F489652

General Info

Members Datasets Scaffolds Average Seq Length
1079 630 784 244

Family's Representative Sequence

Representative Sequence 3300049758|Ga0501241_001086|Ga0501241_001086_522_1358
Length 278
Sequence LRLRRDASGRLQKCADRHLFHQGNFMSRLRVLDDPTILPALDPAYALQRPAIGLGADEPAPRILLLYGSLRARSFSRLAVEEAARLLQFFGAETRIFDPSDLPLPDQIAGDDHPAVHELRELSMWSEGQVWCSPERHGQISGIMKAQIDHLPLEMGGMRPTQGRTLAVMQVSGGSQSFNAVNTLRLLGRWMRMVTIPNQSSVAMAYKEFDEAGRMKPSSYYDRIVDVMEELVRFTVLLRPHAGQLVDRYSERKAAGLRVDPAAELAARALASSTVRSG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
6 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
7 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
8 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
9 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
10 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
11 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
12 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
13 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
14 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
15 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
16 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
17 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
18 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
19 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
20 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
21 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
22 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
23 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
24 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
25 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
26 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
27 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
28 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
29 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
30 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
31 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
32 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
33 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
34 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
35 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
36 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
37 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
38 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
39 2643221583 Caulobacter sp. Root655 Isolate Unclassified
40 2643221584 Caulobacter sp. Root656 Isolate Unclassified
41 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
42 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
43 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
44 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
45 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
46 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
47 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
48 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
49 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
50 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
51 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
52 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
53 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
54 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
55 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
56 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
57 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
58 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
59 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
60 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
61 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
62 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
63 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
64 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
65 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
66 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
67 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
68 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
69 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
70 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
71 2849560528 Caulobacter zeae 410 Isolate Unclassified
72 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
73 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
74 2851153111 Caulobacter radicis 736 Isolate Unclassified
75 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
76 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
77 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
78 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
79 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
80 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
81 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
82 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
83 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
84 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
85 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
86 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
87 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
88 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
89 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
90 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
91 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
92 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
93 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
94 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
95 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
96 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
97 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
98 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
99 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
100 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
101 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
102 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
103 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
104 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
105 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
106 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
107 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
108 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
109 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
110 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
111 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
112 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
113 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
114 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
115 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
116 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
117 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
118 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
119 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
120 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
121 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
122 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
123 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
124 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
125 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
126 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
127 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
128 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
129 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
130 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
131 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
132 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
133 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
134 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
135 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
136 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
137 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
138 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
139 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
140 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
141 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
142 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
143 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
144 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
145 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
146 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
147 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
148 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
149 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
150 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
151 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
152 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
153 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
154 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
155 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
156 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
157 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
158 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
159 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
160 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
161 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
162 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
163 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
164 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
165 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
166 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
167 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
168 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
169 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
170 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
171 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
172 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
173 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
174 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
175 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
176 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
177 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
178 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
179 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
180 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
181 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
182 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
183 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
184 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
185 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
186 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
187 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
188 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
189 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
190 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
191 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
192 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
193 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
194 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
195 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
196 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
197 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
198 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
199 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
200 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
201 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
202 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
203 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
204 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
205 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
206 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
207 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
208 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
209 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
210 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
211 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
212 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
213 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
214 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
215 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
216 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
217 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
218 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
219 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
220 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
221 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
222 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
223 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
224 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
225 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
226 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
227 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
228 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
229 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
230 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
231 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
232 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
233 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
234 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
235 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
236 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
237 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
238 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
239 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
240 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
241 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
242 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
243 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
244 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
245 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
246 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
247 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
248 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
249 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
250 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
251 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
252 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
253 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
254 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
255 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
256 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
257 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
258 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
259 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
260 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
261 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
262 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
263 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
264 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
265 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
266 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
267 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
268 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
269 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
270 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
271 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
272 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
273 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
274 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
275 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
276 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
277 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
278 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
279 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
280 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
281 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
282 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
283 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
284 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
285 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
286 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
287 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
288 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
289 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
290 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
