2916 |
| 854 | Ga0495660_0017159 | 3300046810 | Bacteria | 4170 |
| 855 | Ga0495660_0101677 | 3300046810 | Bacteria | 1479 |
| 856 | Ga0495660_0127836 | 3300046810 | Bacteria | 1278 |
| 857 | Ga0495660_0166222 | 3300046810 | Bacteria | 1078 |
| 858 | Ga0495581_0001082 | 3300047315 | Bacteria | 14814 |
| 859 | Ga0495581_0009759 | 3300047315 | Bacteria | 5556 |
| 860 | Ga0495581_0015272 | 3300047315 | Bacteria | 4458 |
| 861 | Ga0495604_0001718 | 3300047317 | Bacteria | 17961 |
| 862 | Ga0495604_0003130 | 3300047317 | Bacteria | 13230 |
| 863 | Ga0495604_0026680 | 3300047317 | Bacteria | 4597 |
| 864 | Ga0495604_0028005 | 3300047317 | Bacteria | 4481 |
| 865 | Ga0495604_0072782 | 3300047317 | Bacteria | 2596 |
| 866 | Ga0495604_0323952 | 3300047317 | Bacteria | 1029 |
| 867 | Ga0495636_0156271 | 3300047318 | Bacteria | 1026 |
| 868 | Ga0495674_0000665 | 3300047319 | Bacteria | 32277 |
| 869 | Ga0495674_0023044 | 3300047319 | Bacteria | 5737 |
| 870 | Ga0495674_0030932 | 3300047319 | Bacteria | 4864 |
| 871 | Ga0495674_0413173 | 3300047319 | Bacteria | 1088 |
| 872 | Ga0495672_0001486 | 3300047320 | Bacteria | 22986 |
| 873 | Ga0495672_0066950 | 3300047320 | Bacteria | 2047 |
| 874 | Ga0495672_0113097 | 3300047320 | Bacteria | 1454 |
| 875 | Ga0495672_0145062 | 3300047320 | Bacteria | 1236 |
| 876 | Ga0495672_0149118 | 3300047320 | Bacteria | 1214 |
| 877 | Ga0495676_0087719 | 3300047321 | Bacteria | 2336 |
| 878 | Ga0495676_0147631 | 3300047321 | Bacteria | 1677 |
| 879 | Ga0495676_0217238 | 3300047321 | Bacteria | 1319 |
| 880 | Ga0495680_0011970 | 3300047322 | Bacteria | 7656 |
| 881 | Ga0495680_0030485 | 3300047322 | Bacteria | 4403 |
| 882 | Ga0495680_0133286 | 3300047322 | Bacteria | 1823 |
| 883 | Ga0495680_0204936 | 3300047322 | Bacteria | 1414 |
| 884 | Ga0495683_0000838 | 3300047323 | Bacteria | 21880 |
| 885 | Ga0495683_0008256 | 3300047323 | Bacteria | 5579 |
| 886 | Ga0495683_0009032 | 3300047323 | Bacteria | 5313 |
| 887 | Ga0495683_0026883 | 3300047323 | Bacteria | 2944 |
| 888 | Ga0495683_0054747 | 3300047323 | Bacteria | 1987 |
| 889 | Ga0495683_0115112 | 3300047323 | Bacteria | 1280 |
| 890 | Ga0495683_0172316 | 3300047323 | Bacteria | 994 |
| 891 | Ga0495687_000134 | 3300047443 | Bacteria | 113646 |
| 892 | Ga0495687_001929 | 3300047443 | Bacteria | 17770 |
| 893 | Ga0495687_004091 | 3300047443 | Bacteria | 10090 |
| 894 | Ga0495687_070709 | 3300047443 | Bacteria | 1400 |
| 895 | Ga0495675_0000784 | 3300047444 | Bacteria | 19640 |
| 896 | Ga0495675_0075902 | 3300047444 | Bacteria | 2118 |
| 897 | Ga0495675_0080487 | 3300047444 | Bacteria | 2051 |
| 898 | Ga0495675_0513857 | 3300047444 | Bacteria | 686 |
| 899 | Ga0495679_000342 | 3300047446 | Bacteria | 36534 |
| 900 | Ga0495679_002089 | 3300047446 | Bacteria | 10523 |
| 901 | Ga0495679_005909 | 3300047446 | Bacteria | 5362 |
| 902 | Ga0495679_062146 | 3300047446 | Bacteria | 1093 |
| 903 | Ga0495679_064720 | 3300047446 | Bacteria | 1065 |
| 904 | Ga0495685_036583 | 3300047447 | Bacteria | 1685 |
| 905 | Ga0495685_122517 | 3300047447 | Bacteria | 853 |
| 906 | Ga0495685_164772 | 3300047447 | Bacteria | 717 |
| 907 | Ga0495673_0012012 | 3300047469 | Bacteria | 4620 |
| 908 | Ga0495673_0040757 | 3300047469 | Bacteria | 2094 |
| 909 | Ga0495673_0155236 | 3300047469 | Bacteria | 882 |
| 910 | Ga0495673_0164301 | 3300047469 | Bacteria | 850 |
| 911 | Ga0495681_0124459 | 3300047470 | Bacteria | 1103 |
| 912 | Ga0495681_0181291 | 3300047470 | Bacteria | 865 |
| 913 | Ga0495684_0014068 | 3300047471 | Bacteria | 6154 |
| 914 | Ga0495684_0083650 | 3300047471 | Bacteria | 2420 |
| 915 | Ga0495684_0100571 | 3300047471 | Bacteria | 2186 |
| 916 | Ga0495686_0000129 | 3300047472 | Bacteria | 155797 |
| 917 | Ga0495686_0055686 | 3300047472 | Bacteria | 2472 |
| 918 | Ga0495686_0408225 | 3300047472 | Bacteria | 728 |
| 919 | Ga0495593_0005757 | 3300047673 | Bacteria | 7311 |
| 920 | Ga0495593_0005997 | 3300047673 | Bacteria | 7154 |
| 921 | Ga0495593_0019899 | 3300047673 | Bacteria | 3760 |
| 922 | Ga0495593_0022040 | 3300047673 | Bacteria | 3554 |
| 923 | Ga0495602_0004174 | 3300048088 | Bacteria | 15032 |
| 924 | Ga0495602_0022647 | 3300048088 | Bacteria | 6143 |
| 925 | Ga0495602_0026745 | 3300048088 | Bacteria | 5559 |
| 926 | Ga0495602_0029768 | 3300048088 | Bacteria | 5191 |
| 927 | Ga0495602_0031238 | 3300048088 | Bacteria | 5038 |
| 928 | Ga0495602_0171340 | 3300048088 | Bacteria | 1684 |
| 929 | Ga0495602_0221440 | 3300048088 | Bacteria | 1428 |
| 930 | Ga0495614_0000057 | 3300048089 | Bacteria | 34749 |
| 931 | Ga0495614_0029300 | 3300048089 | Bacteria | 2369 |
| 932 | Ga0495614_0033692 | 3300048089 | Bacteria | 2203 |
| 933 | Ga0495614_0040117 | 3300048089 | Bacteria | 2009 |
| 934 | Ga0495614_0089178 | 3300048089 | Bacteria | 1341 |
| 935 | Ga0495626_0050164 | 3300048091 | Bacteria | 1929 |
| 936 | Ga0495626_0051127 | 3300048091 | Bacteria | 1907 |
| 937 | Ga0495626_0095624 | 3300048091 | Bacteria | 1301 |
| 938 | Ga0495626_0123898 | 3300048091 | Bacteria | 1108 |
| 939 | Ga0496100_0001212 | 3300048903 | Bacteria | 12531 |
| 940 | Ga0496100_0033632 | 3300048903 | Bacteria | 3209 |
| 941 | Ga0496100_0125277 | 3300048903 | Bacteria | 1802 |
| 942 | Ga0496101_0002850 | 3300048904 | Bacteria | 10629 |
| 943 | Ga0496101_0028498 | 3300048904 | Bacteria | 3898 |
| 944 | Ga0496101_0237834 | 3300048904 | Bacteria | 1417 |
| 945 | Ga0496102_0000553 | 3300048905 | Bacteria | 40140 |
| 946 | Ga0496102_0002084 | 3300048905 | Bacteria | 17195 |
| 947 | Ga0496102_0006527 | 3300048905 | Bacteria | 9953 |
| 948 | Ga0496102_0013289 | 3300048905 | Bacteria | 7130 |
| 949 | Ga0496102_0199999 | 3300048905 | Bacteria | 1883 |
| 950 | Ga0496103_0003408 | 3300048906 | Bacteria | 9719 |
| 951 | Ga0496103_0005875 | 3300048906 | Bacteria | 7333 |
| 952 | Ga0496103_0043638 | 3300048906 | Bacteria | 2761 |
| 953 | Ga0496103_0084148 | 3300048906 | Bacteria | 2003 |
| 954 | Ga0496104_0147490 | 3300048907 | Bacteria | 2259 |
| 955 | Ga0496104_0420091 | 3300048907 | Bacteria | 1249 |
| 956 | Ga0496104_0440929 | 3300048907 | Bacteria | 1214 |
| 957 | Ga0496104_0541019 | 3300048907 | Bacteria | 1075 |
| 958 | Ga0496105_0020961 | 3300048908 | Bacteria | 5286 |
| 959 | Ga0496105_0149655 | 3300048908 | Bacteria | 1919 |
| 960 | Ga0496105_0171652 | 3300048908 | Bacteria | 1777 |
| 961 | Ga0496106_0074298 | 3300048909 | Bacteria | 2602 |
| 962 | Ga0496106_0084304 | 3300048909 | Bacteria | 2445 |
| 963 | Ga0496106_0123160 | 3300048909 | Bacteria | 2028 |
| 964 | Ga0496106_0184218 | 3300048909 | Bacteria | 1658 |
| 965 | Ga0496106_0702728 | 3300048909 | Bacteria | 806 |
| 966 | Ga0496107_0130532 | 3300048910 | Bacteria | 1855 |
| 967 | Ga0496107_0612445 | 3300048910 | Bacteria | 804 |
| 968 | Ga0496108_0122725 | 3300048911 | Bacteria | 2229 |
| 969 | Ga0496109_0204587 | 3300048912 | Bacteria | 1856 |
| 970 | Ga0496110_0025088 | 3300048913 | Bacteria | 5090 |
| 971 | Ga0496110_0116706 | 3300048913 | Bacteria | 2403 |
| 972 | Ga0496110_0638809 | 3300048913 | Bacteria | 964 |
| 973 | Ga0496111_0011978 | 3300048914 | Bacteria | 5862 |
| 974 | Ga0496112_0017022 | 3300048915 | Bacteria | 6824 |
| 975 | Ga0496113_0008792 | 3300048916 | Bacteria | 6597 |
| 976 | Ga0496113_0279930 | 3300048916 | Bacteria | 1334 |
| 977 | Ga0496113_0546976 | 3300048916 | Bacteria | 929 |
| 978 | Ga0496114_0026593 | 3300048917 | Bacteria | 4738 |
| 979 | Ga0496115_0097632 | 3300048918 | Bacteria | 2406 |
| 980 | Ga0496115_0441894 | 3300048918 | Bacteria | 1052 |
| 981 | Ga0496116_0001320 | 3300048919 | Bacteria | 28280 |
| 982 | Ga0496116_0007863 | 3300048919 | Bacteria | 9357 |
| 983 | Ga0496116_0088130 | 3300048919 | Bacteria | 1897 |
| 984 | Ga0496116_0167305 | 3300048919 | Bacteria | 1196 |
| 985 | Ga0496117_0001476 | 3300048920 | Bacteria | 33776 |
| 986 | Ga0496117_0012055 | 3300048920 | Bacteria | 7673 |
| 987 | Ga0496117_0044221 | 3300048920 | Bacteria | 3228 |
| 988 | Ga0496117_0067052 | 3300048920 | Bacteria | 2431 |
| 989 | Ga0496117_0071784 | 3300048920 | Bacteria | 2318 |
| 990 | Ga0496118_0001841 | 3300048921 | Bacteria | 30372 |
| 991 | Ga0496118_0002994 | 3300048921 | Bacteria | 21830 |
| 992 | Ga0496118_0003375 | 3300048921 | Bacteria | 20179 |
| 993 | Ga0496118_0012483 | 3300048921 | Bacteria | 8145 |
| 994 | Ga0496118_0034000 | 3300048921 | Bacteria | 4170 |
| 995 | Ga0496118_0069117 | 3300048921 | Bacteria | 2560 |
| 996 | Ga0496118_0206663 | 3300048921 | Bacteria | 1157 |
| 997 | Ga0496119_0135213 | 3300048922 | Bacteria | 1338 |
| 998 | Ga0496119_0284089 | 3300048922 | Bacteria | 822 |
| 999 | Ga0496121_0000639 | 3300048924 | Bacteria | 65359 |
| 1000 | Ga0496121_0003125 | 3300048924 | Bacteria | 23912 |
| 1001 | Ga0496121_0006587 | 3300048924 | Bacteria | 14324 |
| 1002 | Ga0496122_0007397 | 3300048925 | Bacteria | 12226 |
| 1003 | Ga0496122_0076979 | 3300048925 | Bacteria | 2345 |
| 1004 | Ga0496122_0096034 | 3300048925 | Bacteria | 2000 |
| 1005 | Ga0496123_0006456 | 3300048926 | Bacteria | 11351 |
| 1006 | Ga0496123_0020775 | 3300048926 | Bacteria | 5124 |
| 1007 | Ga0496123_0054577 | 3300048926 | Bacteria | 2629 |
| 1008 | Ga0496124_0026467 | 3300048927 | Bacteria | 5229 |
| 1009 | Ga0496124_0031878 | 3300048927 | Bacteria | 4661 |
| 1010 | Ga0496124_0038979 | 3300048927 | Bacteria | 4122 |
| 1011 | Ga0496124_0085965 | 3300048927 | Bacteria | 2576 |
| 1012 | Ga0496124_0191792 | 3300048927 | Bacteria | 1563 |
| 1013 | Ga0496124_0230306 | 3300048927 | Bacteria | 1386 |
| 1014 | Ga0496125_0005643 | 3300048928 | Bacteria | 13816 |
| 1015 | Ga0496125_0006190 | 3300048928 | Bacteria | 13033 |
| 1016 | Ga0496125_0055564 | 3300048928 | Bacteria | 3224 |
| 1017 | Ga0496125_0244728 | 3300048928 | Bacteria | 1136 |
| 1018 | Ga0496125_0272698 | 3300048928 | Bacteria | 1053 |
| 1019 | Ga0496125_0584346 | 3300048928 | Bacteria | 613 |
| 1020 | Ga0496126_0006608 | 3300048929 | Bacteria | 12910 |
| 1021 | Ga0496126_0028891 | 3300048929 | Bacteria | 5275 |
| 1022 | Ga0496126_0043956 | 3300048929 | Bacteria | 4117 |
| 1023 | Ga0496126_0308190 | 3300048929 | Bacteria | 1304 |
| 1024 | Ga0495678_057979 | 3300049459 | Bacteria | 1465 |
| 1025 | Ga0495682_0087142 | 3300049460 | Bacteria | 1122 |
| 1026 | Ga0501034_0057285 | 3300049571 | Bacteria | 3918 |
| 1027 | Ga0501043_0253363 | 3300049579 | Bacteria | 1355 |
| 1028 | Ga0501209_003792 | 3300049656 | Bacteria | 2547 |
| 1029 | nmdc:mga03683_135476_c1 | 3300050489 | Bacteria | 1104 |
| 1030 | nmdc:mga03n38_135792_c1 | 3300050490 | Bacteria | 1224 |
| 1031 | nmdc:mga0yw44_74458_c1 | 3300050492 | Bacteria | 2115 |
| 1032 | nmdc:mga0k408_13599_c1 | 3300050493 | Bacteria | 4468 |
| 1033 | nmdc:mga0k408_16514_c2 | 3300050493 | Bacteria | 2586 |
| 1034 | nmdc:mga0k408_258628_c1 | 3300050493 | Bacteria | 1039 |
| 1035 | nmdc:mga0k408_4060_c1 | 3300050493 | Bacteria | 7766 |
| 1036 | nmdc:mga0k408_42694_c1 | 3300050493 | Bacteria | 2612 |
| 1037 | nmdc:mga0k408_658079_c1 | 3300050493 | Bacteria | 616 |
| 1038 | nmdc:mga06z11_118662_c1 | 3300050494 | Bacteria | 1473 |
| 1039 | nmdc:mga06z11_202107_c1 | 3300050494 | Bacteria | 1155 |
| 1040 | nmdc:mga06z11_78203_c1 | 3300050494 | Bacteria | 1768 |
| 1041 | nmdc:mga07m45_115998_c1 | 3300050496 | Bacteria | 1544 |
| 1042 | nmdc:mga07m45_2182_c1 | 3300050496 | Bacteria | 9130 |
| 1043 | nmdc:mga07m45_314695_c1 | 3300050496 | Bacteria | 910 |
| 1044 | nmdc:mga07m45_35723_c1 | 3300050496 | Bacteria | 1118 |
| 1045 | nmdc:mga07m45_3941_c1 | 3300050496 | Bacteria | 7214 |
| 1046 | nmdc:mga07m45_47644_c1 | 3300050496 | Bacteria | 2410 |
| 1047 | nmdc:mga07m45_59232_c1 | 3300050496 | Bacteria | 2167 |
| 1048 | nmdc:mga07m45_78892_c1 | 3300050496 | Bacteria | 1879 |
| 1049 | nmdc:mga09592_14541_c1 | 3300050508 | Bacteria | 4822 |
| 1050 | nmdc:mga0qj67_12586_c1 | 3300050509 | Bacteria | 6377 |
| 1051 | Ga0500635_0000318 | 3300053080 | Bacteria | 16609 |
| 1052 | Ga0500578_0017157 | 3300053086 | Bacteria | 4653 |
| 1053 | Ga0500644_0013621 | 3300053088 | Bacteria | 2275 |
| 1054 | Ga0500593_002980 | 3300053117 | Bacteria | 6307 |
| 1055 | Ga0500618_031351 | 3300053125 | Bacteria | 1246 |
| 1056 | Ga0500621_195489 | 3300053126 | Bacteria | 721 |
| 1057 | Ga0500658_0126800 | 3300053134 | Bacteria | 1135 |
| 1058 | Ga0500559_0000207 | 3300053136 | Bacteria | 46949 |
| 1059 | Ga0500568_0081383 | 3300053139 | Bacteria | 1229 |
| 1060 | Ga0500568_0163032 | 3300053139 | Bacteria | 822 |
| 1061 | Ga0500590_039858 | 3300053148 | Bacteria | 2421 |
| 1062 | Ga0500622_0022765 | 3300053156 | Bacteria | 3318 |
| 1063 | Ga0500636_0054911 | 3300053177 | Bacteria | 2335 |
| 1064 | Ga0500570_125006 | 3300053724 | Bacteria | 996 |
| 1065 | Ga0500587_000950 | 3300053739 | Bacteria | 3899 |
| 1066 | Ga0500587_002321 | 3300053739 | Bacteria | 2706 |
| 1067 | Ga0466962_0002580 | 3300061719 | Bacteria | 8604 |
| 1068 | Ga0466962_0008800 | 3300061719 | Bacteria | 4839 |
| 1069 | Ga0466962_0022861 | 3300061719 | Bacteria | 3004 |
| 1070 | Ga0466962_0040446 | 3300061719 | Bacteria | 2231 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005328 | Ga0070676_10010215 | Ga0070676_100102153 | 158 |
| 2 | 3300005338 | Ga0068868_100032328 | Ga0068868_1000323282 | 158 |
| 3 | 3300005355 | Ga0070671_100057929 | Ga0070671_1000579292 | 158 |
| 4 | 3300005459 | Ga0068867_100130849 | Ga0068867_1001308492 | 158 |
| 5 | 3300005548 | Ga0070665_100205597 | Ga0070665_1002055972 | 158 |
| 6 | 3300005578 | Ga0068854_100175418 | Ga0068854_1001754182 | 158 |
| 7 | 3300005616 | Ga0068852_100137779 | Ga0068852_1001377792 | 158 |
| 8 | 3300025907 | Ga0207645_10016258 | Ga0207645_100162583 | 158 |
| 9 | 3300025931 | Ga0207644_10392234 | Ga0207644_103922342 | 158 |
| 10 | 3300025981 | Ga0207640_10107318 | Ga0207640_101073183 | 158 |
| 11 | 3300026089 | Ga0207648_10039290 | Ga0207648_100392902 | 158 |
| 12 | 3300044712 | Ga0453684_0000566 | Ga0453684_0000566_59203_59724 | 159 |
| 13 | 3300048088 | Ga0495602_0221440 | Ga0495602_0221440_112_633 | 159 |
| 14 | 3300048904 | Ga0496101_0237834 | Ga0496101_0237834_408_923 | 159 |
| 15 | 3300048909 | Ga0496106_0702728 | Ga0496106_0702728_40_555 | 161 |
| 16 | 3300002705 | JGI25156J39149_1001638 | JGI25156J39149_10016386 | 162 |
| 17 | 3300002738 | JGI25154J39366_1001034 | JGI25154J39366_10010342 | 162 |
| 18 | 3300002741 | JGI25157J39369_1000278 | JGI25157J39369_10002782 | 162 |
| 19 | 3300005344 | Ga0070661_100083542 | Ga0070661_1000835422 | 162 |
| 20 | 3300005535 | Ga0070684_100090171 | Ga0070684_1000901712 | 162 |
| 21 | 3300005539 | Ga0068853_100419554 | Ga0068853_1004195541 | 162 |
| 22 | 3300005563 | Ga0068855_100174821 | Ga0068855_1001748212 | 162 |
| 23 | 3300005577 | Ga0068857_100004217 | Ga0068857_1000042173 | 162 |
| 24 | 3300005578 | Ga0068854_100018676 | Ga0068854_1000186762 | 162 |
| 25 | 3300005614 | Ga0068856_100001787 | Ga0068856_10000178715 | 162 |
| 26 | 3300005616 | Ga0068852_100174110 | Ga0068852_1001741102 | 162 |
| 27 | 3300009093 | Ga0105240_10070126 | Ga0105240_100701263 | 162 |
| 28 | 3300009174 | Ga0105241_10405709 | Ga0105241_104057092 | 162 |
| 29 | 3300009545 | Ga0105237_10101517 | Ga0105237_101015172 | 162 |
| 30 | 3300009551 | Ga0105238_10527426 | Ga0105238_105274262 | 162 |
| 31 | 3300010375 | Ga0105239_10155541 | Ga0105239_101555413 | 162 |
| 32 | 3300013105 | Ga0157369_10053770 | Ga0157369_100537702 | 162 |
| 33 | 3300025246 | Ga0209646_1000012 | Ga0209646_1000012136 | 162 |
| 34 | 3300025250 | Ga0209026_1000004 | Ga0209026_1000004481 | 162 |
| 35 | 3300025253 | Ga0209677_101750 | Ga0209677_1017507 | 162 |
| 36 | 3300025256 | Ga0209759_1000003 | Ga0209759_1000003244 | 162 |
| 37 | 3300025256 | Ga0209759_1000067 | Ga0209759_1000067171 | 162 |
| 38 | 3300025913 | Ga0207695_10130634 | Ga0207695_101306342 | 162 |
| 39 | 3300025914 | Ga0207671_10245574 | Ga0207671_102455742 | 162 |
| 40 | 3300025949 | Ga0207667_10177509 | Ga0207667_101775092 | 162 |
| 41 | 3300025981 | Ga0207640_10007735 | Ga0207640_100077355 | 162 |
| 42 | 3300026041 | Ga0207639_10587781 | Ga0207639_105877812 | 162 |
| 43 | 3300026078 | Ga0207702_10000033 | Ga0207702_100000338 | 162 |
| 44 | 3300026116 | Ga0207674_10017935 | Ga0207674_100179354 | 162 |
| 45 | 3300026142 | Ga0207698_10082320 | Ga0207698_100823202 | 162 |
| 46 | 3300031730 | Ga0307516_10442238 | Ga0307516_104422382 | 162 |
| 47 | iso_pu_bacteria | 2574179768 | 2574429959 | 167 |
| 48 | iso_pu_bacteria | 2585428062 | 2587757849 | 167 |
| 49 | iso_pu_bacteria | 2588253510 | 2588292658 | 167 |
| 50 | iso_pu_bacteria | 2643221592 | 2643967238 | 167 |
| 51 | iso_pu_bacteria | 2643221625 | 2644140069 | 167 |
| 52 | iso_pu_bacteria | 2643221644 | 2644245981 | 167 |
| 53 | iso_pu_bacteria | 2643221648 | 2644271309 | 167 |
| 54 | iso_pu_bacteria | 2891633521 | 2891635151 | 167 |
| 55 | iso_pu_bacteria | 2721755523 | 2722881184 | 168 |
| 56 | iso_pu_bacteria | 2839138175 | 2839141080 | 168 |
| 57 | iso_pu_bacteria | 2886848708 | 2886849921 | 168 |
| 58 | 3300001915 | JGI24741J21665_1000160 | JGI24741J21665_10001602 | 170 |
| 59 | 3300001915 | JGI24741J21665_1000841 | JGI24741J21665_10008412 | 170 |
| 60 | 3300001979 | JGI24740J21852_10000483 | JGI24740J21852_100004838 | 170 |
| 61 | 3300001979 | JGI24740J21852_10002060 | JGI24740J21852_100020607 | 170 |
| 62 | 3300001979 | JGI24740J21852_10018241 | JGI24740J21852_100182412 | 170 |
| 63 | 3300001989 | JGI24739J22299_10007062 | JGI24739J22299_100070623 | 170 |
| 64 | 3300001989 | JGI24739J22299_10016571 | JGI24739J22299_100165711 | 170 |
| 65 | 3300001990 | JGI24737J22298_10005221 | JGI24737J22298_100052213 | 170 |
| 66 | 3300001990 | JGI24737J22298_10007151 | JGI24737J22298_100071511 | 170 |
| 67 | 3300001990 | JGI24737J22298_10047344 | JGI24737J22298_100473442 | 170 |
| 68 | 3300002067 | JGI24735J21928_10000874 | JGI24735J21928_100008745 | 170 |
| 69 | 3300002067 | JGI24735J21928_10012528 | JGI24735J21928_100125282 | 170 |
| 70 | 3300002067 | JGI24735J21928_10020332 | JGI24735J21928_100203322 | 170 |
| 71 | 3300002067 | JGI24735J21928_10120673 | JGI24735J21928_101206731 | 170 |
| 72 | 3300002075 | JGI24738J21930_10008364 | JGI24738J21930_100083642 | 170 |
| 73 | 3300002075 | JGI24738J21930_10067794 | JGI24738J21930_100677941 | 170 |
| 74 | 3300002705 | JGI25156J39149_1011189 | JGI25156J39149_10111892 | 170 |
| 75 | 3300002705 | JGI25156J39149_1011412 | JGI25156J39149_10114122 | 170 |
| 76 | 3300002705 | JGI25156J39149_1014315 | JGI25156J39149_10143152 | 170 |
| 77 | 3300002705 | JGI25156J39149_1022758 | JGI25156J39149_10227582 | 170 |
| 78 | 3300002738 | JGI25154J39366_1000483 | JGI25154J39366_10004832 | 170 |
| 79 | 3300002773 | JGI25152J39213_1001024 | JGI25152J39213_100102410 | 170 |
| 80 | 3300002774 | JGI25150J39212_1007936 | JGI25150J39212_10079361 | 170 |
| 81 | 3300003214 | JGI25165J46597_1003927 | JGI25165J46597_10039273 | 170 |
| 82 | 3300003215 | JGI25153J46596_10014803 | JGI25153J46596_100148032 | 170 |
| 83 | 3300003215 | JGI25153J46596_10015636 | JGI25153J46596_100156363 | 170 |
| 84 | 3300003322 | rootL2_10059169 | rootL2_100591695 | 170 |
| 85 | 3300003322 | rootL2_10174862 | rootL2_101748622 | 170 |
| 86 | 3300003323 | rootH1_10054318 | rootH1_100543183 | 170 |
| 87 | 3300003323 | rootH1_10067675 | rootH1_100676752 | 170 |
| 88 | 3300003323 | rootH1_10281758 | rootH1_102817581 | 170 |
| 89 | 3300003354 | JGI25160J50197_1000016 | JGI25160J50197_100001636 | 170 |
| 90 | 3300003751 | Ga0055538_1001442 | Ga0055538_10014421 | 170 |
| 91 | 3300003751 | Ga0055538_1005363 | Ga0055538_10053632 | 170 |
| 92 | 3300003752 | Ga0055539_1000226 | Ga0055539_100022616 | 170 |
| 93 | 3300003756 | Ga0055533_1000738 | Ga0055533_10007388 | 170 |
| 94 | 3300003756 | Ga0055533_1003064 | Ga0055533_10030642 | 170 |
| 95 | 3300003756 | Ga0055533_1003745 | Ga0055533_10037452 | 170 |
| 96 | 3300003756 | Ga0055533_1003847 | Ga0055533_10038472 | 170 |
| 97 | 3300003758 | Ga0055532_1000022 | Ga0055532_1000022148 | 170 |
| 98 | 3300003758 | Ga0055532_1000040 | Ga0055532_100004081 | 170 |
| 99 | 3300003759 | Ga0055525_1001187 | Ga0055525_10011872 | 170 |
| 100 | 3300003760 | Ga0055527_1000016 | Ga0055527_1000016148 | 170 |
| 101 | 3300003760 | Ga0055527_1001527 | Ga0055527_10015274 | 170 |
| 102 | 3300003760 | Ga0055527_1002687 | Ga0055527_10026872 | 170 |
| 103 | 3300003760 | Ga0055527_1002714 | Ga0055527_10027142 | 170 |
| 104 | 3300003761 | Ga0055535_1000017 | Ga0055535_1000017148 | 170 |
| 105 | 3300003761 | Ga0055535_1000029 | Ga0055535_100002981 | 170 |
| 106 | 3300003761 | Ga0055535_1005249 | Ga0055535_10052492 | 170 |
| 107 | 3300003761 | Ga0055535_1005280 | Ga0055535_10052802 | 170 |
| 108 | 3300003762 | Ga0055542_1000030 | Ga0055542_100003092 | 170 |
| 109 | 3300003762 | Ga0055542_1000850 | Ga0055542_100085015 | 170 |
| 110 | 3300003762 | Ga0055542_1005397 | Ga0055542_10053972 | 170 |
| 111 | 3300003762 | Ga0055542_1005452 | Ga0055542_10054522 | 170 |
| 112 | 3300003763 | Ga0055529_1000033 | Ga0055529_100003392 | 170 |
| 113 | 3300003763 | Ga0055529_1000055 | Ga0055529_1000055102 | 170 |
| 114 | 3300003763 | Ga0055529_1003036 | Ga0055529_10030362 | 170 |
| 115 | 3300003771 | Ga0055526_1001136 | Ga0055526_100113611 | 170 |
| 116 | 3300003771 | Ga0055526_1002962 | Ga0055526_100296210 | 170 |
| 117 | 3300003771 | Ga0055526_1021340 | Ga0055526_10213403 | 170 |
| 118 | 3300003773 | Ga0055537_1003705 | Ga0055537_10037052 | 170 |
| 119 | 3300003773 | Ga0055537_1007755 | Ga0055537_10077553 | 170 |
| 120 | 3300003775 | Ga0055524_1000137 | Ga0055524_100013726 | 170 |
| 121 | 3300003775 | Ga0055524_1000491 | Ga0055524_100049129 | 170 |
| 122 | 3300003775 | Ga0055524_1001779 | Ga0055524_10017793 | 170 |
| 123 | 3300003775 | Ga0055524_1017950 | Ga0055524_10179502 | 170 |
| 124 | 3300003781 | Ga0055536_1004932 | Ga0055536_10049324 | 170 |
| 125 | 3300003784 | Ga0055534_1008631 | Ga0055534_10086313 | 170 |
| 126 | 3300003784 | Ga0055534_1008695 | Ga0055534_10086951 | 170 |
| 127 | 3300003790 | Ga0055528_1000675 | Ga0055528_100067513 | 170 |
| 128 | 3300003791 | Ga0055530_10001713 | Ga0055530_100017136 | 170 |
| 129 | 3300003792 | Ga0055540_1000042 | Ga0055540_100004262 | 170 |
| 130 | 3300003792 | Ga0055540_1006966 | Ga0055540_10069663 | 170 |
| 131 | 3300003794 | Ga0055531_10010420 | Ga0055531_100104204 | 170 |
| 132 | 3300003794 | Ga0055531_10020132 | Ga0055531_100201322 | 170 |
| 133 | 3300003841 | Ga0055541_1000556 | Ga0055541_10005563 | 170 |
| 134 | 3300003841 | Ga0055541_1007510 | Ga0055541_10075102 | 170 |
| 135 | 3300003856 | Ga0058692_1002295 | Ga0058692_10022952 | 170 |
| 136 | 3300004625 | Ga0055543_1003765 | Ga0055543_10037652 | 170 |
| 137 | 3300005262 | Ga0065165_1000079 | Ga0065165_100007922 | 170 |
| 138 | 3300005262 | Ga0065165_1000154 | Ga0065165_100015436 | 170 |
| 139 | 3300005262 | Ga0065165_1001510 | Ga0065165_100151020 | 170 |
| 140 | 3300005289 | Ga0065704_10365703 | Ga0065704_103657031 | 170 |
| 141 | 3300005327 | Ga0070658_10022919 | Ga0070658_100229195 | 170 |
| 142 | 3300005327 | Ga0070658_10085807 | Ga0070658_100858072 | 170 |
| 143 | 3300005329 | Ga0070683_101671087 | Ga0070683_1016710871 | 170 |
| 144 | 3300005335 | Ga0070666_10053601 | Ga0070666_100536011 | 170 |
| 145 | 3300005335 | Ga0070666_10125164 | Ga0070666_101251642 | 170 |
| 146 | 3300005337 | Ga0070682_100469392 | Ga0070682_1004693921 | 170 |
| 147 | 3300005337 | Ga0070682_100705625 | Ga0070682_1007056251 | 170 |
| 148 | 3300005339 | Ga0070660_100000040 | Ga0070660_10000004073 | 170 |
| 149 | 3300005339 | Ga0070660_100015711 | Ga0070660_1000157115 | 170 |
| 150 | 3300005339 | Ga0070660_100646046 | Ga0070660_1006460461 | 170 |