291 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
292 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
293 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
294 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
295 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
296 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
297 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
298 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
299 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
300 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
301 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
302 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
303 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
304 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
305 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
306 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
307 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
308 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
309 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
310 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
311 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
312 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
313 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
314 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
315 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
316 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
317 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
318 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
319 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
320 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
321 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
322 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
323 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
324 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
325 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
326 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
327 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
328 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
329 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
330 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
331 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
332 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
333 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
334 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
335 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
336 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
337 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
338 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
339 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
340 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
341 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
342 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
343 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
344 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
345 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
346 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
347 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
348 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
349 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
350 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
351 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
352 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
353 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
354 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
355 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
356 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
357 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
358 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
359 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
360 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
361 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
362 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
363 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
364 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
365 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
366 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
367 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
368 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
369 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
371 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
373 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
374 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
375 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
376 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
377 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
378 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
379 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
380 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
381 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
382 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
383 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
384 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
386 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
387 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
388 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
418 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
419 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
420 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
421 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
425 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
426 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
427 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
428 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
429 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
430 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
431 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
432 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
433 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
434 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
435 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
436 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
437 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
438 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
439 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
440 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
441 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
442 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
443 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
444 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
445 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
446 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
447 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
448 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
449 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
450 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
451 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
452 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
453 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
454 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
455 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
456 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
457 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
458 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
459 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
460 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
461 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
462 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
463 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
464 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
465 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
466 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
467 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
468 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
469 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
470 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
471 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
472 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
473 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
474 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
475 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
476 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
477 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
478 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
479 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
480 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
481 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
482 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
483 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
484 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
485 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
486 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
487 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
488 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
489 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
490 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
491 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
492 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
493 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
494 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
495 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
496 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
497 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
498 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
499 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
500 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
501 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
502 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
503 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
504 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
505 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
506 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
507 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
508 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
509 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
510 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
511 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
512 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
513 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
514 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
515 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
516 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
517 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
518 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
519 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
520 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
521 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
522 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
523 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
524 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
525 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
526 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
527 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
528 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
529 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
530 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
531 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
532 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
533 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
534 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
535 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
536 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
537 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
538 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
539 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
540 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
541 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
542 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
543 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
544 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
545 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
546 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
547 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
548 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
549 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
550 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
551 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
552 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
553 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
554 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
555 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
556 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
557 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
558 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
559 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
560 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
561 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
562 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
563 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
564 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
565 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
566 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
567 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
568 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
569 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
570 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
571 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
572 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
573 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
574 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
575 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
576 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
577 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
578 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
579 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
580 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
581 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
582 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
583 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
584 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
585 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
586 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
587 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
588 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
589 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
590 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
591 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
592 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
593 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
594 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
595 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
596 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
597 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
598 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
599 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
600 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
601 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
602 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
603 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
604 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
605 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
606 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
607 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
608 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
609 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
610 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
611 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
612 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
613 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
614 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
615 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
616 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
617 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
618 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
619 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
620 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
621 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
622 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
623 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
624 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
625 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
626 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
627 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
628 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
629 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
630 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.66
Metatranscriptomes 0
Isolates 27.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 20.48
Nodule 21.5
Rhizoplane 2.87
Rhizosphere 42.82
Stem 0
Stem Tuber 0.09
Unclassified 11.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1483352 2162886007 Bacteria 1660
2 SwRhRL2b_contig_1901739 2162886007 Bacteria 28384
3 JGI24740J21852_10009449 3300001979 Bacteria 3817
4 JGI24740J21852_10024760 3300001979 Bacteria 2032
5 JGI24739J22299_10005502 3300001989 Bacteria 4805
6 JGI24739J22299_10013439 3300001989 Bacteria 2990
7 JGI24737J22298_10004941 3300001990 Bacteria 4619
8 JGI24737J22298_10006147 3300001990 Bacteria 4114
9 JGI24737J22298_10008641 3300001990 Bacteria 3406
10 JGI24737J22298_10036595 3300001990 Bacteria 1515
11 JGI24735J21928_10000694 3300002067 Bacteria 11946
12 JGI24735J21928_10006314 3300002067 Bacteria 3911
13 JGI24735J21928_10037938 3300002067 Bacteria 1411
14 JGI24738J21930_10002762 3300002075 Bacteria 4512
15 JGI24738J21930_10004350 3300002075 Bacteria 3482
16 JGI24738J21930_10023083 3300002075 Bacteria 1284
17 JGI25150J39212_1000369 3300002774 Bacteria 21665
18 JGI25151J46595_10000639 3300003187 Bacteria 30118
19 JGI25153J46596_10000124 3300003215 Bacteria 86430
20 rootH1_10030986 3300003316 Bacteria 1859
21 rootL2_10275712 3300003322 Bacteria 2488
22 rootH1_10005886 3300003323 Bacteria 9819
23 rootH1_10160732 3300003323 Bacteria 6407
24 Ga0055532_1003824 3300003758 Bacteria 2434
25 Ga0055532_1004520 3300003758 Bacteria 2083
26 Ga0055525_1000104 3300003759 Bacteria 134560
27 Ga0055542_1000037 3300003762 Bacteria 225640
28 Ga0055529_1000042 3300003763 Bacteria 225663
29 Ga0055526_1003257 3300003771 Bacteria 10432
30 Ga0055537_1002473 3300003773 Bacteria 6179
31 Ga0055524_1000470 3300003775 Bacteria 32352
32 Ga0055524_1002798 3300003775 Bacteria 8760
33 Ga0055524_1014354 3300003775 Bacteria 2939
34 Ga0055536_1000121 3300003781 Bacteria 68027
35 Ga0055536_1000288 3300003781 Bacteria 38152
36 Ga0055536_1000616 3300003781 Bacteria 24156
37 Ga0055536_1001415 3300003781 Bacteria 14501
38 Ga0055536_1002431 3300003781 Bacteria 10470
39 Ga0055536_1004304 3300003781 Bacteria 7328
40 Ga0055536_1046923 3300003781 Bacteria 978
41 Ga0055534_1007990 3300003784 Bacteria 2449
42 Ga0055528_1006831 3300003790 Bacteria 5125
43 Ga0055530_10000897 3300003791 Bacteria 24503
44 Ga0055530_10001863 3300003791 Bacteria 14501
45 Ga0055530_10002377 3300003791 Bacteria 12196
46 Ga0055530_10004849 3300003791 Bacteria 6723
47 Ga0055530_10005341 3300003791 Bacteria 6147
48 Ga0055530_10014423 3300003791 Bacteria 2632
49 Ga0055530_10018168 3300003791 Bacteria 2178
50 Ga0055540_1001358 3300003792 Bacteria 14676
51 Ga0055540_1029201 3300003792 Bacteria 1293
52 Ga0055540_1046215 3300003792 Bacteria 916
53 Ga0055531_10000096 3300003794 Bacteria 95992
54 Ga0055531_10002825 3300003794 Bacteria 11373
55 Ga0055531_10004227 3300003794 Bacteria 8835
56 Ga0055531_10022413 3300003794 Bacteria 2407
57 Ga0055531_10022508 3300003794 Bacteria 2398
58 Ga0058692_1002907 3300003856 Bacteria 5538
59 Ga0058692_1030815 3300003856 Bacteria 1016
60 Ga0065165_1008723 3300005262 Bacteria 4683
61 Ga0065704_10000204 3300005289 Bacteria 211587
62 Ga0065704_10099817 3300005289 Bacteria 2296
63 Ga0065704_10123610 3300005289 Bacteria 1721
64 Ga0065704_10211406 3300005289 Bacteria 1107
65 Ga0070658_10012637 3300005327 Bacteria 6772
66 Ga0070658_10019655 3300005327 Bacteria 5408
67 Ga0070670_100152681 3300005331 Bacteria 1999
68 Ga0070666_10032969 3300005335 Bacteria 3425
69 Ga0070660_100327848 3300005339 Bacteria 1258
70 Ga0070661_100005592 3300005344 Bacteria 8662
71 Ga0070661_100136756 3300005344 Bacteria 1844
72 Ga0070668_100034378 3300005347 Bacteria 3862
73 Ga0070668_100037160 3300005347 Bacteria 3718
74 Ga0070671_100219745 3300005355 Bacteria 1612
75 Ga0070674_100012527 3300005356 Bacteria 5209
76 Ga0070659_100017489 3300005366 Bacteria 5399
77 Ga0070667_100000429 3300005367 Bacteria 44271
78 Ga0070667_100002234 3300005367 Bacteria 17045
79 Ga0070667_100072346 3300005367 Bacteria 2938
80 Ga0070662_100015566 3300005457 Bacteria 5097
81 Ga0070662_100040479 3300005457 Bacteria 3318
82 Ga0070685_10077215 3300005466 Bacteria 1988
83 Ga0070707_100069477 3300005468 Bacteria 3391
84 Ga0068853_100005287 3300005539 Bacteria 10106
85 Ga0068853_100096300 3300005539 Bacteria 2611
86 Ga0070665_100000884 3300005548 Bacteria 38426
87 Ga0070665_100071210 3300005548 Bacteria 3483
88 Ga0068855_100073172 3300005563 Bacteria 3982
89 Ga0068855_100338275 3300005563 Bacteria 1660
90 Ga0070664_100021924 3300005564 Bacteria 5266
91 Ga0070664_100115685 3300005564 Bacteria 2344
92 Ga0068857_100029220 3300005577 Bacteria 4864
93 Ga0068857_101049809 3300005577 Bacteria 785
94 Ga0068854_100014957 3300005578 Bacteria 5126
95 Ga0068854_100037728 3300005578 Bacteria 3393
96 Ga0068856_100479732 3300005614 Bacteria 1264
97 Ga0068859_100001448 3300005617 Bacteria 24068
98 Ga0068864_100017949 3300005618 Bacteria 5904
99 Ga0068861_100001768 3300005719 Bacteria 13896
100 Ga0068861_100145803 3300005719 Bacteria 1937
101 Ga0068861_100201101 3300005719 Bacteria 1672
102 Ga0068863_100043382 3300005841 Bacteria 4270
103 Ga0068860_100000573 3300005843 Bacteria 44277
104 Ga0068860_100833691 3300005843 Bacteria 936
105 Ga0068862_100008954 3300005844 Bacteria 8285
106 Ga0068862_100009968 3300005844 Bacteria 7850
107 Ga0070717_10307434 3300006028 Bacteria 1410
108 Ga0075365_10002570 3300006038 Bacteria 8963
109 Ga0075365_10012014 3300006038 Bacteria 5120
110 Ga0075365_10455720 3300006038 Bacteria 903
111 Ga0075368_10000158 3300006042 Bacteria 18321
112 Ga0075368_10000190 3300006042 Bacteria 16846
113 Ga0075368_10000214 3300006042 Bacteria 16126
114 Ga0075368_10000330 3300006042 Bacteria 13869
115 Ga0075363_100000005 3300006048 Bacteria 56964
116 Ga0075363_100017140 3300006048 Bacteria 3587
117 Ga0075363_100036200 3300006048 Bacteria 2588
118 Ga0075363_100083720 3300006048 Bacteria 1748
119 Ga0075364_10000003 3300006051 Bacteria 111353
120 Ga0075364_10000022 3300006051 Bacteria 53466
121 Ga0075432_10003631 3300006058 Bacteria 5248
122 Ga0075362_10000118 3300006177 Bacteria 22058
123 Ga0075367_10001760 3300006178 Bacteria 9506
124 Ga0075367_10002007 3300006178 Bacteria 9075
125 Ga0075367_10003779 3300006178 Bacteria 7295
126 Ga0075367_10014566 3300006178 Bacteria 4258
127 Ga0075367_10061128 3300006178 Bacteria 2248
128 Ga0075369_10000533 3300006186 Bacteria 12019
129 Ga0075369_10001184 3300006186 Bacteria 8825
130 Ga0075369_10002521 3300006186 Bacteria 6549
131 Ga0075369_10010635 3300006186 Bacteria 3604
132 Ga0075366_10025738 3300006195 Bacteria 3441
133 Ga0075366_10113625 3300006195 Bacteria 1630
134 Ga0075366_10177627 3300006195 Bacteria 1293
135 Ga0075366_10200046 3300006195 Bacteria 1215
136 Ga0075370_10000006 3300006353 Bacteria 110712
137 Ga0075370_10003734 3300006353 Bacteria 7287
138 Ga0075370_10004824 3300006353 Bacteria 6607
139 Ga0075370_10027468 3300006353 Bacteria 3158
140 Ga0075370_10027640 3300006353 Bacteria 3149
141 Ga0075370_10118177 3300006353 Bacteria 1542
142 Ga0075429_100208924 3300006880 Bacteria 1710
143 Ga0097620_100001448 3300006931 Bacteria 24068
144 Ga0079104_1004220 3300006946 Bacteria 6253
145 Ga0079104_1045489 3300006946 Bacteria 1001
146 Ga0105251_10018057 3300009011 Bacteria 3763
147 Ga0105251_10069781 3300009011 Bacteria 1637
148 Ga0105240_10030854 3300009093 Bacteria 6962
149 Ga0105240_10342380 3300009093 Bacteria 1698
150 Ga0105240_10414549 3300009093 Bacteria 1514
151 Ga0105241_10012879 3300009174 Bacteria 6137
152 Ga0105241_10173195 3300009174 Bacteria 1784
153 Ga0105248_10022524 3300009177 Bacteria 6988
154 Ga0105248_10059186 3300009177 Bacteria 4303
155 Ga0105248_10092062 3300009177 Bacteria 3414
156 Ga0105248_10103815 3300009177 Bacteria 3204
157 Ga0105248_10299391 3300009177 Bacteria 1811
158 Ga0105237_10004065 3300009545 Bacteria 17062
159 Ga0105237_10065031 3300009545 Bacteria 3643
160 Ga0105237_10339863 3300009545 Bacteria 1506
161 Ga0105238_10211033 3300009551 Bacteria 1917
162 Ga0105249_10003624 3300009553 Bacteria 13354
163 Ga0105249_10068891 3300009553 Bacteria 3264
164 Ga0105239_10000385 3300010375 Bacteria 64470
165 Ga0105239_10584241 3300010375 Bacteria 1274
166 Ga0157373_10038189 3300013100 Bacteria 3442
167 Ga0157373_10085510 3300013100 Bacteria 2223
168 Ga0157373_10530797 3300013100 Bacteria 852
169 Ga0157371_10000183 3300013102 Bacteria 92426
170 Ga0157371_10006898 3300013102 Bacteria 9273
171 Ga0157370_10017512 3300013104 Bacteria 7229
172 Ga0157369_10029788 3300013105 Bacteria 6028
173 Ga0157369_10063890 3300013105 Bacteria 3965
174 Ga0157369_10285001 3300013105 Bacteria 1720
175 Ga0157369_10440589 3300013105 Bacteria 1349
176 Ga0157369_10488566 3300013105 Bacteria 1274
177 Ga0157374_10432129 3300013296 Bacteria 1316
178 Ga0163162_10003415 3300013306 Bacteria 15154
179 Ga0163162_10053910 3300013306 Bacteria 4043
180 Ga0163162_10077504 3300013306 Bacteria 3388
181 Ga0163162_10655526 3300013306 Bacteria 1173
182 Ga0157375_10002079 3300013308 Bacteria 17318
183 Ga0157380_10230418 3300014326 Bacteria 1663
184 Ga0182008_10037660 3300014497 Bacteria 2420
185 Ga0157379_10305126 3300014968 Bacteria 1451
186 Ga0182006_1027560 3300015261 Bacteria 2317
187 Ga0182007_10012367 3300015262 Bacteria 3284
188 Ga0182007_10088705 3300015262 Bacteria 1018
189 Ga0183369_1007 3300015685 Bacteria 414878
190 Ga0183363_1009 3300015690 Bacteria 127797
191 Ga0163161_10001715 3300017792 Bacteria 16062
192 Ga0163161_10016323 3300017792 Bacteria 5184
193 Ga0163161_10029808 3300017792 Bacteria 3878
194 Ga0163161_10101478 3300017792 Bacteria 2142
195 Ga0163161_10447814 3300017792 Bacteria 1043
196 Ga0214543_1000003 3300021327 Bacteria 692327
197 Ga0228711_1020746 3300022739 Bacteria 5606
198 Ga0228710_1022297 3300022740 Bacteria 4899
199 Ga0209672_101064 3300025228 Bacteria 11746
200 Ga0209147_100205 3300025229 Bacteria 64474
201 Ga0209147_100558 3300025229 Bacteria 20955
202 Ga0209147_100607 3300025229 Bacteria 19587
203 Ga0209147_108381 3300025229 Bacteria 1285
204 Ga0209563_100116 3300025230 Bacteria 134661
205 Ga0207425_1000022 3300025245 Bacteria 355305
206 Ga0209677_110133 3300025253 Bacteria 1602
207 Ga0209148_1000026 3300025254 Bacteria 629213
208 Ga0209759_1008921 3300025256 Bacteria 3082
209 Ga0209129_1001190 3300025258 Bacteria 14977
210 Ga0209233_1000455 3300025261 Bacteria 26723
211 Ga0209233_1045290 3300025261 Bacteria 926
212 Ga0209565_1000065 3300025263 Bacteria 178266
213 Ga0209455_1000005 3300025272 Bacteria 1416756
214 Ga0209673_1000818 3300025273 Bacteria 41077
215 Ga0209675_1000724 3300025291 Bacteria 22437
216 Ga0209676_1000060 3300025292 Bacteria 338238
217 Ga0209676_1000072 3300025292 Bacteria 307347
218 Ga0209676_1000184 3300025292 Bacteria 143543
219 Ga0209676_1000247 3300025292 Bacteria 115814
220 Ga0209676_1000297 3300025292 Bacteria 100558
221 Ga0209676_1001039 3300025292 Bacteria 32114
222 Ga0209676_1019584 3300025292 Bacteria 2325
223 Ga0209676_1024680 3300025292 Bacteria 1941
224 Ga0209025_1000018 3300025294 Bacteria 686898
225 Ga0209025_1000326 3300025294 Bacteria 106087
226 Ga0209025_1000371 3300025294 Bacteria 94612
227 Ga0209025_1033530 3300025294 Bacteria 2370
228 Ga0209564_1004449 3300025295 Bacteria 8568
229 Ga0209564_1025384 3300025295 Bacteria 1994
230 Ga0209564_1027816 3300025295 Bacteria 1826
231 Ga0209758_1000004 3300025297 Bacteria 1375322
232 Ga0209758_1001185 3300025297 Bacteria 32966
233 Ga0209758_1026850 3300025297 Bacteria 2479
234 Ga0209050_1000001 3300025298 Bacteria 3563507
235 Ga0209050_1000057 3300025298 Bacteria 326289
236 Ga0209050_1000077 3300025298 Bacteria 278985
237 Ga0209050_1000402 3300025298 Bacteria 80873
238 Ga0209050_1000548 3300025298 Bacteria 62143
239 Ga0209050_1000622 3300025298 Bacteria 55613
240 Ga0209050_1016408 3300025298 Bacteria 3031
241 Ga0209256_1003381 3300025299 Bacteria 11271
242 Ga0209051_1000303 3300025303 Bacteria 77630
243 Ga0209051_1003506 3300025303 Bacteria 10256
244 Ga0209051_1034867 3300025303 Bacteria 1880
245 Ga0209257_1000088 3300025304 Bacteria 279014
246 Ga0209257_1001450 3300025304 Bacteria 28046
247 Ga0209257_1001686 3300025304 Bacteria 24844
248 Ga0209257_1002690 3300025304 Bacteria 16999
249 Ga0209257_1016515 3300025304 Bacteria 2980
250 Ga0209257_1020328 3300025304 Bacteria 2459
251 Ga0207688_10059879 3300025901 Bacteria 2144
252 Ga0207680_10011950 3300025903 Bacteria 4408
253 Ga0207647_10027364 3300025904 Bacteria 3717
254 Ga0207647_10052205 3300025904 Bacteria 2524
255 Ga0207705_10000397 3300025909 Bacteria 38200
256 Ga0207654_10024820 3300025911 Bacteria 3227
257 Ga0207695_10008826 3300025913 Bacteria 12551
258 Ga0207695_10164752 3300025913 Bacteria 2146
259 Ga0207695_10442779 3300025913 Bacteria 1183
260 Ga0207671_10001440 3300025914 Bacteria 27565
261 Ga0207671_10016082 3300025914 Bacteria 5829
262 Ga0207671_10167441 3300025914 Bacteria 1705
263 Ga0207657_10065059 3300025919 Bacteria 3109
264 Ga0207657_10412079 3300025919 Bacteria 1062
265 Ga0207649_10003218 3300025920 Bacteria 8945
266 Ga0207649_10236072 3300025920 Bacteria 1310
267 Ga0207694_10005402 3300025924 Bacteria 9833
268 Ga0207694_10036765 3300025924 Bacteria 3758
269 Ga0207694_10060062 3300025924 Bacteria 2958
270 Ga0207644_10169376 3300025931 Bacteria 1704
271 Ga0207644_10585917 3300025931 Bacteria 925
272 Ga0207690_10001443 3300025932 Bacteria 14876
273 Ga0207706_10007581 3300025933 Bacteria 10038
274 Ga0207706_10069138 3300025933 Bacteria 3106
275 Ga0207669_10039679 3300025937 Bacteria 2723
276 Ga0207711_10015556 3300025941 Bacteria 6314
277 Ga0207711_10034224 3300025941 Bacteria 4303
278 Ga0207711_10035470 3300025941 Bacteria 4227
279 Ga0207711_10075038 3300025941 Bacteria 2942
280 Ga0207711_10165342 3300025941 Bacteria 2005
281 Ga0207667_10000107 3300025949 Bacteria 133066
282 Ga0207667_10011452 3300025949 Bacteria 10307
283 Ga0207667_10490866 3300025949 Bacteria 1246
284 Ga0207712_10004353 3300025961 Bacteria 8943
285 Ga0207712_10038029 3300025961 Bacteria 3288
286 Ga0207712_10246841 3300025961 Bacteria 1441
287 Ga0207668_10003517 3300025972 Bacteria 9202
288 Ga0207668_10003735 3300025972 Bacteria 8957
289 Ga0207640_10007563 3300025981 Bacteria 6000
290 Ga0207640_10013814 3300025981 Bacteria 4636
291 Ga0207640_10200657 3300025981 Bacteria 1511
292 Ga0207658_10000368 3300025986 Bacteria 44362
293 Ga0207658_10009771 3300025986 Bacteria 6515
294 Ga0207658_10062027 3300025986 Bacteria 2796
295 Ga0207658_10631176 3300025986 Bacteria 964
296 Ga0207639_10002138 3300026041 Bacteria 13301
297 Ga0207639_10009537 3300026041 Bacteria 6699
298 Ga0207639_10020899 3300026041 Bacteria 4695
299 Ga0207678_10002748 3300026067 Bacteria 15930
300 Ga0207678_10030255 3300026067 Bacteria 4727
301 Ga0207702_10005233 3300026078 Bacteria 11389
302 Ga0207702_10007230 3300026078 Bacteria 9496
303 Ga0207702_10007530 3300026078 Bacteria 9283
304 Ga0207641_10027348 3300026088 Bacteria 4710
305 Ga0207676_10009756 3300026095 Bacteria 6828
306 Ga0207674_10002464 3300026116 Bacteria 23363
307 Ga0207674_10087483 3300026116 Bacteria 3109
308 Ga0207675_100000016 3300026118 Bacteria 126353
309 Ga0207675_100216677 3300026118 Bacteria 1843
310 Ga0207675_100455070 3300026118 Bacteria 1269
311 Ga0207683_10074155 3300026121 Bacteria 3010
312 Ga0207698_10018963 3300026142 Bacteria 4697
313 Ga0209281_1000332 3300027111 Bacteria 81534
314 Ga0209281_1000360 3300027111 Bacteria 74340
315 Ga0209281_1033727 3300027111 Bacteria 898
316 Ga0209282_1000060 3300027666 Bacteria 97673
317 Ga0209813_10000022 3300027866 Bacteria 72813
318 Ga0209813_10000038 3300027866 Bacteria 56808
319 Ga0209813_10000092 3300027866 Bacteria 33357
320 Ga0209813_10000105 3300027866 Bacteria 31318
321 Ga0207428_10013576 3300027907 Bacteria 7109
322 Ga0268266_10001163 3300028379 Bacteria 32562
323 Ga0268266_10253345 3300028379 Bacteria 1629
324 Ga0268265_10012328 3300028380 Bacteria 5792
325 Ga0268265_10015937 3300028380 Bacteria 5156
326 Ga0268265_10151002 3300028380 Bacteria 1959
327 Ga0268265_10727088 3300028380 Bacteria 961
328 Ga0268264_10000582 3300028381 Bacteria 44285
329 Ga0268264_10800901 3300028381 Bacteria 941
330 Ga0265318_10009370 3300028577 Bacteria 4309
331 Ga0265322_10029347 3300028654 Bacteria 1572
332 Ga0265336_10000859 3300028666 Bacteria 15784
333 Ga0307517_10021522 3300028786 Bacteria 8140
334 Ga0307517_10052593 3300028786 Bacteria 4078
335 Ga0307515_10026858 3300028794 Bacteria 9877