| 151 | 3300005344 | Ga0070661_100000020 | Ga0070661_1000000206 | 170 |
| 152 | 3300005344 | Ga0070661_100000143 | Ga0070661_10000014350 | 170 |
| 153 | 3300005344 | Ga0070661_100230024 | Ga0070661_1002300241 | 170 |
| 154 | 3300005344 | Ga0070661_100362115 | Ga0070661_1003621152 | 170 |
| 155 | 3300005347 | Ga0070668_100049841 | Ga0070668_1000498412 | 170 |
| 156 | 3300005353 | Ga0070669_100154750 | Ga0070669_1001547502 | 170 |
| 157 | 3300005353 | Ga0070669_100513354 | Ga0070669_1005133541 | 170 |
| 158 | 3300005355 | Ga0070671_100655537 | Ga0070671_1006555371 | 170 |
| 159 | 3300005356 | Ga0070674_100491504 | Ga0070674_1004915042 | 170 |
| 160 | 3300005366 | Ga0070659_100000268 | Ga0070659_10000026835 | 170 |
| 161 | 3300005366 | Ga0070659_100001187 | Ga0070659_10000118711 | 170 |
| 162 | 3300005366 | Ga0070659_100007886 | Ga0070659_1000078862 | 170 |
| 163 | 3300005366 | Ga0070659_100767769 | Ga0070659_1007677691 | 170 |
| 164 | 3300005367 | Ga0070667_100030130 | Ga0070667_1000301306 | 170 |
| 165 | 3300005367 | Ga0070667_100063812 | Ga0070667_1000638122 | 170 |
| 166 | 3300005445 | Ga0070708_100531322 | Ga0070708_1005313221 | 170 |
| 167 | 3300005455 | Ga0070663_100000001 | Ga0070663_100000001219 | 170 |
| 168 | 3300005455 | Ga0070663_100022669 | Ga0070663_1000226694 | 170 |
| 169 | 3300005455 | Ga0070663_100031245 | Ga0070663_1000312453 | 170 |
| 170 | 3300005455 | Ga0070663_100288635 | Ga0070663_1002886351 | 170 |
| 171 | 3300005455 | Ga0070663_100612739 | Ga0070663_1006127391 | 170 |
| 172 | 3300005456 | Ga0070678_100319076 | Ga0070678_1003190761 | 170 |
| 173 | 3300005459 | Ga0068867_100000074 | Ga0068867_10000007415 | 170 |
| 174 | 3300005467 | Ga0070706_100001812 | Ga0070706_10000181217 | 170 |
| 175 | 3300005471 | Ga0070698_100161166 | Ga0070698_1001611662 | 170 |
| 176 | 3300005535 | Ga0070684_100612382 | Ga0070684_1006123821 | 170 |
| 177 | 3300005539 | Ga0068853_100212436 | Ga0068853_1002124362 | 170 |
| 178 | 3300005563 | Ga0068855_100002940 | Ga0068855_10000294017 | 170 |
| 179 | 3300005563 | Ga0068855_100071125 | Ga0068855_1000711253 | 170 |
| 180 | 3300005563 | Ga0068855_100120027 | Ga0068855_1001200273 | 170 |
| 181 | 3300005564 | Ga0070664_100000006 | Ga0070664_10000000696 | 170 |
| 182 | 3300005564 | Ga0070664_100012445 | Ga0070664_1000124453 | 170 |
| 183 | 3300005564 | Ga0070664_100027245 | Ga0070664_1000272452 | 170 |
| 184 | 3300005564 | Ga0070664_100398412 | Ga0070664_1003984121 | 170 |
| 185 | 3300005577 | Ga0068857_100022755 | Ga0068857_1000227553 | 170 |
| 186 | 3300005577 | Ga0068857_100055164 | Ga0068857_1000551642 | 170 |
| 187 | 3300005578 | Ga0068854_100000253 | Ga0068854_1000002536 | 170 |
| 188 | 3300005614 | Ga0068856_100000032 | Ga0068856_10000003258 | 170 |
| 189 | 3300005614 | Ga0068856_100161563 | Ga0068856_1001615631 | 170 |
| 190 | 3300005616 | Ga0068852_100015742 | Ga0068852_1000157426 | 170 |
| 191 | 3300005616 | Ga0068852_100078143 | Ga0068852_1000781432 | 170 |
| 192 | 3300005616 | Ga0068852_100276979 | Ga0068852_1002769792 | 170 |
| 193 | 3300005616 | Ga0068852_100629817 | Ga0068852_1006298172 | 170 |
| 194 | 3300005842 | Ga0068858_100796155 | Ga0068858_1007961551 | 170 |
| 195 | 3300006038 | Ga0075365_10029150 | Ga0075365_100291503 | 170 |
| 196 | 3300006042 | Ga0075368_10019756 | Ga0075368_100197562 | 170 |
| 197 | 3300006048 | Ga0075363_100110369 | Ga0075363_1001103692 | 170 |
| 198 | 3300006051 | Ga0075364_10084728 | Ga0075364_100847282 | 170 |
| 199 | 3300006177 | Ga0075362_10021573 | Ga0075362_100215733 | 170 |
| 200 | 3300006178 | Ga0075367_10017001 | Ga0075367_100170012 | 170 |
| 201 | 3300006186 | Ga0075369_10025355 | Ga0075369_100253552 | 170 |
| 202 | 3300006186 | Ga0075369_10167546 | Ga0075369_101675462 | 170 |
| 203 | 3300006195 | Ga0075366_10014653 | Ga0075366_100146532 | 170 |
| 204 | 3300006195 | Ga0075366_10018236 | Ga0075366_100182363 | 170 |
| 205 | 3300006195 | Ga0075366_10070966 | Ga0075366_100709662 | 170 |
| 206 | 3300006195 | Ga0075366_10740241 | Ga0075366_107402411 | 170 |
| 207 | 3300006353 | Ga0075370_10003868 | Ga0075370_100038685 | 170 |
| 208 | 3300006353 | Ga0075370_10014273 | Ga0075370_100142733 | 170 |
| 209 | 3300006353 | Ga0075370_10050713 | Ga0075370_100507132 | 170 |
| 210 | 3300006353 | Ga0075370_10054197 | Ga0075370_100541973 | 170 |
| 211 | 3300006880 | Ga0075429_100000549 | Ga0075429_10000054916 | 170 |
| 212 | 3300006944 | Ga0099823_1000002 | Ga0099823_1000002120 | 170 |
| 213 | 3300006946 | Ga0079104_1000012 | Ga0079104_100001280 | 170 |
| 214 | 3300006946 | Ga0079104_1000170 | Ga0079104_100017062 | 170 |
| 215 | 3300006946 | Ga0079104_1044618 | Ga0079104_10446182 | 170 |
| 216 | 3300006948 | Ga0099826_10000007 | Ga0099826_1000000787 | 170 |
| 217 | 3300009011 | Ga0105251_10000211 | Ga0105251_1000021147 | 170 |
| 218 | 3300009011 | Ga0105251_10000590 | Ga0105251_1000059034 | 170 |
| 219 | 3300009011 | Ga0105251_10076603 | Ga0105251_100766032 | 170 |
| 220 | 3300009011 | Ga0105251_10175552 | Ga0105251_101755522 | 170 |
| 221 | 3300009011 | Ga0105251_10246479 | Ga0105251_102464792 | 170 |
| 222 | 3300009092 | Ga0105250_10000214 | Ga0105250_1000021413 | 170 |
| 223 | 3300009092 | Ga0105250_10013006 | Ga0105250_100130063 | 170 |
| 224 | 3300009092 | Ga0105250_10054686 | Ga0105250_100546862 | 170 |
| 225 | 3300009093 | Ga0105240_10016797 | Ga0105240_100167976 | 170 |
| 226 | 3300009093 | Ga0105240_10029981 | Ga0105240_100299816 | 170 |
| 227 | 3300009093 | Ga0105240_10099364 | Ga0105240_100993642 | 170 |
| 228 | 3300009093 | Ga0105240_10121875 | Ga0105240_101218751 | 170 |
| 229 | 3300009093 | Ga0105240_10172849 | Ga0105240_101728491 | 170 |
| 230 | 3300009093 | Ga0105240_10226734 | Ga0105240_102267342 | 170 |
| 231 | 3300009093 | Ga0105240_10242884 | Ga0105240_102428843 | 170 |
| 232 | 3300009093 | Ga0105240_10939479 | Ga0105240_109394791 | 170 |
| 233 | 3300009094 | Ga0111539_11710783 | Ga0111539_117107831 | 170 |
| 234 | 3300009101 | Ga0105247_10317823 | Ga0105247_103178232 | 170 |
| 235 | 3300009148 | Ga0105243_10002697 | Ga0105243_100026979 | 170 |
| 236 | 3300009148 | Ga0105243_10032598 | Ga0105243_100325983 | 170 |
| 237 | 3300009174 | Ga0105241_10503318 | Ga0105241_105033182 | 170 |
| 238 | 3300009174 | Ga0105241_10661861 | Ga0105241_106618612 | 170 |
| 239 | 3300009176 | Ga0105242_10000638 | Ga0105242_100006383 | 170 |
| 240 | 3300009177 | Ga0105248_10092474 | Ga0105248_100924742 | 170 |
| 241 | 3300009545 | Ga0105237_10040988 | Ga0105237_100409882 | 170 |
| 242 | 3300009545 | Ga0105237_10095994 | Ga0105237_100959942 | 170 |
| 243 | 3300009551 | Ga0105238_10031527 | Ga0105238_100315273 | 170 |
| 244 | 3300009551 | Ga0105238_10282687 | Ga0105238_102826872 | 170 |
| 245 | 3300009551 | Ga0105238_10430880 | Ga0105238_104308802 | 170 |
| 246 | 3300009553 | Ga0105249_10128221 | Ga0105249_101282212 | 170 |
| 247 | 3300009553 | Ga0105249_10509432 | Ga0105249_105094321 | 170 |
| 248 | 3300010375 | Ga0105239_10012282 | Ga0105239_100122825 | 170 |
| 249 | 3300010375 | Ga0105239_10022235 | Ga0105239_100222352 | 170 |
| 250 | 3300010375 | Ga0105239_11172256 | Ga0105239_111722562 | 170 |
| 251 | 3300011119 | Ga0105246_10678738 | Ga0105246_106787382 | 170 |
| 252 | 3300012497 | Ga0157319_1000007 | Ga0157319_100000782 | 170 |
| 253 | 3300013100 | Ga0157373_10007276 | Ga0157373_100072764 | 170 |
| 254 | 3300013100 | Ga0157373_10083227 | Ga0157373_100832273 | 170 |
| 255 | 3300013102 | Ga0157371_10000106 | Ga0157371_1000010681 | 170 |
| 256 | 3300013104 | Ga0157370_10000062 | Ga0157370_1000006273 | 170 |
| 257 | 3300013104 | Ga0157370_10003076 | Ga0157370_100030766 | 170 |
| 258 | 3300013104 | Ga0157370_10005074 | Ga0157370_100050743 | 170 |
| 259 | 3300013104 | Ga0157370_11117372 | Ga0157370_111173722 | 170 |
| 260 | 3300013105 | Ga0157369_10001436 | Ga0157369_100014366 | 170 |
| 261 | 3300013105 | Ga0157369_10014753 | Ga0157369_100147536 | 170 |
| 262 | 3300013105 | Ga0157369_10021633 | Ga0157369_100216333 | 170 |
| 263 | 3300013105 | Ga0157369_10061885 | Ga0157369_100618853 | 170 |
| 264 | 3300013105 | Ga0157369_10224563 | Ga0157369_102245631 | 170 |
| 265 | 3300013105 | Ga0157369_10241322 | Ga0157369_102413222 | 170 |
| 266 | 3300013105 | Ga0157369_10453783 | Ga0157369_104537832 | 170 |
| 267 | 3300013296 | Ga0157374_10003540 | Ga0157374_100035408 | 170 |
| 268 | 3300013297 | Ga0157378_10321976 | Ga0157378_103219762 | 170 |
| 269 | 3300013306 | Ga0163162_10000587 | Ga0163162_1000058728 | 170 |
| 270 | 3300013306 | Ga0163162_11737185 | Ga0163162_117371852 | 170 |
| 271 | 3300013307 | Ga0157372_10000108 | Ga0157372_1000010836 | 170 |
| 272 | 3300013307 | Ga0157372_10002116 | Ga0157372_1000211617 | 170 |
| 273 | 3300014325 | Ga0163163_11371033 | Ga0163163_113710331 | 170 |
| 274 | 3300014497 | Ga0182008_10033036 | Ga0182008_100330362 | 170 |
| 275 | 3300014497 | Ga0182008_10103131 | Ga0182008_101031312 | 170 |
| 276 | 3300014745 | Ga0157377_10000006 | Ga0157377_100000066 | 170 |
| 277 | 3300015261 | Ga0182006_1004867 | Ga0182006_10048675 | 170 |
| 278 | 3300015261 | Ga0182006_1013126 | Ga0182006_10131262 | 170 |
| 279 | 3300015262 | Ga0182007_10000169 | Ga0182007_1000016930 | 170 |
| 280 | 3300015262 | Ga0182007_10123969 | Ga0182007_101239692 | 170 |
| 281 | 3300016635 | Ga0183361_10001 | Ga0183361_10001521 | 170 |
| 282 | 3300020070 | Ga0206356_11010258 | Ga0206356_110102585 | 170 |
| 283 | 3300020077 | Ga0206351_10205994 | Ga0206351_102059942 | 170 |
| 284 | 3300020081 | Ga0206354_10019202 | Ga0206354_100192022 | 170 |
| 285 | 3300020610 | Ga0154015_1595496 | Ga0154015_15954963 | 170 |
| 286 | 3300021361 | Ga0213872_10020599 | Ga0213872_100205992 | 170 |
| 287 | 3300021361 | Ga0213872_10321660 | Ga0213872_103216601 | 170 |
| 288 | 3300025224 | Ga0209784_100006 | Ga0209784_100006438 | 170 |
| 289 | 3300025224 | Ga0209784_100452 | Ga0209784_10045213 | 170 |
| 290 | 3300025225 | Ga0209566_100002 | Ga0209566_100002438 | 170 |
| 291 | 3300025225 | Ga0209566_100218 | Ga0209566_10021833 | 170 |
| 292 | 3300025225 | Ga0209566_100702 | Ga0209566_1007022 | 170 |
| 293 | 3300025225 | Ga0209566_101348 | Ga0209566_1013482 | 170 |
| 294 | 3300025225 | Ga0209566_106577 | Ga0209566_1065772 | 170 |
| 295 | 3300025226 | Ga0209674_100010 | Ga0209674_100010699 | 170 |
| 296 | 3300025226 | Ga0209674_100017 | Ga0209674_100017240 | 170 |
| 297 | 3300025226 | Ga0209674_100060 | Ga0209674_100060133 | 170 |
| 298 | 3300025226 | Ga0209674_100076 | Ga0209674_100076136 | 170 |
| 299 | 3300025226 | Ga0209674_100324 | Ga0209674_10032421 | 170 |
| 300 | 3300025226 | Ga0209674_101404 | Ga0209674_1014045 | 170 |
| 301 | 3300025228 | Ga0209672_100001 | Ga0209672_1000012186 | 170 |
| 302 | 3300025228 | Ga0209672_100041 | Ga0209672_100041221 | 170 |
| 303 | 3300025228 | Ga0209672_100071 | Ga0209672_100071141 | 170 |
| 304 | 3300025228 | Ga0209672_102120 | Ga0209672_1021203 | 170 |
| 305 | 3300025229 | Ga0209147_100018 | Ga0209147_10001882 | 170 |
| 306 | 3300025229 | Ga0209147_100022 | Ga0209147_100022322 | 170 |
| 307 | 3300025229 | Ga0209147_100226 | Ga0209147_10022654 | 170 |
| 308 | 3300025229 | Ga0209147_100401 | Ga0209147_10040129 | 170 |
| 309 | 3300025230 | Ga0209563_100041 | Ga0209563_10004134 | 170 |
| 310 | 3300025230 | Ga0209563_100740 | Ga0209563_1007404 | 170 |
| 311 | 3300025231 | Ga0207427_102710 | Ga0207427_1027102 | 170 |
| 312 | 3300025242 | Ga0209258_100028 | Ga0209258_10002882 | 170 |
| 313 | 3300025242 | Ga0209258_100033 | Ga0209258_10003391 | 170 |
| 314 | 3300025242 | Ga0209258_100309 | Ga0209258_10030923 | 170 |
| 315 | 3300025242 | Ga0209258_100418 | Ga0209258_10041829 | 170 |
| 316 | 3300025245 | Ga0207425_1002645 | Ga0207425_10026455 | 170 |
| 317 | 3300025245 | Ga0207425_1057356 | Ga0207425_10573562 | 170 |
| 318 | 3300025246 | Ga0209646_1000043 | Ga0209646_100004388 | 170 |