336 Ga0265338_10000013 3300028800 Bacteria 379065
337 Ga0265324_10021279 3300029957 Bacteria 2326
338 Ga0265327_10138513 3300031251 Bacteria 1139
339 Ga0307513_10003740 3300031456 Bacteria 20550
340 Ga0307513_10004795 3300031456 Bacteria 17963
341 Ga0307509_10002287 3300031507 Bacteria 31311
342 Ga0307408_100010494 3300031548 Bacteria 6109
343 Ga0307408_100036834 3300031548 Bacteria 3441
344 Ga0307408_100174792 3300031548 Bacteria 1717
345 Ga0307408_100223793 3300031548 Bacteria 1537
346 Ga0307516_10086960 3300031730 Bacteria 2961
347 Ga0307516_10175613 3300031730 Bacteria 1879
348 Ga0307405_10279380 3300031731 Bacteria 1256
349 Ga0307413_10017189 3300031824 Bacteria 3761
350 Ga0307413_10077624 3300031824 Bacteria 2116
351 Ga0307410_10131729 3300031852 Bacteria 1837
352 Ga0307406_10205477 3300031901 Bacteria 1453
353 Ga0307412_10000003 3300031911 Bacteria 659081
354 Ga0307412_10019961 3300031911 Bacteria 4069
355 Ga0307412_10061744 3300031911 Bacteria 2520
356 Ga0307412_10380078 3300031911 Bacteria 1143
357 Ga0315914_1000121 3300031967 Bacteria 70704
358 Ga0307409_100176956 3300031995 Bacteria 1884
359 Ga0307416_100153428 3300032002 Bacteria 2116
360 Ga0307416_100697871 3300032002 Bacteria 1104
361 Ga0307414_10000536 3300032004 Bacteria 19786
362 Ga0307414_10001051 3300032004 Bacteria 14107
363 Ga0307414_10021372 3300032004 Bacteria 4059
364 Ga0307414_10022530 3300032004 Bacteria 3976
365 Ga0307414_10104516 3300032004 Bacteria 2139
366 Ga0307414_10200207 3300032004 Bacteria 1623
367 Ga0307414_10249936 3300032004 Bacteria 1473
368 Ga0307414_10361613 3300032004 Bacteria 1249
369 Ga0307411_10466043 3300032005 Bacteria 1060
370 Ga0307415_100902000 3300032126 Bacteria 815
371 Ga0315913_1000046 3300033430 Bacteria 62008
372 Ga0315915_1000004 3300033464 Bacteria 403083
373 Ga0373937_0277486 3300036401 Bacteria 1582
374 Ga0395898_0036347 3300037466 Bacteria 4890
375 Ga0436365_0654829 3300039437 Bacteria 5264
376 Ga0436365_1097678 3300039437 Bacteria 902
377 Ga0439439_0002567 3300041406 Bacteria 3879
378 Ga0439465_0006311 3300041413 Bacteria 3764
379 Ga0439465_0141468 3300041413 Bacteria 855
380 Ga0451791_0474554 3300041451 Bacteria 1252
381 Ga0451795_1076342 3300041456 Bacteria 818
382 Ga0451802_1573622 3300041460 Bacteria 1841
383 Ga0451807_2178245 3300041486 Bacteria 1737
384 Ga0451837_1810866 3300041494 Bacteria 920
385 Ga0451843_0184918 3300041509 Bacteria 1438
386 Ga0451843_0511461 3300041509 Bacteria 1217
387 Ga0451853_0332407 3300041512 Bacteria 1297
388 Ga0439431_0007141 3300041997 Bacteria 2487
389 Ga0439445_0033116 3300042004 Bacteria 1349
390 Ga0439449_0008122 3300042007 Bacteria 3989
391 Ga0450911_001396 3300042115 Bacteria 5603
392 Ga0439434_0102338 3300042435 Bacteria 923
393 Ga0451576_0000053 3300045051 Bacteria 308708
394 Ga0495627_000103 3300046453 Bacteria 104335
395 Ga0495627_000105 3300046453 Bacteria 103413
396 Ga0495627_000185 3300046453 Bacteria 69533
397 Ga0495592_0063903 3300046454 Bacteria 2698
398 Ga0495638_0000021 3300046460 Bacteria 365602
399 Ga0495638_0002128 3300046460 Bacteria 16657
400 Ga0495638_0002254 3300046460 Bacteria 15983
401 Ga0495638_0004335 3300046460 Bacteria 10752
402 Ga0495638_0006082 3300046460 Bacteria 8833
403 Ga0495638_0086206 3300046460 Bacteria 1898
404 Ga0495651_0437393 3300046462 Bacteria 847
405 Ga0495653_0162114 3300046463 Bacteria 1551
406 Ga0495650_0000045 3300046471 Bacteria 346204
407 Ga0495650_0000862 3300046471 Bacteria 36369
408 Ga0495650_0001034 3300046471 Bacteria 31214
409 Ga0495650_0005530 3300046471 Bacteria 8166
410 Ga0495580_0000047 3300046472 Bacteria 68842
411 Ga0495580_0053620 3300046472 Bacteria 2845
412 Ga0495605_0003880 3300046474 Bacteria 8861
413 Ga0495605_0005837 3300046474 Bacteria 7119
414 Ga0495664_0012632 3300046477 Bacteria 4785
415 Ga0495584_0172349 3300046491 Bacteria 1100
416 Ga0495585_0001506 3300046492 Bacteria 18152
417 Ga0495596_0000171 3300046500 Bacteria 45024
418 Ga0495596_0001194 3300046500 Bacteria 15178
419 Ga0495596_0005301 3300046500 Bacteria 6111
420 Ga0495607_0006779 3300046501 Bacteria 8001
421 Ga0495583_0000069 3300046506 Bacteria 186863
422 Ga0495583_0000184 3300046506 Bacteria 105978
423 Ga0495583_0000401 3300046506 Bacteria 65722
424 Ga0495583_0034485 3300046506 Bacteria 2423
425 Ga0495583_0043219 3300046506 Bacteria 2099
426 Ga0495606_0008550 3300046507 Bacteria 8864
427 Ga0495606_0089105 3300046507 Bacteria 1901
428 Ga0495606_0255917 3300046507 Bacteria 969
429 Ga0495610_0000013 3300046512 Bacteria 465872
430 Ga0495610_0000018 3300046512 Bacteria 355044
431 Ga0495610_0000101 3300046512 Bacteria 99012
432 Ga0495610_0002633 3300046512 Bacteria 14848
433 Ga0495610_0002639 3300046512 Bacteria 14830
434 Ga0495610_0142206 3300046512 Bacteria 1031
435 Ga0495616_0000270 3300046513 Bacteria 42085
436 Ga0495616_0176222 3300046513 Bacteria 953
437 Ga0495620_0033849 3300046515 Bacteria 2315
438 Ga0495620_0039025 3300046515 Bacteria 2103
439 Ga0495620_0045054 3300046515 Bacteria 1913
440 Ga0495628_0062359 3300046516 Bacteria 2922
441 Ga0495628_0345569 3300046516 Bacteria 1094
442 Ga0495630_0172398 3300046517 Bacteria 1648
443 Ga0495631_0052696 3300046518 Bacteria 1777
444 Ga0495631_0099404 3300046518 Bacteria 1252
445 Ga0495632_0001639 3300046519 Bacteria 18335
446 Ga0495632_0001694 3300046519 Bacteria 18032
447 Ga0495643_0000336 3300046522 Bacteria 64049
448 Ga0495643_0027804 3300046522 Bacteria 3174
449 Ga0495643_0030778 3300046522 Bacteria 2993
450 Ga0495643_0034028 3300046522 Bacteria 2814
451 Ga0495643_0044552 3300046522 Bacteria 2411
452 Ga0495643_0114051 3300046522 Bacteria 1371
453 Ga0495648_0000026 3300046524 Bacteria 232162
454 Ga0495648_0000111 3300046524 Bacteria 100648
455 Ga0495648_0048047 3300046524 Bacteria 2631
456 Ga0495648_0049703 3300046524 Bacteria 2568
457 Ga0495648_0067184 3300046524 Bacteria 2098
458 Ga0495663_0000757 3300046525 Bacteria 11087
459 Ga0495663_0052964 3300046525 Bacteria 1261
460 Ga0495666_0004701 3300046526 Bacteria 6904
461 Ga0495642_0007084 3300046528 Bacteria 4302
462 Ga0495642_0106553 3300046528 Bacteria 1196
463 Ga0495652_0051478 3300046529 Bacteria 3517
464 Ga0495652_0156210 3300046529 Bacteria 1776
465 Ga0495654_0000018 3300046530 Bacteria 293124
466 Ga0495640_0066032 3300046533 Bacteria 2441
467 Ga0495609_0074614 3300046538 Bacteria 1487
468 Ga0495597_0002618 3300046542 Bacteria 11199
469 Ga0495597_0024054 3300046542 Bacteria 2813
470 Ga0495597_0105938 3300046542 Bacteria 1182
471 Ga0495645_0378934 3300046543 Bacteria 905
472 Ga0495622_0003300 3300046557 Bacteria 7628
473 Ga0495622_0047054 3300046557 Bacteria 2005
474 Ga0495622_0097704 3300046557 Bacteria 1347
475 Ga0495633_0003416 3300046558 Bacteria 10577
476 Ga0495633_0004092 3300046558 Bacteria 9409
477 Ga0495668_0000002 3300046616 Bacteria 763179
478 Ga0495668_0000325 3300046616 Bacteria 65404
479 Ga0495668_0031231 3300046616 Bacteria 3003
480 Ga0495668_0117517 3300046616 Bacteria 1454
481 Ga0495668_0143886 3300046616 Bacteria 1305
482 Ga0495668_0167114 3300046616 Bacteria 1205
483 Ga0495611_0020290 3300046648 Bacteria 2860
484 Ga0495611_0104509 3300046648 Bacteria 1317
485 Ga0495625_0000011 3300046660 Bacteria 377120
486 Ga0495625_0002609 3300046660 Bacteria 19289
487 Ga0495625_0002714 3300046660 Bacteria 18781
488 Ga0495625_0004251 3300046660 Bacteria 13639
489 Ga0495625_0018596 3300046660 Bacteria 5417
490 Ga0495625_0038770 3300046660 Bacteria 3484
491 Ga0495625_0038875 3300046660 Bacteria 3478
492 Ga0495625_0043927 3300046660 Bacteria 3238
493 Ga0495625_0055530 3300046660 Bacteria 2824
494 Ga0495661_0007978 3300046665 Bacteria 7351
495 Ga0495661_0012689 3300046665 Bacteria 5688
496 Ga0495661_0066993 3300046665 Bacteria 2111
497 Ga0495661_0119451 3300046665 Bacteria 1458
498 Ga0495599_0013711 3300046678 Bacteria 5011
499 Ga0495599_0040463 3300046678 Bacteria 2927
500 Ga0495646_0055361 3300046680 Bacteria 2382
501 Ga0495669_0001020 3300046684 Bacteria 11676
502 Ga0495669_0002307 3300046684 Bacteria 7813
503 Ga0495613_0004913 3300046689 Bacteria 10050
504 Ga0495671_0000050 3300046692 Bacteria 141936
505 Ga0495671_0021372 3300046692 Bacteria 3401
506 Ga0495649_0026157 3300046694 Bacteria 3248
507 Ga0495589_0008502 3300046794 Bacteria 5354
508 Ga0495604_0020344 3300047317 Bacteria 5302
509 Ga0495674_0034286 3300047319 Bacteria 4591
510 Ga0495672_0004230 3300047320 Bacteria 11857
511 Ga0495672_0004815 3300047320 Bacteria 10884
512 Ga0495683_0012468 3300047323 Bacteria 4459
513 Ga0495683_0016369 3300047323 Bacteria 3853
514 Ga0495683_0030145 3300047323 Bacteria 2768
515 Ga0495687_001092 3300047443 Bacteria 26544
516 Ga0495687_001844 3300047443 Bacteria 18546
517 Ga0495687_007250 3300047443 Bacteria 6582
518 Ga0495687_018058 3300047443 Bacteria 3498
519 Ga0495675_0189287 3300047444 Bacteria 1257
520 Ga0495677_0053767 3300047445 Bacteria 1485
521 Ga0495673_0000056 3300047469 Bacteria 245918
522 Ga0495673_0000125 3300047469 Bacteria 141937
523 Ga0495673_0020024 3300047469 Bacteria 3339
524 Ga0495681_0000036 3300047470 Bacteria 124207
525 Ga0495681_0000174 3300047470 Bacteria 53932
526 Ga0495681_0005853 3300047470 Bacteria 8166
527 Ga0495681_0006465 3300047470 Bacteria 7698
528 Ga0495686_0000057 3300047472 Bacteria 250088
529 Ga0495686_0000808 3300047472 Bacteria 40566
530 Ga0495686_0000944 3300047472 Bacteria 36054
531 Ga0495686_0002660 3300047472 Bacteria 16456
532 Ga0495686_0003856 3300047472 Bacteria 12676
533 Ga0495686_0016945 3300047472 Bacteria 4922
534 Ga0495686_0027554 3300047472 Bacteria 3708
535 Ga0495686_0028511 3300047472 Bacteria 3636
536 Ga0495686_0036965 3300047472 Bacteria 3131
537 Ga0495602_0025013 3300048088 Bacteria 5785
538 Ga0495602_0392296 3300048088 Bacteria 992
539 Ga0495615_0000006 3300048090 Bacteria 96050
540 Ga0495615_0000009 3300048090 Bacteria 76727
541 Ga0495615_0000022 3300048090 Bacteria 51294
542 Ga0495615_0000056 3300048090 Bacteria 35338
543 Ga0495626_0034390 3300048091 Bacteria 2424
544 Ga0495626_0092043 3300048091 Bacteria 1332
545 Ga0496100_0004363 3300048903 Bacteria 7490
546 Ga0496100_0580091 3300048903 Bacteria 869
547 Ga0496101_0000647 3300048904 Bacteria 21009
548 Ga0496101_0414580 3300048904 Bacteria 1061
549 Ga0496102_0000067 3300048905 Bacteria 156790
550 Ga0496102_0008560 3300048905 Bacteria 8774
551 Ga0496102_0052303 3300048905 Bacteria 3721
552 Ga0496102_0568457 3300048905 Bacteria 1057
553 Ga0496103_0002600 3300048906 Bacteria 11306
554 Ga0496103_0276162 3300048906 Bacteria 1081
555 Ga0496104_0016161 3300048907 Bacteria 6773
556 Ga0496104_0561403 3300048907 Bacteria 1052
557 Ga0496105_0000662 3300048908 Bacteria 23132
558 Ga0496106_0059203 3300048909 Bacteria 2901
559 Ga0496106_0068882 3300048909 Bacteria 2700
560 Ga0496106_0084941 3300048909 Bacteria 2436
561 Ga0496107_0000136 3300048910 Bacteria 36033
562 Ga0496107_0000515 3300048910 Bacteria 21514
563 Ga0496107_0018371 3300048910 Bacteria 4924
564 Ga0496110_0058225 3300048913 Bacteria 3403
565 Ga0496111_0002307 3300048914 Bacteria 11473
566 Ga0496112_0697702 3300048915 Bacteria 943
567 Ga0496113_0064418 3300048916 Bacteria 2771
568 Ga0496113_0492592 3300048916 Bacteria 984
569 Ga0496114_0040025 3300048917 Bacteria 3879
570 Ga0496115_0000056 3300048918 Bacteria 104434
571 Ga0496116_0000545 3300048919 Bacteria 50407
572 Ga0496116_0006376 3300048919 Bacteria 10721
573 Ga0496116_0036283 3300048919 Bacteria 3452
574 Ga0496117_0000114 3300048920 Bacteria 180658
575 Ga0496117_0012932 3300048920 Bacteria 7314
576 Ga0496117_0013436 3300048920 Bacteria 7145
577 Ga0496117_0026934 3300048920 Bacteria 4489
578 Ga0496117_0062312 3300048920 Bacteria 2556
579 Ga0496118_0000082 3300048921 Bacteria 185820
580 Ga0496118_0000439 3300048921 Bacteria 68828
581 Ga0496118_0001437 3300048921 Bacteria 35866
582 Ga0496118_0004598 3300048921 Bacteria 16223
583 Ga0496118_0014789 3300048921 Bacteria 7279
584 Ga0496118_0061924 3300048921 Bacteria 2766
585 Ga0496119_0002162 3300048922 Bacteria 22091
586 Ga0496119_0019495 3300048922 Bacteria 4993
587 Ga0496120_0006533 3300048923 Bacteria 8927
588 Ga0496120_0048673 3300048923 Bacteria 2438
589 Ga0496121_0000021 3300048924 Bacteria 478544
590 Ga0496121_0000190 3300048924 Bacteria 136607
591 Ga0496121_0000344 3300048924 Bacteria 96865
592 Ga0496121_0000721 3300048924 Bacteria 61207
593 Ga0496121_0002392 3300048924 Bacteria 28763
594 Ga0496121_0009736 3300048924 Bacteria 10996
595 Ga0496121_0028182 3300048924 Bacteria 5234
596 Ga0496121_0032836 3300048924 Bacteria 4709
597 Ga0496121_0034383 3300048924 Bacteria 4562
598 Ga0496121_0230957 3300048924 Bacteria 1296
599 Ga0496122_0000462 3300048925 Bacteria 84546
600 Ga0496122_0001343 3300048925 Bacteria 40125
601 Ga0496122_0004042 3300048925 Bacteria 18642
602 Ga0496122_0004742 3300048925 Bacteria 16663
603 Ga0496122_0008010 3300048925 Bacteria 11540
604 Ga0496122_0010005 3300048925 Bacteria 9870
605 Ga0496122_0021500 3300048925 Bacteria 5774
606 Ga0496122_0031248 3300048925 Bacteria 4437
607 Ga0496122_0078878 3300048925 Bacteria 2304
608 Ga0496123_0000048 3300048926 Bacteria 244152
609 Ga0496123_0000300 3300048926 Bacteria 96475
610 Ga0496123_0000643 3300048926 Bacteria 58206
611 Ga0496123_0002078 3300048926 Bacteria 25781
612 Ga0496123_0013351 3300048926 Bacteria 6905
613 Ga0496123_0017198 3300048926 Bacteria 5833
614 Ga0496123_0025200 3300048926 Bacteria 4491
615 Ga0496123_0065530 3300048926 Bacteria 2308
616 Ga0496123_0143732 3300048926 Bacteria 1299
617 Ga0496124_0000068 3300048927 Bacteria 221819
618 Ga0496124_0003193 3300048927 Bacteria 20246
619 Ga0496124_0006400 3300048927 Bacteria 12839
620 Ga0496124_0019388 3300048927 Bacteria 6332
621 Ga0496124_0056514 3300048927 Bacteria 3309
622 Ga0496124_0061695 3300048927 Bacteria 3141
623 Ga0496124_0119858 3300048927 Bacteria 2104
624 Ga0496124_0175482 3300048927 Bacteria 1655
625 Ga0496125_0000488 3300048928 Bacteria 69299
626 Ga0496125_0002303 3300048928 Bacteria 25208
627 Ga0496125_0004268 3300048928 Bacteria 16627
628 Ga0496125_0012254 3300048928 Bacteria 8525
629 Ga0496125_0035284 3300048928 Bacteria 4391
630 Ga0496125_0070822 3300048928 Bacteria 2727
631 Ga0496125_0102467 3300048928 Bacteria 2103
632 Ga0496125_0159962 3300048928 Bacteria 1531
633 Ga0496125_0230986 3300048928 Bacteria 1183
634 Ga0496126_0000157 3300048929 Bacteria 156203
635 Ga0496126_0000503 3300048929 Bacteria 76786
636 Ga0496126_0011995 3300048929 Bacteria 8906
637 Ga0496126_0018537 3300048929 Bacteria 6891
638 Ga0496126_0027270 3300048929 Bacteria 5458
639 Ga0496126_0265064 3300048929 Bacteria 1427
640 Ga0495682_0028086 3300049460 Bacteria 2086
641 Ga0501292_000003 3300049515 Bacteria 161908
642 Ga0501031_0011456 3300049568 Bacteria 5777
643 Ga0501032_0010834 3300049569 Bacteria 6562
644 Ga0501032_0027261 3300049569 Bacteria 3926
645 Ga0501033_0005862 3300049570 Bacteria 9657
646 Ga0501033_0029586 3300049570 Bacteria 4116
647 Ga0501033_0064704 3300049570 Bacteria 2691
648 Ga0501033_0131204 3300049570 Bacteria 1815
649 Ga0501034_0000215 3300049571 Bacteria 110067
650 Ga0501034_0028660 3300049571 Bacteria 5665
651 Ga0501034_0092516 3300049571 Bacteria 3021
652 Ga0501034_0186316 3300049571 Bacteria 2039
653 Ga0501034_0473074 3300049571 Bacteria 1169
654 Ga0501038_0122898 3300049574 Bacteria 2139
655 Ga0501039_0266539 3300049575 Bacteria 1346
656 Ga0501043_0210689 3300049579 Bacteria 1506
657 Ga0501043_0309235 3300049579 Bacteria 1206
658 Ga0501047_0000307 3300049581 Bacteria 56284
659 Ga0501047_0001806 3300049581 Bacteria 20665
660 Ga0501047_0010908 3300049581 Bacteria 8593
661 Ga0501047_0274153 3300049581 Bacteria 1533
662 Ga0501048_0063616 3300049582 Bacteria 2609
663 Ga0501048_0239907 3300049582 Bacteria 1286
664 Ga0501073_0000140 3300049589 Bacteria 47436
665 Ga0501223_000007 3300049663 Bacteria 132601
666 Ga0501238_000513 3300049671 Bacteria 4442
667 Ga0501246_000376 3300049676 Bacteria 3180
668 Ga0501249_000267 3300049679 Bacteria 14967
669 Ga0501249_000588 3300049679 Bacteria 8509
670 Ga0501225_0000010 3300049705 Bacteria 82395
671 Ga0501080_0018648 3300049742 Bacteria 6421
672 Ga0501083_0079772 3300049744 Bacteria 2170
673 Ga0501241_001086 3300049758 Bacteria 5722
674 Ga0501262_002548 3300049759 Bacteria 2059
675 Ga0501279_000009 3300049775 Bacteria 117146
676 Ga0501035_0004268 3300049822 Bacteria 13569
677 Ga0501035_0092439 3300049822 Bacteria 2662
678 Ga0501035_0102217 3300049822 Bacteria 2514
679 Ga0501044_0000109 3300049823 Bacteria 100674
680 Ga0501044_0000453 3300049823 Bacteria 49990
681 Ga0501044_0043037 3300049823 Bacteria 4693
682 Ga0501044_0105330 3300049823 Bacteria 2833
683 Ga0501044_0672560 3300049823 Bacteria 923
684 nmdc:mga03n38_68_c1 3300050490 Bacteria 21917
685 nmdc:mga03n38_71089_c1 3300050490 Bacteria 1611
686 nmdc:mga00v17_91_c1 3300050491 Bacteria 53223
687 nmdc:mga00v17_9_c1 3300050491 Bacteria 138453
688 nmdc:mga0yw44_452865_c1 3300050492 Bacteria 870
689 nmdc:mga0yw44_567_c1 3300050492 Bacteria 13324
690 nmdc:mga0yw44_727_c2 3300050492 Bacteria 11571
691 nmdc:mga0k408_156526_c1 3300050493 Bacteria 1041
692 nmdc:mga0k408_28620_c1 3300050493 Bacteria 3168
693 nmdc:mga0k408_415_c1 3300050493 Bacteria 23295
694 nmdc:mga0k408_59038_c1 3300050493 Bacteria 2228
695 nmdc:mga0k408_80036_c1 3300050493 Bacteria 1912
696 nmdc:mga06z11_121710_c1 3300050494 Bacteria 1456
697 nmdc:mga06z11_3_c1 3300050494 Bacteria 138457
698 nmdc:mga06z11_41_c1 3300050494 Bacteria 53112
699 nmdc:mga06z11_48_c1 3300050494 Bacteria 51095
700 nmdc:mga06z11_60931_c1 3300050494 Bacteria 1966
701 nmdc:mga06z11_71_c1 3300050494 Bacteria 42338
702 nmdc:mga04h51_27_c1 3300050495 Bacteria 53116
703 nmdc:mga04h51_43_c1 3300050495 Bacteria 42355
704 nmdc:mga04h51_57_c1 3300050495 Bacteria 35214
705 nmdc:mga04h51_5_c1 3300050495 Bacteria 138278
706 nmdc:mga07m45_18_c1 3300050496 Bacteria 138462
707 nmdc:mga07m45_22856_c1 3300050496 Bacteria 3415
708 nmdc:mga07m45_26825_c1 3300050496 Bacteria 3168
709 nmdc:mga07m45_2787_c1 3300050496 Bacteria 8259
710 nmdc:mga09592_163515_c1 3300050508 Bacteria 1923
711 nmdc:mga0sz30_271_c1 3300050516 Bacteria 19815
712 nmdc:mga0sz30_3064_c1 3300050516 Bacteria 5987
713 nmdc:mga0sz30_34_c1 3300050516 Bacteria 53573
714 nmdc:mga0sz30_397_c1 3300050516 Bacteria 16569
715 Ga0495601_0046860 3300053077 Bacteria 2721
716 Ga0500610_0000206 3300053079 Bacteria 18104
717 Ga0500635_0000154 3300053080 Bacteria 38155
718 Ga0495619_0066359 3300053085 Bacteria 2408
719 Ga0500643_000203 3300053087 Bacteria 56433
720 Ga0500643_030347 3300053087 Bacteria 1656
721 Ga0500646_0007574 3300053090 Bacteria 2775
722 Ga0500647_0014019 3300053091 Bacteria 3636
723 Ga0500651_0000062 3300053093 Bacteria 71042
724 Ga0500651_0004291 3300053093 Bacteria 7964
725 Ga0500566_0000824 3300053094 Bacteria 17698
726 Ga0500566_0022100 3300053094 Bacteria 3739
727 Ga0500566_0076541 3300053094 Bacteria 1870
728 Ga0500566_0082680 3300053094 Bacteria 1784
729 Ga0500641_0001855 3300053096 Bacteria 7498
730 Ga0500650_0170650 3300053098 Bacteria 1000
731 Ga0500654_078918 3300053099 Bacteria 1549
732 Ga0500555_000448 3300053103 Bacteria 17084
733 Ga0500592_016490 3300053116 Bacteria 1185
734 Ga0500592_019210 3300053116 Bacteria 1097
735 Ga0500595_002134 3300053119 Bacteria 10068
736 Ga0500595_002188 3300053119 Bacteria 9926
737 Ga0500595_004324 3300053119 Bacteria 6398
738 Ga0500595_021474 3300053119 Bacteria 2303
739 Ga0500607_000293 3300053121 Bacteria 47399
740 Ga0500608_000135 3300053122 Bacteria 30072
741 Ga0500608_000353 3300053122 Bacteria 17755
742 Ga0500608_002030 3300053122 Bacteria 7258
743 Ga0500614_000155 3300053123 Bacteria 17375
744 Ga0500614_004939 3300053123 Bacteria 2804
745 Ga0500614_023077 3300053123 Bacteria 1459
746 Ga0500618_000178 3300053125 Bacteria 52653
747 Ga0500618_000606 3300053125 Bacteria 21912
748 Ga0500618_000707 3300053125 Bacteria 19471
749 Ga0500618_006287 3300053125 Bacteria 3506
750 Ga0500642_0000471 3300053130 Bacteria 12520
751 Ga0500642_0031645 3300053130 Bacteria 2212
752 Ga0500655_000055 3300053133 Bacteria 30746
753 Ga0500655_017095 3300053133 Bacteria 1339
754 Ga0500559_0000031 3300053136 Bacteria 114782
755 Ga0500559_0000879 3300053136 Bacteria 19217
756 Ga0500559_0000984 3300053136 Bacteria 17768
757 Ga0500559_0003462 3300053136 Bacteria 7753
758 Ga0500559_0008942 3300053136 Bacteria 4359
759 Ga0500559_0021988 3300053136 Bacteria 2705
760 Ga0500559_0220483 3300053136 Bacteria 894
761 Ga0500568_0069966 3300053139 Bacteria 1345
762 Ga0500573_0047098 3300053140 Bacteria 2484
763 Ga0500590_000433 3300053148 Bacteria 14077
764 Ga0500603_000737 3300053150 Bacteria 7972
765 Ga0500604_0000520 3300053151 Bacteria 10639
766 Ga0500622_0003059 3300053156 Bacteria 11547
767 Ga0500622_0005037 3300053156 Bacteria 8048
768 Ga0500622_0005173 3300053156 Bacteria 7907
769 Ga0500622_0005293 3300053156 Bacteria 7784
770 Ga0500624_000002 3300053157 Bacteria 257900
771 Ga0500627_0000020 3300053158 Bacteria 109977
772 Ga0500639_101614 3300053163 Bacteria 1414
773 Ga0500636_0001943 3300053177 Bacteria 11357
774 Ga0500637_0004224 3300053178 Bacteria 6780
775 Ga0500570_006654 3300053724 Bacteria 6292
776 Ga0500625_000007 3300053729 Bacteria 177638
777 Ga0500645_000585 3300053730 Bacteria 23518
778 Ga0500645_001694 3300053730 Bacteria 10762
779 Ga0500645_002181 3300053730 Bacteria 8957
780 Ga0500645_014440 3300053730 Bacteria 2515
781 Ga0501084_0021531 3300054114 Bacteria 5374
782 Ga0500661_000033 3300055283 Bacteria 20509
783 Ga0501082_0043906 3300060353 Bacteria 3856
784 Ga0530510_0211114 3300061734 Bacteria 1442

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0162114 Ga0495653_0162114_842_1465 188
2 3300048088 Ga0495602_0025013 Ga0495602_0025013_4381_5004 188
3 3300046616 Ga0495668_0000002 Ga0495668_0000002_231544_232236 204
4 iso_pu_bacteria 2510461069 2510842739 216
5 3300046616 Ga0495668_0167114 Ga0495668_0167114_28_690 217
6 3300041413 Ga0439465_0006311 Ga0439465_0006311_81_806 218
7 3300049744 Ga0501083_0079772 Ga0501083_0079772_138_854 218
8 3300054114 Ga0501084_0021531 Ga0501084_0021531_4617_5333 218
9 3300060353 Ga0501082_0043906 Ga0501082_0043906_1272_1988 218
10 iso_pu_bacteria 2775507255 2778126862 218
11 3300046522 Ga0495643_0030778 Ga0495643_0030778_886_1638 219
12 3300025295 Ga0209564_1027816 Ga0209564_10278162 220
13 iso_pu_bacteria 2874220319 2874220725 220
14 iso_pu_bacteria 2919089067 2919090755 220
15 iso_pu_bacteria 2928496128 2928496739 220
16 iso_pu_bacteria 2931380184 2931381641 220
17 iso_pu_bacteria 2939626828 2939627491 220
18 iso_pu_bacteria 2961047084 2961047490 220
19 3300046528 Ga0495642_0106553 Ga0495642_0106553_196_960 221
20 3300046557 Ga0495622_0003300 Ga0495622_0003300_5181_5879 221
21 3300046616 Ga0495668_0031231 Ga0495668_0031231_1250_2014 221
22 3300046665 Ga0495661_0007978 Ga0495661_0007978_5523_6287 221
23 3300047443 Ga0495687_018058 Ga0495687_018058_2417_3181 221
24 3300048928 Ga0496125_0230986 Ga0496125_0230986_339_1028 221
25 3300053094 Ga0500566_0082680 Ga0500566_0082680_720_1418 221
26 3300053119 Ga0500595_002134 Ga0500595_002134_2616_3314 221
27 3300053122 Ga0500608_002030 Ga0500608_002030_1106_1804 221
28 3300053123 Ga0500614_004939 Ga0500614_004939_1832_2530 221
29 3300005289 Ga0065704_10123610 Ga0065704_101236101 222
30 3300005468 Ga0070707_100069477 Ga0070707_1000694774 222
31 3300013102 Ga0157371_10006898 Ga0157371_100068981 222
32 3300013105 Ga0157369_10029788 Ga0157369_100297885 222
33 3300014326 Ga0157380_10230418 Ga0157380_102304183 222
34 3300015261 Ga0182006_1027560 Ga0182006_10275602 222
35 3300015262 Ga0182007_10088705 Ga0182007_100887052 222
36 3300017792 Ga0163161_10016323 Ga0163161_100163236 222
37 3300031548 Ga0307408_100036834 Ga0307408_1000368344 222
38 3300032004 Ga0307414_10200207 Ga0307414_102002071 222
39 3300036401 Ga0373937_0277486 Ga0373937_0277486_483_1175 222
40 3300042115 Ga0450911_001396 Ga0450911_001396_663_1394 222
41 3300046525 Ga0495663_0000757 Ga0495663_0000757_9716_10447 222
42 3300046558 Ga0495633_0003416 Ga0495633_0003416_9111_9842 222
43 3300048916 Ga0496113_0064418 Ga0496113_0064418_676_1407 222
44 3300048919 Ga0496116_0000545 Ga0496116_0000545_13041_13772 222
45 3300048920 Ga0496117_0062312 Ga0496117_0062312_667_1398 222
46 3300048921 Ga0496118_0061924 Ga0496118_0061924_1605_2336 222
47 3300048924 Ga0496121_0034383 Ga0496121_0034383_245_976 222
48 3300048926 Ga0496123_0143732 Ga0496123_0143732_439_1170 222
49 3300048928 Ga0496125_0035284 Ga0496125_0035284_213_944 222
50 3300048929 Ga0496126_0265064 Ga0496126_0265064_117_848 222
51 3300053080 Ga0500635_0000154 Ga0500635_0000154_27706_28410 222
52 iso_pu_bacteria 2524023207 2524454505 223
53 iso_pu_bacteria 2582581865 2585387239 223
54 iso_pu_bacteria 2838035591 2838041808 223
55 iso_pu_bacteria 2838661181 2838661187 223
56 iso_pu_bacteria 2842521101 2842525297 223
57 iso_pu_bacteria 2979100975 2979103089 223
58 iso_pu_bacteria 2984601300 2984606509 223
59 3300041456 Ga0451795_1076342 Ga0451795_1076342_55_792 224
60 3300041509 Ga0451843_0184918 Ga0451843_0184918_18_761 224
61 3300003187 JGI25151J46595_10000639 JGI25151J46595_1000063913 225
62 3300014497 Ga0182008_10037660 Ga0182008_100376602 225
63 3300025261 Ga0209233_1045290 Ga0209233_10452901 225
64 3300025294 Ga0209025_1000018 Ga0209025_1000018179 225
65 3300031456 Ga0307513_10004795 Ga0307513_100047956 225
66 3300031824 Ga0307413_10017189 Ga0307413_100171896 225
67 3300031911 Ga0307412_10000003 Ga0307412_10000003539 225
68 3300046512 Ga0495610_0002633 Ga0495610_0002633_9213_10001 225
69 3300047443 Ga0495687_007250 Ga0495687_007250_2476_3264 225
70 3300048091 Ga0495626_0034390 Ga0495626_0034390_31_819 225
71 3300009093 Ga0105240_10342380 Ga0105240_103423801 226
72 3300025256 Ga0209759_1008921 Ga0209759_10089214 226
73 3300025904 Ga0207647_10027364 Ga0207647_100273644 226
74 3300039437 Ga0436365_1097678 Ga0436365_1097678_119_850 226
75 3300046474 Ga0495605_0003880 Ga0495605_0003880_4577_5365 226
76 3300046491 Ga0495584_0172349 Ga0495584_0172349_192_980 226
77 3300046528 Ga0495642_0007084 Ga0495642_0007084_2712_3500 226
78 3300047323 Ga0495683_0016369 Ga0495683_0016369_2988_3776 226
79 3300048920 Ga0496117_0012932 Ga0496117_0012932_6169_6957 226
80 3300050494 nmdc:mga06z11_121710_c1 nmdc:mga06z11_121710_c1_63_896 226
81 iso_pu_bacteria 2509276019 2509374508 226
82 iso_pu_bacteria 2510917020 2511124402 226
83 iso_pu_bacteria 2513237150 2513957704 226
84 iso_pu_bacteria 2513237165 2514045559 226
85 iso_pu_bacteria 2558860100 2558863535 226
86 iso_pu_bacteria 2643221583 2643926097 226
87 iso_pu_bacteria 2643221584 2643928721 226
88 iso_pu_bacteria 2643221598 2644001519 226
89 iso_pu_bacteria 2643221614 2644087198 226
90 iso_pu_bacteria 2643221661 2644342151 226
91 iso_pu_bacteria 2643221666 2644368437 226
92 iso_pu_bacteria 2791355048 2792462246 226
93 iso_pu_bacteria 2849560528 2849563761 226
94 iso_pu_bacteria 2849573788 2849576443 226
95 iso_pu_bacteria 2850079185 2850080426 226
96 iso_pu_bacteria 2851153111 2851154939 226
97 iso_pu_bacteria 2857504554 2857507213 226
98 iso_pu_bacteria 2884960567 2884961984 226
99 iso_pu_bacteria 2898329390 2898331475 226
100 iso_pu_bacteria 2919679072 2919682705 226
101 iso_pu_bacteria 2928531327 2928534089 226
102 iso_pu_bacteria 644736347 644750038 226
103 iso_pu_bacteria 8055266321 8055272054 226
104 3300003316 rootH1_10030986 rootH1_100309862 227
105 3300003322 rootL2_10275712 rootL2_102757122 227
106 3300003323 rootH1_10005886 rootH1_100058869 227
107 3300025261 Ga0209233_1000455 Ga0209233_100045527 227
108 3300041451 Ga0451791_0474554 Ga0451791_0474554_472_1182 227
109 3300041460 Ga0451802_1573622 Ga0451802_1573622_551_1261 227
110 3300041486 Ga0451807_2178245 Ga0451807_2178245_88_798 227
111 3300053156 Ga0500622_0003059 Ga0500622_0003059_8487_9275 227
112 3300003775 Ga0055524_1000470 Ga0055524_100047010 228
113 3300046453 Ga0495627_000105 Ga0495627_000105_30924_31628 228
114 3300046512 Ga0495610_0000018 Ga0495610_0000018_262269_262973 228
115 3300048925 Ga0496122_0000462 Ga0496122_0000462_64156_64866 228
116 3300003775 Ga0055524_1002798 Ga0055524_10027988 229
117 3300003784 Ga0055534_1007990 Ga0055534_10079903 229
118 3300005335 Ga0070666_10032969 Ga0070666_100329694 229
119 3300005367 Ga0070667_100072346 Ga0070667_1000723462 229
120 3300009177 Ga0105248_10022524 Ga0105248_100225247 229
121 3300009177 Ga0105248_10092062 Ga0105248_100920622 229
122 3300013306 Ga0163162_10003415 Ga0163162_1000341511 229
123 3300013308 Ga0157375_10002079 Ga0157375_100020799 229
124 3300025291 Ga0209675_1000724 Ga0209675_100072415 229
125 3300025294 Ga0209025_1000371 Ga0209025_100037161 229
126 3300025294 Ga0209025_1033530 Ga0209025_10335303 229
127 3300025903 Ga0207680_10011950 Ga0207680_100119502 229
128 3300025931 Ga0207644_10585917 Ga0207644_105859171 229
129 3300025941 Ga0207711_10015556 Ga0207711_100155563 229
130 3300025941 Ga0207711_10035470 Ga0207711_100354702 229
131 3300025986 Ga0207658_10062027 Ga0207658_100620273 229
132 3300028577 Ga0265318_10009370 Ga0265318_100093703 229
133 3300028654 Ga0265322_10029347 Ga0265322_100293472 229
134 3300028666 Ga0265336_10000859 Ga0265336_100008595 229
135 3300028800 Ga0265338_10000013 Ga0265338_10000013362 229
136 3300029957 Ga0265324_10021279 Ga0265324_100212792 229
137 3300031548 Ga0307408_100010494 Ga0307408_1000104948 229
138 3300031731 Ga0307405_10279380 Ga0307405_102793802 229
139 3300046454 Ga0495592_0063903 Ga0495592_0063903_1068_1832 229
140 3300046460 Ga0495638_0002254 Ga0495638_0002254_9650_10420 229
141 3300046462 Ga0495651_0437393 Ga0495651_0437393_23_787 229
142 3300046472 Ga0495580_0000047 Ga0495580_0000047_55441_56205 229
143 3300046472 Ga0495580_0053620 Ga0495580_0053620_72_836 229
144 3300046474 Ga0495605_0005837 Ga0495605_0005837_2341_3111 229
145 3300046477 Ga0495664_0012632 Ga0495664_0012632_3799_4563 229
146 3300046501 Ga0495607_0006779 Ga0495607_0006779_3048_3818 229
147 3300046516 Ga0495628_0062359 Ga0495628_0062359_446_1210 229
148 3300046516 Ga0495628_0345569 Ga0495628_0345569_263_1027 229
149 3300046517 Ga0495630_0172398 Ga0495630_0172398_852_1616 229
150 3300046518 Ga0495631_0052696 Ga0495631_0052696_620_1390 229
151 3300046526 Ga0495666_0004701 Ga0495666_0004701_4310_5074 229
152 3300046529 Ga0495652_0051478 Ga0495652_0051478_368_1132 229
153 3300046529 Ga0495652_0156210 Ga0495652_0156210_79_843 229
154 3300046533 Ga0495640_0066032 Ga0495640_0066032_1370_2134 229
155 3300046543 Ga0495645_0378934 Ga0495645_0378934_51_815 229
156 3300046678 Ga0495599_0013711 Ga0495599_0013711_725_1489 229
157 3300046678 Ga0495599_0040463 Ga0495599_0040463_383_1147 229
158 3300046680 Ga0495646_0055361 Ga0495646_0055361_236_1000 229
159 3300046684 Ga0495669_0002307 Ga0495669_0002307_1716_2486 229
160 3300046794 Ga0495589_0008502 Ga0495589_0008502_3117_3887 229
161 3300047317 Ga0495604_0020344 Ga0495604_0020344_1344_2108 229
162 3300047319 Ga0495674_0034286 Ga0495674_0034286_1733_2497 229
163 3300047320 Ga0495672_0004815 Ga0495672_0004815_2862_3626 229
164 3300047444 Ga0495675_0189287 Ga0495675_0189287_469_1233 229
165 3300048088 Ga0495602_0392296 Ga0495602_0392296_205_969 229
166 3300048091 Ga0495626_0092043 Ga0495626_0092043_71_841 229
167 3300048905 Ga0496102_0008560 Ga0496102_0008560_7705_8475 229
168 3300048905 Ga0496102_0052303 Ga0496102_0052303_2000_2764 229
169 3300048907 Ga0496104_0561403 Ga0496104_0561403_120_890 229
170 3300048909 Ga0496106_0059203 Ga0496106_0059203_1319_2089 229
171 3300048910 Ga0496107_0018371 Ga0496107_0018371_3736_4506 229
172 3300048919 Ga0496116_0036283 Ga0496116_0036283_2328_3092 229
173 3300048921 Ga0496118_0000439 Ga0496118_0000439_39127_39891 229
174 3300048929 Ga0496126_0000503 Ga0496126_0000503_52266_53030 229
175 3300049571 Ga0501034_0000215 Ga0501034_0000215_54512_55276 229
176 3300053125 Ga0500618_006287 Ga0500618_006287_823_1575 229
177 iso_pu_bacteria 2510065057 2510306598 229
178 iso_pu_bacteria 2511231052 2511500961 229
179 iso_pu_bacteria 2512047086 2512532376 229
180 iso_pu_bacteria 2513237086 2513583501 229
181 iso_pu_bacteria 2513237091 2513617650 229
182 iso_pu_bacteria 2513237140 2513882714 229
183 iso_pu_bacteria 2513237143 2513905259 229
184 iso_pu_bacteria 2513237144 2513914506 229
185 iso_pu_bacteria 2513237146 2513928245 229
186 iso_pu_bacteria 2513237159 2513999503 229
187 iso_pu_bacteria 2516653046 2516892242 229
188 iso_pu_bacteria 2551306084 2551676421 229
189 iso_pu_bacteria 2551306085 2551687222 229
190 iso_pu_bacteria 2551306086 2551694402 229
191 iso_pu_bacteria 2551306087 2551703175 229
192 iso_pu_bacteria 2551306093 2551740391 229
193 iso_pu_bacteria 2582581306 2585266237 229
194 iso_pu_bacteria 2599185170 2599416862 229
195 iso_pu_bacteria 2855825444 2855831312 229
196 iso_pu_bacteria 2855839649 2855840437 229
197 iso_pu_bacteria 2858800743 2858800965 229
198 iso_pu_bacteria 2915986958 2915990905 229
199 iso_pu_bacteria 2915993759 2915996271 229
200 iso_pu_bacteria 2916000859 2916005749 229
201 iso_pu_bacteria 2916007675 2916010916 229
202 iso_pu_bacteria 2916014648 2916016553 229
203 iso_pu_bacteria 2916021584 2916024752 229
204 iso_pu_bacteria 2916028427 2916032191 229
205 iso_pu_bacteria 2916035215 2916038154 229
206 iso_pu_bacteria 2916041962 2916047918 229
207 iso_pu_bacteria 2916048683 2916054361 229
208 iso_pu_bacteria 2916055098 2916055368 229
209 iso_pu_bacteria 2916068649 2916073448 229
210 iso_pu_bacteria 2916076590 2916078178 229
211 iso_pu_bacteria 2921201388 2921204930 229
212 iso_pu_bacteria 2921208531 2921213520 229
213 iso_pu_bacteria 2921237296 2921241612 229
214 iso_pu_bacteria 2921244191 2921247526 229
215 iso_pu_bacteria 2921257292 2921261599 229
216 iso_pu_bacteria 2921263974 2921264245 229
217 iso_pu_bacteria 2921282425 2921282758 229
218 iso_pu_bacteria 2921289301 2921290140 229
219 iso_pu_bacteria 2921296804 2921303397 229
220 iso_pu_bacteria 2924144063 2924145610 229
221 iso_pu_bacteria 2924150972 2924157260 229
222 iso_pu_bacteria 2924158325 2924160563 229
223 iso_pu_bacteria 2924165586 2924168161 229
224 iso_pu_bacteria 2924172951 2924173408 229
225 iso_pu_bacteria 2924179722 2924186324 229
226 iso_pu_bacteria 2924186466 2924189502 229
227 iso_pu_bacteria 2924193448 2924198238 229
228 iso_pu_bacteria 2924200457 2924204069 229