| 319 | 3300025250 | Ga0209026_1017580 | Ga0209026_10175802 | 170 |
| 320 | 3300025253 | Ga0209677_100007 | Ga0209677_100007438 | 170 |
| 321 | 3300025253 | Ga0209677_106440 | Ga0209677_1064402 | 170 |
| 322 | 3300025254 | Ga0209148_1000046 | Ga0209148_1000046323 | 170 |
| 323 | 3300025254 | Ga0209148_1000134 | Ga0209148_100013429 | 170 |
| 324 | 3300025254 | Ga0209148_1000162 | Ga0209148_100016249 | 170 |
| 325 | 3300025254 | Ga0209148_1005487 | Ga0209148_10054872 | 170 |
| 326 | 3300025256 | Ga0209759_1000092 | Ga0209759_10000928 | 170 |
| 327 | 3300025256 | Ga0209759_1000184 | Ga0209759_100018474 | 170 |
| 328 | 3300025256 | Ga0209759_1001030 | Ga0209759_100103010 | 170 |
| 329 | 3300025256 | Ga0209759_1001470 | Ga0209759_10014703 | 170 |
| 330 | 3300025256 | Ga0209759_1006172 | Ga0209759_10061725 | 170 |
| 331 | 3300025256 | Ga0209759_1011903 | Ga0209759_10119033 | 170 |
| 332 | 3300025256 | Ga0209759_1012277 | Ga0209759_10122772 | 170 |
| 333 | 3300025258 | Ga0209129_1000035 | Ga0209129_1000035219 | 170 |
| 334 | 3300025261 | Ga0209233_1000050 | Ga0209233_1000050315 | 170 |
| 335 | 3300025263 | Ga0209565_1000106 | Ga0209565_100010631 | 170 |
| 336 | 3300025263 | Ga0209565_1015667 | Ga0209565_10156672 | 170 |
| 337 | 3300025272 | Ga0209455_1000038 | Ga0209455_1000038323 | 170 |
| 338 | 3300025272 | Ga0209455_1000065 | Ga0209455_100006582 | 170 |
| 339 | 3300025272 | Ga0209455_1000315 | Ga0209455_100031529 | 170 |
| 340 | 3300025272 | Ga0209455_1008018 | Ga0209455_10080182 | 170 |
| 341 | 3300025273 | Ga0209673_1000102 | Ga0209673_100010281 | 170 |
| 342 | 3300025273 | Ga0209673_1007570 | Ga0209673_10075702 | 170 |
| 343 | 3300025273 | Ga0209673_1011280 | Ga0209673_10112803 | 170 |
| 344 | 3300025273 | Ga0209673_1014156 | Ga0209673_10141563 | 170 |
| 345 | 3300025273 | Ga0209673_1015533 | Ga0209673_10155332 | 170 |
| 346 | 3300025273 | Ga0209673_1022806 | Ga0209673_10228062 | 170 |
| 347 | 3300025284 | Ga0209130_1009929 | Ga0209130_10099292 | 170 |
| 348 | 3300025291 | Ga0209675_1000168 | Ga0209675_10001683 | 170 |
| 349 | 3300025291 | Ga0209675_1000363 | Ga0209675_10003633 | 170 |
| 350 | 3300025291 | Ga0209675_1006967 | Ga0209675_10069673 | 170 |
| 351 | 3300025292 | Ga0209676_1000036 | Ga0209676_1000036168 | 170 |
| 352 | 3300025294 | Ga0209025_1000110 | Ga0209025_100011050 | 170 |
| 353 | 3300025294 | Ga0209025_1000462 | Ga0209025_10004623 | 170 |
| 354 | 3300025294 | Ga0209025_1001247 | Ga0209025_100124735 | 170 |
| 355 | 3300025294 | Ga0209025_1006182 | Ga0209025_10061828 | 170 |
| 356 | 3300025295 | Ga0209564_1000024 | Ga0209564_1000024413 | 170 |
| 357 | 3300025295 | Ga0209564_1000030 | Ga0209564_1000030153 | 170 |
| 358 | 3300025295 | Ga0209564_1001348 | Ga0209564_100134826 | 170 |
| 359 | 3300025295 | Ga0209564_1003869 | Ga0209564_10038693 | 170 |
| 360 | 3300025295 | Ga0209564_1005611 | Ga0209564_10056113 | 170 |
| 361 | 3300025295 | Ga0209564_1006456 | Ga0209564_10064565 | 170 |
| 362 | 3300025295 | Ga0209564_1009644 | Ga0209564_10096443 | 170 |
| 363 | 3300025297 | Ga0209758_1000066 | Ga0209758_100006699 | 170 |
| 364 | 3300025297 | Ga0209758_1000248 | Ga0209758_100024867 | 170 |
| 365 | 3300025298 | Ga0209050_1000556 | Ga0209050_100055654 | 170 |
| 366 | 3300025298 | Ga0209050_1000614 | Ga0209050_100061441 | 170 |
| 367 | 3300025298 | Ga0209050_1008170 | Ga0209050_10081704 | 170 |
| 368 | 3300025298 | Ga0209050_1008250 | Ga0209050_10082502 | 170 |
| 369 | 3300025299 | Ga0209256_1000030 | Ga0209256_1000030235 | 170 |
| 370 | 3300025299 | Ga0209256_1000197 | Ga0209256_10001979 | 170 |
| 371 | 3300025299 | Ga0209256_1000220 | Ga0209256_100022068 | 170 |
| 372 | 3300025299 | Ga0209256_1000469 | Ga0209256_100046912 | 170 |
| 373 | 3300025299 | Ga0209256_1003387 | Ga0209256_10033878 | 170 |
| 374 | 3300025299 | Ga0209256_1021865 | Ga0209256_10218652 | 170 |
| 375 | 3300025302 | Ga0207426_1000007 | Ga0207426_1000007559 | 170 |
| 376 | 3300025302 | Ga0207426_1002079 | Ga0207426_10020795 | 170 |
| 377 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004654 | 170 |
| 378 | 3300025303 | Ga0209051_1002061 | Ga0209051_100206113 | 170 |
| 379 | 3300025303 | Ga0209051_1003541 | Ga0209051_10035411 | 170 |
| 380 | 3300025303 | Ga0209051_1024073 | Ga0209051_10240732 | 170 |
| 381 | 3300025304 | Ga0209257_1000063 | Ga0209257_1000063140 | 170 |
| 382 | 3300025304 | Ga0209257_1002434 | Ga0209257_10024343 | 170 |
| 383 | 3300025304 | Ga0209257_1004130 | Ga0209257_10041309 | 170 |
| 384 | 3300025304 | Ga0209257_1031974 | Ga0209257_10319742 | 170 |
| 385 | 3300025711 | Ga0207696_1026972 | Ga0207696_10269722 | 170 |
| 386 | 3300025735 | Ga0207713_1000137 | Ga0207713_100013763 | 170 |
| 387 | 3300025735 | Ga0207713_1049881 | Ga0207713_10498812 | 170 |
| 388 | 3300025735 | Ga0207713_1108016 | Ga0207713_11080162 | 170 |
| 389 | 3300025735 | Ga0207713_1150573 | Ga0207713_11505731 | 170 |
| 390 | 3300025903 | Ga0207680_10084046 | Ga0207680_100840462 | 170 |
| 391 | 3300025903 | Ga0207680_10168249 | Ga0207680_101682492 | 170 |
| 392 | 3300025903 | Ga0207680_10374127 | Ga0207680_103741272 | 170 |
| 393 | 3300025904 | Ga0207647_10000216 | Ga0207647_1000021644 | 170 |
| 394 | 3300025904 | Ga0207647_10004229 | Ga0207647_100042291 | 170 |
| 395 | 3300025904 | Ga0207647_10011182 | Ga0207647_100111825 | 170 |
| 396 | 3300025904 | Ga0207647_10021006 | Ga0207647_100210062 | 170 |
| 397 | 3300025904 | Ga0207647_10089085 | Ga0207647_100890851 | 170 |
| 398 | 3300025904 | Ga0207647_10229705 | Ga0207647_102297052 | 170 |
| 399 | 3300025909 | Ga0207705_10005161 | Ga0207705_100051612 | 170 |
| 400 | 3300025909 | Ga0207705_10037796 | Ga0207705_100377962 | 170 |
| 401 | 3300025909 | Ga0207705_10320970 | Ga0207705_103209702 | 170 |
| 402 | 3300025910 | Ga0207684_10065777 | Ga0207684_100657772 | 170 |
| 403 | 3300025911 | Ga0207654_10266819 | Ga0207654_102668192 | 170 |
| 404 | 3300025911 | Ga0207654_10749404 | Ga0207654_107494041 | 170 |
| 405 | 3300025913 | Ga0207695_10019161 | Ga0207695_100191614 | 170 |
| 406 | 3300025913 | Ga0207695_10035571 | Ga0207695_100355714 | 170 |
| 407 | 3300025913 | Ga0207695_10062843 | Ga0207695_100628433 | 170 |
| 408 | 3300025913 | Ga0207695_10226377 | Ga0207695_102263772 | 170 |
| 409 | 3300025913 | Ga0207695_10265284 | Ga0207695_102652842 | 170 |
| 410 | 3300025913 | Ga0207695_10692617 | Ga0207695_106926172 | 170 |
| 411 | 3300025914 | Ga0207671_10059265 | Ga0207671_100592652 | 170 |
| 412 | 3300025914 | Ga0207671_10395458 | Ga0207671_103954582 | 170 |
| 413 | 3300025919 | Ga0207657_10000044 | Ga0207657_1000004432 | 170 |
| 414 | 3300025919 | Ga0207657_10009206 | Ga0207657_100092069 | 170 |
| 415 | 3300025919 | Ga0207657_10206367 | Ga0207657_102063672 | 170 |
| 416 | 3300025919 | Ga0207657_10622836 | Ga0207657_106228361 | 170 |
| 417 | 3300025920 | Ga0207649_10000636 | Ga0207649_1000063612 | 170 |
| 418 | 3300025920 | Ga0207649_10007131 | Ga0207649_100071315 | 170 |
| 419 | 3300025920 | Ga0207649_10028729 | Ga0207649_100287292 | 170 |
| 420 | 3300025920 | Ga0207649_10148298 | Ga0207649_101482982 | 170 |
| 421 | 3300025922 | Ga0207646_10025442 | Ga0207646_100254424 | 170 |
| 422 | 3300025923 | Ga0207681_10046278 | Ga0207681_100462782 | 170 |
| 423 | 3300025924 | Ga0207694_10004421 | Ga0207694_100044212 | 170 |
| 424 | 3300025924 | Ga0207694_10363183 | Ga0207694_103631832 | 170 |
| 425 | 3300025924 | Ga0207694_10428874 | Ga0207694_104288742 | 170 |
| 426 | 3300025925 | Ga0207650_10255989 | Ga0207650_102559892 | 170 |
| 427 | 3300025926 | Ga0207659_10171436 | Ga0207659_101714362 | 170 |
| 428 | 3300025931 | Ga0207644_10666691 | Ga0207644_106666911 | 170 |
| 429 | 3300025932 | Ga0207690_10000046 | Ga0207690_1000004632 | 170 |
| 430 | 3300025932 | Ga0207690_10001085 | Ga0207690_1000108510 | 170 |
| 431 | 3300025932 | Ga0207690_10002717 | Ga0207690_100027177 | 170 |
| 432 | 3300025933 | Ga0207706_10183589 | Ga0207706_101835892 | 170 |
| 433 | 3300025934 | Ga0207686_10006359 | Ga0207686_100063593 | 170 |
| 434 | 3300025935 | Ga0207709_10000599 | Ga0207709_100005997 | 170 |
| 435 | 3300025941 | Ga0207711_10036836 | Ga0207711_100368363 | 170 |
| 436 | 3300025944 | Ga0207661_11066830 | Ga0207661_110668301 | 170 |
| 437 | 3300025945 | Ga0207679_10000012 | Ga0207679_1000001281 | 170 |
| 438 | 3300025945 | Ga0207679_10000107 | Ga0207679_1000010712 | 170 |
| 439 | 3300025945 | Ga0207679_10103628 | Ga0207679_101036282 | 170 |
| 440 | 3300025945 | Ga0207679_10147977 | Ga0207679_101479772 | 170 |
| 441 | 3300025949 | Ga0207667_10003134 | Ga0207667_1000313421 | 170 |
| 442 | 3300025949 | Ga0207667_10012254 | Ga0207667_100122547 | 170 |
| 443 | 3300025949 | Ga0207667_10034287 | Ga0207667_100342872 | 170 |
| 444 | 3300025949 | Ga0207667_10116761 | Ga0207667_101167612 | 170 |
| 445 | 3300025961 | Ga0207712_10324177 | Ga0207712_103241771 | 170 |
| 446 | 3300025972 | Ga0207668_10098962 | Ga0207668_100989622 | 170 |
| 447 | 3300025981 | Ga0207640_10000012 | Ga0207640_10000012179 | 170 |
| 448 | 3300025986 | Ga0207658_10046242 | Ga0207658_100462422 | 170 |
| 449 | 3300025986 | Ga0207658_10096082 | Ga0207658_100960822 | 170 |
| 450 | 3300026035 | Ga0207703_10523097 | Ga0207703_105230971 | 170 |
| 451 | 3300026041 | Ga0207639_10170680 | Ga0207639_101706802 | 170 |
| 452 | 3300026041 | Ga0207639_10443322 | Ga0207639_104433221 | 170 |
| 453 | 3300026067 | Ga0207678_10000009 | Ga0207678_1000000958 | 170 |
| 454 | 3300026067 | Ga0207678_10000286 | Ga0207678_1000028641 | 170 |
| 455 | 3300026067 | Ga0207678_10003470 | Ga0207678_1000347012 | 170 |
| 456 | 3300026067 | Ga0207678_10094921 | Ga0207678_100949212 | 170 |
| 457 | 3300026067 | Ga0207678_10133310 | Ga0207678_101333102 | 170 |
| 458 | 3300026067 | Ga0207678_10180375 | Ga0207678_101803752 | 170 |
| 459 | 3300026078 | Ga0207702_10000028 | Ga0207702_1000002881 | 170 |
| 460 | 3300026088 | Ga0207641_10417029 | Ga0207641_104170292 | 170 |
| 461 | 3300026089 | Ga0207648_10000039 | Ga0207648_1000003958 | 170 |
| 462 | 3300026116 | Ga0207674_10012807 | Ga0207674_100128075 | 170 |
| 463 | 3300026121 | Ga0207683_10467220 | Ga0207683_104672201 | 170 |
| 464 | 3300026142 | Ga0207698_10028878 | Ga0207698_100288783 | 170 |
| 465 | 3300026142 | Ga0207698_10044239 | Ga0207698_100442393 | 170 |
| 466 | 3300027111 | Ga0209281_1000039 | Ga0209281_1000039246 | 170 |
| 467 | 3300027111 | Ga0209281_1000072 | Ga0209281_1000072195 | 170 |
| 468 | 3300027111 | Ga0209281_1032752 | Ga0209281_10327522 | 170 |
| 469 | 3300027296 | Ga0209389_1004640 | Ga0209389_10046401 | 170 |
| 470 | 3300027312 | Ga0209371_1000145 | Ga0209371_100014574 | 170 |
| 471 | 3300027312 | Ga0209371_1003991 | Ga0209371_10039916 | 170 |
| 472 | 3300027312 | Ga0209371_1005262 | Ga0209371_10052622 | 170 |
| 473 | 3300027666 | Ga0209282_1000061 | Ga0209282_100006196 | 170 |
| 474 | 3300027876 | Ga0209974_10001718 | Ga0209974_100017186 | 170 |
| 475 | 3300028380 | Ga0268265_10576516 | Ga0268265_105765161 | 170 |
| 476 | 3300028786 | Ga0307517_10003885 | Ga0307517_1000388521 | 170 |
| 477 | 3300028786 | Ga0307517_10182552 | Ga0307517_101825522 | 170 |
| 478 | 3300028786 | Ga0307517_10425588 | Ga0307517_104255882 | 170 |
| 479 | 3300028794 | Ga0307515_10000013 | Ga0307515_10000013513 | 170 |
| 480 | 3300028794 | Ga0307515_10000179 | Ga0307515_10000179126 | 170 |
| 481 | 3300028794 | Ga0307515_10000239 | Ga0307515_10000239112 | 170 |
| 482 | 3300028794 | Ga0307515_10001166 | Ga0307515_1000116626 | 170 |
| 483 | 3300028794 | Ga0307515_10019026 | Ga0307515_1001902611 | 170 |
| 484 | 3300028794 | Ga0307515_10049706 | Ga0307515_100497065 | 170 |
| 485 | 3300028794 | Ga0307515_10140165 | Ga0307515_101401652 | 170 |
| 486 | 3300028800 | Ga0265338_10000087 | Ga0265338_1000008724 | 170 |
| 487 | 3300030500 | Ga0268256_1000128 | Ga0268256_100012835 | 170 |