229 iso_pu_bacteria 2924207177 2924209899 229
230 iso_pu_bacteria 2924214083 2924215186 229
231 iso_pu_bacteria 2924221636 2924226239 229
232 iso_pu_bacteria 2924228884 2924234924 229
233 iso_pu_bacteria 2933016740 2933019853 229
234 iso_pu_bacteria 2937002841 2937009524 229
235 iso_pu_bacteria 2937009748 2937010876 229
236 iso_pu_bacteria 2937016420 2937018995 229
237 iso_pu_bacteria 2937023124 2937027935 229
238 iso_pu_bacteria 2937042894 2937048979 229
239 iso_pu_bacteria 2937049772 2937056294 229
240 iso_pu_bacteria 2937056579 2937063363 229
241 iso_pu_bacteria 2937063883 2937070635 229
242 iso_pu_bacteria 2937071275 2937072169 229
243 iso_pu_bacteria 2937091812 2937095579 229
244 iso_pu_bacteria 2937098957 2937103645 229
245 iso_pu_bacteria 2937106411 2937112552 229
246 iso_pu_bacteria 2937113482 2937118184 229
247 iso_pu_bacteria 2937119839 2937121175 229
248 iso_pu_bacteria 2937126314 2937129809 229
249 iso_pu_bacteria 2957382221 2957385079 229
250 iso_pu_bacteria 2957388812 2957389142 229
251 iso_pu_bacteria 2957395598 2957396396 229
252 iso_pu_bacteria 2957402308 2957405458 229
253 iso_pu_bacteria 2957408893 2957413261 229
254 iso_pu_bacteria 2957415311 2957419188 229
255 iso_pu_bacteria 2957422303 2957427723 229
256 iso_pu_bacteria 2957430029 2957431101 229
257 iso_pu_bacteria 2957443900 2957446664 229
258 iso_pu_bacteria 2957450854 2957454180 229
259 iso_pu_bacteria 2957457609 2957457613 229
260 iso_pu_bacteria 2957464669 2957467758 229
261 iso_pu_bacteria 2957471148 2957477800 229
262 iso_pu_bacteria 2957478035 2957480638 229
263 iso_pu_bacteria 2957484790 2957485800 229
264 iso_pu_bacteria 2957491536 2957495984 229
265 iso_pu_bacteria 2957498199 2957501026 229
266 iso_pu_bacteria 2957505466 2957509582 229
267 iso_pu_bacteria 2960584000 2960586634 229
268 iso_pu_bacteria 2960597568 2960600585 229
269 iso_pu_bacteria 2960603979 2960609485 229
270 iso_pu_bacteria 2960610863 2960616721 229
271 iso_pu_bacteria 2960617483 2960617693 229
272 iso_pu_bacteria 2960624210 2960629778 229
273 iso_pu_bacteria 2960637947 2960640197 229
274 iso_pu_bacteria 2960645483 2960648738 229
275 iso_pu_bacteria 2960652885 2960659496 229
276 iso_pu_bacteria 2960660292 2960666394 229
277 iso_pu_bacteria 2960667422 2960673915 229
278 iso_pu_bacteria 2960674078 2960678822 229
279 iso_pu_bacteria 2960687367 2960692069 229
280 iso_pu_bacteria 2964607997 2964609722 229
281 iso_pu_bacteria 2964615318 2964620711 229
282 iso_pu_bacteria 2964621998 2964627797 229
283 iso_pu_bacteria 2964628898 2964633127 229
284 iso_pu_bacteria 2964636051 2964637207 229
285 iso_pu_bacteria 2964643177 2964646151 229
286 iso_pu_bacteria 2964649959 2964653093 229
287 iso_pu_bacteria 2964656573 2964661894 229
288 iso_pu_bacteria 2964670856 2964671696 229
289 iso_pu_bacteria 2964678106 2964678977 229
290 iso_pu_bacteria 2964685014 2964688098 229
291 iso_pu_bacteria 2964691889 2964695831 229
292 iso_pu_bacteria 2964698721 2964703605 229
293 iso_pu_bacteria 2964705432 2964706166 229
294 iso_pu_bacteria 2964712639 2964716289 229
295 iso_pu_bacteria 2964719344 2964726467 229
296 iso_pu_bacteria 2967664464 2967667361 229
297 iso_pu_bacteria 2967671571 2967672154 229
298 iso_pu_bacteria 2967678726 2967678915 229
299 iso_pu_bacteria 2967693043 2967693235 229
300 iso_pu_bacteria 2967699805 2967704250 229
301 iso_pu_bacteria 2967706974 2967712938 229
302 iso_pu_bacteria 2967714385 2967716539 229
303 iso_pu_bacteria 2967721400 2967724576 229
304 iso_pu_bacteria 2967735183 2967737590 229
305 iso_pu_bacteria 2967742019 2967747863 229
306 iso_pu_bacteria 2967748971 2967752115 229
307 iso_pu_bacteria 2967755722 2967757724 229
308 iso_pu_bacteria 2967762386 2967763809 229
309 iso_pu_bacteria 2967769361 2967770782 229
310 iso_pu_bacteria 2967775926 2967782167 229
311 iso_pu_bacteria 2970019648 2970026061 229
312 iso_pu_bacteria 2970033650 2970037792 229
313 iso_pu_bacteria 2970040964 2970043295 229
314 iso_pu_bacteria 2970047711 2970049930 229
315 iso_pu_bacteria 2970054988 2970059618 229
316 iso_pu_bacteria 2970061556 2970065304 229
317 iso_pu_bacteria 2970068827 2970075673 229
318 iso_pu_bacteria 2970076120 2970076979 229
319 iso_pu_bacteria 2970082768 2970085658 229
320 iso_pu_bacteria 2970088815 2970093298 229
321 iso_pu_bacteria 2970095765 2970096805 229
322 iso_pu_bacteria 2970102677 2970108554 229
323 iso_pu_bacteria 2970109326 2970109829 229
324 iso_pu_bacteria 2970116247 2970117978 229
325 iso_pu_bacteria 2970129317 2970129508 229
326 iso_pu_bacteria 2970136068 2970143160 229
327 iso_pu_bacteria 2970149975 2970153824 229
328 iso_pu_bacteria 2970156795 2970162816 229
329 iso_pu_bacteria 2970164137 2970167494 229
330 iso_pu_bacteria 2970170962 2970171784 229
331 iso_pu_bacteria 2970177841 2970184114 229
332 iso_pu_bacteria 2970184632 2970185134 229
333 iso_pu_bacteria 2970191845 2970198334 229
334 iso_pu_bacteria 2977516862 2977523657 229
335 iso_pu_bacteria 2977523885 2977527645 229
336 iso_pu_bacteria 2977537788 2977537979 229
337 iso_pu_bacteria 2977551784 2977551977 229
338 iso_pu_bacteria 2977558990 2977561682 229
339 iso_pu_bacteria 2977565890 2977568972 229
340 iso_pu_bacteria 2977572785 2977578971 229
341 iso_pu_bacteria 2977579622 2977581504 229
342 iso_pu_bacteria 648276728 648736356 229
343 iso_pu_bacteria 8003992118 8003992934 229
344 3300003773 Ga0055537_1002473 Ga0055537_10024736 230
345 3300003775 Ga0055524_1014354 Ga0055524_10143542 230
346 3300003781 Ga0055536_1000121 Ga0055536_100012111 230
347 3300003781 Ga0055536_1000288 Ga0055536_100028812 230
348 3300003781 Ga0055536_1001415 Ga0055536_10014155 230
349 3300003790 Ga0055528_1006831 Ga0055528_10068315 230
350 3300003791 Ga0055530_10000897 Ga0055530_100008976 230
351 3300003791 Ga0055530_10001863 Ga0055530_100018635 230
352 3300003791 Ga0055530_10002377 Ga0055530_1000237712 230
353 3300003792 Ga0055540_1029201 Ga0055540_10292012 230
354 3300003792 Ga0055540_1046215 Ga0055540_10462151 230
355 3300003794 Ga0055531_10000096 Ga0055531_1000009610 230
356 3300005347 Ga0070668_100034378 Ga0070668_1000343786 230
357 3300005347 Ga0070668_100037160 Ga0070668_1000371605 230
358 3300005367 Ga0070667_100002234 Ga0070667_10000223417 230
359 3300005548 Ga0070665_100000884 Ga0070665_10000088411 230
360 3300005719 Ga0068861_100145803 Ga0068861_1001458032 230
361 3300005719 Ga0068861_100201101 Ga0068861_1002011013 230
362 3300005844 Ga0068862_100009968 Ga0068862_1000099683 230
363 3300006186 Ga0075369_10010635 Ga0075369_100106354 230
364 3300009177 Ga0105248_10103815 Ga0105248_101038154 230
365 3300009553 Ga0105249_10068891 Ga0105249_100688914 230
366 3300015262 Ga0182007_10012367 Ga0182007_100123676 230
367 3300021327 Ga0214543_1000003 Ga0214543_1000003425 230
368 3300025263 Ga0209565_1000065 Ga0209565_1000065128 230
369 3300025273 Ga0209673_1000818 Ga0209673_100081837 230
370 3300025292 Ga0209676_1000072 Ga0209676_1000072177 230
371 3300025292 Ga0209676_1000184 Ga0209676_100018478 230
372 3300025292 Ga0209676_1000247 Ga0209676_100024794 230
373 3300025295 Ga0209564_1025384 Ga0209564_10253843 230
374 3300025297 Ga0209758_1001185 Ga0209758_100118529 230
375 3300025298 Ga0209050_1000057 Ga0209050_100005725 230
376 3300025298 Ga0209050_1000077 Ga0209050_1000077177 230
377 3300025298 Ga0209050_1000548 Ga0209050_100054841 230
378 3300025299 Ga0209256_1003381 Ga0209256_10033814 230
379 3300025303 Ga0209051_1003506 Ga0209051_100350610 230
380 3300025303 Ga0209051_1034867 Ga0209051_10348673 230
381 3300025304 Ga0209257_1000088 Ga0209257_1000088177 230
382 3300025941 Ga0207711_10075038 Ga0207711_100750384 230
383 3300025961 Ga0207712_10038029 Ga0207712_100380294 230
384 3300025972 Ga0207668_10003735 Ga0207668_1000373514 230
385 3300025986 Ga0207658_10009771 Ga0207658_100097716 230
386 3300026118 Ga0207675_100216677 Ga0207675_1002166773 230
387 3300026118 Ga0207675_100455070 Ga0207675_1004550702 230
388 3300028379 Ga0268266_10001163 Ga0268266_1000116311 230
389 3300028380 Ga0268265_10015937 Ga0268265_100159375 230
390 3300028380 Ga0268265_10151002 Ga0268265_101510024 230
391 3300028786 Ga0307517_10052593 Ga0307517_100525936 230
392 3300028794 Ga0307515_10026858 Ga0307515_100268585 230
393 3300046460 Ga0495638_0004335 Ga0495638_0004335_5094_5825 230
394 3300046460 Ga0495638_0006082 Ga0495638_0006082_6256_6990 230
395 3300046471 Ga0495650_0000045 Ga0495650_0000045_113456_114199 230
396 3300046506 Ga0495583_0000069 Ga0495583_0000069_676_1419 230
397 3300046515 Ga0495620_0033849 Ga0495620_0033849_886_1629 230
398 3300046542 Ga0495597_0002618 Ga0495597_0002618_8653_9390 230
399 3300046660 Ga0495625_0000011 Ga0495625_0000011_357967_358683 230
400 3300046689 Ga0495613_0004913 Ga0495613_0004913_338_1066 230
401 3300047469 Ga0495673_0000056 Ga0495673_0000056_193694_194410 230
402 3300047472 Ga0495686_0002660 Ga0495686_0002660_880_1596 230
403 3300048909 Ga0496106_0084941 Ga0496106_0084941_506_1222 230
404 3300048910 Ga0496107_0000515 Ga0496107_0000515_11453_12169 230
405 3300048924 Ga0496121_0000190 Ga0496121_0000190_72262_72954 230
406 3300048924 Ga0496121_0028182 Ga0496121_0028182_2688_3404 230
407 3300048924 Ga0496121_0230957 Ga0496121_0230957_540_1280 230
408 3300048927 Ga0496124_0019388 Ga0496124_0019388_2824_3603 230
409 3300048929 Ga0496126_0018537 Ga0496126_0018537_4333_5085 230
410 3300048929 Ga0496126_0027270 Ga0496126_0027270_1832_2524 230
411 3300049574 Ga0501038_0122898 Ga0501038_0122898_123_890 230
412 3300049581 Ga0501047_0010908 Ga0501047_0010908_7532_8248 230
413 3300049671 Ga0501238_000513 Ga0501238_000513_398_1141 230
414 3300049823 Ga0501044_0043037 Ga0501044_0043037_3513_4241 230
415 3300049823 Ga0501044_0672560 Ga0501044_0672560_67_783 230
416 3300050516 nmdc:mga0sz30_3064_c1 nmdc:mga0sz30_3064_c1_830_1609 230
417 3300053122 Ga0500608_000135 Ga0500608_000135_18410_19144 230
418 3300053125 Ga0500618_000178 Ga0500618_000178_22596_23339 230
419 3300053136 Ga0500559_0000031 Ga0500559_0000031_47297_48031 230
420 3300053136 Ga0500559_0000984 Ga0500559_0000984_4894_5637 230
421 3300053136 Ga0500559_0021988 Ga0500559_0021988_341_1057 230
422 3300053156 Ga0500622_0005037 Ga0500622_0005037_3148_3882 230
423 3300053156 Ga0500622_0005173 Ga0500622_0005173_4997_5713 230
424 3300053730 Ga0500645_002181 Ga0500645_002181_2764_3495 230
425 iso_pu_bacteria 2791355048 2792458920 230
426 iso_pu_bacteria 2843744320 2843749076 230
427 3300031901 Ga0307406_10205477 Ga0307406_102054771 231
428 3300032004 Ga0307414_10000536 Ga0307414_1000053614 231
429 3300048920 Ga0496117_0013436 Ga0496117_0013436_2978_3688 231
430 3300048921 Ga0496118_0004598 Ga0496118_0004598_11231_11941 231
431 3300048922 Ga0496119_0002162 Ga0496119_0002162_8015_8737 231
432 3300048923 Ga0496120_0006533 Ga0496120_0006533_2096_2818 231
433 3300048924 Ga0496121_0032836 Ga0496121_0032836_582_1304 231
434 3300048928 Ga0496125_0000488 Ga0496125_0000488_2711_3433 231
435 3300048929 Ga0496126_0011995 Ga0496126_0011995_1026_1748 231
436 3300053730 Ga0500645_001694 Ga0500645_001694_2385_3149 231
437 iso_pu_bacteria 2791355048 2792462237 231
438 3300046648 Ga0495611_0104509 Ga0495611_0104509_90_800 232
439 3300053087 Ga0500643_000203 Ga0500643_000203_24113_24853 232
440 iso_pu_bacteria 2946787523 2946790953 232
441 3300003856 Ga0058692_1030815 Ga0058692_10308152 233
442 3300006946 Ga0079104_1004220 Ga0079104_10042204 233
443 3300027111 Ga0209281_1000332 Ga0209281_100033213 233
444 3300041494 Ga0451837_1810866 Ga0451837_1810866_15_758 233
445 3300048927 Ga0496124_0175482 Ga0496124_0175482_875_1600 233
446 3300049571 Ga0501034_0473074 Ga0501034_0473074_313_1059 233
447 3300049581 Ga0501047_0001806 Ga0501047_0001806_12596_13342 233
448 3300049589 Ga0501073_0000140 Ga0501073_0000140_40430_41176 233
449 3300049742 Ga0501080_0018648 Ga0501080_0018648_3131_3877 233
450 3300053099 Ga0500654_078918 Ga0500654_078918_616_1341 233
451 3300053125 Ga0500618_000606 Ga0500618_000606_19901_20602 233
452 iso_pu_bacteria 2687453130 2687583756 233
453 3300003856 Ga0058692_1002907 Ga0058692_10029072 234
454 3300048925 Ga0496122_0031248 Ga0496122_0031248_3054_3800 234
455 3300048926 Ga0496123_0000048 Ga0496123_0000048_19660_20391 234
456 3300053079 Ga0500610_0000206 Ga0500610_0000206_12340_13053 234
457 3300005843 Ga0068860_100833691 Ga0068860_1008336911 235
458 3300025961 Ga0207712_10246841 Ga0207712_102468412 235
459 3300028381 Ga0268264_10800901 Ga0268264_108009011 235
460 3300031456 Ga0307513_10003740 Ga0307513_100037404 235
461 3300046506 Ga0495583_0034485 Ga0495583_0034485_1337_2053 235
462 3300046524 Ga0495648_0000111 Ga0495648_0000111_8936_9652 235
463 3300046660 Ga0495625_0018596 Ga0495625_0018596_2716_3432 235
464 3300046684 Ga0495669_0001020 Ga0495669_0001020_10612_11328 235
465 3300046694 Ga0495649_0026157 Ga0495649_0026157_449_1165 235
466 3300047443 Ga0495687_001844 Ga0495687_001844_12571_13287 235
467 3300053087 Ga0500643_030347 Ga0500643_030347_837_1553 235
468 3300053730 Ga0500645_000585 Ga0500645_000585_10578_11294 235
469 3300006195 Ga0075366_10177627 Ga0075366_101776273 236
470 3300015685 Ga0183369_1007 Ga0183369_1007390 236
471 3300046453 Ga0495627_000185 Ga0495627_000185_46981_47748 236
472 3300046460 Ga0495638_0002128 Ga0495638_0002128_138_914 236
473 3300046512 Ga0495610_0000101 Ga0495610_0000101_36791_37567 236
474 3300046512 Ga0495610_0142206 Ga0495610_0142206_248_1003 236
475 3300046513 Ga0495616_0000270 Ga0495616_0000270_23116_23871 236
476 3300046515 Ga0495620_0045054 Ga0495620_0045054_1097_1879 236
477 3300046519 Ga0495632_0001639 Ga0495632_0001639_11525_12280 236
478 3300046530 Ga0495654_0000018 Ga0495654_0000018_110661_111443 236
479 3300046616 Ga0495668_0117517 Ga0495668_0117517_283_1038 236
480 3300046660 Ga0495625_0004251 Ga0495625_0004251_4940_5716 236
481 3300046660 Ga0495625_0038770 Ga0495625_0038770_193_975 236
482 3300046660 Ga0495625_0038875 Ga0495625_0038875_1944_2720 236
483 3300047320 Ga0495672_0004230 Ga0495672_0004230_8291_9067 236
484 3300047472 Ga0495686_0027554 Ga0495686_0027554_2761_3516 236
485 3300047472 Ga0495686_0036965 Ga0495686_0036965_290_1045 236
486 3300049581 Ga0501047_0274153 Ga0501047_0274153_355_1080 236
487 3300050493 nmdc:mga0k408_59038_c1 nmdc:mga0k408_59038_c1_1201_1911 236
488 iso_pu_bacteria 2841911363 2841915630 236
489 iso_pu_bacteria 2841917233 2841920832 236
490 iso_pu_bacteria 2917699015 2917705606 236
491 3300001990 JGI24737J22298_10004941 JGI24737J22298_100049413 237
492 3300001990 JGI24737J22298_10008641 JGI24737J22298_100086415 237
493 3300002067 JGI24735J21928_10037938 JGI24735J21928_100379382 237
494 3300003759 Ga0055525_1000104 Ga0055525_100010453 237
495 3300003762 Ga0055542_1000037 Ga0055542_1000037222 237
496 3300003763 Ga0055529_1000042 Ga0055529_1000042222 237
497 3300005327 Ga0070658_10019655 Ga0070658_100196555 237
498 3300005331 Ga0070670_100152681 Ga0070670_1001526812 237
499 3300005339 Ga0070660_100327848 Ga0070660_1003278481 237
500 3300005344 Ga0070661_100005592 Ga0070661_1000055923 237
501 3300005356 Ga0070674_100012527 Ga0070674_1000125273 237
502 3300005366 Ga0070659_100017489 Ga0070659_1000174893 237
503 3300005457 Ga0070662_100040479 Ga0070662_1000404792 237
504 3300005564 Ga0070664_100021924 Ga0070664_1000219242 237
505 3300005577 Ga0068857_101049809 Ga0068857_1010498091 237
506 3300009174 Ga0105241_10173195 Ga0105241_101731952 237
507 3300009551 Ga0105238_10211033 Ga0105238_102110333 237
508 3300013102 Ga0157371_10000183 Ga0157371_1000018327 237
509 3300013296 Ga0157374_10432129 Ga0157374_104321292 237
510 3300017792 Ga0163161_10101478 Ga0163161_101014782 237
511 3300025230 Ga0209563_100116 Ga0209563_10011685 237
512 3300025253 Ga0209677_110133 Ga0209677_1101333 237
513 3300025254 Ga0209148_1000026 Ga0209148_1000026605 237
514 3300025272 Ga0209455_1000005 Ga0209455_10000051352 237
515 3300025901 Ga0207688_10059879 Ga0207688_100598792 237
516 3300025909 Ga0207705_10000397 Ga0207705_1000039721 237
517 3300025913 Ga0207695_10442779 Ga0207695_104427791 237
518 3300025914 Ga0207671_10167441 Ga0207671_101674412 237
519 3300025919 Ga0207657_10065059 Ga0207657_100650594 237
520 3300025919 Ga0207657_10412079 Ga0207657_104120792 237
521 3300025920 Ga0207649_10003218 Ga0207649_100032186 237
522 3300025924 Ga0207694_10005402 Ga0207694_100054025 237
523 3300025932 Ga0207690_10001443 Ga0207690_1000144318 237
524 3300025933 Ga0207706_10069138 Ga0207706_100691382 237
525 3300025937 Ga0207669_10039679 Ga0207669_100396792 237
526 3300025949 Ga0207667_10000107 Ga0207667_1000010773 237
527 3300025981 Ga0207640_10007563 Ga0207640_100075634 237
528 3300026041 Ga0207639_10020899 Ga0207639_100208994 237
529 3300026067 Ga0207678_10030255 Ga0207678_100302554 237
530 3300026078 Ga0207702_10007230 Ga0207702_100072305 237
531 3300026078 Ga0207702_10007530 Ga0207702_100075305 237
532 3300026116 Ga0207674_10087483 Ga0207674_100874833 237
533 3300026121 Ga0207683_10074155 Ga0207683_100741555 237
534 3300026142 Ga0207698_10018963 Ga0207698_100189634 237
535 3300041512 Ga0451853_0332407 Ga0451853_0332407_274_996 237
536 3300046492 Ga0495585_0001506 Ga0495585_0001506_4876_5598 237
537 3300046500 Ga0495596_0005301 Ga0495596_0005301_591_1313 237
538 3300046507 Ga0495606_0089105 Ga0495606_0089105_1006_1728 237
539 3300046518 Ga0495631_0099404 Ga0495631_0099404_273_995 237
540 3300046522 Ga0495643_0000336 Ga0495643_0000336_57610_58332 237
541 3300046522 Ga0495643_0027804 Ga0495643_0027804_2293_3015 237
542 3300046542 Ga0495597_0105938 Ga0495597_0105938_170_892 237
543 3300046558 Ga0495633_0004092 Ga0495633_0004092_5340_6062 237
544 3300046616 Ga0495668_0000325 Ga0495668_0000325_48710_49432 237
545 3300046648 Ga0495611_0020290 Ga0495611_0020290_1150_1872 237
546 3300046660 Ga0495625_0002609 Ga0495625_0002609_15340_16062 237
547 3300046660 Ga0495625_0043927 Ga0495625_0043927_638_1360 237
548 3300046660 Ga0495625_0055530 Ga0495625_0055530_1618_2340 237
549 3300047323 Ga0495683_0012468 Ga0495683_0012468_3091_3813 237
550 3300047323 Ga0495683_0030145 Ga0495683_0030145_277_999 237
551 3300047443 Ga0495687_001092 Ga0495687_001092_14923_15645 237
552 3300047445 Ga0495677_0053767 Ga0495677_0053767_381_1103 237
553 3300047470 Ga0495681_0006465 Ga0495681_0006465_1528_2250 237
554 3300048090 Ga0495615_0000006 Ga0495615_0000006_89184_89906 237
555 3300048905 Ga0496102_0000067 Ga0496102_0000067_154311_155033 237
556 3300048906 Ga0496103_0002600 Ga0496103_0002600_8671_9393 237
557 3300048907 Ga0496104_0016161 Ga0496104_0016161_6025_6747 237
558 3300048908 Ga0496105_0000662 Ga0496105_0000662_2152_2874 237
559 3300048913 Ga0496110_0058225 Ga0496110_0058225_1065_1787 237
560 3300048914 Ga0496111_0002307 Ga0496111_0002307_8890_9612 237
561 3300048915 Ga0496112_0697702 Ga0496112_0697702_60_782 237
562 3300048916 Ga0496113_0492592 Ga0496113_0492592_50_772 237
563 3300048917 Ga0496114_0040025 Ga0496114_0040025_1630_2352 237
564 3300048918 Ga0496115_0000056 Ga0496115_0000056_101649_102371 237
565 3300048919 Ga0496116_0006376 Ga0496116_0006376_1838_2560 237
566 3300048920 Ga0496117_0000114 Ga0496117_0000114_1690_2412 237
567 3300048921 Ga0496118_0000082 Ga0496118_0000082_182773_183495 237
568 3300048922 Ga0496119_0019495 Ga0496119_0019495_3070_3792 237
569 3300048924 Ga0496121_0000344 Ga0496121_0000344_1807_2529 237
570 3300048925 Ga0496122_0010005 Ga0496122_0010005_8326_9048 237
571 3300048926 Ga0496123_0025200 Ga0496123_0025200_889_1611 237
572 3300048927 Ga0496124_0000068 Ga0496124_0000068_1827_2549 237
573 3300048928 Ga0496125_0002303 Ga0496125_0002303_1824_2546 237
574 3300048929 Ga0496126_0000157 Ga0496126_0000157_1839_2561 237
575 3300049579 Ga0501043_0309235 Ga0501043_0309235_260_985 237
576 3300049582 Ga0501048_0239907 Ga0501048_0239907_53_778 237
577 3300050493 nmdc:mga0k408_80036_c1 nmdc:mga0k408_80036_c1_590_1312 237
578 3300053130 Ga0500642_0000471 Ga0500642_0000471_4706_5428 237
579 iso_pu_bacteria 2643221605 2644040957 237
580 iso_pu_bacteria 2739367664 2739652359 237
581 iso_pu_bacteria 2739367865 2740030833 237
582 iso_pu_bacteria 2808606401 2809064532 237
583 iso_pu_bacteria 2808606404 2809080557 237
584 iso_pu_bacteria 2808606405 2809084921 237
585 3300006880 Ga0075429_100208924 Ga0075429_1002089242 238
586 3300050508 nmdc:mga09592_163515_c1 nmdc:mga09592_163515_c1_489_1217 238
587 iso_pu_bacteria 2512875026 2512974772 238
588 iso_pu_bacteria 2513237089 2513603894 238
589 iso_pu_bacteria 2513237156 2513984799 238
590 iso_pu_bacteria 2513237160 2514004151 238
591 iso_pu_bacteria 2515154107 2515610215 238
592 iso_pu_bacteria 2517487022 2517567419 238
593 iso_pu_bacteria 2582581305 2585259935 238
594 iso_pu_bacteria 2751185897 2753767250 238
595 iso_pu_bacteria 2802428859 2802725820 238
596 iso_pu_bacteria 2802428860 2802731472 238
597 iso_pu_bacteria 2802428861 2802736337 238
598 iso_pu_bacteria 2802428863 2802750099 238
599 iso_pu_bacteria 2818991466 2819713795 238
600 iso_pu_bacteria 2830075706 2830078833 238
601 iso_pu_bacteria 2848297114 2848298222 238
602 iso_pu_bacteria 2876808645 2876808932 238
603 iso_pu_bacteria 2879110137 2879110278 238
604 iso_pu_bacteria 2885427238 2885429103 238
605 iso_pu_bacteria 2885429604 2885433150 238
606 iso_pu_bacteria 2894414249 2894417496 238
607 iso_pu_bacteria 2915980308 2915980963 238
608 iso_pu_bacteria 2916061851 2916064490 238
609 iso_pu_bacteria 2919704043 2919708895 238
610 iso_pu_bacteria 2921250672 2921251303 238
611 iso_pu_bacteria 2936996657 2937000765 238
612 iso_pu_bacteria 2937029754 2937035893 238
613 iso_pu_bacteria 2937036028 2937036359 238
614 iso_pu_bacteria 2937078374 2937084741 238
615 iso_pu_bacteria 2937084907 2937086888 238
616 iso_pu_bacteria 2941485952 2941486494 238
617 iso_pu_bacteria 2941499720 2941506422 238
618 iso_pu_bacteria 2957375807 2957375998 238
619 iso_pu_bacteria 2957415311 2957419369 238
620 iso_pu_bacteria 2957415311 2957421810 238
621 iso_pu_bacteria 2957437181 2957439587 238
622 iso_pu_bacteria 2957443900 2957450504 238
623 iso_pu_bacteria 2957457609 2957463576 238
624 iso_pu_bacteria 2960591022 2960592469 238
625 iso_pu_bacteria 2960617483 2960622637 238
626 iso_pu_bacteria 2960631154 2960636146 238
627 iso_pu_bacteria 2960660292 2960666751 238
628 iso_pu_bacteria 2960680706 2960681106 238
629 iso_pu_bacteria 2960693952 2960694106 238
630 iso_pu_bacteria 2964643177 2964646037 238
631 iso_pu_bacteria 2967686174 2967692032 238
632 iso_pu_bacteria 2967728569 2967731364 238
633 iso_pu_bacteria 2967735183 2967740159 238
634 iso_pu_bacteria 2967742019 2967742200 238
635 iso_pu_bacteria 2970026789 2970029635 238
636 iso_pu_bacteria 2970122695 2970124152 238
637 iso_pu_bacteria 2970143518 2970144954 238
638 iso_pu_bacteria 2977523885 2977528876 238
639 iso_pu_bacteria 2977530762 2977537306 238
640 iso_pu_bacteria 2977544691 2977550078 238
641 iso_pu_bacteria 2990265787 2990269394 238
642 iso_pu_bacteria 2993693658 2993697504 238
643 iso_pu_bacteria 8003999396 8004006137 238
644 iso_pu_bacteria 8054302542 8054305125 238
645 iso_pu_bacteria 8056673599 8056679075 238
646 3300002774 JGI25150J39212_1000369 JGI25150J39212_100036919 239
647 3300003215 JGI25153J46596_10000124 JGI25153J46596_1000012422 239
648 3300003781 Ga0055536_1046923 Ga0055536_10469231 239
649 3300003791 Ga0055530_10014423 Ga0055530_100144233 239
650 3300003791 Ga0055530_10018168 Ga0055530_100181683 239
651 3300003792 Ga0055540_1001358 Ga0055540_10013589 239
652 3300003794 Ga0055531_10022413 Ga0055531_100224133 239
653 3300003794 Ga0055531_10022508 Ga0055531_100225083 239
654 3300025245 Ga0207425_1000022 Ga0207425_100002228 239
655 3300025258 Ga0209129_1001190 Ga0209129_100119012 239
656 3300025292 Ga0209676_1019584 Ga0209676_10195844 239
657 3300025292 Ga0209676_1024680 Ga0209676_10246801 239
658 3300025294 Ga0209025_1000326 Ga0209025_100032625 239
659 3300025297 Ga0209758_1000004 Ga0209758_1000004655 239
660 3300025298 Ga0209050_1000001 Ga0209050_10000012620 239
661 3300025298 Ga0209050_1016408 Ga0209050_10164084 239
662 3300025303 Ga0209051_1000303 Ga0209051_10003037 239
663 3300025304 Ga0209257_1001686 Ga0209257_10016863 239
664 3300025304 Ga0209257_1020328 Ga0209257_10203284 239
665 3300048905 Ga0496102_0568457 Ga0496102_0568457_282_1019 239
666 iso_pu_bacteria 2524023250 2524614013 239
667 iso_pu_bacteria 2599185354 2600200418 239
668 iso_pu_bacteria 2739367664 2739649610 239
669 iso_pu_bacteria 2739367865 2740028083 239
670 iso_pu_bacteria 2919138771 2919140636 239
671 iso_pu_bacteria 2928968154 2928969803 239
672 3300006038 Ga0075365_10012014 Ga0075365_100120143 240
673 3300006051 Ga0075364_10000022 Ga0075364_100000225 240
674 3300006186 Ga0075369_10000533 Ga0075369_1000053312 240
675 3300009545 Ga0105237_10004065 Ga0105237_1000406514 240
676 3300009545 Ga0105237_10339863 Ga0105237_103398632 240
677 3300025914 Ga0207671_10001440 Ga0207671_1000144020 240
678 3300046471 Ga0495650_0000862 Ga0495650_0000862_6738_7478 240
679 3300046557 Ga0495622_0047054 Ga0495622_0047054_1099_1839 240
680 3300048090 Ga0495615_0000056 Ga0495615_0000056_1448_2191 240
681 3300048924 Ga0496121_0000021 Ga0496121_0000021_466095_466826 240
682 3300049759 Ga0501262_002548 Ga0501262_002548_586_1332 240
683 3300050491 nmdc:mga00v17_91_c1 nmdc:mga00v17_91_c1_48985_49737 240
684 3300050492 nmdc:mga0yw44_727_c2 nmdc:mga0yw44_727_c2_7374_8126 240
685 3300050516 nmdc:mga0sz30_34_c1 nmdc:mga0sz30_34_c1_27328_28080 240
686 iso_pu_bacteria 2643221541 2643729558 240
687 iso_pu_bacteria 2643221606 2644043915 240
688 iso_pu_bacteria 2643221671 2644392386 240
689 3300003771 Ga0055526_1003257 Ga0055526_10032579 241
690 3300005578 Ga0068854_100014957 Ga0068854_1000149575 241
691 3300005618 Ga0068864_100017949 Ga0068864_1000179496 241
692 3300006353 Ga0075370_10118177 Ga0075370_101181771 241
693 3300014968 Ga0157379_10305126 Ga0157379_103051262 241
694 3300025228 Ga0209672_101064 Ga0209672_10106412 241
695 3300025295 Ga0209564_1004449 Ga0209564_10044496 241
696 3300025297 Ga0209758_1026850 Ga0209758_10268504 241
697 3300025981 Ga0207640_10013814 Ga0207640_100138145 241
698 3300026095 Ga0207676_10009756 Ga0207676_100097568 241
699 3300031911 Ga0307412_10380078 Ga0307412_103800781 241
700 3300037466 Ga0395898_0036347 Ga0395898_0036347_3360_4130 241
701 3300046507 Ga0495606_0255917 Ga0495606_0255917_197_940 241
702 3300046522 Ga0495643_0034028 Ga0495643_0034028_252_995 241
703 3300046542 Ga0495597_0024054 Ga0495597_0024054_1781_2524 241
704 3300046616 Ga0495668_0143886 Ga0495668_0143886_197_940 241
705 3300047472 Ga0495686_0003856 Ga0495686_0003856_4110_4853 241
706 3300048903 Ga0496100_0580091 Ga0496100_0580091_88_831 241
707 3300048928 Ga0496125_0004268 Ga0496125_0004268_174_914 241
708 3300053091 Ga0500647_0014019 Ga0500647_0014019_1189_1932 241
709 3300053093 Ga0500651_0004291 Ga0500651_0004291_4837_5580 241
710 3300053096 Ga0500641_0001855 Ga0500641_0001855_4906_5649 241
711 3300053098 Ga0500650_0170650 Ga0500650_0170650_183_926 241
712 3300053130 Ga0500642_0031645 Ga0500642_0031645_508_1251 241
713 3300053133 Ga0500655_000055 Ga0500655_000055_952_1695 241
714 3300053133 Ga0500655_017095 Ga0500655_017095_540_1283 241
715 3300053136 Ga0500559_0008942 Ga0500559_0008942_2524_3258 241
716 3300053139 Ga0500568_0069966 Ga0500568_0069966_163_903 241
717 3300053148 Ga0500590_000433 Ga0500590_000433_10774_11517 241
718 3300053151 Ga0500604_0000520 Ga0500604_0000520_726_1466 241
719 3300053156 Ga0500622_0005293 Ga0500622_0005293_3093_3836 241
720 3300053157 Ga0500624_000002 Ga0500624_000002_126720_127460 241
721 3300053163 Ga0500639_101614 Ga0500639_101614_388_1131 241
722 3300053724 Ga0500570_006654 Ga0500570_006654_3599_4342 241
723 3300055283 Ga0500661_000033 Ga0500661_000033_6734_7471 241
724 2162886007 SwRhRL2b_contig_1901739 SwRhRL2b_0828.00007060 242
725 3300001979 JGI24740J21852_10009449 JGI24740J21852_100094493 242
726 3300001989 JGI24739J22299_10005502 JGI24739J22299_100055022 242
727 3300001990 JGI24737J22298_10006147 JGI24737J22298_100061473 242
728 3300002067 JGI24735J21928_10006314 JGI24735J21928_100063146 242
729 3300002075 JGI24738J21930_10002762 JGI24738J21930_100027622 242
730 3300002075 JGI24738J21930_10023083 JGI24738J21930_100230832 242
731 3300003323 rootH1_10160732 rootH1_101607328 242
732 3300003758 Ga0055532_1004520 Ga0055532_10045202 242
733 3300003791 Ga0055530_10005341 Ga0055530_100053416 242
734 3300005289 Ga0065704_10000204 Ga0065704_10000204107 242
735 3300005289 Ga0065704_10211406 Ga0065704_102114062 242
736 3300005327 Ga0070658_10012637 Ga0070658_100126378 242
737 3300005344 Ga0070661_100136756 Ga0070661_1001367562 242
738 3300005355 Ga0070671_100219745 Ga0070671_1002197452 242
739 3300005367 Ga0070667_100000429 Ga0070667_10000042941 242
740 3300005466 Ga0070685_10077215 Ga0070685_100772152 242
741 3300005539 Ga0068853_100096300 Ga0068853_1000963004 242
742 3300005563 Ga0068855_100073172 Ga0068855_1000731722 242
743 3300005563 Ga0068855_100338275 Ga0068855_1003382752 242
744 3300005564 Ga0070664_100115685 Ga0070664_1001156852 242
745 3300005614 Ga0068856_100479732 Ga0068856_1004797322 242
746 3300005841 Ga0068863_100043382 Ga0068863_1000433824 242
747 3300005843 Ga0068860_100000573 Ga0068860_10000057340 242
748 3300006028 Ga0070717_10307434 Ga0070717_103074342 242
749 3300006042 Ga0075368_10000214 Ga0075368_100002148 242
750 3300006042 Ga0075368_10000330 Ga0075368_100003306 242
751 3300006048 Ga0075363_100036200 Ga0075363_1000362004 242
752 3300006178 Ga0075367_10002007 Ga0075367_100020072 242
753 3300006178 Ga0075367_10003779 Ga0075367_100037798 242
754 3300006178 Ga0075367_10061128 Ga0075367_100611282 242
755 3300006353 Ga0075370_10004824 Ga0075370_100048248 242
756 3300006353 Ga0075370_10027640 Ga0075370_100276404 242
757 3300006946 Ga0079104_1045489 Ga0079104_10454892 242
758 3300009011 Ga0105251_10018057 Ga0105251_100180572 242
759 3300009093 Ga0105240_10030854 Ga0105240_100308547 242
760 3300009093 Ga0105240_10414549 Ga0105240_104145491 242
761 3300009174 Ga0105241_10012879 Ga0105241_100128793 242
762 3300009545 Ga0105237_10065031 Ga0105237_100650311 242
763 3300009553 Ga0105249_10003624 Ga0105249_100036247 242
764 3300010375 Ga0105239_10000385 Ga0105239_1000038510 242
765 3300010375 Ga0105239_10584241 Ga0105239_105842412 242
766 3300013100 Ga0157373_10038189 Ga0157373_100381895 242
767 3300013100 Ga0157373_10530797 Ga0157373_105307971 242
768 3300013104 Ga0157370_10017512 Ga0157370_100175122 242
769 3300013105 Ga0157369_10063890 Ga0157369_100638903 242
770 3300013105 Ga0157369_10440589 Ga0157369_104405892 242
771 3300013105 Ga0157369_10488566 Ga0157369_104885662 242
772 3300013306 Ga0163162_10077504 Ga0163162_100775043 242
773 3300013306 Ga0163162_10655526 Ga0163162_106555261 242
774 3300015690 Ga0183363_1009 Ga0183363_1009139 242
775 3300017792 Ga0163161_10001715 Ga0163161_100017159 242
776 3300017792 Ga0163161_10029808 Ga0163161_100298083 242
777 3300022739 Ga0228711_1020746 Ga0228711_10207461 242
778 3300022740 Ga0228710_1022297 Ga0228710_10222971 242
779 3300025229 Ga0209147_100205 Ga0209147_10020536 242
780 3300025298 Ga0209050_1000402 Ga0209050_100040264 242
781 3300025304 Ga0209257_1016515 Ga0209257_10165155 242
782 3300025904 Ga0207647_10052205 Ga0207647_100522053 242
783 3300025911 Ga0207654_10024820 Ga0207654_100248201 242
784 3300025913 Ga0207695_10008826 Ga0207695_1000882617 242
785 3300025913 Ga0207695_10164752 Ga0207695_101647522 242
786 3300025914 Ga0207671_10016082 Ga0207671_100160822 242
787 3300025920 Ga0207649_10236072 Ga0207649_102360722 242
788 3300025924 Ga0207694_10060062 Ga0207694_100600621 242
789 3300025931 Ga0207644_10169376 Ga0207644_101693762 242
790 3300025949 Ga0207667_10011452 Ga0207667_100114521 242
791 3300025949 Ga0207667_10490866 Ga0207667_104908662 242
792 3300025961 Ga0207712_10004353 Ga0207712_100043534 242
793 3300025986 Ga0207658_10000368 Ga0207658_1000036840 242
794 3300026041 Ga0207639_10002138 Ga0207639_100021384 242
795 3300026067 Ga0207678_10002748 Ga0207678_1000274811 242
796 3300026078 Ga0207702_10005233 Ga0207702_1000523310 242
797 3300026088 Ga0207641_10027348 Ga0207641_100273487 242
798 3300027111 Ga0209281_1000360 Ga0209281_100036025 242
799 3300027111 Ga0209281_1033727 Ga0209281_10337271 242
800 3300027666 Ga0209282_1000060 Ga0209282_100006063 242
801 3300027866 Ga0209813_10000038 Ga0209813_1000003848 242
802 3300027866 Ga0209813_10000092 Ga0209813_100000925 242
803 3300028381 Ga0268264_10000582 Ga0268264_1000058240 242
804 3300028786 Ga0307517_10021522 Ga0307517_100215224 242
805 3300031251 Ga0265327_10138513 Ga0265327_101385131 242
806 3300031507 Ga0307509_10002287 Ga0307509_1000228712 242
807 3300031548 Ga0307408_100174792 Ga0307408_1001747921 242
808 3300031730 Ga0307516_10086960 Ga0307516_100869603 242
809 3300031730 Ga0307516_10175613 Ga0307516_101756132 242
810 3300031824 Ga0307413_10077624 Ga0307413_100776241 242
811 3300031852 Ga0307410_10131729 Ga0307410_101317292 242
812 3300031911 Ga0307412_10019961 Ga0307412_100199612 242
813 3300031911 Ga0307412_10061744 Ga0307412_100617442 242
814 3300031967 Ga0315914_1000121 Ga0315914_100012163 242
815 3300032002 Ga0307416_100153428 Ga0307416_1001534283 242
816 3300032002 Ga0307416_100697871 Ga0307416_1006978711 242
817 3300032004 Ga0307414_10022530 Ga0307414_100225305 242
818 3300032004 Ga0307414_10104516 Ga0307414_101045162 242
819 3300032004 Ga0307414_10249936 Ga0307414_102499362 242
820 3300032005 Ga0307411_10466043 Ga0307411_104660431 242
821 3300032126 Ga0307415_100902000 Ga0307415_1009020001 242
822 3300033430 Ga0315913_1000046 Ga0315913_100004619 242
823 3300033464 Ga0315915_1000004 Ga0315915_1000004345 242
824 3300039437 Ga0436365_0654829 Ga0436365_0654829_4321_5073 242
825 3300041413 Ga0439465_0141468 Ga0439465_0141468_31_798 242
826 3300042007 Ga0439449_0008122 Ga0439449_0008122_2257_3012 242
827 3300046453 Ga0495627_000103 Ga0495627_000103_23361_24107 242
828 3300046471 Ga0495650_0001034 Ga0495650_0001034_14242_14988 242
829 3300046471 Ga0495650_0005530 Ga0495650_0005530_7188_7940 242
830 3300046500 Ga0495596_0000171 Ga0495596_0000171_6306_7061 242
831 3300046500 Ga0495596_0001194 Ga0495596_0001194_8042_8788 242
832 3300046506 Ga0495583_0043219 Ga0495583_0043219_1296_2042 242
833 3300046512 Ga0495610_0000013 Ga0495610_0000013_33929_34675 242