| 488 | 3300030500 | Ga0268256_1003719 | Ga0268256_10037192 | 170 |
| 489 | 3300030500 | Ga0268256_1006515 | Ga0268256_10065154 | 170 |
| 490 | 3300031239 | Ga0265328_10005564 | Ga0265328_100055646 | 170 |
| 491 | 3300031239 | Ga0265328_10083473 | Ga0265328_100834732 | 170 |
| 492 | 3300031241 | Ga0265325_10017793 | Ga0265325_100177932 | 170 |
| 493 | 3300031247 | Ga0265340_10037151 | Ga0265340_100371512 | 170 |
| 494 | 3300031251 | Ga0265327_10000147 | Ga0265327_10000147124 | 170 |
| 495 | 3300031456 | Ga0307513_10025671 | Ga0307513_100256712 | 170 |
| 496 | 3300031456 | Ga0307513_10031954 | Ga0307513_100319543 | 170 |
| 497 | 3300031456 | Ga0307513_10137233 | Ga0307513_101372332 | 170 |
| 498 | 3300031507 | Ga0307509_10095836 | Ga0307509_100958362 | 170 |
| 499 | 3300031507 | Ga0307509_10147894 | Ga0307509_101478941 | 170 |
| 500 | 3300031507 | Ga0307509_10170107 | Ga0307509_101701072 | 170 |
| 501 | 3300031548 | Ga0307408_100000298 | Ga0307408_10000029844 | 170 |
| 502 | 3300031548 | Ga0307408_100002033 | Ga0307408_1000020339 | 170 |
| 503 | 3300031548 | Ga0307408_100542698 | Ga0307408_1005426982 | 170 |
| 504 | 3300031616 | Ga0307508_10000048 | Ga0307508_1000004835 | 170 |
| 505 | 3300031616 | Ga0307508_10000122 | Ga0307508_1000012268 | 170 |
| 506 | 3300031616 | Ga0307508_10010633 | Ga0307508_100106336 | 170 |
| 507 | 3300031649 | Ga0307514_10000595 | Ga0307514_1000059520 | 170 |
| 508 | 3300031649 | Ga0307514_10022005 | Ga0307514_100220055 | 170 |
| 509 | 3300031649 | Ga0307514_10026307 | Ga0307514_100263073 | 170 |
| 510 | 3300031649 | Ga0307514_10140682 | Ga0307514_101406822 | 170 |
| 511 | 3300031649 | Ga0307514_10300458 | Ga0307514_103004582 | 170 |
| 512 | 3300031730 | Ga0307516_10000723 | Ga0307516_100007238 | 170 |
| 513 | 3300031730 | Ga0307516_10002560 | Ga0307516_100025602 | 170 |
| 514 | 3300031730 | Ga0307516_10005879 | Ga0307516_1000587914 | 170 |
| 515 | 3300031730 | Ga0307516_10051506 | Ga0307516_100515062 | 170 |
| 516 | 3300031730 | Ga0307516_10331408 | Ga0307516_103314082 | 170 |
| 517 | 3300031730 | Ga0307516_10539279 | Ga0307516_105392792 | 170 |
| 518 | 3300031730 | Ga0307516_10661095 | Ga0307516_106610952 | 170 |
| 519 | 3300031731 | Ga0307405_10006050 | Ga0307405_100060503 | 170 |
| 520 | 3300031731 | Ga0307405_10270003 | Ga0307405_102700032 | 170 |
| 521 | 3300031731 | Ga0307405_10614616 | Ga0307405_106146162 | 170 |
| 522 | 3300031852 | Ga0307410_10115502 | Ga0307410_101155022 | 170 |
| 523 | 3300031901 | Ga0307406_10006328 | Ga0307406_100063285 | 170 |
| 524 | 3300031911 | Ga0307412_10000011 | Ga0307412_10000011311 | 170 |
| 525 | 3300031911 | Ga0307412_10203691 | Ga0307412_102036912 | 170 |
| 526 | 3300031911 | Ga0307412_10472554 | Ga0307412_104725542 | 170 |
| 527 | 3300031995 | Ga0307409_100006395 | Ga0307409_1000063956 | 170 |
| 528 | 3300032002 | Ga0307416_100046596 | Ga0307416_1000465962 | 170 |
| 529 | 3300032005 | Ga0307411_10087012 | Ga0307411_100870122 | 170 |
| 530 | 3300032005 | Ga0307411_11391360 | Ga0307411_113913602 | 170 |
| 531 | 3300033179 | Ga0307507_10014209 | Ga0307507_100142093 | 170 |
| 532 | 3300033180 | Ga0307510_10173162 | Ga0307510_101731621 | 170 |
| 533 | 3300034957 | Ga0373938_0040706 | Ga0373938_0040706_188_709 | 170 |
| 534 | 3300035084 | Ga0373928_0054127 | Ga0373928_0054127_364_891 | 170 |
| 535 | 3300035691 | Ga0373931_0008015 | Ga0373931_0008015_983_1510 | 170 |
| 536 | 3300035695 | Ga0373927_0258380 | Ga0373927_0258380_58_579 | 170 |
| 537 | 3300037312 | Ga0395899_0000421 | Ga0395899_0000421_29418_29930 | 170 |
| 538 | 3300037312 | Ga0395899_0003093 | Ga0395899_0003093_267_779 | 170 |
| 539 | 3300037312 | Ga0395899_0178662 | Ga0395899_0178662_320_832 | 170 |
| 540 | 3300037418 | Ga0395900_0000159 | Ga0395900_0000159_81557_82069 | 170 |
| 541 | 3300037418 | Ga0395900_0000445 | Ga0395900_0000445_23929_24441 | 170 |
| 542 | 3300037418 | Ga0395900_0011343 | Ga0395900_0011343_7404_7916 | 170 |
| 543 | 3300037418 | Ga0395900_0051796 | Ga0395900_0051796_1937_2449 | 170 |
| 544 | 3300037418 | Ga0395900_0089267 | Ga0395900_0089267_644_1156 | 170 |
| 545 | 3300037418 | Ga0395900_0102691 | Ga0395900_0102691_1041_1553 | 170 |
| 546 | 3300037466 | Ga0395898_0000425 | Ga0395898_0000425_7700_8212 | 170 |
| 547 | 3300037466 | Ga0395898_0002174 | Ga0395898_0002174_7798_8310 | 170 |
| 548 | 3300037466 | Ga0395898_0005757 | Ga0395898_0005757_5998_6510 | 170 |
| 549 | 3300037466 | Ga0395898_0045538 | Ga0395898_0045538_2026_2538 | 170 |
| 550 | 3300037466 | Ga0395898_0610299 | Ga0395898_0610299_299_820 | 170 |
| 551 | 3300037466 | Ga0395898_1217434 | Ga0395898_1217434_35_667 | 170 |
| 552 | 3300037471 | Ga0395905_0000079 | Ga0395905_0000079_22170_22682 | 170 |
| 553 | 3300037471 | Ga0395905_0016607 | Ga0395905_0016607_4429_4950 | 170 |
| 554 | 3300037471 | Ga0395905_0016928 | Ga0395905_0016928_4684_5196 | 170 |
| 555 | 3300037471 | Ga0395905_0032505 | Ga0395905_0032505_2521_3042 | 170 |
| 556 | 3300037471 | Ga0395905_0054569 | Ga0395905_0054569_2935_3456 | 170 |
| 557 | 3300038443 | Ga0395901_0000017 | Ga0395901_0000017_195998_196510 | 170 |
| 558 | 3300038443 | Ga0395901_0000109 | Ga0395901_0000109_27025_27537 | 170 |
| 559 | 3300038443 | Ga0395901_0009637 | Ga0395901_0009637_7726_8238 | 170 |
| 560 | 3300038443 | Ga0395901_0065312 | Ga0395901_0065312_1807_2319 | 170 |
| 561 | 3300039437 | Ga0436365_0055475 | Ga0436365_0055475_32_544 | 170 |
| 562 | 3300039438 | Ga0436360_1271525 | Ga0436360_1271525_979_1491 | 170 |
| 563 | 3300039447 | Ga0436361_0276814 | Ga0436361_0276814_430_942 | 170 |
| 564 | 3300039447 | Ga0436361_0357138 | Ga0436361_0357138_36_548 | 170 |
| 565 | 3300039447 | Ga0436361_0474915 | Ga0436361_0474915_3668_4180 | 170 |
| 566 | 3300041404 | Ga0439436_0124971 | Ga0439436_0124971_93_605 | 170 |
| 567 | 3300041413 | Ga0439465_0058776 | Ga0439465_0058776_153_674 | 170 |
| 568 | 3300041459 | Ga0451800_1689085 | Ga0451800_1689085_139_657 | 170 |
| 569 | 3300041486 | Ga0451807_1399310 | Ga0451807_1399310_108_629 | 170 |
| 570 | 3300041486 | Ga0451807_2771500 | Ga0451807_2771500_245_763 | 170 |
| 571 | 3300041496 | Ga0451839_1646275 | Ga0451839_1646275_83_601 | 170 |
| 572 | 3300041498 | Ga0451841_0602513 | Ga0451841_0602513_268_786 | 170 |
| 573 | 3300041512 | Ga0451853_3184930 | Ga0451853_3184930_579_1097 | 170 |
| 574 | 3300041997 | Ga0439431_0009103 | Ga0439431_0009103_1550_2071 | 170 |
| 575 | 3300042005 | Ga0439448_0000197 | Ga0439448_0000197_8734_9246 | 170 |
| 576 | 3300042118 | Ga0450914_019216 | Ga0450914_019216_123_641 | 170 |
| 577 | 3300042121 | Ga0450919_000557 | Ga0450919_000557_1228_1746 | 170 |
| 578 | 3300042126 | Ga0450888_015827 | Ga0450888_015827_70_591 | 170 |
| 579 | 3300042157 | Ga0439458_0060548 | Ga0439458_0060548_187_705 | 170 |
| 580 | 3300042438 | Ga0439459_0001457 | Ga0439459_0001457_2160_2681 | 170 |
| 581 | 3300042531 | Ga0450918_000035 | Ga0450918_000035_23393_23911 | 170 |
| 582 | 3300042876 | Ga0451577_0002691 | Ga0451577_0002691_18661_19182 | 170 |
| 583 | 3300042876 | Ga0451577_0011641 | Ga0451577_0011641_1547_2068 | 170 |
| 584 | 3300042876 | Ga0451577_0021420 | Ga0451577_0021420_3618_4139 | 170 |
| 585 | 3300042876 | Ga0451577_0051158 | Ga0451577_0051158_830_1351 | 170 |
| 586 | 3300042876 | Ga0451577_0206362 | Ga0451577_0206362_942_1463 | 170 |
| 587 | 3300042876 | Ga0451577_0267325 | Ga0451577_0267325_545_1111 | 170 |
| 588 | 3300042876 | Ga0451577_0363728 | Ga0451577_0363728_86_604 | 170 |
| 589 | 3300042876 | Ga0451577_0494385 | Ga0451577_0494385_295_813 | 170 |
| 590 | 3300044656 | Ga0466969_0000493 | Ga0466969_0000493_16923_17435 | 170 |
| 591 | 3300044656 | Ga0466969_0037388 | Ga0466969_0037388_1788_2300 | 170 |
| 592 | 3300044656 | Ga0466969_0049749 | Ga0466969_0049749_865_1377 | 170 |
| 593 | 3300044656 | Ga0466969_0160165 | Ga0466969_0160165_130_642 | 170 |
| 594 | 3300044656 | Ga0466969_0189302 | Ga0466969_0189302_318_830 | 170 |
| 595 | 3300044658 | Ga0466972_0103660 | Ga0466972_0103660_786_1298 | 170 |
| 596 | 3300044658 | Ga0466972_0142132 | Ga0466972_0142132_18_539 | 170 |
| 597 | 3300044659 | Ga0466973_0089504 | Ga0466973_0089504_1899_2411 | 170 |
| 598 | 3300044666 | Ga0466977_0000673 | Ga0466977_0000673_4098_4610 | 170 |
| 599 | 3300044671 | Ga0466978_0016741 | Ga0466978_0016741_393_905 | 170 |
| 600 | 3300044671 | Ga0466978_0448168 | Ga0466978_0448168_82_594 | 170 |
| 601 | 3300044673 | Ga0453683_0321818 | Ga0453683_0321818_404_925 | 170 |
| 602 | 3300044673 | Ga0453683_0660378 | Ga0453683_0660378_132_653 | 170 |
| 603 | 3300044673 | Ga0453683_0667859 | Ga0453683_0667859_28_549 | 170 |
| 604 | 3300044683 | Ga0466965_0003295 | Ga0466965_0003295_464_976 | 170 |
| 605 | 3300044683 | Ga0466965_0004833 | Ga0466965_0004833_4898_5410 | 170 |
| 606 | 3300044683 | Ga0466965_0096356 | Ga0466965_0096356_240_752 | 170 |
| 607 | 3300044683 | Ga0466965_0286824 | Ga0466965_0286824_181_693 | 170 |
| 608 | 3300044684 | Ga0466966_0000431 | Ga0466966_0000431_4548_5060 | 170 |
| 609 | 3300044684 | Ga0466966_0006383 | Ga0466966_0006383_2896_3408 | 170 |
| 610 | 3300044684 | Ga0466966_0013580 | Ga0466966_0013580_3091_3603 | 170 |
| 611 | 3300044684 | Ga0466966_0278330 | Ga0466966_0278330_384_896 | 170 |
| 612 | 3300044693 | Ga0466961_0000698 | Ga0466961_0000698_5454_5966 | 170 |
| 613 | 3300044693 | Ga0466961_0001496 | Ga0466961_0001496_11905_12417 | 170 |
| 614 | 3300044693 | Ga0466961_0038919 | Ga0466961_0038919_1761_2273 | 170 |
| 615 | 3300044693 | Ga0466961_0044697 | Ga0466961_0044697_143_655 | 170 |
| 616 | 3300044693 | Ga0466961_0049456 | Ga0466961_0049456_1230_1742 | 170 |
| 617 | 3300044693 | Ga0466961_0175587 | Ga0466961_0175587_697_1209 | 170 |
| 618 | 3300044693 | Ga0466961_0180486 | Ga0466961_0180486_530_1042 | 170 |
| 619 | 3300044694 | Ga0466963_0014335 | Ga0466963_0014335_2939_3451 | 170 |
| 620 | 3300044694 | Ga0466963_0028670 | Ga0466963_0028670_1928_2440 | 170 |
| 621 | 3300044694 | Ga0466963_0050273 | Ga0466963_0050273_1800_2312 | 170 |
| 622 | 3300044694 | Ga0466963_0335880 | Ga0466963_0335880_410_922 | 170 |
| 623 | 3300044706 | Ga0466964_0047790 | Ga0466964_0047790_688_1200 | 170 |
| 624 | 3300044712 | Ga0453684_0000222 | Ga0453684_0000222_7481_8002 | 170 |
| 625 | 3300044712 | Ga0453684_0000659 | Ga0453684_0000659_7461_7982 | 170 |
| 626 | 3300044712 | Ga0453684_0001598 | Ga0453684_0001598_36909_37430 | 170 |
| 627 | 3300044712 | Ga0453684_0143536 | Ga0453684_0143536_1876_2397 | 170 |
| 628 | 3300044712 | Ga0453684_0163016 | Ga0453684_0163016_1326_1847 | 170 |
| 629 | 3300044719 | Ga0466971_0001521 | Ga0466971_0001521_5572_6084 | 170 |
| 630 | 3300044719 | Ga0466971_0007298 | Ga0466971_0007298_1732_2244 | 170 |
| 631 | 3300044719 | Ga0466971_0031567 | Ga0466971_0031567_509_1021 | 170 |
| 632 | 3300044719 | Ga0466971_0131728 | Ga0466971_0131728_502_1014 | 170 |
| 633 | 3300044735 | Ga0466968_0062191 | Ga0466968_0062191_815_1327 | 170 |
| 634 | 3300044765 | Ga0466970_0122243 | Ga0466970_0122243_392_904 | 170 |
| 635 | 3300044765 | Ga0466970_0305069 | Ga0466970_0305069_78_590 | 170 |
| 636 | 3300044842 | Ga0466957_0037134 | Ga0466957_0037134_607_1119 | 170 |
| 637 | 3300044842 | Ga0466957_0039769 | Ga0466957_0039769_458_970 | 170 |
| 638 | 3300044842 | Ga0466957_0090802 | Ga0466957_0090802_910_1422 | 170 |
| 639 | 3300044842 | Ga0466957_0339861 | Ga0466957_0339861_366_878 | 170 |
| 640 | 3300044842 | Ga0466957_0359606 | Ga0466957_0359606_113_625 | 170 |
| 641 | 3300044842 | Ga0466957_0554382 | Ga0466957_0554382_193_705 | 170 |
| 642 | 3300045049 | Ga0466959_0001907 | Ga0466959_0001907_12088_12600 | 170 |
| 643 | 3300045049 | Ga0466959_0012308 | Ga0466959_0012308_3185_3697 | 170 |
| 644 | 3300045049 | Ga0466959_0017092 | Ga0466959_0017092_1044_1556 | 170 |
| 645 | 3300045049 | Ga0466959_0063301 | Ga0466959_0063301_1471_1983 | 170 |
| 646 | 3300045049 | Ga0466959_0318101 | Ga0466959_0318101_170_682 | 170 |
| 647 | 3300045051 | Ga0451576_0000169 | Ga0451576_0000169_1235_1756 | 170 |
| 648 | 3300045051 | Ga0451576_0143833 | Ga0451576_0143833_11_532 | 170 |
| 649 | 3300045051 | Ga0451576_0206374 | Ga0451576_0206374_903_1430 | 170 |
| 650 | 3300045051 | Ga0451576_0502204 | Ga0451576_0502204_369_890 | 170 |
| 651 | 3300045051 | Ga0451576_1030071 | Ga0451576_1030071_185_700 | 170 |
| 652 | 3300045836 | Ga0466958_0007430 | Ga0466958_0007430_1718_2230 | 170 |
| 653 | 3300045836 | Ga0466958_0015060 | Ga0466958_0015060_3711_4223 | 170 |
| 654 | 3300045836 | Ga0466958_0134903 | Ga0466958_0134903_355_867 | 170 |
| 655 | 3300045836 | Ga0466958_0168946 | Ga0466958_0168946_515_1027 | 170 |
| 656 | 3300045976 | Ga0466967_0146710 | Ga0466967_0146710_327_839 | 170 |
| 657 | 3300046454 | Ga0495592_0050852 | Ga0495592_0050852_1173_1685 | 170 |
| 658 | 3300046454 | Ga0495592_0067818 | Ga0495592_0067818_1821_2333 | 170 |
| 659 | 3300046454 | Ga0495592_0089242 | Ga0495592_0089242_1196_1708 | 170 |
| 660 | 3300046455 | Ga0495603_0009839 | Ga0495603_0009839_2163_2675 | 170 |
| 661 | 3300046455 | Ga0495603_0017889 | Ga0495603_0017889_429_941 | 170 |
| 662 | 3300046455 | Ga0495603_0126336 | Ga0495603_0126336_580_1092 | 170 |
| 663 | 3300046457 | Ga0495590_0004166 | Ga0495590_0004166_482_994 | 170 |
| 664 | 3300046457 | Ga0495590_0008265 | Ga0495590_0008265_2032_2553 | 170 |
| 665 | 3300046457 | Ga0495590_0012809 | Ga0495590_0012809_1832_2344 | 170 |
| 666 | 3300046457 | Ga0495590_0021061 | Ga0495590_0021061_419_931 | 170 |
| 667 | 3300046459 | Ga0495629_0000350 | Ga0495629_0000350_27859_28371 | 170 |
| 668 | 3300046459 | Ga0495629_0000676 | Ga0495629_0000676_12470_12982 | 170 |
| 669 | 3300046459 | Ga0495629_0001209 | Ga0495629_0001209_14184_14696 | 170 |
| 670 | 3300046459 | Ga0495629_0011325 | Ga0495629_0011325_5591_6103 | 170 |
| 671 | 3300046459 | Ga0495629_0117026 | Ga0495629_0117026_1300_1812 | 170 |
| 672 | 3300046459 | Ga0495629_0323723 | Ga0495629_0323723_82_594 | 170 |
| 673 | 3300046459 | Ga0495629_0398243 | Ga0495629_0398243_200_721 | 170 |
| 674 | 3300046460 | Ga0495638_0012433 | Ga0495638_0012433_4712_5224 | 170 |
| 675 | 3300046460 | Ga0495638_0073743 | Ga0495638_0073743_462_974 | 170 |
| 676 | 3300046461 | Ga0495641_0018783 | Ga0495641_0018783_970_1482 | 170 |
| 677 | 3300046461 | Ga0495641_0048066 | Ga0495641_0048066_1053_1565 | 170 |
| 678 | 3300046462 | Ga0495651_0018210 | Ga0495651_0018210_4530_5042 | 170 |
| 679 | 3300046462 | Ga0495651_0091459 | Ga0495651_0091459_1186_1698 | 170 |
| 680 | 3300046463 | Ga0495653_0013167 | Ga0495653_0013167_527_1039 | 170 |
| 681 | 3300046463 | Ga0495653_0026233 | Ga0495653_0026233_600_1112 | 170 |
| 682 | 3300046463 | Ga0495653_0075356 | Ga0495653_0075356_1524_2036 | 170 |
| 683 | 3300046463 | Ga0495653_0085820 | Ga0495653_0085820_954_1466 | 170 |
| 684 | 3300046471 | Ga0495650_0003448 | Ga0495650_0003448_82_594 | 170 |
| 685 | 3300046471 | Ga0495650_0009266 | Ga0495650_0009266_4933_5445 | 170 |
| 686 | 3300046471 | Ga0495650_0023967 | Ga0495650_0023967_2140_2652 | 170 |
| 687 | 3300046471 | Ga0495650_0025851 | Ga0495650_0025851_1150_1662 | 170 |
| 688 | 3300046471 | Ga0495650_0028449 | Ga0495650_0028449_398_910 | 170 |
| 689 | 3300046471 | Ga0495650_0033224 | Ga0495650_0033224_160_681 | 170 |
| 690 | 3300046471 | Ga0495650_0041177 | Ga0495650_0041177_955_1467 | 170 |
| 691 | 3300046472 | Ga0495580_0000001 | Ga0495580_0000001_55159_55671 | 170 |
| 692 | 3300046472 | Ga0495580_0009533 | Ga0495580_0009533_4108_4620 | 170 |
| 693 | 3300046472 | Ga0495580_0019500 | Ga0495580_0019500_4130_4642 | 170 |
| 694 | 3300046472 | Ga0495580_0030923 | Ga0495580_0030923_914_1426 | 170 |
| 695 | 3300046472 | Ga0495580_0099457 | Ga0495580_0099457_1163_1675 | 170 |
| 696 | 3300046472 | Ga0495580_0120524 | Ga0495580_0120524_910_1422 | 170 |
| 697 | 3300046472 | Ga0495580_0225977 | Ga0495580_0225977_246_758 | 170 |
| 698 | 3300046472 | Ga0495580_0275515 | Ga0495580_0275515_595_1107 | 170 |
| 699 | 3300046472 | Ga0495580_0334625 | Ga0495580_0334625_504_1016 | 170 |
| 700 | 3300046473 | Ga0495582_0002692 | Ga0495582_0002692_8285_8797 | 170 |
| 701 | 3300046473 | Ga0495582_0012374 | Ga0495582_0012374_3806_4318 | 170 |
| 702 | 3300046474 | Ga0495605_0011540 | Ga0495605_0011540_2761_3273 | 170 |
| 703 | 3300046474 | Ga0495605_0013340 | Ga0495605_0013340_2046_2558 | 170 |
| 704 | 3300046474 | Ga0495605_0028772 | Ga0495605_0028772_1648_2160 | 170 |
| 705 | 3300046474 | Ga0495605_0043489 | Ga0495605_0043489_488_1000 | 170 |
| 706 | 3300046474 | Ga0495605_0138791 | Ga0495605_0138791_204_716 | 170 |
| 707 | 3300046474 | Ga0495605_0258373 | Ga0495605_0258373_206_718 | 170 |
| 708 | 3300046476 | Ga0495662_0025265 | Ga0495662_0025265_582_1094 | 170 |
| 709 | 3300046477 | Ga0495664_0002647 | Ga0495664_0002647_2306_2818 | 170 |
| 710 | 3300046477 | Ga0495664_0016595 | Ga0495664_0016595_2207_2719 | 170 |
| 711 | 3300046477 | Ga0495664_0082556 | Ga0495664_0082556_258_770 | 170 |
| 712 | 3300046477 | Ga0495664_0127317 | Ga0495664_0127317_836_1348 | 170 |
| 713 | 3300046477 | Ga0495664_0148094 | Ga0495664_0148094_499_1011 | 170 |
| 714 | 3300046477 | Ga0495664_0181461 | Ga0495664_0181461_213_725 | 170 |
| 715 | 3300046477 | Ga0495664_0370809 | Ga0495664_0370809_218_730 | 170 |
| 716 | 3300046491 | Ga0495584_0028382 | Ga0495584_0028382_1847_2359 | 170 |
| 717 | 3300046492 | Ga0495585_0024408 | Ga0495585_0024408_2069_2593 | 170 |
| 718 | 3300046492 | Ga0495585_0073044 | Ga0495585_0073044_1172_1684 | 170 |
| 719 | 3300046499 | Ga0495594_0053840 | Ga0495594_0053840_1192_1704 | 170 |
| 720 | 3300046500 | Ga0495596_0022238 | Ga0495596_0022238_241_753 | 170 |
| 721 | 3300046500 | Ga0495596_0025511 | Ga0495596_0025511_1488_2000 | 170 |
| 722 | 3300046500 | Ga0495596_0031853 | Ga0495596_0031853_1323_1835 | 170 |
| 723 | 3300046500 | Ga0495596_0051645 | Ga0495596_0051645_125_637 | 170 |
| 724 | 3300046501 | Ga0495607_0000044 | Ga0495607_0000044_51824_52372 | 170 |
| 725 | 3300046501 | Ga0495607_0058822 | Ga0495607_0058822_308_820 | 170 |
| 726 | 3300046506 | Ga0495583_0011505 | Ga0495583_0011505_4541_5053 | 170 |
| 727 | 3300046506 | Ga0495583_0097030 | Ga0495583_0097030_583_1104 | 170 |
| 728 | 3300046506 | Ga0495583_0131706 | Ga0495583_0131706_306_818 | 170 |
| 729 | 3300046507 | Ga0495606_0016268 | Ga0495606_0016268_1873_2385 | 170 |
| 730 | 3300046507 | Ga0495606_0020827 | Ga0495606_0020827_3554_4066 | 170 |
| 731 | 3300046507 | Ga0495606_0058889 | Ga0495606_0058889_1858_2370 | 170 |
| 732 | 3300046507 | Ga0495606_0072777 | Ga0495606_0072777_186_698 | 170 |
| 733 | 3300046507 | Ga0495606_0093316 | Ga0495606_0093316_982_1494 | 170 |
| 734 | 3300046507 | Ga0495606_0101390 | Ga0495606_0101390_98_610 | 170 |
| 735 | 3300046507 | Ga0495606_0241107 | Ga0495606_0241107_107_631 | 170 |
| 736 | 3300046507 | Ga0495606_0377099 | Ga0495606_0377099_89_601 | 170 |
| 737 | 3300046511 | Ga0495608_0062016 | Ga0495608_0062016_1682_2194 | 170 |
| 738 | 3300046511 | Ga0495608_0194132 | Ga0495608_0194132_81_593 | 170 |
| 739 | 3300046511 | Ga0495608_0194515 | Ga0495608_0194515_59_571 | 170 |
| 740 | 3300046512 | Ga0495610_0030270 | Ga0495610_0030270_568_1080 | 170 |
| 741 | 3300046512 | Ga0495610_0049719 | Ga0495610_0049719_1242_1754 | 170 |
| 742 | 3300046512 | Ga0495610_0057701 | Ga0495610_0057701_257_778 | 170 |
| 743 | 3300046512 | Ga0495610_0125608 | Ga0495610_0125608_70_591 | 170 |
| 744 | 3300046512 | Ga0495610_0135091 | Ga0495610_0135091_314_832 | 170 |
| 745 | 3300046513 | Ga0495616_0007919 | Ga0495616_0007919_752_1264 | 170 |
| 746 | 3300046514 | Ga0495618_0003677 | Ga0495618_0003677_4489_5001 | 170 |
| 747 | 3300046514 | Ga0495618_0054176 | Ga0495618_0054176_235_747 | 170 |
| 748 | 3300046514 | Ga0495618_0368817 | Ga0495618_0368817_312_824 | 170 |
| 749 | 3300046515 | Ga0495620_0015323 | Ga0495620_0015323_323_835 | 170 |
| 750 | 3300046515 | Ga0495620_0020708 | Ga0495620_0020708_1835_2347 | 170 |
| 751 | 3300046515 | Ga0495620_0065208 | Ga0495620_0065208_244_756 | 170 |
| 752 | 3300046516 | Ga0495628_0000262 | Ga0495628_0000262_42891_43403 | 170 |
| 753 | 3300046516 | Ga0495628_0023102 | Ga0495628_0023102_4196_4708 | 170 |
| 754 | 3300046516 | Ga0495628_0026203 | Ga0495628_0026203_2546_3058 | 170 |
| 755 | 3300046516 | Ga0495628_0046943 | Ga0495628_0046943_1721_2233 | 170 |
| 756 | 3300046516 | Ga0495628_0351805 | Ga0495628_0351805_226_738 | 170 |
| 757 | 3300046517 | Ga0495630_0004146 | Ga0495630_0004146_4399_4911 | 170 |
| 758 | 3300046517 | Ga0495630_0049487 | Ga0495630_0049487_1370_1882 | 170 |
| 759 | 3300046517 | Ga0495630_0057140 | Ga0495630_0057140_2044_2556 | 170 |
| 760 | 3300046517 | Ga0495630_0063604 | Ga0495630_0063604_370_882 | 170 |
| 761 | 3300046518 | Ga0495631_0085976 | Ga0495631_0085976_141_662 | 170 |
| 762 | 3300046519 | Ga0495632_0005415 | Ga0495632_0005415_1316_1837 | 170 |
| 763 | 3300046519 | Ga0495632_0021619 | Ga0495632_0021619_2003_2521 | 170 |
| 764 | 3300046522 | Ga0495643_0192830 | Ga0495643_0192830_70_582 | 170 |
| 765 | 3300046522 | Ga0495643_0239942 | Ga0495643_0239942_225_737 | 170 |
| 766 | 3300046523 | Ga0495644_0125517 | Ga0495644_0125517_354_866 | 170 |
| 767 | 3300046524 | Ga0495648_0012471 | Ga0495648_0012471_5642_6154 | 170 |
| 768 | 3300046524 | Ga0495648_0012802 | Ga0495648_0012802_1724_2236 | 170 |
| 769 | 3300046524 | Ga0495648_0019099 | Ga0495648_0019099_3756_4268 | 170 |
| 770 | 3300046524 | Ga0495648_0095490 | Ga0495648_0095490_324_845 | 170 |
| 771 | 3300046526 | Ga0495666_0004161 | Ga0495666_0004161_323_835 | 170 |
| 772 | 3300046526 | Ga0495666_0006932 | Ga0495666_0006932_4922_5434 | 170 |
| 773 | 3300046526 | Ga0495666_0010532 | Ga0495666_0010532_997_1509 | 170 |
| 774 | 3300046528 | Ga0495642_0043013 | Ga0495642_0043013_438_950 | 170 |
| 775 | 3300046528 | Ga0495642_0052150 | Ga0495642_0052150_248_760 | 170 |
| 776 | 3300046528 | Ga0495642_0067527 | Ga0495642_0067527_922_1443 | 170 |
| 777 | 3300046528 | Ga0495642_0129195 | Ga0495642_0129195_40_561 | 170 |
| 778 | 3300046528 | Ga0495642_0136903 | Ga0495642_0136903_437_949 | 170 |
| 779 | 3300046529 | Ga0495652_0017575 | Ga0495652_0017575_4711_5223 | 170 |
| 780 | 3300046529 | Ga0495652_0023307 | Ga0495652_0023307_980_1492 | 170 |
| 781 | 3300046529 | Ga0495652_0025263 | Ga0495652_0025263_180_692 | 170 |
| 782 | 3300046529 | Ga0495652_0060455 | Ga0495652_0060455_1263_1775 | 170 |
| 783 | 3300046530 | Ga0495654_0043090 | Ga0495654_0043090_247_759 | 170 |
| 784 | 3300046530 | Ga0495654_0180336 | Ga0495654_0180336_316_828 | 170 |
| 785 | 3300046531 | Ga0495665_0003952 | Ga0495665_0003952_7292_7804 | 170 |
| 786 | 3300046531 | Ga0495665_0011526 | Ga0495665_0011526_1174_1686 | 170 |
| 787 | 3300046531 | Ga0495665_0013158 | Ga0495665_0013158_482_994 | 170 |
| 788 | 3300046531 | Ga0495665_0014545 | Ga0495665_0014545_511_1023 | 170 |
| 789 | 3300046531 | Ga0495665_0027170 | Ga0495665_0027170_287_799 | 170 |
| 790 | 3300046533 | Ga0495640_0005464 | Ga0495640_0005464_3414_3926 | 170 |
| 791 | 3300046533 | Ga0495640_0026890 | Ga0495640_0026890_224_736 | 170 |
| 792 | 3300046533 | Ga0495640_0047455 | Ga0495640_0047455_260_772 | 170 |
| 793 | 3300046535 | Ga0495586_0001325 | Ga0495586_0001325_8378_8890 | 170 |
| 794 | 3300046536 | Ga0495587_0043356 | Ga0495587_0043356_650_1162 | 170 |
| 795 | 3300046538 | Ga0495609_0032863 | Ga0495609_0032863_1485_1997 | 170 |
| 796 | 3300046542 | Ga0495597_0003643 | Ga0495597_0003643_1389_1910 | 170 |
| 797 | 3300046542 | Ga0495597_0030019 | Ga0495597_0030019_193_705 | 170 |
| 798 | 3300046542 | Ga0495597_0242185 | Ga0495597_0242185_37_549 | 170 |
| 799 | 3300046543 | Ga0495645_0003095 | Ga0495645_0003095_5945_6457 | 170 |