834 3300046515 Ga0495620_0039025 Ga0495620_0039025_53_799 242
835 3300046538 Ga0495609_0074614 Ga0495609_0074614_703_1455 242
836 3300046660 Ga0495625_0002714 Ga0495625_0002714_14190_14933 242
837 3300046665 Ga0495661_0066993 Ga0495661_0066993_1188_1940 242
838 3300046665 Ga0495661_0119451 Ga0495661_0119451_150_926 242
839 3300047470 Ga0495681_0000174 Ga0495681_0000174_7027_7773 242
840 3300047470 Ga0495681_0005853 Ga0495681_0005853_7188_7940 242
841 3300047472 Ga0495686_0000057 Ga0495686_0000057_73602_74345 242
842 3300047472 Ga0495686_0000808 Ga0495686_0000808_30177_30920 242
843 3300047472 Ga0495686_0000944 Ga0495686_0000944_24940_25683 242
844 3300047472 Ga0495686_0016945 Ga0495686_0016945_2495_3241 242
845 3300048090 Ga0495615_0000022 Ga0495615_0000022_35876_36622 242
846 3300048903 Ga0496100_0004363 Ga0496100_0004363_2255_2986 242
847 3300048904 Ga0496101_0000647 Ga0496101_0000647_17382_18113 242
848 3300048904 Ga0496101_0414580 Ga0496101_0414580_293_1039 242
849 3300048909 Ga0496106_0068882 Ga0496106_0068882_370_1101 242
850 3300048910 Ga0496107_0000136 Ga0496107_0000136_21460_22191 242
851 3300048920 Ga0496117_0026934 Ga0496117_0026934_3362_4105 242
852 3300048921 Ga0496118_0014789 Ga0496118_0014789_3891_4634 242
853 3300048924 Ga0496121_0002392 Ga0496121_0002392_18219_18965 242
854 3300048924 Ga0496121_0009736 Ga0496121_0009736_7063_7806 242
855 3300048925 Ga0496122_0004042 Ga0496122_0004042_12030_12776 242
856 3300048925 Ga0496122_0004742 Ga0496122_0004742_13523_14287 242
857 3300048925 Ga0496122_0008010 Ga0496122_0008010_2398_3144 242
858 3300048925 Ga0496122_0021500 Ga0496122_0021500_4045_4788 242
859 3300048925 Ga0496122_0078878 Ga0496122_0078878_1014_1769 242
860 3300048926 Ga0496123_0000643 Ga0496123_0000643_43994_44758 242
861 3300048926 Ga0496123_0002078 Ga0496123_0002078_17697_18443 242
862 3300048926 Ga0496123_0013351 Ga0496123_0013351_1637_2380 242
863 3300048926 Ga0496123_0017198 Ga0496123_0017198_3432_4178 242
864 3300048927 Ga0496124_0003193 Ga0496124_0003193_11133_11879 242
865 3300048927 Ga0496124_0006400 Ga0496124_0006400_8575_9339 242
866 3300048927 Ga0496124_0056514 Ga0496124_0056514_2486_3226 242
867 3300048927 Ga0496124_0061695 Ga0496124_0061695_2224_2979 242
868 3300048928 Ga0496125_0070822 Ga0496125_0070822_314_1069 242
869 3300048928 Ga0496125_0102467 Ga0496125_0102467_719_1465 242
870 3300049568 Ga0501031_0011456 Ga0501031_0011456_3716_4483 242
871 3300049570 Ga0501033_0064704 Ga0501033_0064704_1275_2042 242
872 3300049571 Ga0501034_0028660 Ga0501034_0028660_1259_2026 242
873 3300049579 Ga0501043_0210689 Ga0501043_0210689_536_1303 242
874 3300049822 Ga0501035_0092439 Ga0501035_0092439_477_1244 242
875 3300049823 Ga0501044_0105330 Ga0501044_0105330_1148_1915 242
876 3300050494 nmdc:mga06z11_41_c1 nmdc:mga06z11_41_c1_45229_45975 242
877 3300050494 nmdc:mga06z11_48_c1 nmdc:mga06z11_48_c1_49669_50421 242
878 3300050494 nmdc:mga06z11_60931_c1 nmdc:mga06z11_60931_c1_1147_1893 242
879 3300050495 nmdc:mga04h51_27_c1 nmdc:mga04h51_27_c1_7142_7888 242
880 3300050495 nmdc:mga04h51_57_c1 nmdc:mga04h51_57_c1_30679_31431 242
881 3300050496 nmdc:mga07m45_22856_c1 nmdc:mga07m45_22856_c1_1404_2156 242
882 3300050496 nmdc:mga07m45_2787_c1 nmdc:mga07m45_2787_c1_6234_6980 242
883 3300053077 Ga0495601_0046860 Ga0495601_0046860_1587_2327 242
884 3300053085 Ga0495619_0066359 Ga0495619_0066359_1233_1973 242
885 3300053090 Ga0500646_0007574 Ga0500646_0007574_352_1095 242
886 3300053093 Ga0500651_0000062 Ga0500651_0000062_66444_67196 242
887 3300053094 Ga0500566_0000824 Ga0500566_0000824_14648_15391 242
888 3300053094 Ga0500566_0022100 Ga0500566_0022100_1527_2270 242
889 3300053094 Ga0500566_0076541 Ga0500566_0076541_686_1429 242
890 3300053116 Ga0500592_019210 Ga0500592_019210_251_994 242
891 3300053119 Ga0500595_002188 Ga0500595_002188_4958_5701 242
892 3300053119 Ga0500595_021474 Ga0500595_021474_163_903 242
893 3300053123 Ga0500614_000155 Ga0500614_000155_9300_10043 242
894 3300053136 Ga0500559_0003462 Ga0500559_0003462_1896_2660 242
895 3300053136 Ga0500559_0220483 Ga0500559_0220483_93_848 242
896 3300053150 Ga0500603_000737 Ga0500603_000737_2243_2986 242
897 3300061734 Ga0530510_0211114 Ga0530510_0211114_589_1356 242
898 iso_pu_bacteria 2852653556 2852656984 242
899 3300001979 JGI24740J21852_10024760 JGI24740J21852_100247603 243
900 3300001989 JGI24739J22299_10013439 JGI24739J22299_100134392 243
901 3300001990 JGI24737J22298_10036595 JGI24737J22298_100365952 243
902 3300002067 JGI24735J21928_10000694 JGI24735J21928_100006946 243
903 3300002075 JGI24738J21930_10004350 JGI24738J21930_100043505 243
904 3300003758 Ga0055532_1003824 Ga0055532_10038244 243
905 3300003781 Ga0055536_1000616 Ga0055536_100061620 243
906 3300003781 Ga0055536_1002431 Ga0055536_100243112 243
907 3300003781 Ga0055536_1004304 Ga0055536_10043047 243
908 3300003791 Ga0055530_10004849 Ga0055530_100048496 243
909 3300003794 Ga0055531_10002825 Ga0055531_100028254 243
910 3300003794 Ga0055531_10004227 Ga0055531_100042279 243
911 3300005262 Ga0065165_1008723 Ga0065165_10087234 243
912 3300005457 Ga0070662_100015566 Ga0070662_1000155667 243
913 3300005539 Ga0068853_100005287 Ga0068853_1000052876 243
914 3300005548 Ga0070665_100071210 Ga0070665_1000712102 243
915 3300005577 Ga0068857_100029220 Ga0068857_1000292204 243
916 3300005578 Ga0068854_100037728 Ga0068854_1000377286 243
917 3300005617 Ga0068859_100001448 Ga0068859_10000144825 243
918 3300005719 Ga0068861_100001768 Ga0068861_1000017689 243
919 3300005844 Ga0068862_100008954 Ga0068862_1000089548 243
920 3300006038 Ga0075365_10002570 Ga0075365_100025708 243
921 3300006038 Ga0075365_10455720 Ga0075365_104557201 243
922 3300006042 Ga0075368_10000158 Ga0075368_100001584 243
923 3300006042 Ga0075368_10000190 Ga0075368_1000019012 243
924 3300006048 Ga0075363_100000005 Ga0075363_10000000552 243
925 3300006048 Ga0075363_100017140 Ga0075363_1000171404 243
926 3300006048 Ga0075363_100083720 Ga0075363_1000837201 243
927 3300006051 Ga0075364_10000003 Ga0075364_1000000379 243
928 3300006058 Ga0075432_10003631 Ga0075432_100036315 243
929 3300006177 Ga0075362_10000118 Ga0075362_100001186 243
930 3300006178 Ga0075367_10001760 Ga0075367_100017606 243
931 3300006178 Ga0075367_10014566 Ga0075367_100145663 243
932 3300006186 Ga0075369_10001184 Ga0075369_1000118412 243
933 3300006186 Ga0075369_10002521 Ga0075369_100025218 243
934 3300006195 Ga0075366_10025738 Ga0075366_100257383 243
935 3300006195 Ga0075366_10113625 Ga0075366_101136252 243
936 3300006195 Ga0075366_10200046 Ga0075366_102000462 243
937 3300006353 Ga0075370_10000006 Ga0075370_10000006108 243
938 3300006353 Ga0075370_10003734 Ga0075370_100037343 243
939 3300006353 Ga0075370_10027468 Ga0075370_100274683 243
940 3300006931 Ga0097620_100001448 Ga0097620_10000144825 243
941 3300009011 Ga0105251_10069781 Ga0105251_100697812 243
942 3300009177 Ga0105248_10059186 Ga0105248_100591863 243
943 3300009177 Ga0105248_10299391 Ga0105248_102993912 243
944 3300013100 Ga0157373_10085510 Ga0157373_100855102 243
945 3300013105 Ga0157369_10285001 Ga0157369_102850012 243
946 3300013306 Ga0163162_10053910 Ga0163162_100539105 243
947 3300017792 Ga0163161_10447814 Ga0163161_104478142 243
948 3300025229 Ga0209147_100558 Ga0209147_1005582 243
949 3300025229 Ga0209147_100607 Ga0209147_10060718 243
950 3300025229 Ga0209147_108381 Ga0209147_1083812 243
951 3300025292 Ga0209676_1000060 Ga0209676_1000060224 243
952 3300025292 Ga0209676_1000297 Ga0209676_10002977 243
953 3300025292 Ga0209676_1001039 Ga0209676_100103932 243
954 3300025298 Ga0209050_1000622 Ga0209050_100062242 243
955 3300025304 Ga0209257_1001450 Ga0209257_10014508 243
956 3300025304 Ga0209257_1002690 Ga0209257_10026909 243
957 3300025924 Ga0207694_10036765 Ga0207694_100367656 243
958 3300025933 Ga0207706_10007581 Ga0207706_100075818 243
959 3300025941 Ga0207711_10034224 Ga0207711_100342242 243
960 3300025941 Ga0207711_10165342 Ga0207711_101653422 243
961 3300025972 Ga0207668_10003517 Ga0207668_100035176 243
962 3300025981 Ga0207640_10200657 Ga0207640_102006571 243
963 3300025986 Ga0207658_10631176 Ga0207658_106311761 243
964 3300026041 Ga0207639_10009537 Ga0207639_100095374 243
965 3300026116 Ga0207674_10002464 Ga0207674_1000246424 243
966 3300026118 Ga0207675_100000016 Ga0207675_10000001648 243
967 3300027866 Ga0209813_10000022 Ga0209813_1000002264 243
968 3300027866 Ga0209813_10000105 Ga0209813_100001054 243
969 3300027907 Ga0207428_10013576 Ga0207428_100135768 243
970 3300028379 Ga0268266_10253345 Ga0268266_102533452 243
971 3300028380 Ga0268265_10012328 Ga0268265_100123287 243
972 3300028380 Ga0268265_10727088 Ga0268265_107270881 243
973 3300031548 Ga0307408_100223793 Ga0307408_1002237931 243
974 3300031995 Ga0307409_100176956 Ga0307409_1001769562 243
975 3300032004 Ga0307414_10001051 Ga0307414_1000105110 243
976 3300032004 Ga0307414_10021372 Ga0307414_100213724 243
977 3300032004 Ga0307414_10361613 Ga0307414_103616132 243
978 3300041406 Ga0439439_0002567 Ga0439439_0002567_2697_3446 243
979 3300041509 Ga0451843_0511461 Ga0451843_0511461_418_1158 243
980 3300041997 Ga0439431_0007141 Ga0439431_0007141_565_1314 243
981 3300042004 Ga0439445_0033116 Ga0439445_0033116_547_1296 243
982 3300042435 Ga0439434_0102338 Ga0439434_0102338_162_911 243
983 3300045051 Ga0451576_0000053 Ga0451576_0000053_138303_139043 243
984 3300046460 Ga0495638_0000021 Ga0495638_0000021_3551_4300 243
985 3300046506 Ga0495583_0000184 Ga0495583_0000184_42271_43020 243
986 3300046507 Ga0495606_0008550 Ga0495606_0008550_3976_4734 243
987 3300046512 Ga0495610_0002639 Ga0495610_0002639_7413_8153 243
988 3300046513 Ga0495616_0176222 Ga0495616_0176222_153_902 243
989 3300046519 Ga0495632_0001694 Ga0495632_0001694_3553_4302 243
990 3300046522 Ga0495643_0044552 Ga0495643_0044552_1621_2370 243
991 3300046522 Ga0495643_0114051 Ga0495643_0114051_111_869 243
992 3300046524 Ga0495648_0000026 Ga0495648_0000026_3523_4272 243
993 3300046524 Ga0495648_0048047 Ga0495648_0048047_465_1211 243
994 3300046524 Ga0495648_0049703 Ga0495648_0049703_1598_2353 243
995 3300046524 Ga0495648_0067184 Ga0495648_0067184_513_1253 243
996 3300046525 Ga0495663_0052964 Ga0495663_0052964_109_849 243
997 3300046557 Ga0495622_0097704 Ga0495622_0097704_347_1093 243
998 3300046692 Ga0495671_0000050 Ga0495671_0000050_137701_138450 243
999 3300046692 Ga0495671_0021372 Ga0495671_0021372_1268_2023 243
1000 3300047469 Ga0495673_0000125 Ga0495673_0000125_3488_4237 243
1001 3300047469 Ga0495673_0020024 Ga0495673_0020024_930_1670 243
1002 3300047470 Ga0495681_0000036 Ga0495681_0000036_7596_8336 243
1003 3300047472 Ga0495686_0028511 Ga0495686_0028511_254_994 243
1004 3300048090 Ga0495615_0000009 Ga0495615_0000009_27455_28204 243
1005 3300048906 Ga0496103_0276162 Ga0496103_0276162_277_1026 243
1006 3300048921 Ga0496118_0001437 Ga0496118_0001437_29875_30654 243
1007 3300048923 Ga0496120_0048673 Ga0496120_0048673_1501_2256 243
1008 3300048924 Ga0496121_0000721 Ga0496121_0000721_31300_32061 243
1009 3300048925 Ga0496122_0001343 Ga0496122_0001343_14249_14998 243
1010 3300048926 Ga0496123_0000300 Ga0496123_0000300_32106_32855 243
1011 3300048926 Ga0496123_0065530 Ga0496123_0065530_270_1010 243
1012 3300048927 Ga0496124_0119858 Ga0496124_0119858_695_1447 243
1013 3300048928 Ga0496125_0012254 Ga0496125_0012254_2021_2773 243
1014 3300048928 Ga0496125_0159962 Ga0496125_0159962_499_1251 243
1015 3300049569 Ga0501032_0010834 Ga0501032_0010834_5574_6320 243
1016 3300049569 Ga0501032_0027261 Ga0501032_0027261_3152_3907 243
1017 3300049570 Ga0501033_0005862 Ga0501033_0005862_6033_6788 243
1018 3300049570 Ga0501033_0029586 Ga0501033_0029586_3145_3891 243
1019 3300049570 Ga0501033_0131204 Ga0501033_0131204_919_1674 243
1020 3300049571 Ga0501034_0092516 Ga0501034_0092516_747_1502 243
1021 3300049571 Ga0501034_0186316 Ga0501034_0186316_1249_1995 243
1022 3300049575 Ga0501039_0266539 Ga0501039_0266539_193_966 243
1023 3300049581 Ga0501047_0000307 Ga0501047_0000307_31025_31771 243
1024 3300049582 Ga0501048_0063616 Ga0501048_0063616_711_1457 243
1025 3300049663 Ga0501223_000007 Ga0501223_000007_97356_98126 243
1026 3300049676 Ga0501246_000376 Ga0501246_000376_1582_2352 243
1027 3300049679 Ga0501249_000267 Ga0501249_000267_2982_3734 243
1028 3300049679 Ga0501249_000588 Ga0501249_000588_6386_7141 243
1029 3300049705 Ga0501225_0000010 Ga0501225_0000010_10980_11750 243
1030 3300049758 Ga0501241_001086 Ga0501241_001086_522_1358 243
1031 3300049822 Ga0501035_0004268 Ga0501035_0004268_4698_5453 243
1032 3300049822 Ga0501035_0102217 Ga0501035_0102217_1003_1749 243
1033 3300049823 Ga0501044_0000109 Ga0501044_0000109_43987_44742 243
1034 3300049823 Ga0501044_0000453 Ga0501044_0000453_20088_20837 243
1035 3300050490 nmdc:mga03n38_68_c1 nmdc:mga03n38_68_c1_13515_14279 243
1036 3300050490 nmdc:mga03n38_71089_c1 nmdc:mga03n38_71089_c1_843_1583 243
1037 3300050491 nmdc:mga00v17_9_c1 nmdc:mga00v17_9_c1_21970_22734 243
1038 3300050492 nmdc:mga0yw44_452865_c1 nmdc:mga0yw44_452865_c1_33_773 243
1039 3300050492 nmdc:mga0yw44_567_c1 nmdc:mga0yw44_567_c1_7197_7961 243
1040 3300050493 nmdc:mga0k408_156526_c1 nmdc:mga0k408_156526_c1_60_818 243
1041 3300050493 nmdc:mga0k408_28620_c1 nmdc:mga0k408_28620_c1_202_951 243
1042 3300050493 nmdc:mga0k408_415_c1 nmdc:mga0k408_415_c1_13276_14076 243
1043 3300050494 nmdc:mga06z11_3_c1 nmdc:mga06z11_3_c1_69709_70509 243
1044 3300050494 nmdc:mga06z11_71_c1 nmdc:mga06z11_71_c1_2166_2906 243
1045 3300050495 nmdc:mga04h51_43_c1 nmdc:mga04h51_43_c1_39450_40190 243
1046 3300050495 nmdc:mga04h51_5_c1 nmdc:mga04h51_5_c1_124268_125032 243
1047 3300050496 nmdc:mga07m45_18_c1 nmdc:mga07m45_18_c1_21979_22743 243
1048 3300050496 nmdc:mga07m45_26825_c1 nmdc:mga07m45_26825_c1_1424_2182 243
1049 3300050516 nmdc:mga0sz30_271_c1 nmdc:mga0sz30_271_c1_17450_18190 243
1050 3300050516 nmdc:mga0sz30_397_c1 nmdc:mga0sz30_397_c1_15700_16464 243
1051 3300053116 Ga0500592_016490 Ga0500592_016490_154_912 243
1052 3300053119 Ga0500595_004324 Ga0500595_004324_3785_4531 243
1053 3300053121 Ga0500607_000293 Ga0500607_000293_28389_29138 243
1054 3300053122 Ga0500608_000353 Ga0500608_000353_6484_7245 243
1055 3300053123 Ga0500614_023077 Ga0500614_023077_119_880 243
1056 3300053125 Ga0500618_000707 Ga0500618_000707_8486_9244 243
1057 3300053136 Ga0500559_0000879 Ga0500559_0000879_2183_2923 243
1058 3300053140 Ga0500573_0047098 Ga0500573_0047098_772_1533 243
1059 3300053158 Ga0500627_0000020 Ga0500627_0000020_106540_107298 243
1060 3300053178 Ga0500637_0004224 Ga0500637_0004224_4811_5563 243
1061 3300053729 Ga0500625_000007 Ga0500625_000007_87041_87802 243
1062 3300053730 Ga0500645_014440 Ga0500645_014440_57_806 243
1063 iso_pu_bacteria 2643221563 2643832609 243
1064 iso_pu_bacteria 2643221563 2643834711 243
1065 iso_pu_bacteria 2643221608 2644053596 243
1066 iso_pu_bacteria 2643221608 2644055638 243
1067 iso_pu_bacteria 2852680915 2852681249 243
1068 iso_pu_bacteria 2880518877 2880523668 243
1069 iso_pu_bacteria 2919709256 2919709460 243
1070 3300046460 Ga0495638_0086206 Ga0495638_0086206_444_1199 244
1071 3300046506 Ga0495583_0000401 Ga0495583_0000401_50434_51189 244
1072 3300046665 Ga0495661_0012689 Ga0495661_0012689_1218_1973 244
1073 3300049460 Ga0495682_0028086 Ga0495682_0028086_1176_1931 244
1074 3300049515 Ga0501292_000003 Ga0501292_000003_71247_72005 244
1075 3300049775 Ga0501279_000009 Ga0501279_000009_42119_42877 244
1076 3300053103 Ga0500555_000448 Ga0500555_000448_10067_10822 244
1077 3300053177 Ga0500636_0001943 Ga0500636_0001943_3088_3837 244
1078 2162886007 SwRhRL2b_contig_1483352 SwRhRL2b_0029.00008500 245
1079 3300005289 Ga0065704_10099817 Ga0065704_100998172 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

61

207

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fzv-assembly1.cif.gz_B crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.9351 1 231
2fzv-assembly1.cif.gz_A crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.9338 3 233
2fzv-assembly1.cif.gz_D crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.9272 2 231
2fzv-assembly1.cif.gz_C crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.9237 1 231
2fzv-assembly1.cif.gz_A crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.9147 3 233
ID Description Score Start End Superfamily
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9237 1 231 3.40.50.360
2q62A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9214 34 228 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8863 1 231 3.40.50.360
2q62A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8658 34 228 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8514 37 206 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A4Q3A6A9-F1-model_v4 Arsenical resistance protein ArsH 0.9912 1 98 GO:0016655
AF-A0A6S4VTP6-F1-model_v4 deleted 0.9901 2 106
AF-A0A2D8TFP3-F1-model_v4 deleted 0.9881 1 82
AF-A0A6I1JFG8-F1-model_v4 NADPH-dependent FMN reductase 0.9788 1 72 GO:0016655
AF-A0A2D8TFP3-F1-model_v4 deleted 0.9763 1 82

Feature Viewer

pLDDT pTM Quality
87.31 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map