| 800 | 3300046543 | Ga0495645_0034987 | Ga0495645_0034987_1268_1780 | 170 |
| 801 | 3300046543 | Ga0495645_0050757 | Ga0495645_0050757_1126_1638 | 170 |
| 802 | 3300046543 | Ga0495645_0082140 | Ga0495645_0082140_1286_1798 | 170 |
| 803 | 3300046557 | Ga0495622_0000323 | Ga0495622_0000323_15101_15613 | 170 |
| 804 | 3300046557 | Ga0495622_0072903 | Ga0495622_0072903_319_831 | 170 |
| 805 | 3300046559 | Ga0495667_0091605 | Ga0495667_0091605_498_1010 | 170 |
| 806 | 3300046559 | Ga0495667_0306212 | Ga0495667_0306212_427_939 | 170 |
| 807 | 3300046616 | Ga0495668_0579891 | Ga0495668_0579891_26_547 | 170 |
| 808 | 3300046642 | Ga0495634_0012324 | Ga0495634_0012324_1268_1780 | 170 |
| 809 | 3300046642 | Ga0495634_0017115 | Ga0495634_0017115_1454_1966 | 170 |
| 810 | 3300046642 | Ga0495634_0021353 | Ga0495634_0021353_3579_4091 | 170 |
| 811 | 3300046642 | Ga0495634_0123088 | Ga0495634_0123088_149_661 | 170 |
| 812 | 3300046648 | Ga0495611_0026094 | Ga0495611_0026094_1379_1891 | 170 |
| 813 | 3300046648 | Ga0495611_0055137 | Ga0495611_0055137_630_1151 | 170 |
| 814 | 3300046660 | Ga0495625_0006884 | Ga0495625_0006884_8086_8604 | 170 |
| 815 | 3300046660 | Ga0495625_0118480 | Ga0495625_0118480_1205_1726 | 170 |
| 816 | 3300046663 | Ga0495635_0000381 | Ga0495635_0000381_18430_18942 | 170 |
| 817 | 3300046663 | Ga0495635_0009189 | Ga0495635_0009189_4493_5005 | 170 |
| 818 | 3300046663 | Ga0495635_0011998 | Ga0495635_0011998_5355_5867 | 170 |
| 819 | 3300046665 | Ga0495661_0014497 | Ga0495661_0014497_430_942 | 170 |
| 820 | 3300046665 | Ga0495661_0021507 | Ga0495661_0021507_226_738 | 170 |
| 821 | 3300046665 | Ga0495661_0045087 | Ga0495661_0045087_1589_2101 | 170 |
| 822 | 3300046665 | Ga0495661_0142680 | Ga0495661_0142680_322_834 | 170 |
| 823 | 3300046675 | Ga0495657_0032130 | Ga0495657_0032130_794_1306 | 170 |
| 824 | 3300046678 | Ga0495599_0026415 | Ga0495599_0026415_430_942 | 170 |
| 825 | 3300046678 | Ga0495599_0050372 | Ga0495599_0050372_1922_2434 | 170 |
| 826 | 3300046678 | Ga0495599_0057819 | Ga0495599_0057819_466_978 | 170 |
| 827 | 3300046678 | Ga0495599_0481510 | Ga0495599_0481510_210_722 | 170 |
| 828 | 3300046679 | Ga0495623_0002662 | Ga0495623_0002662_6047_6559 | 170 |
| 829 | 3300046679 | Ga0495623_0003990 | Ga0495623_0003990_5267_5779 | 170 |
| 830 | 3300046680 | Ga0495646_0001984 | Ga0495646_0001984_6459_6971 | 170 |
| 831 | 3300046680 | Ga0495646_0008866 | Ga0495646_0008866_1984_2496 | 170 |
| 832 | 3300046680 | Ga0495646_0016544 | Ga0495646_0016544_376_888 | 170 |
| 833 | 3300046680 | Ga0495646_0073419 | Ga0495646_0073419_382_894 | 170 |
| 834 | 3300046680 | Ga0495646_0409117 | Ga0495646_0409117_177_689 | 170 |
| 835 | 3300046684 | Ga0495669_0087605 | Ga0495669_0087605_667_1188 | 170 |
| 836 | 3300046684 | Ga0495669_0156277 | Ga0495669_0156277_310_822 | 170 |
| 837 | 3300046684 | Ga0495669_0199567 | Ga0495669_0199567_58_570 | 170 |
| 838 | 3300046684 | Ga0495669_0240464 | Ga0495669_0240464_299_811 | 170 |
| 839 | 3300046684 | Ga0495669_0279988 | Ga0495669_0279988_79_591 | 170 |
| 840 | 3300046684 | Ga0495669_0297907 | Ga0495669_0297907_58_570 | 170 |
| 841 | 3300046689 | Ga0495613_0010036 | Ga0495613_0010036_6135_6647 | 170 |
| 842 | 3300046689 | Ga0495613_0029195 | Ga0495613_0029195_241_753 | 170 |
| 843 | 3300046689 | Ga0495613_0290063 | Ga0495613_0290063_293_805 | 170 |
| 844 | 3300046690 | Ga0495624_0004047 | Ga0495624_0004047_4869_5381 | 170 |
| 845 | 3300046690 | Ga0495624_0015178 | Ga0495624_0015178_4464_4976 | 170 |
| 846 | 3300046690 | Ga0495624_0041103 | Ga0495624_0041103_276_788 | 170 |
| 847 | 3300046690 | Ga0495624_0072943 | Ga0495624_0072943_1174_1686 | 170 |
| 848 | 3300046690 | Ga0495624_0081472 | Ga0495624_0081472_1425_1937 | 170 |
| 849 | 3300046690 | Ga0495624_0276904 | Ga0495624_0276904_450_962 | 170 |
| 850 | 3300046691 | Ga0495670_0027374 | Ga0495670_0027374_1695_2207 | 170 |
| 851 | 3300046691 | Ga0495670_0059758 | Ga0495670_0059758_1184_1696 | 170 |
| 852 | 3300046692 | Ga0495671_0011561 | Ga0495671_0011561_867_1379 | 170 |
| 853 | 3300046692 | Ga0495671_0035689 | Ga0495671_0035689_1531_2043 | 170 |
| 854 | 3300046692 | Ga0495671_0190862 | Ga0495671_0190862_422_943 | 170 |
| 855 | 3300046694 | Ga0495649_0023864 | Ga0495649_0023864_624_1136 | 170 |
| 856 | 3300046694 | Ga0495649_0032962 | Ga0495649_0032962_723_1235 | 170 |
| 857 | 3300046694 | Ga0495649_0044504 | Ga0495649_0044504_1365_1886 | 170 |
| 858 | 3300046694 | Ga0495649_0058728 | Ga0495649_0058728_1193_1705 | 170 |
| 859 | 3300046694 | Ga0495649_0061512 | Ga0495649_0061512_604_1116 | 170 |
| 860 | 3300046694 | Ga0495649_0064137 | Ga0495649_0064137_182_694 | 170 |
| 861 | 3300046694 | Ga0495649_0104511 | Ga0495649_0104511_301_813 | 170 |
| 862 | 3300046694 | Ga0495649_0198861 | Ga0495649_0198861_265_777 | 170 |
| 863 | 3300046794 | Ga0495589_0003622 | Ga0495589_0003622_5987_6499 | 170 |
| 864 | 3300046794 | Ga0495589_0038158 | Ga0495589_0038158_895_1407 | 170 |
| 865 | 3300046794 | Ga0495589_0119675 | Ga0495589_0119675_246_758 | 170 |
| 866 | 3300046809 | Ga0495600_0008130 | Ga0495600_0008130_2232_2744 | 170 |
| 867 | 3300046809 | Ga0495600_0043890 | Ga0495600_0043890_286_798 | 170 |
| 868 | 3300046810 | Ga0495660_0017159 | Ga0495660_0017159_1459_1971 | 170 |
| 869 | 3300046810 | Ga0495660_0101677 | Ga0495660_0101677_96_608 | 170 |
| 870 | 3300046810 | Ga0495660_0127836 | Ga0495660_0127836_155_676 | 170 |
| 871 | 3300046810 | Ga0495660_0166222 | Ga0495660_0166222_112_624 | 170 |
| 872 | 3300047315 | Ga0495581_0001082 | Ga0495581_0001082_7880_8392 | 170 |
| 873 | 3300047315 | Ga0495581_0009759 | Ga0495581_0009759_4639_5151 | 170 |
| 874 | 3300047315 | Ga0495581_0015272 | Ga0495581_0015272_3694_4206 | 170 |
| 875 | 3300047317 | Ga0495604_0001718 | Ga0495604_0001718_16929_17441 | 170 |
| 876 | 3300047317 | Ga0495604_0003130 | Ga0495604_0003130_6036_6548 | 170 |
| 877 | 3300047317 | Ga0495604_0026680 | Ga0495604_0026680_3876_4388 | 170 |
| 878 | 3300047317 | Ga0495604_0028005 | Ga0495604_0028005_870_1382 | 170 |
| 879 | 3300047317 | Ga0495604_0072782 | Ga0495604_0072782_1369_1881 | 170 |
| 880 | 3300047317 | Ga0495604_0323952 | Ga0495604_0323952_105_617 | 170 |
| 881 | 3300047318 | Ga0495636_0156271 | Ga0495636_0156271_23_544 | 170 |
| 882 | 3300047319 | Ga0495674_0000665 | Ga0495674_0000665_28545_29057 | 170 |
| 883 | 3300047319 | Ga0495674_0023044 | Ga0495674_0023044_4381_4893 | 170 |
| 884 | 3300047319 | Ga0495674_0030932 | Ga0495674_0030932_2313_2825 | 170 |
| 885 | 3300047319 | Ga0495674_0413173 | Ga0495674_0413173_155_667 | 170 |
| 886 | 3300047320 | Ga0495672_0001486 | Ga0495672_0001486_17939_18451 | 170 |
| 887 | 3300047320 | Ga0495672_0066950 | Ga0495672_0066950_210_722 | 170 |
| 888 | 3300047320 | Ga0495672_0113097 | Ga0495672_0113097_363_875 | 170 |
| 889 | 3300047320 | Ga0495672_0145062 | Ga0495672_0145062_451_963 | 170 |
| 890 | 3300047320 | Ga0495672_0149118 | Ga0495672_0149118_150_662 | 170 |
| 891 | 3300047321 | Ga0495676_0087719 | Ga0495676_0087719_430_942 | 170 |
| 892 | 3300047321 | Ga0495676_0147631 | Ga0495676_0147631_845_1357 | 170 |
| 893 | 3300047321 | Ga0495676_0217238 | Ga0495676_0217238_230_742 | 170 |
| 894 | 3300047322 | Ga0495680_0011970 | Ga0495680_0011970_2129_2641 | 170 |
| 895 | 3300047322 | Ga0495680_0030485 | Ga0495680_0030485_543_1055 | 170 |
| 896 | 3300047322 | Ga0495680_0133286 | Ga0495680_0133286_594_1106 | 170 |
| 897 | 3300047322 | Ga0495680_0204936 | Ga0495680_0204936_332_844 | 170 |
| 898 | 3300047323 | Ga0495683_0000838 | Ga0495683_0000838_13955_14467 | 170 |
| 899 | 3300047323 | Ga0495683_0008256 | Ga0495683_0008256_3285_3797 | 170 |
| 900 | 3300047323 | Ga0495683_0009032 | Ga0495683_0009032_3212_3724 | 170 |
| 901 | 3300047323 | Ga0495683_0026883 | Ga0495683_0026883_1815_2327 | 170 |
| 902 | 3300047323 | Ga0495683_0054747 | Ga0495683_0054747_1034_1546 | 170 |
| 903 | 3300047323 | Ga0495683_0115112 | Ga0495683_0115112_276_788 | 170 |
| 904 | 3300047323 | Ga0495683_0172316 | Ga0495683_0172316_373_885 | 170 |
| 905 | 3300047443 | Ga0495687_000134 | Ga0495687_000134_17219_17731 | 170 |
| 906 | 3300047443 | Ga0495687_001929 | Ga0495687_001929_15695_16216 | 170 |
| 907 | 3300047443 | Ga0495687_004091 | Ga0495687_004091_8379_8900 | 170 |
| 908 | 3300047443 | Ga0495687_070709 | Ga0495687_070709_500_1012 | 170 |
| 909 | 3300047444 | Ga0495675_0000784 | Ga0495675_0000784_16459_16971 | 170 |
| 910 | 3300047444 | Ga0495675_0075902 | Ga0495675_0075902_1389_1901 | 170 |
| 911 | 3300047444 | Ga0495675_0080487 | Ga0495675_0080487_300_812 | 170 |
| 912 | 3300047444 | Ga0495675_0513857 | Ga0495675_0513857_65_577 | 170 |
| 913 | 3300047446 | Ga0495679_000342 | Ga0495679_000342_5963_6475 | 170 |
| 914 | 3300047446 | Ga0495679_002089 | Ga0495679_002089_1286_1798 | 170 |
| 915 | 3300047446 | Ga0495679_005909 | Ga0495679_005909_383_895 | 170 |
| 916 | 3300047446 | Ga0495679_062146 | Ga0495679_062146_36_548 | 170 |
| 917 | 3300047446 | Ga0495679_064720 | Ga0495679_064720_315_827 | 170 |
| 918 | 3300047447 | Ga0495685_036583 | Ga0495685_036583_1003_1515 | 170 |
| 919 | 3300047447 | Ga0495685_122517 | Ga0495685_122517_225_737 | 170 |
| 920 | 3300047447 | Ga0495685_164772 | Ga0495685_164772_43_555 | 170 |
| 921 | 3300047469 | Ga0495673_0012012 | Ga0495673_0012012_3722_4234 | 170 |
| 922 | 3300047469 | Ga0495673_0040757 | Ga0495673_0040757_680_1192 | 170 |
| 923 | 3300047469 | Ga0495673_0155236 | Ga0495673_0155236_323_844 | 170 |
| 924 | 3300047469 | Ga0495673_0164301 | Ga0495673_0164301_224_736 | 170 |
| 925 | 3300047470 | Ga0495681_0124459 | Ga0495681_0124459_485_997 | 170 |
| 926 | 3300047470 | Ga0495681_0181291 | Ga0495681_0181291_284_796 | 170 |
| 927 | 3300047471 | Ga0495684_0014068 | Ga0495684_0014068_5244_5756 | 170 |
| 928 | 3300047471 | Ga0495684_0083650 | Ga0495684_0083650_282_794 | 170 |
| 929 | 3300047471 | Ga0495684_0100571 | Ga0495684_0100571_1137_1649 | 170 |
| 930 | 3300047472 | Ga0495686_0000129 | Ga0495686_0000129_60708_61220 | 170 |
| 931 | 3300047472 | Ga0495686_0055686 | Ga0495686_0055686_331_843 | 170 |
| 932 | 3300047472 | Ga0495686_0408225 | Ga0495686_0408225_188_700 | 170 |
| 933 | 3300047673 | Ga0495593_0005757 | Ga0495593_0005757_6296_6808 | 170 |
| 934 | 3300047673 | Ga0495593_0005997 | Ga0495593_0005997_277_789 | 170 |
| 935 | 3300047673 | Ga0495593_0019899 | Ga0495593_0019899_992_1504 | 170 |
| 936 | 3300047673 | Ga0495593_0022040 | Ga0495593_0022040_1396_1908 | 170 |
| 937 | 3300048088 | Ga0495602_0004174 | Ga0495602_0004174_3485_3997 | 170 |
| 938 | 3300048088 | Ga0495602_0022647 | Ga0495602_0022647_574_1086 | 170 |
| 939 | 3300048088 | Ga0495602_0026745 | Ga0495602_0026745_235_747 | 170 |
| 940 | 3300048088 | Ga0495602_0029768 | Ga0495602_0029768_4431_4943 | 170 |
| 941 | 3300048088 | Ga0495602_0031238 | Ga0495602_0031238_3131_3643 | 170 |
| 942 | 3300048088 | Ga0495602_0171340 | Ga0495602_0171340_66_578 | 170 |
| 943 | 3300048089 | Ga0495614_0000057 | Ga0495614_0000057_3475_3987 | 170 |
| 944 | 3300048089 | Ga0495614_0029300 | Ga0495614_0029300_1673_2185 | 170 |
| 945 | 3300048089 | Ga0495614_0033692 | Ga0495614_0033692_1475_1987 | 170 |
| 946 | 3300048089 | Ga0495614_0040117 | Ga0495614_0040117_630_1142 | 170 |
| 947 | 3300048089 | Ga0495614_0089178 | Ga0495614_0089178_518_1030 | 170 |
| 948 | 3300048091 | Ga0495626_0050164 | Ga0495626_0050164_1070_1582 | 170 |
| 949 | 3300048091 | Ga0495626_0051127 | Ga0495626_0051127_894_1442 | 170 |
| 950 | 3300048091 | Ga0495626_0095624 | Ga0495626_0095624_756_1277 | 170 |
| 951 | 3300048091 | Ga0495626_0123898 | Ga0495626_0123898_380_892 | 170 |
| 952 | 3300048903 | Ga0496100_0001212 | Ga0496100_0001212_7146_7658 | 170 |
| 953 | 3300048903 | Ga0496100_0033632 | Ga0496100_0033632_416_928 | 170 |
| 954 | 3300048903 | Ga0496100_0125277 | Ga0496100_0125277_1200_1712 | 170 |
| 955 | 3300048904 | Ga0496101_0002850 | Ga0496101_0002850_8552_9064 | 170 |
| 956 | 3300048904 | Ga0496101_0028498 | Ga0496101_0028498_972_1484 | 170 |
| 957 | 3300048905 | Ga0496102_0000553 | Ga0496102_0000553_90_608 | 170 |
| 958 | 3300048905 | Ga0496102_0002084 | Ga0496102_0002084_11325_11837 | 170 |
| 959 | 3300048905 | Ga0496102_0006527 | Ga0496102_0006527_7737_8249 | 170 |
| 960 | 3300048905 | Ga0496102_0013289 | Ga0496102_0013289_5011_5523 | 170 |
| 961 | 3300048905 | Ga0496102_0199999 | Ga0496102_0199999_491_1003 | 170 |
| 962 | 3300048906 | Ga0496103_0003408 | Ga0496103_0003408_7446_7958 | 170 |
| 963 | 3300048906 | Ga0496103_0005875 | Ga0496103_0005875_6388_6900 | 170 |
| 964 | 3300048906 | Ga0496103_0043638 | Ga0496103_0043638_247_759 | 170 |
| 965 | 3300048906 | Ga0496103_0084148 | Ga0496103_0084148_1410_1922 | 170 |
| 966 | 3300048907 | Ga0496104_0147490 | Ga0496104_0147490_376_888 | 170 |
| 967 | 3300048907 | Ga0496104_0420091 | Ga0496104_0420091_458_970 | 170 |
| 968 | 3300048907 | Ga0496104_0440929 | Ga0496104_0440929_251_763 | 170 |
| 969 | 3300048907 | Ga0496104_0541019 | Ga0496104_0541019_165_677 | 170 |
| 970 | 3300048908 | Ga0496105_0020961 | Ga0496105_0020961_4666_5178 | 170 |
| 971 | 3300048908 | Ga0496105_0149655 | Ga0496105_0149655_1241_1765 | 170 |
| 972 | 3300048908 | Ga0496105_0171652 | Ga0496105_0171652_1077_1589 | 170 |
| 973 | 3300048909 | Ga0496106_0074298 | Ga0496106_0074298_1224_1745 | 170 |
| 974 | 3300048909 | Ga0496106_0084304 | Ga0496106_0084304_1388_1909 | 170 |
| 975 | 3300048909 | Ga0496106_0123160 | Ga0496106_0123160_1177_1689 | 170 |
| 976 | 3300048909 | Ga0496106_0184218 | Ga0496106_0184218_837_1349 | 170 |
| 977 | 3300048910 | Ga0496107_0130532 | Ga0496107_0130532_333_845 | 170 |
| 978 | 3300048910 | Ga0496107_0612445 | Ga0496107_0612445_50_562 | 170 |
| 979 | 3300048911 | Ga0496108_0122725 | Ga0496108_0122725_959_1471 | 170 |
| 980 | 3300048912 | Ga0496109_0204587 | Ga0496109_0204587_248_760 | 170 |
| 981 | 3300048913 | Ga0496110_0025088 | Ga0496110_0025088_1719_2231 | 170 |
| 982 | 3300048913 | Ga0496110_0116706 | Ga0496110_0116706_135_647 | 170 |
| 983 | 3300048913 | Ga0496110_0638809 | Ga0496110_0638809_104_628 | 170 |
| 984 | 3300048914 | Ga0496111_0011978 | Ga0496111_0011978_1441_1953 | 170 |
| 985 | 3300048915 | Ga0496112_0017022 | Ga0496112_0017022_6078_6590 | 170 |
| 986 | 3300048916 | Ga0496113_0008792 | Ga0496113_0008792_2201_2713 | 170 |
| 987 | 3300048916 | Ga0496113_0279930 | Ga0496113_0279930_241_762 | 170 |
| 988 | 3300048916 | Ga0496113_0546976 | Ga0496113_0546976_308_820 | 170 |
| 989 | 3300048917 | Ga0496114_0026593 | Ga0496114_0026593_2112_2624 | 170 |
| 990 | 3300048918 | Ga0496115_0097632 | Ga0496115_0097632_1862_2374 | 170 |
| 991 | 3300048918 | Ga0496115_0441894 | Ga0496115_0441894_294_806 | 170 |
| 992 | 3300048919 | Ga0496116_0001320 | Ga0496116_0001320_3597_4109 | 170 |
| 993 | 3300048919 | Ga0496116_0007863 | Ga0496116_0007863_321_833 | 170 |
| 994 | 3300048919 | Ga0496116_0088130 | Ga0496116_0088130_147_659 | 170 |
| 995 | 3300048919 | Ga0496116_0167305 | Ga0496116_0167305_272_784 | 170 |
| 996 | 3300048920 | Ga0496117_0001476 | Ga0496117_0001476_9792_10304 | 170 |
| 997 | 3300048920 | Ga0496117_0012055 | Ga0496117_0012055_6901_7413 | 170 |
| 998 | 3300048920 | Ga0496117_0044221 | Ga0496117_0044221_259_771 | 170 |
| 999 | 3300048920 | Ga0496117_0067052 | Ga0496117_0067052_1318_1830 | 170 |
| 1000 | 3300048920 | Ga0496117_0071784 | Ga0496117_0071784_465_977 | 170 |
| 1001 | 3300048921 | Ga0496118_0001841 | Ga0496118_0001841_443_955 | 170 |
| 1002 | 3300048921 | Ga0496118_0002994 | Ga0496118_0002994_7903_8415 | 170 |
| 1003 | 3300048921 | Ga0496118_0003375 | Ga0496118_0003375_2760_3272 | 170 |
| 1004 | 3300048921 | Ga0496118_0012483 | Ga0496118_0012483_7156_7668 | 170 |
| 1005 | 3300048921 | Ga0496118_0034000 | Ga0496118_0034000_987_1499 | 170 |
| 1006 | 3300048921 | Ga0496118_0069117 | Ga0496118_0069117_230_742 | 170 |
| 1007 | 3300048921 | Ga0496118_0206663 | Ga0496118_0206663_114_626 | 170 |
| 1008 | 3300048922 | Ga0496119_0135213 | Ga0496119_0135213_591_1103 | 170 |
| 1009 | 3300048922 | Ga0496119_0284089 | Ga0496119_0284089_68_580 | 170 |
| 1010 | 3300048924 | Ga0496121_0000639 | Ga0496121_0000639_53107_53619 | 170 |
| 1011 | 3300048924 | Ga0496121_0003125 | Ga0496121_0003125_451_963 | 170 |
| 1012 | 3300048924 | Ga0496121_0006587 | Ga0496121_0006587_9220_9732 | 170 |
| 1013 | 3300048925 | Ga0496122_0007397 | Ga0496122_0007397_5174_5686 | 170 |
| 1014 | 3300048925 | Ga0496122_0076979 | Ga0496122_0076979_467_979 | 170 |
| 1015 | 3300048925 | Ga0496122_0096034 | Ga0496122_0096034_46_564 | 170 |
| 1016 | 3300048926 | Ga0496123_0006456 | Ga0496123_0006456_1655_2167 | 170 |
| 1017 | 3300048926 | Ga0496123_0020775 | Ga0496123_0020775_3432_3950 | 170 |
| 1018 | 3300048926 | Ga0496123_0054577 | Ga0496123_0054577_707_1219 | 170 |
| 1019 | 3300048927 | Ga0496124_0026467 | Ga0496124_0026467_3541_4053 | 170 |
| 1020 | 3300048927 | Ga0496124_0031878 | Ga0496124_0031878_1281_1802 | 170 |
| 1021 | 3300048927 | Ga0496124_0038979 | Ga0496124_0038979_601_1122 | 170 |
| 1022 | 3300048927 | Ga0496124_0085965 | Ga0496124_0085965_1660_2172 | 170 |
| 1023 | 3300048927 | Ga0496124_0191792 | Ga0496124_0191792_617_1135 | 170 |
| 1024 | 3300048927 | Ga0496124_0230306 | Ga0496124_0230306_733_1245 | 170 |
| 1025 | 3300048928 | Ga0496125_0005643 | Ga0496125_0005643_2453_2965 | 170 |
| 1026 | 3300048928 | Ga0496125_0006190 | Ga0496125_0006190_2948_3466 | 170 |
| 1027 | 3300048928 | Ga0496125_0055564 | Ga0496125_0055564_1791_2303 | 170 |
| 1028 | 3300048928 | Ga0496125_0244728 | Ga0496125_0244728_459_980 | 170 |
| 1029 | 3300048928 | Ga0496125_0272698 | Ga0496125_0272698_285_797 | 170 |
| 1030 | 3300048928 | Ga0496125_0584346 | Ga0496125_0584346_35_556 | 170 |
| 1031 | 3300048929 | Ga0496126_0006608 | Ga0496126_0006608_432_944 | 170 |
| 1032 | 3300048929 | Ga0496126_0028891 | Ga0496126_0028891_4402_4914 | 170 |
| 1033 | 3300048929 | Ga0496126_0043956 | Ga0496126_0043956_718_1236 | 170 |
| 1034 | 3300048929 | Ga0496126_0308190 | Ga0496126_0308190_303_824 | 170 |
| 1035 | 3300049459 | Ga0495678_057979 | Ga0495678_057979_101_613 | 170 |
| 1036 | 3300049460 | Ga0495682_0087142 | Ga0495682_0087142_226_738 | 170 |
| 1037 | 3300049571 | Ga0501034_0057285 | Ga0501034_0057285_1680_2198 | 170 |
| 1038 | 3300049579 | Ga0501043_0253363 | Ga0501043_0253363_312_824 | 170 |
| 1039 | 3300049656 | Ga0501209_003792 | Ga0501209_003792_1230_1751 | 170 |
| 1040 | 3300050489 | nmdc:mga03683_135476_c1 | nmdc:mga03683_135476_c1_359_877 | 170 |
| 1041 | 3300050490 | nmdc:mga03n38_135792_c1 | nmdc:mga03n38_135792_c1_636_1157 | 170 |
| 1042 | 3300050492 | nmdc:mga0yw44_74458_c1 | nmdc:mga0yw44_74458_c1_623_1144 | 170 |
| 1043 | 3300050493 | nmdc:mga0k408_13599_c1 | nmdc:mga0k408_13599_c1_2080_2601 | 170 |
| 1044 | 3300050493 | nmdc:mga0k408_16514_c2 | nmdc:mga0k408_16514_c2_878_1399 | 170 |
| 1045 | 3300050493 | nmdc:mga0k408_258628_c1 | nmdc:mga0k408_258628_c1_469_990 | 170 |
| 1046 | 3300050493 | nmdc:mga0k408_4060_c1 | nmdc:mga0k408_4060_c1_5706_6227 | 170 |
| 1047 | 3300050493 | nmdc:mga0k408_42694_c1 | nmdc:mga0k408_42694_c1_288_809 | 170 |
| 1048 | 3300050493 | nmdc:mga0k408_658079_c1 | nmdc:mga0k408_658079_c1_56_574 | 170 |
| 1049 | 3300050494 | nmdc:mga06z11_118662_c1 | nmdc:mga06z11_118662_c1_917_1438 | 170 |
| 1050 | 3300050494 | nmdc:mga06z11_202107_c1 | nmdc:mga06z11_202107_c1_196_717 | 170 |
| 1051 | 3300050494 | nmdc:mga06z11_78203_c1 | nmdc:mga06z11_78203_c1_874_1395 | 170 |
| 1052 | 3300050496 | nmdc:mga07m45_115998_c1 | nmdc:mga07m45_115998_c1_558_1079 | 170 |
| 1053 | 3300050496 | nmdc:mga07m45_2182_c1 | nmdc:mga07m45_2182_c1_1547_2068 | 170 |
| 1054 | 3300050496 | nmdc:mga07m45_314695_c1 | nmdc:mga07m45_314695_c1_110_631 | 170 |
| 1055 | 3300050496 | nmdc:mga07m45_35723_c1 | nmdc:mga07m45_35723_c1_544_1065 | 170 |
| 1056 | 3300050496 | nmdc:mga07m45_3941_c1 | nmdc:mga07m45_3941_c1_1571_2092 | 170 |
| 1057 | 3300050496 | nmdc:mga07m45_47644_c1 | nmdc:mga07m45_47644_c1_1092_1613 | 170 |
| 1058 | 3300050496 | nmdc:mga07m45_59232_c1 | nmdc:mga07m45_59232_c1_837_1367 | 170 |
| 1059 | 3300050496 | nmdc:mga07m45_78892_c1 | nmdc:mga07m45_78892_c1_655_1176 | 170 |
| 1060 | 3300050508 | nmdc:mga09592_14541_c1 | nmdc:mga09592_14541_c1_1290_1811 | 170 |
| 1061 | 3300050509 | nmdc:mga0qj67_12586_c1 | nmdc:mga0qj67_12586_c1_815_1336 | 170 |
| 1062 | 3300053080 | Ga0500635_0000318 | Ga0500635_0000318_5986_6501 | 170 |
| 1063 | 3300053086 | Ga0500578_0017157 | Ga0500578_0017157_3085_3603 | 170 |
| 1064 | 3300053088 | Ga0500644_0013621 | Ga0500644_0013621_459_980 | 170 |
| 1065 | 3300053117 | Ga0500593_002980 | Ga0500593_002980_1267_1785 | 170 |
| 1066 | 3300053125 | Ga0500618_031351 | Ga0500618_031351_246_758 | 170 |
| 1067 | 3300053126 | Ga0500621_195489 | Ga0500621_195489_80_601 | 170 |
| 1068 | 3300053134 | Ga0500658_0126800 | Ga0500658_0126800_15_536 | 170 |
| 1069 | 3300053136 | Ga0500559_0000207 | Ga0500559_0000207_44535_45056 | 170 |
| 1070 | 3300053139 | Ga0500568_0081383 | Ga0500568_0081383_339_860 | 170 |
| 1071 | 3300053139 | Ga0500568_0163032 | Ga0500568_0163032_31_552 | 170 |
| 1072 | 3300053148 | Ga0500590_039858 | Ga0500590_039858_1079_1600 | 170 |
| 1073 | 3300053156 | Ga0500622_0022765 | Ga0500622_0022765_1457_1978 | 170 |
| 1074 | 3300053177 | Ga0500636_0054911 | Ga0500636_0054911_1462_1983 | 170 |
| 1075 | 3300053724 | Ga0500570_125006 | Ga0500570_125006_216_734 | 170 |
| 1076 | 3300053739 | Ga0500587_000950 | Ga0500587_000950_2768_3286 | 170 |
| 1077 | 3300053739 | Ga0500587_002321 | Ga0500587_002321_572_1093 | 170 |
| 1078 | 3300061719 | Ga0466962_0002580 | Ga0466962_0002580_4469_4981 | 170 |
| 1079 | 3300061719 | Ga0466962_0008800 | Ga0466962_0008800_2153_2665 | 170 |
| 1080 | 3300061719 | Ga0466962_0022861 | Ga0466962_0022861_736_1248 | 170 |
| 1081 | 3300061719 | Ga0466962_0040446 | Ga0466962_0040446_15_527 | 170 |
| 1082 | iso_pu_bacteria | 2857576091 | 2857578293 | 170 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p5n-assembly1.cif.gz_B | structure and mechanism of the s component of a bacterial ecf transporter | 0.6108 | 15 | 160 |
| 7nnt-assembly1.cif.gz_C | cryo-em structure of the folate-specific ecf transporter complex in ddm micelles | 0.5482 | 7 | 157 |
| 3p5n-assembly1.cif.gz_B | structure and mechanism of the s component of a bacterial ecf transporter | 0.5444 | 15 | 160 |
| 5kc4-assembly2.cif.gz_E | structure of tmribu, orthorhombic crystal form | 0.5089 | 14 | 156 |
| 5kc4-assembly1.cif.gz_A | structure of tmribu, orthorhombic crystal form | 0.5051 | 14 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ABH4_4_155_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.9284 | 16 | 154 | 1.10.1760.20 |
| af_P0ABH4_4_155_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8472 | 16 | 154 | 1.10.1760.20 |
| af_Q2FXS7_1_165_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7552 | 16 | 154 | 1.10.1760.20 |
| af_Q2FXS7_1_165_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6489 | 16 | 154 | 1.10.1760.20 |
| af_Q2G061_16_177_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.5654 | 9 | 158 | 1.10.1760.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W6Z419-F1-model_v4 | Rod shape-determining protein MreD | 0.957 | 9 | 157 |
GO:0005886
GO:0008360 |
| AF-A0A6B2R0A9-F1-model_v4 | Rod shape-determining protein MreD | 0.9563 | 26 | 158 |
GO:0005886
GO:0008360 |
| AF-A0A521Z556-F1-model_v4 | Rod shape-determining protein MreD | 0.9552 | 7 | 158 |
GO:0005886
GO:0008360 |
| AF-R5PK45-F1-model_v4 | deleted | 0.9519 | 9 | 154 |
|
| AF-Q7VSM8-F1-model_v4 | Rod shape-determining protein | 0.9507 | 17 | 158 |
GO:0005886
GO:0008360 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar