F489583
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1076 | 607 | 2152 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300021321|Ga0214542_1021066|Ga0214542_10210665 |
| Length | 236 |
| Sequence | MTGARAYIRKTGPERDDMTGFGNNGLGPSRRAALTLIGAGALAVGGIVSARAATGDDEVLTEAKVLRDPDTPVAGNPDGNITIVEWSDYNCPYCRKLEPELRQVVQDDGKVRLVMKDWPILGPVSVTAARSALAAKFQGKYHQAHDALIGVSSRLTEPRINELLAAAGVDMDRLKRDLTGHAKDIDAILKRNNEQAEAFGFQGTPSFIVGKYRVPGVLSMTEFEQVIADARKAKMN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 81 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 82 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 112 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 115 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 116 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 181 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 183 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 194 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 200 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 210 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 211 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 214 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 236 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 237 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 246 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 247 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 327 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 328 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 329 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 330 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 331 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 332 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 333 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 334 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 344 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 345 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 347 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 349 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 358 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 359 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 362 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 363 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 365 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 366 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 367 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 368 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 370 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 371 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 372 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 374 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 375 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 376 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 377 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 378 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 379 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 380 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 381 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 382 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 385 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 386 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 387 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 389 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 391 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 392 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 393 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 394 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 397 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 398 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 399 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 400 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 401 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 402 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 403 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 404 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 405 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 407 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 408 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 409 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 410 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 411 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 412 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 413 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 414 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 415 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 416 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 417 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 418 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 419 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 420 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 421 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 422 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 423 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 424 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 425 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 426 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 427 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 428 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 429 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 430 | 2791355199 | |||
| 431 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 432 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 433 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 434 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 435 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 436 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 437 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 438 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 439 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 440 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 441 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 442 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 443 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 444 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 445 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 446 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 447 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 448 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 449 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 450 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 451 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 452 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 453 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 454 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 455 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 456 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 457 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 458 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 459 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 460 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 461 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 462 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 463 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 464 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 465 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 466 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 467 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 468 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 469 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 470 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 471 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 472 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 473 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 474 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 475 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 476 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 477 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 478 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 479 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 480 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 481 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 482 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 483 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 484 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 485 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 486 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 487 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 488 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 489 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 490 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 491 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 492 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 493 | 2904699407 | |||
| 494 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 495 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 496 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 497 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 498 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 499 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 500 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 501 | 2922368715 | |||
| 502 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 503 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 504 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 505 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 506 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 507 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 508 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 509 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 510 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 511 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 512 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 513 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 514 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 515 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 516 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 517 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 518 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 519 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 520 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 521 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 522 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 523 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 524 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 525 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 526 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 527 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 528 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 529 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 530 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 531 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 532 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 533 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 534 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 535 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 536 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 537 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 538 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 539 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 540 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 541 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 542 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 543 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 544 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 545 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 546 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 547 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 548 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 549 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 550 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 551 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 552 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 553 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 554 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 555 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 556 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 557 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 558 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 559 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 560 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 561 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 562 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 563 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 564 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 565 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 566 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 567 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 568 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 569 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 570 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 571 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 572 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 573 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 574 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 575 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 576 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 577 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 578 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 579 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 580 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 581 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 582 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 583 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 584 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 585 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 586 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 587 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 588 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 589 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 590 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 591 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 592 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 593 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 594 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 595 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 596 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 597 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 598 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 599 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 600 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 601 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 602 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 603 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 604 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 605 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 606 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 607 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.99 |
| Metatranscriptomes | 0.56 |
| Isolates | 18.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.31 |
| Nodule | 15.43 |
| Rhizoplane | 5.67 |
| Rhizosphere | 54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0214542_1021066 | 3300021321 | Bacteria | 4603 |
| 2 | JGI25406J46586_10006811 | 3300003203 | Bacteria | 5249 |
| 3 | JGI25153J46596_10002547 | 3300003215 | Bacteria | 10449 |
| 4 | JGI25153J46596_10003542 | 3300003215 | Bacteria | 8707 |
| 5 | JGI25153J46596_10004097 | 3300003215 | Bacteria | 7925 |
| 6 | JGI25153J46596_10014855 | 3300003215 | Bacteria | 3211 |
| 7 | rootH1_10016026 | 3300003323 | Bacteria | 1867 |
| 8 | JGI25160J50197_1001680 | 3300003354 | Bacteria | 10780 |
| 9 | JGI25160J50197_1003442 | 3300003354 | Bacteria | 7079 |
| 10 | JGI25160J50197_1005384 | 3300003354 | Bacteria | 5338 |
| 11 | JGI25404J52841_10025272 | 3300003659 | Bacteria | 1279 |
| 12 | JGI25404J52841_10030013 | 3300003659 | Bacteria | 1165 |
| 13 | Ga0055531_10007525 | 3300003794 | Bacteria | 5917 |
| 14 | Ga0055543_1007516 | 3300004625 | Bacteria | 2506 |
| 15 | Ga0065165_1000370 | 3300005262 | Bacteria | 73604 |
| 16 | Ga0065165_1006098 | 3300005262 | Bacteria | 6459 |
| 17 | Ga0065165_1008717 | 3300005262 | Bacteria | 4687 |
| 18 | Ga0070658_10021405 | 3300005327 | Bacteria | 5182 |
| 19 | Ga0070676_10394328 | 3300005328 | Bacteria | 961 |
| 20 | Ga0070683_100042686 | 3300005329 | Bacteria | 4176 |
| 21 | Ga0070683_100139749 | 3300005329 | Bacteria | 2294 |
| 22 | Ga0070683_100521941 | 3300005329 | Bacteria | 1135 |
| 23 | Ga0070670_100124537 | 3300005331 | Bacteria | 2224 |
| 24 | Ga0068869_100013181 | 3300005334 | Bacteria | 5491 |
| 25 | Ga0068869_100064153 | 3300005334 | Bacteria | 2701 |
| 26 | Ga0070680_100019553 | 3300005336 | Bacteria | 5369 |
| 27 | Ga0070680_100079829 | 3300005336 | Bacteria | 2697 |
| 28 | Ga0070680_100104138 | 3300005336 | Bacteria | 2358 |
| 29 | Ga0070680_100221827 | 3300005336 | Bacteria | 1596 |
| 30 | Ga0070682_100110140 | 3300005337 | Bacteria | 1834 |
| 31 | Ga0068868_100063339 | 3300005338 | Bacteria | 2933 |
| 32 | Ga0068868_100284079 | 3300005338 | Bacteria | 1401 |
| 33 | Ga0068868_100658426 | 3300005338 | Bacteria | 933 |
| 34 | Ga0070660_100244847 | 3300005339 | Bacteria | 1461 |
| 35 | Ga0070689_100474764 | 3300005340 | Bacteria | 1067 |
| 36 | Ga0070691_10090375 | 3300005341 | Bacteria | 1509 |
| 37 | Ga0070668_100008756 | 3300005347 | Bacteria | 7517 |
| 38 | Ga0070668_100027658 | 3300005347 | Bacteria | 4306 |
| 39 | Ga0070671_100032245 | 3300005355 | Bacteria | 4332 |
| 40 | Ga0070673_100719100 | 3300005364 | Bacteria | 918 |
| 41 | Ga0070667_100137265 | 3300005367 | Bacteria | 2138 |
| 42 | Ga0070667_100425118 | 3300005367 | Bacteria | 1212 |
| 43 | Ga0070709_10003090 | 3300005434 | Bacteria | 8947 |
| 44 | Ga0070709_10008369 | 3300005434 | Bacteria | 5681 |
| 45 | Ga0070714_100162069 | 3300005435 | Bacteria | 2024 |
| 46 | Ga0070713_100002234 | 3300005436 | Bacteria | 12560 |
| 47 | Ga0070713_100008846 | 3300005436 | Bacteria | 7167 |
| 48 | Ga0070713_101072866 | 3300005436 | Bacteria | 778 |
| 49 | Ga0070710_10000552 | 3300005437 | Bacteria | 17723 |
| 50 | Ga0070710_10172200 | 3300005437 | Bacteria | 1349 |
| 51 | Ga0070701_10348617 | 3300005438 | Bacteria | 924 |
| 52 | Ga0070711_100011221 | 3300005439 | Bacteria | 5556 |
| 53 | Ga0070711_100017038 | 3300005439 | Bacteria | 4621 |
| 54 | Ga0070711_100027986 | 3300005439 | Bacteria | 3705 |
| 55 | Ga0070711_100062871 | 3300005439 | Bacteria | 2589 |
| 56 | Ga0070711_100166520 | 3300005439 | Bacteria | 1676 |
| 57 | Ga0070711_100752190 | 3300005439 | Bacteria | 824 |
| 58 | Ga0070700_100252535 | 3300005441 | Bacteria | 1265 |
| 59 | Ga0070663_100435647 | 3300005455 | Bacteria | 1078 |
| 60 | Ga0070663_100672247 | 3300005455 | Bacteria | 878 |
| 61 | Ga0070678_100012735 | 3300005456 | Bacteria | 5243 |
| 62 | Ga0070678_100029982 | 3300005456 | Bacteria | 3732 |
| 63 | Ga0070678_100164756 | 3300005456 | Bacteria | 1800 |
| 64 | Ga0070678_100862047 | 3300005456 | Bacteria | 826 |
| 65 | Ga0070662_100230394 | 3300005457 | Bacteria | 1482 |
| 66 | Ga0070681_10012819 | 3300005458 | Bacteria | 8322 |
| 67 | Ga0070681_10037527 | 3300005458 | Bacteria | 4861 |
| 68 | Ga0070681_10051933 | 3300005458 | Bacteria | 4088 |
| 69 | Ga0070681_10125936 | 3300005458 | Bacteria | 2494 |
| 70 | Ga0070681_10607547 | 3300005458 | Bacteria | 1008 |
| 71 | Ga0070685_10132407 | 3300005466 | Bacteria | 1561 |
| 72 | Ga0070685_10187510 | 3300005466 | Bacteria | 1336 |
| 73 | Ga0070706_100736318 | 3300005467 | Bacteria | 914 |
| 74 | Ga0070698_100604936 | 3300005471 | Bacteria | 1036 |
| 75 | Ga0070679_100031919 | 3300005530 | Bacteria | 5207 |
| 76 | Ga0070679_100034291 | 3300005530 | Bacteria | 5029 |
| 77 | Ga0070679_100109277 | 3300005530 | Bacteria | 2751 |
| 78 | Ga0070679_100137259 | 3300005530 | Bacteria | 2426 |
| 79 | Ga0070679_100138618 | 3300005530 | Bacteria | 2413 |
| 80 | Ga0070679_100600551 | 3300005530 | Bacteria | 1044 |
| 81 | Ga0070684_100003258 | 3300005535 | Bacteria | 12159 |
| 82 | Ga0068853_100026606 | 3300005539 | Bacteria | 4858 |
| 83 | Ga0068853_100112148 | 3300005539 | Bacteria | 2424 |
| 84 | Ga0070672_100649058 | 3300005543 | Bacteria | 922 |
| 85 | Ga0070696_100164886 | 3300005546 | Bacteria | 1635 |
| 86 | Ga0070693_100262254 | 3300005547 | Bacteria | 1150 |
| 87 | Ga0070665_100028897 | 3300005548 | Bacteria | 5581 |
| 88 | Ga0070665_100045145 | 3300005548 | Bacteria | 4425 |
| 89 | Ga0070665_100071651 | 3300005548 | Bacteria | 3472 |
| 90 | Ga0070665_100135904 | 3300005548 | Bacteria | 2461 |
| 91 | Ga0070665_100136213 | 3300005548 | Bacteria | 2458 |
| 92 | Ga0070665_100161250 | 3300005548 | Bacteria | 2245 |
| 93 | Ga0070665_100472269 | 3300005548 | Bacteria | 1265 |
| 94 | Ga0070665_100554908 | 3300005548 | Bacteria | 1161 |
| 95 | Ga0068855_100015587 | 3300005563 | Bacteria | 9146 |
| 96 | Ga0068855_100073742 | 3300005563 | Bacteria | 3965 |
| 97 | Ga0068855_100188786 | 3300005563 | Bacteria | 2326 |
| 98 | Ga0068855_100217196 | 3300005563 | Bacteria | 2146 |
| 99 | Ga0070664_100249863 | 3300005564 | Bacteria | 1594 |
| 100 | Ga0070664_100516844 | 3300005564 | Bacteria | 1102 |
| 101 | Ga0068857_100125486 | 3300005577 | Bacteria | 2313 |
| 102 | Ga0068857_100264142 | 3300005577 | Bacteria | 1580 |
| 103 | Ga0068856_100013570 | 3300005614 | Bacteria | 7888 |
| 104 | Ga0068856_100152081 | 3300005614 | Bacteria | 2324 |
| 105 | Ga0068856_100253525 | 3300005614 | Bacteria | 1775 |
| 106 | Ga0068856_100255228 | 3300005614 | Bacteria | 1768 |
| 107 | Ga0068856_100467549 | 3300005614 | Bacteria | 1282 |
| 108 | Ga0068856_100832796 | 3300005614 | Bacteria | 942 |
| 109 | Ga0070702_100269391 | 3300005615 | Bacteria | 1164 |
| 110 | Ga0070702_100437731 | 3300005615 | Bacteria | 945 |
| 111 | Ga0070702_100510897 | 3300005615 | Bacteria | 884 |
| 112 | Ga0068852_100002075 | 3300005616 | Bacteria | 13685 |
| 113 | Ga0068852_100185761 | 3300005616 | Bacteria | 1958 |
| 114 | Ga0068859_100127861 | 3300005617 | Bacteria | 2611 |
| 115 | Ga0068859_100538127 | 3300005617 | Bacteria | 1263 |
| 116 | Ga0068864_100182468 | 3300005618 | Bacteria | 1919 |
| 117 | Ga0068864_100257270 | 3300005618 | Bacteria | 1623 |
| 118 | Ga0068861_100139299 | 3300005719 | Bacteria | 1978 |
| 119 | Ga0068861_100151333 | 3300005719 | Bacteria | 1904 |
| 120 | Ga0068851_10113048 | 3300005834 | Bacteria | 1451 |
| 121 | Ga0068863_100776274 | 3300005841 | Bacteria | 955 |
| 122 | Ga0068858_100150433 | 3300005842 | Bacteria | 2189 |
| 123 | Ga0068858_100721009 | 3300005842 | Bacteria | 971 |
| 124 | Ga0068860_100084953 | 3300005843 | Bacteria | 3010 |
| 125 | Ga0068860_100215672 | 3300005843 | Bacteria | 1862 |
| 126 | Ga0068860_100238488 | 3300005843 | Bacteria | 1768 |
| 127 | Ga0068862_100158116 | 3300005844 | Bacteria | 2021 |
| 128 | Ga0068862_100373845 | 3300005844 | Bacteria | 1327 |
| 129 | Ga0068862_100569757 | 3300005844 | Bacteria | 1083 |
| 130 | Ga0081455_10003156 | 3300005937 | Bacteria | 19144 |
| 131 | Ga0081455_10006663 | 3300005937 | Bacteria | 12343 |
| 132 | Ga0081455_10007464 | 3300005937 | Bacteria | 11515 |
| 133 | Ga0081455_10073137 | 3300005937 | Bacteria | 2835 |
| 134 | Ga0081540_1001341 | 3300005983 | Bacteria | 21422 |
| 135 | Ga0081540_1002121 | 3300005983 | Bacteria | 16515 |
| 136 | Ga0081540_1012706 | 3300005983 | Bacteria | 5523 |
| 137 | Ga0081540_1018462 | 3300005983 | Bacteria | 4276 |
| 138 | Ga0081540_1073482 | 3300005983 | Bacteria | 1571 |
| 139 | Ga0081540_1100945 | 3300005983 | Bacteria | 1243 |
| 140 | Ga0081540_1120509 | 3300005983 | Bacteria | 1090 |
| 141 | Ga0081540_1120511 | 3300005983 | Bacteria | 1090 |
| 142 | Ga0081539_10000729 | 3300005985 | Bacteria | 65907 |
| 143 | Ga0081539_10091157 | 3300005985 | Bacteria | 1575 |
| 144 | Ga0081539_10125163 | 3300005985 | Bacteria | 1271 |
| 145 | Ga0070717_10001026 | 3300006028 | Bacteria | 18703 |
| 146 | Ga0070717_10237647 | 3300006028 | Bacteria | 1606 |
| 147 | Ga0075365_10033553 | 3300006038 | Bacteria | 3309 |
| 148 | Ga0075365_10046161 | 3300006038 | Bacteria | 2860 |
| 149 | Ga0075368_10008533 | 3300006042 | Bacteria | 3653 |
| 150 | Ga0075368_10102393 | 3300006042 | Bacteria | 1177 |
| 151 | Ga0075368_10103345 | 3300006042 | Bacteria | 1172 |
| 152 | Ga0075368_10127023 | 3300006042 | Bacteria | 1058 |
| 153 | Ga0075363_100003880 | 3300006048 | Bacteria | 6449 |
| 154 | Ga0075363_100013422 | 3300006048 | Bacteria | 3971 |
| 155 | Ga0075363_100060796 | 3300006048 | Bacteria | 2035 |
| 156 | Ga0075363_100163594 | 3300006048 | Bacteria | 1261 |
| 157 | Ga0075364_10039240 | 3300006051 | Bacteria | 3069 |
| 158 | Ga0070716_100069962 | 3300006173 | Bacteria | 2059 |
| 159 | Ga0070716_100073994 | 3300006173 | Bacteria | 2011 |
| 160 | Ga0070716_100585493 | 3300006173 | Bacteria | 837 |
| 161 | Ga0070712_100044616 | 3300006175 | Bacteria | 3057 |
| 162 | Ga0070712_100502818 | 3300006175 | Bacteria | 1016 |
| 163 | Ga0070712_100840602 | 3300006175 | Bacteria | 789 |
| 164 | Ga0075367_10098911 | 3300006178 | Bacteria | 1781 |
| 165 | Ga0075367_10110452 | 3300006178 | Bacteria | 1687 |
| 166 | Ga0075367_10330846 | 3300006178 | Bacteria | 960 |
| 167 | Ga0075369_10028877 | 3300006186 | Bacteria | 2327 |
| 168 | Ga0075366_10008044 | 3300006195 | Bacteria | 5844 |
| 169 | Ga0075366_10071534 | 3300006195 | Bacteria | 2066 |
| 170 | Ga0075366_10094649 | 3300006195 | Bacteria | 1791 |
| 171 | Ga0097621_100234276 | 3300006237 | Bacteria | 1603 |
| 172 | Ga0097621_100239636 | 3300006237 | Bacteria | 1585 |
| 173 | Ga0075370_10028282 | 3300006353 | Bacteria | 3115 |
| 174 | Ga0075370_10042444 | 3300006353 | Bacteria | 2570 |
| 175 | Ga0075370_10116584 | 3300006353 | Bacteria | 1553 |
| 176 | Ga0075370_10132901 | 3300006353 | Bacteria | 1452 |
| 177 | Ga0075370_10216835 | 3300006353 | Bacteria | 1130 |
| 178 | Ga0075428_100622896 | 3300006844 | Bacteria | 1152 |
| 179 | Ga0075434_100092226 | 3300006871 | Bacteria | 3031 |
| 180 | Ga0075434_100826714 | 3300006871 | Bacteria | 942 |
| 181 | Ga0068865_100069342 | 3300006881 | Bacteria | 2495 |
| 182 | Ga0068865_100316538 | 3300006881 | Bacteria | 1254 |
| 183 | Ga0075436_100134933 | 3300006914 | Bacteria | 1732 |
| 184 | Ga0097620_100127864 | 3300006931 | Bacteria | 2611 |
| 185 | Ga0097620_100538168 | 3300006931 | Bacteria | 1263 |
| 186 | Ga0099824_1002047 | 3300006942 | Bacteria | 29222 |
| 187 | Ga0099824_1018951 | 3300006942 | Bacteria | 5500 |
| 188 | Ga0099822_1004737 | 3300006943 | Bacteria | 17740 |
| 189 | Ga0099822_1063565 | 3300006943 | Bacteria | 1165 |
| 190 | Ga0099823_1071205 | 3300006944 | Bacteria | 1538 |
| 191 | Ga0075435_100109533 | 3300007076 | Bacteria | 2296 |
| 192 | Ga0099794_10112341 | 3300007265 | Bacteria | 1366 |
| 193 | Ga0099795_10017558 | 3300007788 | Bacteria | 2284 |
| 194 | Ga0099795_10161517 | 3300007788 | Bacteria | 925 |
| 195 | Ga0105240_10002295 | 3300009093 | Bacteria | 30967 |
| 196 | Ga0105240_10053247 | 3300009093 | Bacteria | 5081 |
| 197 | Ga0105240_10183475 | 3300009093 | Bacteria | 2467 |
| 198 | Ga0105240_10218361 | 3300009093 | Bacteria | 2223 |
| 199 | Ga0105240_10251298 | 3300009093 | Bacteria | 2045 |
| 200 | Ga0105240_10266078 | 3300009093 | Bacteria | 1976 |
| 201 | Ga0105240_10672889 | 3300009093 | Bacteria | 1132 |
| 202 | Ga0111539_10182022 | 3300009094 | Bacteria | 2454 |
| 203 | Ga0111539_10395278 | 3300009094 | Bacteria | 1610 |
| 204 | Ga0105245_10037331 | 3300009098 | Bacteria | 4319 |
| 205 | Ga0105245_10340923 | 3300009098 | Bacteria | 1482 |
| 206 | Ga0105245_10904070 | 3300009098 | Bacteria | 924 |
| 207 | Ga0105243_10994056 | 3300009148 | Bacteria | 841 |
| 208 | Ga0105241_10012898 | 3300009174 | Bacteria | 6131 |
| 209 | Ga0105241_10046174 | 3300009174 | Bacteria | 3307 |
| 210 | Ga0105241_10066451 | 3300009174 | Bacteria | 2788 |
| 211 | Ga0105241_10444899 | 3300009174 | Bacteria | 1145 |
| 212 | Ga0105242_10234670 | 3300009176 | Bacteria | 1646 |
| 213 | Ga0105242_10458835 | 3300009176 | Bacteria | 1203 |
| 214 | Ga0105248_10042923 | 3300009177 | Bacteria | 5071 |
| 215 | Ga0105248_10144863 | 3300009177 | Bacteria | 2681 |
| 216 | Ga0105248_10211185 | 3300009177 | Bacteria | 2187 |
| 217 | Ga0105237_10002301 | 3300009545 | Bacteria | 23744 |
| 218 | Ga0105237_10006999 | 3300009545 | Bacteria | 12427 |
| 219 | Ga0105237_10026831 | 3300009545 | Bacteria | 5887 |
| 220 | Ga0105237_10080389 | 3300009545 | Bacteria | 3250 |
| 221 | Ga0105237_10259204 | 3300009545 | Bacteria | 1741 |
| 222 | Ga0105237_10346620 | 3300009545 | Bacteria | 1489 |
| 223 | Ga0105237_10358448 | 3300009545 | Bacteria | 1463 |
| 224 | Ga0105237_10430729 | 3300009545 | Bacteria | 1325 |
| 225 | Ga0105237_10807367 | 3300009545 | Bacteria | 945 |
| 226 | Ga0105238_10018488 | 3300009551 | Bacteria | 7091 |
| 227 | Ga0105238_10063133 | 3300009551 | Bacteria | 3704 |
| 228 | Ga0105238_10112590 | 3300009551 | Bacteria | 2701 |
| 229 | Ga0105238_10247537 | 3300009551 | Bacteria | 1760 |
| 230 | Ga0105238_10345957 | 3300009551 | Bacteria | 1475 |
| 231 | Ga0105238_10422128 | 3300009551 | Bacteria | 1328 |
| 232 | Ga0105249_10165545 | 3300009553 | Bacteria | 2140 |
| 233 | Ga0105249_10395205 | 3300009553 | Bacteria | 1412 |
| 234 | Ga0105249_11331530 | 3300009553 | Bacteria | 790 |
| 235 | Ga0105239_10025401 | 3300010375 | Bacteria | 6522 |
| 236 | Ga0105239_10083534 | 3300010375 | Bacteria | 3517 |
| 237 | Ga0105239_10142048 | 3300010375 | Bacteria | 2676 |
| 238 | Ga0105239_10321091 | 3300010375 | Bacteria | 1746 |
| 239 | Ga0105239_11309354 | 3300010375 | Bacteria | 836 |
| 240 | Ga0105246_10114789 | 3300011119 | Bacteria | 1985 |
| 241 | Ga0105246_10484397 | 3300011119 | Bacteria | 1047 |
| 242 | Ga0157370_10061670 | 3300013104 | Bacteria | 3559 |
| 243 | Ga0157370_10497971 | 3300013104 | Bacteria | 1119 |
| 244 | Ga0157369_10017488 | 3300013105 | Bacteria | 8058 |
| 245 | Ga0157369_10102904 | 3300013105 | Bacteria | 3042 |
| 246 | Ga0157369_10570470 | 3300013105 | Bacteria | 1169 |
| 247 | Ga0157374_10191301 | 3300013296 | Bacteria | 2002 |
| 248 | Ga0157378_10057612 | 3300013297 | Bacteria | 3463 |
| 249 | Ga0157378_10146176 | 3300013297 | Bacteria | 2199 |
| 250 | Ga0157378_10573750 | 3300013297 | Bacteria | 1136 |
| 251 | Ga0163162_10155709 | 3300013306 | Bacteria | 2405 |
| 252 | Ga0163162_10362366 | 3300013306 | Bacteria | 1583 |
| 253 | Ga0163162_10475004 | 3300013306 | Bacteria | 1382 |
| 254 | Ga0157372_10118851 | 3300013307 | Bacteria | 3033 |
| 255 | Ga0157375_10069051 | 3300013308 | Bacteria | 3538 |
| 256 | Ga0157375_10076159 | 3300013308 | Bacteria | 3381 |
| 257 | Ga0157375_10137987 | 3300013308 | Bacteria | 2564 |
| 258 | Ga0157375_10541055 | 3300013308 | Bacteria | 1327 |
| 259 | Ga0157375_10784330 | 3300013308 | Bacteria | 1102 |
| 260 | Ga0163163_10002774 | 3300014325 | Bacteria | 14789 |
| 261 | Ga0163163_10043948 | 3300014325 | Bacteria | 4382 |
| 262 | Ga0163163_10129093 | 3300014325 | Bacteria | 2567 |
| 263 | Ga0163163_10183688 | 3300014325 | Bacteria | 2139 |
| 264 | Ga0163163_10203230 | 3300014325 | Bacteria | 2030 |
| 265 | Ga0163163_10910132 | 3300014325 | Bacteria | 943 |
| 266 | Ga0157377_10044206 | 3300014745 | Bacteria | 2483 |
| 267 | Ga0157379_10192263 | 3300014968 | Bacteria | 1844 |
| 268 | Ga0157379_10255394 | 3300014968 | Bacteria | 1592 |
| 269 | Ga0157379_10609805 | 3300014968 | Bacteria | 1019 |
| 270 | Ga0157376_10086282 | 3300014969 | Bacteria | 2706 |
| 271 | Ga0157376_10179560 | 3300014969 | Bacteria | 1934 |
| 272 | Ga0157376_10321788 | 3300014969 | Bacteria | 1471 |
| 273 | Ga0157376_10537824 | 3300014969 | Bacteria | 1154 |
| 274 | Ga0163161_10171094 | 3300017792 | Bacteria | 1661 |
| 275 | Ga0163161_10299170 | 3300017792 | Bacteria | 1267 |
| 276 | Ga0163161_10338303 | 3300017792 | Bacteria | 1193 |
| 277 | Ga0197907_11157109 | 3300020069 | Bacteria | 1476 |
| 278 | Ga0206355_1507511 | 3300020076 | Bacteria | 1302 |
| 279 | Ga0206350_10389318 | 3300020080 | Bacteria | 991 |
| 280 | Ga0206353_10556866 | 3300020082 | Bacteria | 959 |
| 281 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 282 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 283 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 284 | Ga0214545_1021274 | 3300021324 | Bacteria | 4909 |
| 285 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 286 | Ga0213876_10002755 | 3300021384 | Bacteria | 10233 |
| 287 | Ga0213876_10094238 | 3300021384 | Bacteria | 1586 |
| 288 | Ga0213875_10130551 | 3300021388 | Bacteria | 1175 |
| 289 | Ga0224712_10107802 | 3300022467 | Bacteria | 1191 |
| 290 | Ga0209563_100438 | 3300025230 | Bacteria | 14431 |
| 291 | Ga0209677_103197 | 3300025253 | Bacteria | 5489 |
| 292 | Ga0209148_1000267 | 3300025254 | Bacteria | 81839 |
| 293 | Ga0209233_1012874 | 3300025261 | Bacteria | 2408 |
| 294 | Ga0209455_1001737 | 3300025272 | Bacteria | 9272 |
| 295 | Ga0209673_1013733 | 3300025273 | Bacteria | 3180 |
| 296 | Ga0209564_1010432 | 3300025295 | Bacteria | 4282 |
| 297 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 298 | Ga0209758_1000277 | 3300025297 | Bacteria | 102106 |
| 299 | Ga0209758_1000711 | 3300025297 | Bacteria | 49164 |
| 300 | Ga0209758_1000893 | 3300025297 | Bacteria | 40627 |
| 301 | Ga0209758_1001645 | 3300025297 | Bacteria | 25366 |
| 302 | Ga0209758_1002462 | 3300025297 | Bacteria | 18855 |
| 303 | Ga0209758_1005049 | 3300025297 | Bacteria | 10483 |
| 304 | Ga0209758_1050686 | 3300025297 | Bacteria | 1453 |
| 305 | Ga0207426_1000271 | 3300025302 | Bacteria | 108392 |
| 306 | Ga0207426_1001517 | 3300025302 | Bacteria | 18935 |
| 307 | Ga0207426_1008000 | 3300025302 | Bacteria | 4342 |
| 308 | Ga0209257_1000662 | 3300025304 | Bacteria | 54143 |
| 309 | Ga0209257_1015967 | 3300025304 | Bacteria | 3073 |
| 310 | Ga0207653_10004044 | 3300025885 | Bacteria | 4615 |
| 311 | Ga0207692_10001302 | 3300025898 | Bacteria | 9295 |
| 312 | Ga0207692_10075621 | 3300025898 | Bacteria | 1787 |
| 313 | Ga0207692_10250024 | 3300025898 | Bacteria | 1062 |
| 314 | Ga0207710_10028157 | 3300025900 | Bacteria | 2438 |
| 315 | Ga0207688_10033353 | 3300025901 | Bacteria | 2847 |
| 316 | Ga0207688_10069981 | 3300025901 | Bacteria | 1989 |
| 317 | Ga0207680_10231384 | 3300025903 | Bacteria | 1270 |
| 318 | Ga0207647_10008109 | 3300025904 | Bacteria | 7549 |
| 319 | Ga0207647_10211960 | 3300025904 | Bacteria | 1118 |
| 320 | Ga0207699_10023510 | 3300025906 | Bacteria | 3355 |
| 321 | Ga0207699_10045183 | 3300025906 | Bacteria | 2569 |
| 322 | Ga0207645_10084865 | 3300025907 | Bacteria | 2033 |
| 323 | Ga0207684_10261744 | 3300025910 | Bacteria | 1492 |
| 324 | Ga0207707_10000438 | 3300025912 | Bacteria | 43316 |
| 325 | Ga0207707_10136890 | 3300025912 | Bacteria | 2141 |
| 326 | Ga0207707_10669633 | 3300025912 | Bacteria | 873 |
| 327 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 328 | Ga0207695_10027002 | 3300025913 | Bacteria | 6397 |
| 329 | Ga0207695_10043272 | 3300025913 | Bacteria | 4800 |
| 330 | Ga0207695_10218834 | 3300025913 | Bacteria | 1812 |
| 331 | Ga0207671_10001109 | 3300025914 | Bacteria | 32478 |
| 332 | Ga0207671_10035801 | 3300025914 | Bacteria | 3681 |
| 333 | Ga0207671_10069327 | 3300025914 | Bacteria | 2629 |
| 334 | Ga0207671_10162971 | 3300025914 | Bacteria | 1727 |
| 335 | Ga0207671_10173745 | 3300025914 | Bacteria | 1674 |
| 336 | Ga0207693_10027888 | 3300025915 | Bacteria | 4463 |
| 337 | Ga0207693_10104554 | 3300025915 | Bacteria | 2221 |
| 338 | Ga0207693_10114267 | 3300025915 | Bacteria | 2118 |
| 339 | Ga0207693_10235143 | 3300025915 | Bacteria | 1439 |
| 340 | Ga0207693_10463230 | 3300025915 | Bacteria | 990 |
| 341 | Ga0207663_10017392 | 3300025916 | Bacteria | 4006 |
| 342 | Ga0207663_10030104 | 3300025916 | Bacteria | 3197 |
| 343 | Ga0207663_10095514 | 3300025916 | Bacteria | 1983 |
| 344 | Ga0207660_10017792 | 3300025917 | Bacteria | 4730 |
| 345 | Ga0207660_10087395 | 3300025917 | Bacteria | 2303 |
| 346 | Ga0207660_10183018 | 3300025917 | Bacteria | 1628 |
| 347 | Ga0207660_10219447 | 3300025917 | Bacteria | 1492 |
| 348 | Ga0207660_10619273 | 3300025917 | Bacteria | 882 |
| 349 | Ga0207657_10275808 | 3300025919 | Bacteria | 1336 |
| 350 | Ga0207657_10506158 | 3300025919 | Bacteria | 946 |
| 351 | Ga0207652_10047083 | 3300025921 | Bacteria | 3683 |
| 352 | Ga0207652_10518673 | 3300025921 | Bacteria | 1072 |
| 353 | Ga0207694_10173320 | 3300025924 | Bacteria | 1747 |
| 354 | Ga0207694_10356417 | 3300025924 | Bacteria | 1211 |
| 355 | Ga0207650_10158200 | 3300025925 | Bacteria | 1793 |
| 356 | Ga0207659_10263324 | 3300025926 | Bacteria | 1403 |
| 357 | Ga0207700_10067007 | 3300025928 | Bacteria | 2746 |
| 358 | Ga0207700_10234026 | 3300025928 | Bacteria | 1563 |
| 359 | Ga0207700_10634800 | 3300025928 | Bacteria | 952 |
| 360 | Ga0207664_10021535 | 3300025929 | Bacteria | 4797 |
| 361 | Ga0207644_10018254 | 3300025931 | Bacteria | 4744 |
| 362 | Ga0207644_10334329 | 3300025931 | Bacteria | 1227 |
| 363 | Ga0207644_10743095 | 3300025931 | Bacteria | 819 |
| 364 | Ga0207706_10059147 | 3300025933 | Bacteria | 3375 |
| 365 | Ga0207706_10134929 | 3300025933 | Bacteria | 2171 |
| 366 | Ga0207706_10499489 | 3300025933 | Bacteria | 1050 |
| 367 | Ga0207686_10200241 | 3300025934 | Bacteria | 1430 |
| 368 | Ga0207686_10225341 | 3300025934 | Bacteria | 1356 |
| 369 | Ga0207670_10389508 | 3300025936 | Bacteria | 1112 |
| 370 | Ga0207669_10478717 | 3300025937 | Bacteria | 992 |
| 371 | Ga0207669_10624750 | 3300025937 | Bacteria | 878 |
| 372 | Ga0207704_10265709 | 3300025938 | Bacteria | 1296 |
| 373 | Ga0207665_10014858 | 3300025939 | Bacteria | 5119 |
| 374 | Ga0207665_10061914 | 3300025939 | Bacteria | 2538 |
| 375 | Ga0207665_10380452 | 3300025939 | Bacteria | 1071 |
| 376 | Ga0207691_10197132 | 3300025940 | Bacteria | 1754 |
| 377 | Ga0207711_10018230 | 3300025941 | Bacteria | 5835 |
| 378 | Ga0207711_10276472 | 3300025941 | Bacteria | 1546 |
| 379 | Ga0207711_10876686 | 3300025941 | Bacteria | 835 |
| 380 | Ga0207689_10080482 | 3300025942 | Bacteria | 2678 |
| 381 | Ga0207689_10208165 | 3300025942 | Bacteria | 1615 |
| 382 | Ga0207661_10000959 | 3300025944 | Bacteria | 18985 |
| 383 | Ga0207661_10412760 | 3300025944 | Bacteria | 1225 |
| 384 | Ga0207679_10401124 | 3300025945 | Bacteria | 1206 |
| 385 | Ga0207667_10044714 | 3300025949 | Bacteria | 4691 |
| 386 | Ga0207667_10086148 | 3300025949 | Bacteria | 3251 |
| 387 | Ga0207667_10101512 | 3300025949 | Bacteria | 2967 |
| 388 | Ga0207667_10406284 | 3300025949 | Bacteria | 1386 |
| 389 | Ga0207668_10060395 | 3300025972 | Bacteria | 2660 |
| 390 | Ga0207668_10069357 | 3300025972 | Bacteria | 2510 |
| 391 | Ga0207668_10095673 | 3300025972 | Bacteria | 2192 |
| 392 | Ga0207668_10124091 | 3300025972 | Bacteria | 1960 |
| 393 | Ga0207668_10425960 | 3300025972 | Bacteria | 1127 |
| 394 | Ga0207658_10678577 | 3300025986 | Bacteria | 930 |
| 395 | Ga0207677_10461146 | 3300026023 | Bacteria | 1091 |
| 396 | Ga0207703_10050557 | 3300026035 | Bacteria | 3365 |
| 397 | Ga0207703_10181953 | 3300026035 | Bacteria | 1855 |
| 398 | Ga0207639_10023427 | 3300026041 | Bacteria | 4459 |
| 399 | Ga0207639_10160589 | 3300026041 | Bacteria | 1893 |
| 400 | Ga0207639_10163367 | 3300026041 | Bacteria | 1879 |
| 401 | Ga0207639_10267758 | 3300026041 | Bacteria | 1497 |
| 402 | Ga0207678_10021386 | 3300026067 | Bacteria | 5673 |
| 403 | Ga0207678_10023768 | 3300026067 | Bacteria | 5359 |
| 404 | Ga0207678_10025320 | 3300026067 | Bacteria | 5180 |
| 405 | Ga0207678_10040824 | 3300026067 | Bacteria | 4022 |
| 406 | Ga0207678_10052328 | 3300026067 | Bacteria | 3523 |
| 407 | Ga0207678_10064507 | 3300026067 | Bacteria | 3147 |
| 408 | Ga0207678_10698805 | 3300026067 | Bacteria | 892 |
| 409 | Ga0207708_10433723 | 3300026075 | Bacteria | 1092 |
| 410 | Ga0207708_10513717 | 3300026075 | Bacteria | 1006 |
| 411 | Ga0207702_10106927 | 3300026078 | Bacteria | 2480 |
| 412 | Ga0207702_10186192 | 3300026078 | Bacteria | 1915 |
| 413 | Ga0207702_10380959 | 3300026078 | Bacteria | 1356 |
| 414 | Ga0207702_10436225 | 3300026078 | Bacteria | 1269 |
| 415 | Ga0207648_10042881 | 3300026089 | Bacteria | 3973 |
| 416 | Ga0207648_10704914 | 3300026089 | Bacteria | 935 |
| 417 | Ga0207676_10128955 | 3300026095 | Bacteria | 2147 |
| 418 | Ga0207676_10163439 | 3300026095 | Bacteria | 1932 |
| 419 | Ga0207676_10614381 | 3300026095 | Bacteria | 1046 |
| 420 | Ga0207674_10055839 | 3300026116 | Bacteria | 4013 |
| 421 | Ga0207674_10057340 | 3300026116 | Bacteria | 3948 |
| 422 | Ga0207674_10084699 | 3300026116 | Bacteria | 3167 |
| 423 | Ga0207674_10310289 | 3300026116 | Bacteria | 1527 |
| 424 | Ga0207675_100031542 | 3300026118 | Bacteria | 4936 |
| 425 | Ga0207675_100279247 | 3300026118 | Bacteria | 1623 |
| 426 | Ga0207675_100354860 | 3300026118 | Bacteria | 1438 |
| 427 | Ga0207683_10008695 | 3300026121 | Bacteria | 8677 |
| 428 | Ga0207683_10032517 | 3300026121 | Bacteria | 4531 |
| 429 | Ga0207683_10135169 | 3300026121 | Bacteria | 2219 |
| 430 | Ga0207683_10450052 | 3300026121 | Bacteria | 1187 |
| 431 | Ga0207683_10470438 | 3300026121 | Bacteria | 1159 |
| 432 | Ga0207698_10013446 | 3300026142 | Bacteria | 5400 |
| 433 | Ga0207698_10166178 | 3300026142 | Bacteria | 1937 |
| 434 | Ga0207698_10371088 | 3300026142 | Bacteria | 1358 |
| 435 | Ga0207698_11005794 | 3300026142 | Bacteria | 844 |
| 436 | Ga0207698_11336862 | 3300026142 | Bacteria | 731 |
| 437 | Ga0209389_1000055 | 3300027296 | Bacteria | 108798 |
| 438 | Ga0209389_1000494 | 3300027296 | Bacteria | 23661 |
| 439 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 440 | Ga0209589_1000024 | 3300027357 | Bacteria | 169886 |
| 441 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 442 | Ga0209489_100123 | 3300027361 | Bacteria | 113105 |
| 443 | Ga0209489_103769 | 3300027361 | Bacteria | 28981 |
| 444 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 445 | Ga0209700_100420 | 3300027363 | Bacteria | 77617 |
| 446 | Ga0209588_1014950 | 3300027671 | Bacteria | 2383 |
| 447 | Ga0209588_1031471 | 3300027671 | Bacteria | 1698 |
| 448 | Ga0209813_10024296 | 3300027866 | Bacteria | 1732 |
| 449 | Ga0268266_10000638 | 3300028379 | Bacteria | 47680 |
| 450 | Ga0268266_10001364 | 3300028379 | Bacteria | 29475 |
| 451 | Ga0268266_10030958 | 3300028379 | Bacteria | 4544 |
| 452 | Ga0268266_10070131 | 3300028379 | Bacteria | 3037 |
| 453 | Ga0268266_10085353 | 3300028379 | Bacteria | 2758 |
| 454 | Ga0268266_10117632 | 3300028379 | Bacteria | 2362 |
| 455 | Ga0268266_10366104 | 3300028379 | Bacteria | 1357 |
| 456 | Ga0268266_10712521 | 3300028379 | Bacteria | 967 |
| 457 | Ga0268266_10768309 | 3300028379 | Bacteria | 930 |
| 458 | Ga0268266_10774729 | 3300028379 | Bacteria | 926 |
| 459 | Ga0268266_10848742 | 3300028379 | Bacteria | 883 |
| 460 | Ga0268265_10178216 | 3300028380 | Bacteria | 1824 |
| 461 | Ga0268265_10396337 | 3300028380 | Bacteria | 1274 |
| 462 | Ga0268265_10678065 | 3300028380 | Bacteria | 993 |
| 463 | Ga0268265_10770230 | 3300028380 | Bacteria | 935 |
| 464 | Ga0268264_10000051 | 3300028381 | Bacteria | 321565 |
| 465 | Ga0268264_10295742 | 3300028381 | Bacteria | 1522 |
| 466 | Ga0265337_1006988 | 3300028556 | Bacteria | 4274 |
| 467 | Ga0265334_10005278 | 3300028573 | Bacteria | 5652 |
| 468 | Ga0265318_10031122 | 3300028577 | Bacteria | 2071 |
| 469 | Ga0265323_10000560 | 3300028653 | Bacteria | 20568 |
| 470 | Ga0265336_10000550 | 3300028666 | Bacteria | 21394 |
| 471 | Ga0307517_10000856 | 3300028786 | Bacteria | 51999 |
| 472 | Ga0307515_10027090 | 3300028794 | Bacteria | 9818 |
| 473 | Ga0265338_10000231 | 3300028800 | Bacteria | 103805 |
| 474 | Ga0265324_10005806 | 3300029957 | Bacteria | 5250 |
| 475 | Ga0265339_10034239 | 3300031249 | Bacteria | 2855 |
| 476 | Ga0307513_10125136 | 3300031456 | Bacteria | 2528 |
| 477 | Ga0307509_10085186 | 3300031507 | Bacteria | 3253 |
| 478 | Ga0307508_10014562 | 3300031616 | Bacteria | 7175 |
| 479 | Ga0307508_10567299 | 3300031616 | Bacteria | 734 |
| 480 | Ga0265314_10069773 | 3300031711 | Bacteria | 2357 |
| 481 | Ga0265342_10003396 | 3300031712 | Bacteria | 13107 |
| 482 | Ga0307516_10011176 | 3300031730 | Bacteria | 9797 |
| 483 | Ga0307405_10374919 | 3300031731 | Bacteria | 1106 |
| 484 | Ga0307413_10103325 | 3300031824 | Bacteria | 1889 |
| 485 | Ga0307409_100119908 | 3300031995 | Bacteria | 2225 |
| 486 | Ga0307416_100286859 | 3300032002 | Bacteria | 1627 |
| 487 | Ga0307415_100143022 | 3300032126 | Bacteria | 1830 |
| 488 | Ga0307510_10004951 | 3300033180 | Bacteria | 15758 |
| 489 | Ga0307510_10022034 | 3300033180 | Bacteria | 7406 |
| 490 | Ga0307510_10121417 | 3300033180 | Bacteria | 2316 |
| 491 | Ga0316215_1002564 | 3300033544 | Bacteria | 1719 |
| 492 | Ga0373934_0076806 | 3300035086 | Bacteria | 1340 |
| 493 | Ga0373949_0020331 | 3300035090 | Bacteria | 1518 |
| 494 | Ga0373952_0006580 | 3300035092 | Bacteria | 2152 |
| 495 | Ga0373945_0209184 | 3300035116 | Bacteria | 812 |
| 496 | Ga0373954_0052727 | 3300035118 | Bacteria | 1911 |
| 497 | Ga0373956_0087974 | 3300035119 | Bacteria | 1431 |
| 498 | Ga0373960_0132987 | 3300035121 | Bacteria | 836 |
| 499 | Ga0373943_0157391 | 3300035170 | Bacteria | 1235 |
| 500 | Ga0373943_0234201 | 3300035170 | Bacteria | 1027 |
| 501 | Ga0373955_0108257 | 3300035172 | Bacteria | 1604 |
| 502 | Ga0373955_0122209 | 3300035172 | Bacteria | 1514 |
| 503 | Ga0373924_0027656 | 3300035410 | Bacteria | 2256 |
| 504 | Ga0373931_0008723 | 3300035691 | Bacteria | 4824 |
| 505 | Ga0373935_0557741 | 3300035692 | Bacteria | 835 |
| 506 | Ga0373927_0012565 | 3300035695 | Bacteria | 5638 |
| 507 | Ga0373927_0263187 | 3300035695 | Bacteria | 1134 |
| 508 | Ga0373927_0363133 | 3300035695 | Bacteria | 954 |
| 509 | Ga0373933_0000018 | 3300035724 | Bacteria | 98044 |
| 510 | Ga0373937_0069895 | 3300036401 | Bacteria | 3238 |
| 511 | Ga0373937_0227646 | 3300036401 | Bacteria | 1755 |
| 512 | Ga0372808_020869 | 3300036459 | Bacteria | 942 |
| 513 | Ga0373925_0401179 | 3300037068 | Bacteria | 1118 |
| 514 | Ga0373925_0639533 | 3300037068 | Bacteria | 876 |
| 515 | Ga0395899_0050587 | 3300037312 | Bacteria | 3085 |
| 516 | Ga0395899_0443317 | 3300037312 | Bacteria | 852 |
| 517 | Ga0395900_0001051 | 3300037418 | Bacteria | 35383 |
| 518 | Ga0395900_0169700 | 3300037418 | Bacteria | 2222 |
| 519 | Ga0395900_0265761 | 3300037418 | Bacteria | 1711 |
| 520 | Ga0395900_0399957 | 3300037418 | Bacteria | 1338 |
| 521 | Ga0395898_0001503 | 3300037466 | Bacteria | 32214 |
| 522 | Ga0395898_0004875 | 3300037466 | Bacteria | 14570 |
| 523 | Ga0395898_0532852 | 3300037466 | Bacteria | 1116 |
| 524 | Ga0395905_0064717 | 3300037471 | Bacteria | 3422 |
| 525 | Ga0395905_0109320 | 3300037471 | Bacteria | 2596 |
| 526 | Ga0395905_0134424 | 3300037471 | Bacteria | 2326 |
| 527 | Ga0436364_0238267 | 3300037853 | Bacteria | 846 |
| 528 | Ga0436364_0310036 | 3300037853 | Bacteria | 2843 |
| 529 | Ga0395901_0051645 | 3300038443 | Bacteria | 4275 |
| 530 | Ga0395901_0061578 | 3300038443 | Bacteria | 3905 |
| 531 | Ga0395901_0092858 | 3300038443 | Bacteria | 3159 |
| 532 | Ga0395901_0371972 | 3300038443 | Bacteria | 1472 |
| 533 | Ga0436365_0093274 | 3300039437 | Bacteria | 81442 |
| 534 | Ga0436365_0372041 | 3300039437 | Bacteria | 3768 |
| 535 | Ga0436365_1021233 | 3300039437 | Bacteria | 861 |
| 536 | Ga0436363_0554977 | 3300039450 | Bacteria | 1279 |
| 537 | Ga0436363_1689393 | 3300039450 | Bacteria | 959 |
| 538 | Ga0436362_0626323 | 3300039453 | Bacteria | 7982 |
| 539 | Ga0451789_0919161 | 3300041443 | Bacteria | 1052 |
| 540 | Ga0451833_0031051 | 3300041491 | Bacteria | 1104 |
| 541 | Ga0466969_0026762 | 3300044656 | Bacteria | 2957 |
| 542 | Ga0466972_0000124 | 3300044658 | Bacteria | 65163 |
| 543 | Ga0466972_0002537 | 3300044658 | Bacteria | 9032 |
| 544 | Ga0466965_0026765 | 3300044683 | Bacteria | 2796 |
| 545 | Ga0466965_0318596 | 3300044683 | Bacteria | 847 |
| 546 | Ga0466966_0000411 | 3300044684 | Bacteria | 27522 |
| 547 | Ga0466961_0000065 | 3300044693 | Bacteria | 63259 |
| 548 | Ga0466961_0254334 | 3300044693 | Bacteria | 1078 |
| 549 | Ga0466963_0027444 | 3300044694 | Bacteria | 3646 |
| 550 | Ga0466968_0006334 | 3300044735 | Bacteria | 4457 |
| 551 | Ga0466968_0215322 | 3300044735 | Bacteria | 903 |
| 552 | Ga0466970_0089040 | 3300044765 | Bacteria | 1674 |
| 553 | Ga0466970_0143814 | 3300044765 | Bacteria | 1315 |
| 554 | Ga0466960_0001481 | 3300044901 | Bacteria | 8559 |
| 555 | Ga0466960_0139165 | 3300044901 | Bacteria | 1288 |
| 556 | Ga0466960_0220761 | 3300044901 | Bacteria | 1043 |
| 557 | Ga0466959_0000634 | 3300045049 | Bacteria | 20407 |
| 558 | Ga0466959_0275904 | 3300045049 | Bacteria | 1155 |
| 559 | Ga0466958_0031405 | 3300045836 | Bacteria | 3157 |
| 560 | Ga0495603_0082839 | 3300046455 | Bacteria | 1879 |
| 561 | Ga0495603_0132329 | 3300046455 | Bacteria | 1452 |
| 562 | Ga0495603_0300832 | 3300046455 | Bacteria | 921 |
| 563 | Ga0495629_0003519 | 3300046459 | Bacteria | 11838 |
| 564 | Ga0495629_0206705 | 3300046459 | Bacteria | 1357 |
| 565 | Ga0495638_0011267 | 3300046460 | Bacteria | 6167 |
| 566 | Ga0495638_0085181 | 3300046460 | Bacteria | 1912 |
| 567 | Ga0495641_0062004 | 3300046461 | Bacteria | 1687 |
| 568 | Ga0495651_0017692 | 3300046462 | Bacteria | 5518 |
| 569 | Ga0495651_0424287 | 3300046462 | Bacteria | 864 |
| 570 | Ga0495580_0092623 | 3300046472 | Bacteria | 2104 |
| 571 | Ga0495639_0056409 | 3300046475 | Bacteria | 1793 |
| 572 | Ga0495639_0061813 | 3300046475 | Bacteria | 1718 |
| 573 | Ga0495664_0011915 | 3300046477 | Bacteria | 4914 |
| 574 | Ga0495584_0131529 | 3300046491 | Bacteria | 1270 |
| 575 | Ga0495585_0283872 | 3300046492 | Bacteria | 818 |
| 576 | Ga0495594_0065555 | 3300046499 | Bacteria | 2014 |
| 577 | Ga0495596_0092262 | 3300046500 | Bacteria | 1176 |
| 578 | Ga0495583_0044422 | 3300046506 | Bacteria | 2062 |
| 579 | Ga0495606_0065243 | 3300046507 | Bacteria | 2314 |
| 580 | Ga0495606_0160809 | 3300046507 | Bacteria | 1310 |
| 581 | Ga0495610_0078267 | 3300046512 | Bacteria | 1525 |
| 582 | Ga0495616_0057328 | 3300046513 | Bacteria | 1921 |
| 583 | Ga0495616_0084560 | 3300046513 | Bacteria | 1512 |
| 584 | Ga0495616_0253094 | 3300046513 | Bacteria | 756 |
| 585 | Ga0495618_0141248 | 3300046514 | Bacteria | 1540 |
| 586 | Ga0495620_0020979 | 3300046515 | Bacteria | 3180 |
| 587 | Ga0495643_0045119 | 3300046522 | Bacteria | 2393 |
| 588 | Ga0495648_0008955 | 3300046524 | Bacteria | 7820 |
| 589 | Ga0495648_0218345 | 3300046524 | Bacteria | 942 |
| 590 | Ga0495666_0133388 | 3300046526 | Bacteria | 1160 |
| 591 | Ga0495652_0089784 | 3300046529 | Bacteria | 2515 |
| 592 | Ga0495652_0122342 | 3300046529 | Bacteria | 2073 |
| 593 | Ga0495652_0391588 | 3300046529 | Bacteria | 986 |
| 594 | Ga0495652_0457905 | 3300046529 | Bacteria | 892 |
| 595 | Ga0495654_0129733 | 3300046530 | Bacteria | 1133 |
| 596 | Ga0495640_0027614 | 3300046533 | Bacteria | 4091 |
| 597 | Ga0495640_0081673 | 3300046533 | Bacteria | 2148 |
| 598 | Ga0495640_0087035 | 3300046533 | Bacteria | 2067 |
| 599 | Ga0495586_0158427 | 3300046535 | Bacteria | 1276 |
| 600 | Ga0495587_0269474 | 3300046536 | Bacteria | 955 |
| 601 | Ga0495609_0090829 | 3300046538 | Bacteria | 1328 |
| 602 | Ga0495645_0017494 | 3300046543 | Bacteria | 5135 |
| 603 | Ga0495645_0163321 | 3300046543 | Bacteria | 1538 |
| 604 | Ga0495622_0014799 | 3300046557 | Bacteria | 3626 |
| 605 | Ga0495622_0265165 | 3300046557 | Bacteria | 753 |
| 606 | Ga0495667_0044811 | 3300046559 | Bacteria | 2929 |
| 607 | Ga0495668_0084179 | 3300046616 | Bacteria | 1744 |
| 608 | Ga0495668_0379536 | 3300046616 | Bacteria | 776 |
| 609 | Ga0495634_0056964 | 3300046642 | Bacteria | 2610 |
| 610 | Ga0495611_0244628 | 3300046648 | Bacteria | 832 |
| 611 | Ga0495625_0225233 | 3300046660 | Bacteria | 1227 |
| 612 | Ga0495635_0158351 | 3300046663 | Bacteria | 1541 |
| 613 | Ga0495635_0366258 | 3300046663 | Bacteria | 960 |
| 614 | Ga0495588_0001353 | 3300046674 | Bacteria | 10458 |
| 615 | Ga0495657_0002384 | 3300046675 | Bacteria | 15809 |
| 616 | Ga0495657_0014532 | 3300046675 | Bacteria | 5776 |
| 617 | Ga0495599_0004607 | 3300046678 | Bacteria | 8178 |
| 618 | Ga0495599_0065022 | 3300046678 | Bacteria | 2279 |
| 619 | Ga0495599_0067383 | 3300046678 | Bacteria | 2236 |
| 620 | Ga0495623_0010248 | 3300046679 | Bacteria | 6064 |
| 621 | Ga0495623_0320794 | 3300046679 | Bacteria | 851 |
| 622 | Ga0495646_0113582 | 3300046680 | Bacteria | 1540 |
| 623 | Ga0495646_0120906 | 3300046680 | Bacteria | 1482 |
| 624 | Ga0495613_0062464 | 3300046689 | Bacteria | 2726 |
| 625 | Ga0495613_0274008 | 3300046689 | Bacteria | 1173 |
| 626 | Ga0495613_0756129 | 3300046689 | Bacteria | 637 |
| 627 | Ga0495624_0067145 | 3300046690 | Bacteria | 2238 |
| 628 | Ga0495624_0110799 | 3300046690 | Bacteria | 1688 |
| 629 | Ga0495670_0115431 | 3300046691 | Bacteria | 1392 |
| 630 | Ga0495671_0043951 | 3300046692 | Bacteria | 2241 |
| 631 | Ga0495671_0072278 | 3300046692 | Bacteria | 1694 |
| 632 | Ga0495671_0286670 | 3300046692 | Bacteria | 793 |
| 633 | Ga0495649_0024307 | 3300046694 | Bacteria | 3379 |
| 634 | Ga0495600_0210544 | 3300046809 | Bacteria | 1246 |
| 635 | Ga0495660_0076880 | 3300046810 | Bacteria | 1758 |
| 636 | Ga0495581_0014180 | 3300047315 | Bacteria | 4620 |
| 637 | Ga0495581_0041048 | 3300047315 | Bacteria | 2677 |
| 638 | Ga0495604_0002741 | 3300047317 | Bacteria | 14128 |
| 639 | Ga0495604_0006835 | 3300047317 | Bacteria | 9039 |
| 640 | Ga0495674_0018428 | 3300047319 | Bacteria | 6499 |
| 641 | Ga0495672_0017605 | 3300047320 | Bacteria | 4776 |
| 642 | Ga0495672_0050250 | 3300047320 | Bacteria | 2463 |
| 643 | Ga0495676_0055266 | 3300047321 | Bacteria | 3149 |
| 644 | Ga0495676_0102528 | 3300047321 | Bacteria | 2114 |
| 645 | Ga0495676_0374195 | 3300047321 | Bacteria | 949 |
| 646 | Ga0495680_0001876 | 3300047322 | Bacteria | 22116 |
| 647 | Ga0495680_0085161 | 3300047322 | Bacteria | 2380 |
| 648 | Ga0495687_016979 | 3300047443 | Bacteria | 3645 |
| 649 | Ga0495675_0007387 | 3300047444 | Bacteria | 6766 |
| 650 | Ga0495685_082541 | 3300047447 | Bacteria | 1070 |
| 651 | Ga0495673_0060041 | 3300047469 | Bacteria | 1632 |
| 652 | Ga0495673_0061680 | 3300047469 | Bacteria | 1604 |
| 653 | Ga0495673_0108676 | 3300047469 | Bacteria | 1112 |
| 654 | Ga0495684_0012933 | 3300047471 | Bacteria | 6442 |
| 655 | Ga0495684_0436988 | 3300047471 | Bacteria | 912 |
| 656 | Ga0495686_0114233 | 3300047472 | Bacteria | 1616 |
| 657 | Ga0495686_0147890 | 3300047472 | Bacteria | 1381 |
| 658 | Ga0495686_0179200 | 3300047472 | Bacteria | 1229 |
| 659 | Ga0495593_0079436 | 3300047673 | Bacteria | 1698 |
| 660 | Ga0495602_0134279 | 3300048088 | Bacteria | 1968 |
| 661 | Ga0495602_0543596 | 3300048088 | Bacteria | 806 |
| 662 | Ga0496101_0055034 | 3300048904 | Bacteria | 2873 |
| 663 | Ga0496101_0149898 | 3300048904 | Bacteria | 1783 |
| 664 | Ga0496101_0559044 | 3300048904 | Bacteria | 905 |
| 665 | Ga0496102_0107971 | 3300048905 | Bacteria | 2592 |
| 666 | Ga0496102_0125274 | 3300048905 | Bacteria | 2401 |
| 667 | Ga0496102_0134420 | 3300048905 | Bacteria | 2317 |
| 668 | Ga0496102_0252451 | 3300048905 | Bacteria | 1663 |
| 669 | Ga0496103_0080553 | 3300048906 | Bacteria | 2047 |
| 670 | Ga0496103_0338198 | 3300048906 | Bacteria | 968 |
| 671 | Ga0496103_0629569 | 3300048906 | Bacteria | 682 |
| 672 | Ga0496104_0009070 | 3300048907 | Bacteria | 8843 |
| 673 | Ga0496104_0024225 | 3300048907 | Bacteria | 5582 |
| 674 | Ga0496104_0037936 | 3300048907 | Bacteria | 4506 |
| 675 | Ga0496104_0068302 | 3300048907 | Bacteria | 3377 |
| 676 | Ga0496104_0103508 | 3300048907 | Bacteria | 2727 |
| 677 | Ga0496104_0375050 | 3300048907 | Bacteria | 1335 |
| 678 | Ga0496105_0022832 | 3300048908 | Bacteria | 5070 |
| 679 | Ga0496105_0039456 | 3300048908 | Bacteria | 3892 |
| 680 | Ga0496105_0099088 | 3300048908 | Bacteria | 2407 |
| 681 | Ga0496105_0589435 | 3300048908 | Bacteria | 864 |
| 682 | Ga0496106_0026873 | 3300048909 | Bacteria | 4286 |
| 683 | Ga0496106_0038587 | 3300048909 | Bacteria | 3575 |
| 684 | Ga0496106_0264939 | 3300048909 | Bacteria | 1375 |
| 685 | Ga0496106_0271437 | 3300048909 | Bacteria | 1358 |
| 686 | Ga0496106_0285674 | 3300048909 | Bacteria | 1322 |
| 687 | Ga0496107_0011974 | 3300048910 | Bacteria | 6054 |
| 688 | Ga0496107_0164616 | 3300048910 | Bacteria | 1644 |
| 689 | Ga0496107_0237925 | 3300048910 | Bacteria | 1355 |
| 690 | Ga0496107_0709954 | 3300048910 | Bacteria | 739 |
| 691 | Ga0496108_0012004 | 3300048911 | Bacteria | 7048 |
| 692 | Ga0496108_0013488 | 3300048911 | Bacteria | 6669 |
| 693 | Ga0496108_0080117 | 3300048911 | Bacteria | 2766 |
| 694 | Ga0496108_0243202 | 3300048911 | Bacteria | 1565 |
| 695 | Ga0496108_0467421 | 3300048911 | Bacteria | 1102 |
| 696 | Ga0496109_0023442 | 3300048912 | Bacteria | 5480 |
| 697 | Ga0496109_0222517 | 3300048912 | Bacteria | 1775 |
| 698 | Ga0496109_0275200 | 3300048912 | Bacteria | 1586 |
| 699 | Ga0496109_0296979 | 3300048912 | Bacteria | 1523 |
| 700 | Ga0496109_0721487 | 3300048912 | Bacteria | 934 |
| 701 | Ga0496109_0893173 | 3300048912 | Bacteria | 826 |
| 702 | Ga0496110_0015719 | 3300048913 | Bacteria | 6306 |
| 703 | Ga0496110_0015752 | 3300048913 | Bacteria | 6301 |
| 704 | Ga0496110_0980438 | 3300048913 | Bacteria | 752 |
| 705 | Ga0496111_0056301 | 3300048914 | Bacteria | 2845 |
| 706 | Ga0496111_0152814 | 3300048914 | Bacteria | 1712 |
| 707 | Ga0496111_0583484 | 3300048914 | Bacteria | 819 |
| 708 | Ga0496112_0045698 | 3300048915 | Bacteria | 4293 |
| 709 | Ga0496112_0053279 | 3300048915 | Bacteria | 3973 |
| 710 | Ga0496112_0242029 | 3300048915 | Bacteria | 1756 |
| 711 | Ga0496112_0704478 | 3300048915 | Bacteria | 937 |
| 712 | Ga0496112_0938372 | 3300048915 | Bacteria | 786 |
| 713 | Ga0496113_0004044 | 3300048916 | Bacteria | 8931 |
| 714 | Ga0496113_0055910 | 3300048916 | Bacteria | 2960 |
| 715 | Ga0496113_0297442 | 3300048916 | Bacteria | 1292 |
| 716 | Ga0496113_0534347 | 3300048916 | Bacteria | 941 |
| 717 | Ga0496114_0014145 | 3300048917 | Bacteria | 6399 |
| 718 | Ga0496114_0121968 | 3300048917 | Bacteria | 2242 |
| 719 | Ga0496115_0005405 | 3300048918 | Bacteria | 9289 |
| 720 | Ga0496115_0032960 | 3300048918 | Bacteria | 4089 |
| 721 | Ga0496115_0069485 | 3300048918 | Bacteria | 2853 |
| 722 | Ga0496116_0028887 | 3300048919 | Bacteria | 4009 |
| 723 | Ga0496116_0032538 | 3300048919 | Bacteria | 3715 |
| 724 | Ga0496116_0242663 | 3300048919 | Bacteria | 904 |
| 725 | Ga0496117_0061833 | 3300048920 | Bacteria | 2571 |
| 726 | Ga0496117_0071741 | 3300048920 | Bacteria | 2319 |
| 727 | Ga0496117_0301026 | 3300048920 | Bacteria | 849 |
| 728 | Ga0496118_0002445 | 3300048921 | Bacteria | 25000 |
| 729 | Ga0496119_0015983 | 3300048922 | Bacteria | 5739 |
| 730 | Ga0496119_0069417 | 3300048922 | Bacteria | 2071 |
| 731 | Ga0496119_0215489 | 3300048922 | Bacteria | 985 |
| 732 | Ga0496120_0035858 | 3300048923 | Bacteria | 2958 |
| 733 | Ga0496121_0000452 | 3300048924 | Bacteria | 80796 |
| 734 | Ga0496121_0000571 | 3300048924 | Bacteria | 69504 |
| 735 | Ga0496121_0024152 | 3300048924 | Bacteria | 5823 |
| 736 | Ga0496121_0043447 | 3300048924 | Bacteria | 3891 |
| 737 | Ga0496121_0050510 | 3300048924 | Bacteria | 3512 |
| 738 | Ga0496121_0051348 | 3300048924 | Bacteria | 3473 |
| 739 | Ga0496121_0071559 | 3300048924 | Bacteria | 2788 |
| 740 | Ga0496121_0114848 | 3300048924 | Bacteria | 2045 |
| 741 | Ga0496121_0322890 | 3300048924 | Bacteria | 1039 |
| 742 | Ga0496122_0205725 | 3300048925 | Bacteria | 1146 |
| 743 | Ga0496124_0000267 | 3300048927 | Bacteria | 101138 |
| 744 | Ga0496124_0026050 | 3300048927 | Bacteria | 5280 |
| 745 | Ga0496124_0053485 | 3300048927 | Bacteria | 3422 |
| 746 | Ga0496125_0043745 | 3300048928 | Bacteria | 3796 |
| 747 | Ga0496125_0059362 | 3300048928 | Bacteria | 3083 |
| 748 | Ga0496125_0069134 | 3300048928 | Bacteria | 2773 |
| 749 | Ga0496126_0015704 | 3300048929 | Bacteria | 7609 |
| 750 | Ga0496126_0035587 | 3300048929 | Bacteria | 4665 |
| 751 | Ga0496126_0052619 | 3300048929 | Bacteria | 3699 |
| 752 | Ga0496126_0059836 | 3300048929 | Bacteria | 3429 |
| 753 | Ga0496126_0071503 | 3300048929 | Bacteria | 3088 |
| 754 | Ga0496126_0355971 | 3300048929 | Bacteria | 1196 |
| 755 | Ga0496126_0366683 | 3300048929 | Bacteria | 1175 |
| 756 | Ga0496126_0580061 | 3300048929 | Bacteria | 886 |
| 757 | Ga0496126_0676636 | 3300048929 | Bacteria | 804 |
| 758 | Ga0495682_0014877 | 3300049460 | Bacteria | 2948 |
| 759 | Ga0495682_0139946 | 3300049460 | Bacteria | 864 |
| 760 | Ga0501069_0480989 | 3300049585 | Bacteria | 740 |
| 761 | Ga0501071_0175538 | 3300049587 | Bacteria | 1605 |
| 762 | Ga0501076_0123356 | 3300049592 | Bacteria | 2098 |
| 763 | Ga0501080_0060360 | 3300049742 | Bacteria | 3530 |
| 764 | Ga0501035_0618962 | 3300049822 | Bacteria | 881 |
| 765 | nmdc:mga03683_133639_c1 | 3300050489 | Bacteria | 1111 |
| 766 | nmdc:mga03683_184261_c1 | 3300050489 | Bacteria | 953 |
| 767 | nmdc:mga03n38_155829_c1 | 3300050490 | Bacteria | 1153 |
| 768 | nmdc:mga03n38_208_c1 | 3300050490 | Bacteria | 12446 |
| 769 | nmdc:mga03n38_58574_c1 | 3300050490 | Bacteria | 1746 |
| 770 | nmdc:mga00v17_145883_c1 | 3300050491 | Bacteria | 1519 |
| 771 | nmdc:mga00v17_439992_c1 | 3300050491 | Bacteria | 847 |
| 772 | nmdc:mga00v17_55068_c1 | 3300050491 | Bacteria | 2428 |
| 773 | nmdc:mga0yw44_14616_c1 | 3300050492 | Bacteria | 4175 |
| 774 | nmdc:mga0yw44_223543_c1 | 3300050492 | Bacteria | 1248 |
| 775 | nmdc:mga0yw44_557513_c1 | 3300050492 | Bacteria | 778 |
| 776 | nmdc:mga0yw44_66485_c1 | 3300050492 | Bacteria | 2225 |
| 777 | nmdc:mga0k408_122214_c1 | 3300050493 | Bacteria | 1543 |
| 778 | nmdc:mga0k408_211493_c1 | 3300050493 | Bacteria | 1158 |
| 779 | nmdc:mga0k408_4612_c1 | 3300050493 | Bacteria | 5915 |
| 780 | nmdc:mga06z11_118063_c1 | 3300050494 | Bacteria | 1477 |
| 781 | nmdc:mga06z11_199908_c1 | 3300050494 | Bacteria | 1160 |
| 782 | nmdc:mga06z11_57073_c1 | 3300050494 | Bacteria | 2021 |
| 783 | nmdc:mga06z11_73502_c1 | 3300050494 | Bacteria | 1816 |
| 784 | nmdc:mga04h51_17986_c1 | 3300050495 | Bacteria | 2075 |
| 785 | nmdc:mga04h51_53954_c1 | 3300050495 | Bacteria | 1357 |
| 786 | nmdc:mga07m45_14648_c1 | 3300050496 | Bacteria | 4182 |
| 787 | nmdc:mga07m45_182616_c1 | 3300050496 | Bacteria | 1220 |
| 788 | nmdc:mga07m45_488800_c1 | 3300050496 | Bacteria | 713 |
| 789 | nmdc:mga07m45_74631_c1 | 3300050496 | Bacteria | 1932 |
| 790 | nmdc:mga08y16_211641_c1 | 3300050511 | Bacteria | 2008 |
| 791 | nmdc:mga08y16_527905_c1 | 3300050511 | Bacteria | 1196 |
| 792 | nmdc:mga0n895_1120456_c1 | 3300050512 | Bacteria | 764 |
| 793 | nmdc:mga0n895_21774_c1 | 3300050512 | Bacteria | 6000 |
| 794 | nmdc:mga0rr50_171235_c1 | 3300050513 | Bacteria | 1769 |
| 795 | nmdc:mga08x19_97007_c1 | 3300050514 | Bacteria | 1951 |
| 796 | nmdc:mga0a205_133434_c1 | 3300050515 | Bacteria | 2383 |
| 797 | nmdc:mga0sz30_23037_c2 | 3300050516 | Bacteria | 1851 |
| 798 | nmdc:mga0sz30_55224_c1 | 3300050516 | Bacteria | 1690 |
| 799 | Ga0495612_0053958 | 3300053078 | Bacteria | 1655 |
| 800 | Ga0500610_0158106 | 3300053079 | Bacteria | 1130 |
| 801 | Ga0500635_0006464 | 3300053080 | Bacteria | 3131 |
| 802 | Ga0500635_0062937 | 3300053080 | Bacteria | 1299 |
| 803 | Ga0495655_0014011 | 3300053083 | Bacteria | 1672 |
| 804 | Ga0495619_0007832 | 3300053085 | Bacteria | 6762 |
| 805 | Ga0495619_0514646 | 3300053085 | Bacteria | 822 |
| 806 | Ga0500578_0120031 | 3300053086 | Bacteria | 1653 |
| 807 | Ga0500578_0297900 | 3300053086 | Bacteria | 957 |
| 808 | Ga0500643_000028 | 3300053087 | Bacteria | 245672 |
| 809 | Ga0500644_0052058 | 3300053088 | Bacteria | 1408 |
| 810 | Ga0500646_0064528 | 3300053090 | Bacteria | 1085 |
| 811 | Ga0500647_0018007 | 3300053091 | Bacteria | 3267 |
| 812 | Ga0500583_0022614 | 3300053092 | Bacteria | 2636 |
| 813 | Ga0500651_0038098 | 3300053093 | Bacteria | 3029 |
| 814 | Ga0500566_0000245 | 3300053094 | Bacteria | 28976 |
| 815 | Ga0500566_0002949 | 3300053094 | Bacteria | 10161 |
| 816 | Ga0500566_0069046 | 3300053094 | Bacteria | 1986 |
| 817 | Ga0500641_0027837 | 3300053096 | Bacteria | 2203 |
| 818 | Ga0500641_0065899 | 3300053096 | Bacteria | 1516 |
| 819 | Ga0500650_0092938 | 3300053098 | Bacteria | 1412 |
| 820 | Ga0500650_0114678 | 3300053098 | Bacteria | 1257 |
| 821 | Ga0500555_002075 | 3300053103 | Bacteria | 5892 |
| 822 | Ga0500556_0017153 | 3300053104 | Bacteria | 2264 |
| 823 | Ga0500557_000116 | 3300053105 | Bacteria | 22549 |
| 824 | Ga0500562_044412 | 3300053108 | Bacteria | 1183 |
| 825 | Ga0500569_002793 | 3300053109 | Bacteria | 3483 |
| 826 | Ga0500572_004309 | 3300053111 | Bacteria | 3231 |
| 827 | Ga0500595_000580 | 3300053119 | Bacteria | 21802 |
| 828 | Ga0500595_004072 | 3300053119 | Bacteria | 6645 |
| 829 | Ga0500595_035681 | 3300053119 | Bacteria | 1635 |
| 830 | Ga0500595_058462 | 3300053119 | Bacteria | 1172 |
| 831 | Ga0500607_228960 | 3300053121 | Bacteria | 764 |
| 832 | Ga0500642_0000113 | 3300053130 | Bacteria | 37567 |
| 833 | Ga0500642_0001807 | 3300053130 | Bacteria | 6174 |
| 834 | Ga0500642_0233797 | 3300053130 | Bacteria | 848 |
| 835 | Ga0500655_017624 | 3300053133 | Bacteria | 1322 |
| 836 | Ga0500655_017634 | 3300053133 | Bacteria | 1322 |
| 837 | Ga0500559_0000103 | 3300053136 | Bacteria | 66422 |
| 838 | Ga0500559_0016441 | 3300053136 | Bacteria | 3124 |
| 839 | Ga0500559_0115729 | 3300053136 | Bacteria | 1244 |
| 840 | Ga0500564_180237 | 3300053138 | Bacteria | 881 |
| 841 | Ga0500568_0005758 | 3300053139 | Bacteria | 6344 |
| 842 | Ga0500568_0043749 | 3300053139 | Bacteria | 1789 |
| 843 | Ga0500577_0040536 | 3300053142 | Bacteria | 1694 |
| 844 | Ga0500577_0103682 | 3300053142 | Bacteria | 1166 |
| 845 | Ga0500577_0228024 | 3300053142 | Bacteria | 807 |
| 846 | Ga0500579_184734 | 3300053143 | Bacteria | 811 |
| 847 | Ga0500590_080114 | 3300053148 | Bacteria | 1606 |
| 848 | Ga0500590_083689 | 3300053148 | Bacteria | 1563 |
| 849 | Ga0500603_016640 | 3300053150 | Bacteria | 1748 |
| 850 | Ga0500604_0006950 | 3300053151 | Bacteria | 2996 |
| 851 | Ga0500616_0000046 | 3300053153 | Bacteria | 333409 |
| 852 | Ga0500620_026632 | 3300053155 | Bacteria | 1792 |
| 853 | Ga0500622_0188348 | 3300053156 | Bacteria | 947 |
| 854 | Ga0500633_0131813 | 3300053160 | Bacteria | 933 |
| 855 | Ga0500634_0053113 | 3300053161 | Bacteria | 2175 |
| 856 | Ga0500638_016392 | 3300053162 | Bacteria | 3418 |
| 857 | Ga0500638_042327 | 3300053162 | Bacteria | 2212 |
| 858 | Ga0500638_094379 | 3300053162 | Bacteria | 1404 |
| 859 | Ga0500636_0000054 | 3300053177 | Bacteria | 54446 |
| 860 | Ga0500636_0108981 | 3300053177 | Bacteria | 1567 |
| 861 | Ga0500637_0000303 | 3300053178 | Bacteria | 18607 |
| 862 | Ga0500637_0027373 | 3300053178 | Bacteria | 3147 |
| 863 | Ga0500637_0273034 | 3300053178 | Bacteria | 934 |
| 864 | Ga0500611_005942 | 3300053727 | Bacteria | 1749 |
| 865 | Ga0500625_017426 | 3300053729 | Bacteria | 3355 |
| 866 | Ga0500645_005369 | 3300053730 | Bacteria | 4733 |
| 867 | Ga0500645_048584 | 3300053730 | Bacteria | 1242 |
| 868 | Ga0500552_020370 | 3300053733 | Bacteria | 938 |
| 869 | Ga0500596_005620 | 3300053735 | Bacteria | 2185 |
| 870 | Ga0500596_006582 | 3300053735 | Bacteria | 1955 |
| 871 | Ga0500599_002194 | 3300053736 | Bacteria | 2321 |
| 872 | Ga0500601_000834 | 3300053737 | Bacteria | 3791 |
| 873 | Ga0500661_001086 | 3300055283 | Bacteria | 5115 |
| 874 | Ga0501082_0090266 | 3300060353 | Bacteria | 2646 |
| 875 | Ga0530510_0254120 | 3300061734 | Bacteria | 1310 |
| 876 | 2507504485 | 2507262055 | Bacteria | 8048963 |
| 877 | 2508545909 | 2508501009 | Bacteria | 7784016 |
| 878 | 2508694741 | 2508501042 | Bacteria | 8719808 |
| 879 | 2511400264 | 2511231028 | Bacteria | 8046582 |
| 880 | 2513624280 | 2513237092 | Bacteria | 8341956 |
| 881 | 2513638767 | 2513237094 | Bacteria | 8789602 |
| 882 | 2513649243 | 2513237095 | Bacteria | 8976980 |
| 883 | 2513694581 | 2513237101 | Bacteria | 7952346 |
| 884 | 2513701643 | 2513237102 | Bacteria | 7703324 |
| 885 | 2513716656 | 2513237104 | Bacteria | 10034502 |
| 886 | 2513874131 | 2513237139 | Bacteria | 8737671 |
| 887 | 2514010104 | 2513237161 | Bacteria | 8871253 |
| 888 | 2515624338 | 2515154112 | Bacteria | 8294334 |
| 889 | 2517103029 | 2517093001 | Bacteria | 9002274 |
| 890 | 2524438868 | 2524023205 | Bacteria | 8918781 |
| 891 | 2528849486 | 2528768022 | Bacteria | 10457665 |
| 892 | 2617350256 | 2617270735 | Bacteria | 9163226 |
| 893 | 2617374346 | 2617270741 | Bacteria | 8201522 |
| 894 | 2723842398 | 2721755755 | Bacteria | 8322773 |
| 895 | 2728748321 | 2728368998 | Bacteria | 8720350 |
| 896 | 2745080371 | 2744054633 | Bacteria | 8678936 |
| 897 | 2793059257 | 2791355196 | Bacteria | 7323613 |
| 898 | 2793070197 | 2791355197 | Bacteria | 8420563 |
| 899 | 2793078764 | |||
| 900 | 2805920850 | 2802429603 | Bacteria | 8777136 |
| 901 | 2818240632 | 2816332527 | Bacteria | 8933356 |
| 902 | 2824607602 | 2824600985 | Bacteria | 8488197 |
| 903 | 2824615346 | 2824609381 | Bacteria | 8672835 |
| 904 | 2824618797 | 2824617872 | Bacteria | 8814715 |
| 905 | 2824628903 | 2824626560 | Bacteria | 8813858 |
| 906 | 2824638414 | 2824635225 | Bacteria | 8785348 |
| 907 | 2824648046 | 2824644064 | Bacteria | 8743947 |
| 908 | 2824657967 | 2824653114 | Bacteria | 8493680 |
| 909 | 2824665883 | 2824661429 | Bacteria | 9877870 |
| 910 | 2824675853 | 2824671348 | Bacteria | 8369588 |
| 911 | 2824681638 | 2824679649 | Bacteria | 8248951 |
| 912 | 2824692814 | 2824687955 | Bacteria | 8360029 |
| 913 | 2824699391 | 2824696289 | Bacteria | 8335049 |
| 914 | 2824710856 | 2824704595 | Bacteria | 9667483 |
| 915 | 2824722615 | 2824714736 | Bacteria | 8717648 |
| 916 | 2824726005 | 2824723954 | Bacteria | 8758240 |
| 917 | 2824736433 | 2824732956 | Bacteria | 7810675 |
| 918 | 2824751039 | 2824746037 | Bacteria | 7911610 |
| 919 | 2824761521 | 2824753945 | Bacteria | 9787441 |
| 920 | 2824765064 | 2824763712 | Bacteria | 9792355 |
| 921 | 2824778047 | 2824773399 | Bacteria | 8360218 |
| 922 | 2838125984 | 2838122688 | Bacteria | 8803140 |
| 923 | 2841942621 | 2841941048 | Bacteria | 8688029 |
| 924 | 2841953027 | 2841949485 | Bacteria | 8680857 |
| 925 | 2841963878 | 2841957949 | Bacteria | 8652217 |
| 926 | 2841970947 | 2841966195 | Bacteria | 8673214 |
| 927 | 2841977795 | 2841974524 | Bacteria | 8931498 |
| 928 | 2841984643 | 2841983080 | Bacteria | 8395090 |
| 929 | 2842041636 | 2842038055 | Bacteria | 8002051 |
| 930 | 2842049678 | 2842045827 | Bacteria | 8006841 |
| 931 | 2844321468 | 2844315083 | Bacteria | 8138177 |
| 932 | 2847931928 | 2847930680 | Bacteria | 9342022 |
| 933 | 2847943168 | 2847939898 | Bacteria | 8606328 |
| 934 | 2849076908 | 2849076700 | Bacteria | 7039503 |
| 935 | 2857514828 | 2857509624 | Bacteria | 7472071 |
| 936 | 2874595375 | 2874590934 | Bacteria | 8299676 |
| 937 | 2874608911 | 2874604998 | Bacteria | 7834745 |
| 938 | 2874620424 | 2874612657 | Bacteria | 8252029 |
| 939 | 2874621914 | 2874620515 | Bacteria | 8290088 |
| 940 | 2874629592 | 2874628541 | Bacteria | 8630250 |
| 941 | 2874651801 | 2874645413 | Bacteria | 8214782 |
| 942 | 2876763622 | 2876761206 | Bacteria | 10111113 |
| 943 | 2876775569 | 2876771140 | Bacteria | 8287509 |
| 944 | 2876812910 | 2876808645 | Bacteria | 8824342 |
| 945 | 2876823561 | 2876818435 | Bacteria | 8274608 |
| 946 | 2879079660 | 2879074833 | Bacteria | 8279565 |
| 947 | 2879091162 | 2879083081 | Bacteria | 8587928 |
| 948 | 2879104443 | 2879099564 | Bacteria | 10442239 |
| 949 | 2879112371 | 2879110137 | Bacteria | 8907982 |
| 950 | 2879133936 | 2879127579 | Bacteria | 8294491 |
| 951 | 2879145069 | 2879142872 | Bacteria | 8267021 |
| 952 | 2881364580 | 2881364244 | Bacteria | 7710352 |
| 953 | 2881673323 | 2881665667 | Bacteria | 8175609 |
| 954 | 2885374340 | 2885366525 | Bacteria | 8326213 |
| 955 | 2885413720 | 2885409591 | Bacteria | 9235467 |
| 956 | 2888387312 | 2888378607 | Bacteria | 9652610 |
| 957 | 2888391395 | 2888388044 | Bacteria | 7304136 |
| 958 | 2888426991 | 2888419890 | Bacteria | 7857137 |
| 959 | 2889034384 | 2889033259 | Bacteria | 9099371 |
| 960 | 2903727953 | 2903727486 | Bacteria | 8281579 |
| 961 | 2904669493 | 2904666416 | Bacteria | 8226587 |
| 962 | 2904711305 | |||
| 963 | 2904716497 | 2904711408 | Bacteria | 9771557 |
| 964 | 2906602563 | 2906602504 | Bacteria | 8295279 |
| 965 | 2906629677 | 2906626472 | Bacteria | 8826946 |
| 966 | 2906645793 | 2906643746 | Bacteria | 8722424 |
| 967 | 2908757590 | 2908756301 | Bacteria | 8864324 |
| 968 | 2908776828 | 2908775508 | Bacteria | 8092255 |
| 969 | 2922364836 | 2922361189 | Bacteria | 7436256 |
| 970 | 2922370260 | |||
| 971 | 2922400120 | 2922393267 | Bacteria | 8285685 |
| 972 | 2929622687 | 2929615660 | Bacteria | 9193770 |
| 973 | 2929632210 | 2929624759 | Bacteria | 9339455 |
| 974 | 2932789975 | 2932784394 | Bacteria | 9704911 |
| 975 | 2932800652 | 2932794094 | Bacteria | 7915132 |
| 976 | 2932808383 | 2932801729 | Bacteria | 7987968 |
| 977 | 2932815517 | 2932809354 | Bacteria | 9135765 |
| 978 | 2932824907 | 2932818245 | Bacteria | 9955613 |
| 979 | 2932829169 | 2932828146 | Bacteria | 9745859 |
| 980 | 2933584682 | 2933577622 | Bacteria | 9116884 |
| 981 | 2935613111 | 2935608549 | Bacteria | 8203142 |
| 982 | 2935617644 | 2935616580 | Bacteria | 9032984 |
| 983 | 2935632986 | 2935630451 | Bacteria | 8169952 |
| 984 | 2935643689 | 2935638405 | Bacteria | 10015038 |
| 985 | 2935654067 | 2935648319 | Bacteria | 8801166 |
| 986 | 2935662831 | 2935656913 | Bacteria | 8965014 |
| 987 | 2935671001 | 2935665750 | Bacteria | 9571747 |
| 988 | 2935681644 | 2935675223 | Bacteria | 9928132 |
| 989 | 2935692621 | 2935684952 | Bacteria | 9590419 |
| 990 | 2935702607 | 2935694250 | Bacteria | 9291695 |
| 991 | 2935711895 | 2935703347 | Bacteria | 10242284 |
| 992 | 2935721239 | 2935713505 | Bacteria | 9608509 |
| 993 | 2935730767 | 2935722832 | Bacteria | 9608746 |
| 994 | 2935739929 | 2935732158 | Bacteria | 9706831 |
| 995 | 2935748967 | 2935741537 | Bacteria | 9707219 |
| 996 | 2935758837 | 2935750917 | Bacteria | 9590372 |
| 997 | 2935767101 | 2935760218 | Bacteria | 9817913 |
| 998 | 2935774863 | 2935769743 | Bacteria | 7878163 |
| 999 | 2935779951 | 2935777560 | Bacteria | 8077691 |
| 1000 | 2935792219 | 2935785616 | Bacteria | 7962367 |
| 1001 | 2935798612 | 2935793552 | Bacteria | 8012592 |
| 1002 | 2935806866 | 2935801545 | Bacteria | 9301974 |
| 1003 | 2935818869 | 2935810662 | Bacteria | 9401221 |
| 1004 | 2935825037 | 2935819856 | Bacteria | 8261050 |
| 1005 | 2935834374 | 2935827899 | Bacteria | 10038562 |
| 1006 | 2935843901 | 2935837841 | Bacteria | 9454360 |
| 1007 | 2935852256 | 2935847175 | Bacteria | 8228321 |
| 1008 | 2935856857 | 2935855204 | Bacteria | 9035059 |
| 1009 | 2935868384 | 2935864058 | Bacteria | 9784707 |
| 1010 | 2935879694 | 2935873716 | Bacteria | 9632195 |
| 1011 | 2935883490 | 2935883170 | Bacteria | 7964738 |
| 1012 | 2935910689 | 2935908558 | Bacteria | 8568796 |
| 1013 | 2935921869 | 2935916978 | Bacteria | 9113783 |
| 1014 | 2935929992 | 2935926038 | Bacteria | 8601059 |
| 1015 | 2935937660 | 2935934488 | Bacteria | 8602579 |
| 1016 | 2935949764 | 2935942939 | Bacteria | 8599779 |
| 1017 | 2935956860 | 2935951376 | Bacteria | 8602333 |
| 1018 | 2935965322 | 2935959822 | Bacteria | 7869783 |
| 1019 | 2935970883 | 2935967501 | Bacteria | 8603075 |
| 1020 | 2935982983 | 2935975950 | Bacteria | 8347125 |
| 1021 | 2935984370 | 2935984226 | Bacteria | 8302647 |
| 1022 | 2935997200 | 2935992306 | Bacteria | 9802711 |
| 1023 | 2936009947 | 2936002035 | Bacteria | 9362176 |
| 1024 | 2936016972 | 2936011229 | Bacteria | 8801034 |
| 1025 | 2936025620 | 2936019824 | Bacteria | 8804134 |
| 1026 | 2936034462 | 2936028420 | Bacteria | 8965941 |
| 1027 | 2936045445 | 2936037263 | Bacteria | 9446081 |
| 1028 | 2936052504 | 2936046547 | Bacteria | 8903709 |
| 1029 | 2936055450 | 2936055302 | Bacteria | 8785755 |
| 1030 | 2940564573 | 2940556831 | Bacteria | 9590747 |
| 1031 | 2941509712 | 2941507105 | Bacteria | 8166816 |
| 1032 | 2941517541 | 2941515067 | Bacteria | 8166720 |
| 1033 | 2941526506 | 2941523033 | Bacteria | 8169134 |
| 1034 | 2941532050 | 2941531003 | Bacteria | 7653939 |
| 1035 | 2941545149 | 2941538514 | Bacteria | 9402094 |
| 1036 | 3005490881 | 3005483717 | Bacteria | 7877331 |
| 1037 | 3005506527 | 3005506211 | Bacteria | 6943378 |
| 1038 | 3005593200 | 3005587118 | Bacteria | 7794411 |
| 1039 | 3005717572 | 3005710791 | Bacteria | 7622528 |
| 1040 | 3005724621 | 3005718088 | Bacteria | 8283608 |
| 1041 | 8006928330 | 8006926726 | Bacteria | 6749210 |
| 1042 | 8006937312 | 8006933436 | Bacteria | 10410654 |
| 1043 | 8006965273 | 8006964411 | Bacteria | 8966052 |
| 1044 | 8006977344 | 8006973647 | Bacteria | 10679141 |
| 1045 | 8006991605 | 8006984368 | Bacteria | 9651211 |
| 1046 | 8006995426 | 8006994254 | Bacteria | 8309700 |
| 1047 | 8016519043 | 8016511872 | Bacteria | 9921665 |
| 1048 | 8016525261 | 8016522445 | Bacteria | 8156687 |
| 1049 | 8016538843 | 8016530956 | Bacteria | 8155261 |
| 1050 | 8016543126 | 8016539877 | Bacteria | 8155419 |
| 1051 | 8016550163 | 8016548790 | Bacteria | 8155074 |
| 1052 | 8016558572 | 8016557553 | Bacteria | 8154380 |
| 1053 | 8016581183 | 8016575299 | Bacteria | 8154085 |
| 1054 | 8016587521 | 8016583857 | Bacteria | 10421953 |
| 1055 | 8016596555 | 8016595262 | Bacteria | 8149947 |
| 1056 | 8016619222 | 8016613128 | Bacteria | 8794220 |
| 1057 | 8016630377 | 8016622563 | Bacteria | 7999408 |
| 1058 | 8016636758 | 8016630954 | Bacteria | 9217207 |
| 1059 | 8017057653 | 8017057580 | Bacteria | 10023680 |
| 1060 | 8019541311 | 8019538911 | Bacteria | 7872763 |
| 1061 | 8019549320 | 8019547302 | Bacteria | 7996444 |
| 1062 | 8019578165 | 8019576017 | Bacteria | 10049540 |
| 1063 | 8019596195 | 8019586578 | Bacteria | 10212056 |
| 1064 | 8019605499 | 8019597564 | Bacteria | 10041141 |
| 1065 | 8019613039 | 8019608314 | Bacteria | 10042931 |
| 1066 | 8019623726 | 8019619141 | Bacteria | 9218857 |
| 1067 | 8019638308 | 8019629233 | Bacteria | 8687553 |
| 1068 | 8019641328 | 8019638758 | Bacteria | 9062356 |
| 1069 | 8019651697 | 8019648815 | Bacteria | 10014479 |
| 1070 | 8019666232 | 8019659431 | Bacteria | 8577854 |
| 1071 | 8019675734 | 8019668869 | Bacteria | 8791617 |
| 1072 | 8019680365 | 8019678201 | Bacteria | 8863603 |
| 1073 | 8019695453 | 8019687851 | Bacteria | 8712826 |
| 1074 | 8055750570 | 8055742211 | Bacteria | 9226248 |
| 1075 | 8056679066 | 8056673599 | Bacteria | 7871253 |
| 1076 | 8056975347 | 8056967851 | Bacteria | 9038162 |
| 1077 | Ga0214542_1021066 | |||
| 1078 | JGI25406J46586_10006811 | |||
| 1079 | JGI25153J46596_10002547 | |||
| 1080 | JGI25153J46596_10003542 | |||
| 1081 | JGI25153J46596_10004097 | |||
| 1082 | JGI25153J46596_10014855 | |||
| 1083 | rootH1_10016026 | |||
| 1084 | JGI25160J50197_1001680 | |||
| 1085 | JGI25160J50197_1003442 | |||
| 1086 | JGI25160J50197_1005384 | |||
| 1087 | JGI25404J52841_10025272 | |||
| 1088 | JGI25404J52841_10030013 | |||
| 1089 | Ga0055531_10007525 | |||
| 1090 | Ga0055543_1007516 | |||
| 1091 | Ga0065165_1000370 | |||
| 1092 | Ga0065165_1006098 | |||
| 1093 | Ga0065165_1008717 | |||
| 1094 | Ga0070658_10021405 | |||
| 1095 | Ga0070676_10394328 | |||
| 1096 | Ga0070683_100042686 | |||
| 1097 | Ga0070683_100139749 | |||
| 1098 | Ga0070683_100521941 | |||
| 1099 | Ga0070670_100124537 | |||
| 1100 | Ga0068869_100013181 | |||
| 1101 | Ga0068869_100064153 | |||
| 1102 | Ga0070680_100019553 | |||
| 1103 | Ga0070680_100079829 | |||
| 1104 | Ga0070680_100104138 | |||
| 1105 | Ga0070680_100221827 | |||
| 1106 | Ga0070682_100110140 | |||
| 1107 | Ga0068868_100063339 | |||
| 1108 | Ga0068868_100284079 | |||
| 1109 | Ga0068868_100658426 | |||
| 1110 | Ga0070660_100244847 | |||
| 1111 | Ga0070689_100474764 | |||
| 1112 | Ga0070691_10090375 | |||
| 1113 | Ga0070668_100008756 | |||
| 1114 | Ga0070668_100027658 | |||
| 1115 | Ga0070671_100032245 | |||
| 1116 | Ga0070673_100719100 | |||
| 1117 | Ga0070667_100137265 | |||
| 1118 | Ga0070667_100425118 | |||
| 1119 | Ga0070709_10003090 | |||
| 1120 | Ga0070709_10008369 | |||
| 1121 | Ga0070714_100162069 | |||
| 1122 | Ga0070713_100002234 | |||
| 1123 | Ga0070713_100008846 | |||
| 1124 | Ga0070713_101072866 | |||
| 1125 | Ga0070710_10000552 | |||
| 1126 | Ga0070710_10172200 | |||
| 1127 | Ga0070701_10348617 | |||
| 1128 | Ga0070711_100011221 | |||
| 1129 | Ga0070711_100017038 | |||
| 1130 | Ga0070711_100027986 | |||
| 1131 | Ga0070711_100062871 | |||
| 1132 | Ga0070711_100166520 | |||
| 1133 | Ga0070711_100752190 | |||
| 1134 | Ga0070700_100252535 | |||
| 1135 | Ga0070663_100435647 | |||
| 1136 | Ga0070663_100672247 | |||
| 1137 | Ga0070678_100012735 | |||
| 1138 | Ga0070678_100029982 | |||
| 1139 | Ga0070678_100164756 | |||
| 1140 | Ga0070678_100862047 | |||
| 1141 | Ga0070662_100230394 | |||
| 1142 | Ga0070681_10012819 | |||
| 1143 | Ga0070681_10037527 | |||
| 1144 | Ga0070681_10051933 | |||
| 1145 | Ga0070681_10125936 | |||
| 1146 | Ga0070681_10607547 | |||
| 1147 | Ga0070685_10132407 | |||
| 1148 | Ga0070685_10187510 | |||
| 1149 | Ga0070706_100736318 | |||
| 1150 | Ga0070698_100604936 | |||
| 1151 | Ga0070679_100031919 | |||
| 1152 | Ga0070679_100034291 | |||
| 1153 | Ga0070679_100109277 | |||
| 1154 | Ga0070679_100137259 | |||
| 1155 | Ga0070679_100138618 | |||
| 1156 | Ga0070679_100600551 | |||
| 1157 | Ga0070684_100003258 | |||
| 1158 | Ga0068853_100026606 | |||
| 1159 | Ga0068853_100112148 | |||
| 1160 | Ga0070672_100649058 | |||
| 1161 | Ga0070696_100164886 | |||
| 1162 | Ga0070693_100262254 | |||
| 1163 | Ga0070665_100028897 | |||
| 1164 | Ga0070665_100045145 | |||
| 1165 | Ga0070665_100071651 | |||
| 1166 | Ga0070665_100135904 | |||
| 1167 | Ga0070665_100136213 | |||
| 1168 | Ga0070665_100161250 | |||
| 1169 | Ga0070665_100472269 | |||
| 1170 | Ga0070665_100554908 | |||
| 1171 | Ga0068855_100015587 | |||
| 1172 | Ga0068855_100073742 | |||
| 1173 | Ga0068855_100188786 | |||
| 1174 | Ga0068855_100217196 | |||
| 1175 | Ga0070664_100249863 | |||
| 1176 | Ga0070664_100516844 | |||
| 1177 | Ga0068857_100125486 | |||
| 1178 | Ga0068857_100264142 | |||
| 1179 | Ga0068856_100013570 | |||
| 1180 | Ga0068856_100152081 | |||
| 1181 | Ga0068856_100253525 | |||
| 1182 | Ga0068856_100255228 | |||
| 1183 | Ga0068856_100467549 | |||
| 1184 | Ga0068856_100832796 | |||
| 1185 | Ga0070702_100269391 | |||
| 1186 | Ga0070702_100437731 | |||
| 1187 | Ga0070702_100510897 | |||
| 1188 | Ga0068852_100002075 | |||
| 1189 | Ga0068852_100185761 | |||
| 1190 | Ga0068859_100127861 | |||
| 1191 | Ga0068859_100538127 | |||
| 1192 | Ga0068864_100182468 | |||
| 1193 | Ga0068864_100257270 | |||
| 1194 | Ga0068861_100139299 | |||
| 1195 | Ga0068861_100151333 | |||
| 1196 | Ga0068851_10113048 | |||
| 1197 | Ga0068863_100776274 | |||
| 1198 | Ga0068858_100150433 | |||
| 1199 | Ga0068858_100721009 | |||
| 1200 | Ga0068860_100084953 | |||
| 1201 | Ga0068860_100215672 | |||
| 1202 | Ga0068860_100238488 | |||
| 1203 | Ga0068862_100158116 | |||
| 1204 | Ga0068862_100373845 | |||
| 1205 | Ga0068862_100569757 | |||
| 1206 | Ga0081455_10003156 | |||
| 1207 | Ga0081455_10006663 | |||
| 1208 | Ga0081455_10007464 | |||
| 1209 | Ga0081455_10073137 | |||
| 1210 | Ga0081540_1001341 | |||
| 1211 | Ga0081540_1002121 | |||
| 1212 | Ga0081540_1012706 | |||
| 1213 | Ga0081540_1018462 | |||
| 1214 | Ga0081540_1073482 | |||
| 1215 | Ga0081540_1100945 | |||
| 1216 | Ga0081540_1120509 | |||
| 1217 | Ga0081540_1120511 | |||
| 1218 | Ga0081539_10000729 | |||
| 1219 | Ga0081539_10091157 | |||
| 1220 | Ga0081539_10125163 | |||
| 1221 | Ga0070717_10001026 | |||
| 1222 | Ga0070717_10237647 | |||
| 1223 | Ga0075365_10033553 | |||
| 1224 | Ga0075365_10046161 | |||
| 1225 | Ga0075368_10008533 | |||
| 1226 | Ga0075368_10102393 | |||
| 1227 | Ga0075368_10103345 | |||
| 1228 | Ga0075368_10127023 | |||
| 1229 | Ga0075363_100003880 | |||
| 1230 | Ga0075363_100013422 | |||
| 1231 | Ga0075363_100060796 | |||
| 1232 | Ga0075363_100163594 | |||
| 1233 | Ga0075364_10039240 | |||
| 1234 | Ga0070716_100069962 | |||
| 1235 | Ga0070716_100073994 | |||
| 1236 | Ga0070716_100585493 | |||
| 1237 | Ga0070712_100044616 | |||
| 1238 | Ga0070712_100502818 | |||
| 1239 | Ga0070712_100840602 | |||
| 1240 | Ga0075367_10098911 | |||
| 1241 | Ga0075367_10110452 | |||
| 1242 | Ga0075367_10330846 | |||
| 1243 | Ga0075369_10028877 | |||
| 1244 | Ga0075366_10008044 | |||
| 1245 | Ga0075366_10071534 | |||
| 1246 | Ga0075366_10094649 | |||
| 1247 | Ga0097621_100234276 | |||
| 1248 | Ga0097621_100239636 | |||
| 1249 | Ga0075370_10028282 | |||
| 1250 | Ga0075370_10042444 | |||
| 1251 | Ga0075370_10116584 | |||
| 1252 | Ga0075370_10132901 | |||
| 1253 | Ga0075370_10216835 | |||
| 1254 | Ga0075428_100622896 | |||
| 1255 | Ga0075434_100092226 | |||
| 1256 | Ga0075434_100826714 | |||
| 1257 | Ga0068865_100069342 | |||
| 1258 | Ga0068865_100316538 | |||
| 1259 | Ga0075436_100134933 | |||
| 1260 | Ga0097620_100127864 | |||
| 1261 | Ga0097620_100538168 | |||
| 1262 | Ga0099824_1002047 | |||
| 1263 | Ga0099824_1018951 | |||
| 1264 | Ga0099822_1004737 | |||
| 1265 | Ga0099822_1063565 | |||
| 1266 | Ga0099823_1071205 | |||
| 1267 | Ga0075435_100109533 | |||
| 1268 | Ga0099794_10112341 | |||
| 1269 | Ga0099795_10017558 | |||
| 1270 | Ga0099795_10161517 | |||
| 1271 | Ga0105240_10002295 | |||
| 1272 | Ga0105240_10053247 | |||
| 1273 | Ga0105240_10183475 | |||
| 1274 | Ga0105240_10218361 | |||
| 1275 | Ga0105240_10251298 | |||
| 1276 | Ga0105240_10266078 | |||
| 1277 | Ga0105240_10672889 | |||
| 1278 | Ga0111539_10182022 | |||
| 1279 | Ga0111539_10395278 | |||
| 1280 | Ga0105245_10037331 | |||
| 1281 | Ga0105245_10340923 | |||
| 1282 | Ga0105245_10904070 | |||
| 1283 | Ga0105243_10994056 | |||
| 1284 | Ga0105241_10012898 | |||
| 1285 | Ga0105241_10046174 | |||
| 1286 | Ga0105241_10066451 | |||
| 1287 | Ga0105241_10444899 | |||
| 1288 | Ga0105242_10234670 | |||
| 1289 | Ga0105242_10458835 | |||
| 1290 | Ga0105248_10042923 | |||
| 1291 | Ga0105248_10144863 | |||
| 1292 | Ga0105248_10211185 | |||
| 1293 | Ga0105237_10002301 | |||
| 1294 | Ga0105237_10006999 | |||
| 1295 | Ga0105237_10026831 | |||
| 1296 | Ga0105237_10080389 | |||
| 1297 | Ga0105237_10259204 | |||
| 1298 | Ga0105237_10346620 | |||
| 1299 | Ga0105237_10358448 | |||
| 1300 | Ga0105237_10430729 | |||
| 1301 | Ga0105237_10807367 | |||
| 1302 | Ga0105238_10018488 | |||
| 1303 | Ga0105238_10063133 | |||
| 1304 | Ga0105238_10112590 | |||
| 1305 | Ga0105238_10247537 | |||
| 1306 | Ga0105238_10345957 | |||
| 1307 | Ga0105238_10422128 | |||
| 1308 | Ga0105249_10165545 | |||
| 1309 | Ga0105249_10395205 | |||
| 1310 | Ga0105249_11331530 | |||
| 1311 | Ga0105239_10025401 | |||
| 1312 | Ga0105239_10083534 | |||
| 1313 | Ga0105239_10142048 | |||
| 1314 | Ga0105239_10321091 | |||
| 1315 | Ga0105239_11309354 | |||
| 1316 | Ga0105246_10114789 | |||
| 1317 | Ga0105246_10484397 | |||
| 1318 | Ga0157370_10061670 | |||
| 1319 | Ga0157370_10497971 | |||
| 1320 | Ga0157369_10017488 | |||
| 1321 | Ga0157369_10102904 | |||
| 1322 | Ga0157369_10570470 | |||
| 1323 | Ga0157374_10191301 | |||
| 1324 | Ga0157378_10057612 | |||
| 1325 | Ga0157378_10146176 | |||
| 1326 | Ga0157378_10573750 | |||
| 1327 | Ga0163162_10155709 | |||
| 1328 | Ga0163162_10362366 | |||
| 1329 | Ga0163162_10475004 | |||
| 1330 | Ga0157372_10118851 | |||
| 1331 | Ga0157375_10069051 | |||
| 1332 | Ga0157375_10076159 | |||
| 1333 | Ga0157375_10137987 | |||
| 1334 | Ga0157375_10541055 | |||
| 1335 | Ga0157375_10784330 | |||
| 1336 | Ga0163163_10002774 | |||
| 1337 | Ga0163163_10043948 | |||
| 1338 | Ga0163163_10129093 | |||
| 1339 | Ga0163163_10183688 | |||
| 1340 | Ga0163163_10203230 | |||
| 1341 | Ga0163163_10910132 | |||
| 1342 | Ga0157377_10044206 | |||
| 1343 | Ga0157379_10192263 | |||
| 1344 | Ga0157379_10255394 | |||
| 1345 | Ga0157379_10609805 | |||
| 1346 | Ga0157376_10086282 | |||
| 1347 | Ga0157376_10179560 | |||
| 1348 | Ga0157376_10321788 | |||
| 1349 | Ga0157376_10537824 | |||
| 1350 | Ga0163161_10171094 | |||
| 1351 | Ga0163161_10299170 | |||
| 1352 | Ga0163161_10338303 | |||
| 1353 | Ga0197907_11157109 | |||
| 1354 | Ga0206355_1507511 | |||
| 1355 | Ga0206350_10389318 | |||
| 1356 | Ga0206353_10556866 | |||
| 1357 | Ga0214544_1000003 | |||
| 1358 | Ga0214542_1000003 | |||
| 1359 | Ga0214545_1000004 | |||
| 1360 | Ga0214545_1021274 | |||
| 1361 | Ga0214543_1000007 | |||
| 1362 | Ga0213876_10002755 | |||
| 1363 | Ga0213876_10094238 | |||
| 1364 | Ga0213875_10130551 | |||
| 1365 | Ga0224712_10107802 | |||
| 1366 | Ga0209563_100438 | |||
| 1367 | Ga0209677_103197 | |||
| 1368 | Ga0209148_1000267 | |||
| 1369 | Ga0209233_1012874 | |||
| 1370 | Ga0209455_1001737 | |||
| 1371 | Ga0209673_1013733 | |||
| 1372 | Ga0209564_1010432 | |||
| 1373 | Ga0209758_1000030 | |||
| 1374 | Ga0209758_1000277 | |||
| 1375 | Ga0209758_1000711 | |||
| 1376 | Ga0209758_1000893 | |||
| 1377 | Ga0209758_1001645 | |||
| 1378 | Ga0209758_1002462 | |||
| 1379 | Ga0209758_1005049 | |||
| 1380 | Ga0209758_1050686 | |||
| 1381 | Ga0207426_1000271 | |||
| 1382 | Ga0207426_1001517 | |||
| 1383 | Ga0207426_1008000 | |||
| 1384 | Ga0209257_1000662 | |||
| 1385 | Ga0209257_1015967 | |||
| 1386 | Ga0207653_10004044 | |||
| 1387 | Ga0207692_10001302 | |||
| 1388 | Ga0207692_10075621 | |||
| 1389 | Ga0207692_10250024 | |||
| 1390 | Ga0207710_10028157 | |||
| 1391 | Ga0207688_10033353 | |||
| 1392 | Ga0207688_10069981 | |||
| 1393 | Ga0207680_10231384 | |||
| 1394 | Ga0207647_10008109 | |||
| 1395 | Ga0207647_10211960 | |||
| 1396 | Ga0207699_10023510 | |||
| 1397 | Ga0207699_10045183 | |||
| 1398 | Ga0207645_10084865 | |||
| 1399 | Ga0207684_10261744 | |||
| 1400 | Ga0207707_10000438 | |||
| 1401 | Ga0207707_10136890 | |||
| 1402 | Ga0207707_10669633 | |||
| 1403 | Ga0207695_10000059 | |||
| 1404 | Ga0207695_10027002 | |||
| 1405 | Ga0207695_10043272 | |||
| 1406 | Ga0207695_10218834 | |||
| 1407 | Ga0207671_10001109 | |||
| 1408 | Ga0207671_10035801 | |||
| 1409 | Ga0207671_10069327 | |||
| 1410 | Ga0207671_10162971 | |||
| 1411 | Ga0207671_10173745 | |||
| 1412 | Ga0207693_10027888 | |||
| 1413 | Ga0207693_10104554 | |||
| 1414 | Ga0207693_10114267 | |||
| 1415 | Ga0207693_10235143 | |||
| 1416 | Ga0207693_10463230 | |||
| 1417 | Ga0207663_10017392 | |||
| 1418 | Ga0207663_10030104 | |||
| 1419 | Ga0207663_10095514 | |||
| 1420 | Ga0207660_10017792 | |||
| 1421 | Ga0207660_10087395 | |||
| 1422 | Ga0207660_10183018 | |||
| 1423 | Ga0207660_10219447 | |||
| 1424 | Ga0207660_10619273 | |||
| 1425 | Ga0207657_10275808 | |||
| 1426 | Ga0207657_10506158 | |||
| 1427 | Ga0207652_10047083 | |||
| 1428 | Ga0207652_10518673 | |||
| 1429 | Ga0207694_10173320 | |||
| 1430 | Ga0207694_10356417 | |||
| 1431 | Ga0207650_10158200 | |||
| 1432 | Ga0207659_10263324 | |||
| 1433 | Ga0207700_10067007 | |||
| 1434 | Ga0207700_10234026 | |||
| 1435 | Ga0207700_10634800 | |||
| 1436 | Ga0207664_10021535 | |||
| 1437 | Ga0207644_10018254 | |||
| 1438 | Ga0207644_10334329 | |||
| 1439 | Ga0207644_10743095 | |||
| 1440 | Ga0207706_10059147 | |||
| 1441 | Ga0207706_10134929 | |||
| 1442 | Ga0207706_10499489 | |||
| 1443 | Ga0207686_10200241 | |||
| 1444 | Ga0207686_10225341 | |||
| 1445 | Ga0207670_10389508 | |||
| 1446 | Ga0207669_10478717 | |||
| 1447 | Ga0207669_10624750 | |||
| 1448 | Ga0207704_10265709 | |||
| 1449 | Ga0207665_10014858 | |||
| 1450 | Ga0207665_10061914 | |||
| 1451 | Ga0207665_10380452 | |||
| 1452 | Ga0207691_10197132 | |||
| 1453 | Ga0207711_10018230 | |||
| 1454 | Ga0207711_10276472 | |||
| 1455 | Ga0207711_10876686 | |||
| 1456 | Ga0207689_10080482 | |||
| 1457 | Ga0207689_10208165 | |||
| 1458 | Ga0207661_10000959 | |||
| 1459 | Ga0207661_10412760 | |||
| 1460 | Ga0207679_10401124 | |||
| 1461 | Ga0207667_10044714 | |||
| 1462 | Ga0207667_10086148 | |||
| 1463 | Ga0207667_10101512 | |||
| 1464 | Ga0207667_10406284 | |||
| 1465 | Ga0207668_10060395 | |||
| 1466 | Ga0207668_10069357 | |||
| 1467 | Ga0207668_10095673 | |||
| 1468 | Ga0207668_10124091 | |||
| 1469 | Ga0207668_10425960 | |||
| 1470 | Ga0207658_10678577 | |||
| 1471 | Ga0207677_10461146 | |||
| 1472 | Ga0207703_10050557 | |||
| 1473 | Ga0207703_10181953 | |||
| 1474 | Ga0207639_10023427 | |||
| 1475 | Ga0207639_10160589 | |||
| 1476 | Ga0207639_10163367 | |||
| 1477 | Ga0207639_10267758 | |||
| 1478 | Ga0207678_10021386 | |||
| 1479 | Ga0207678_10023768 | |||
| 1480 | Ga0207678_10025320 | |||
| 1481 | Ga0207678_10040824 | |||
| 1482 | Ga0207678_10052328 | |||
| 1483 | Ga0207678_10064507 | |||
| 1484 | Ga0207678_10698805 | |||
| 1485 | Ga0207708_10433723 | |||
| 1486 | Ga0207708_10513717 | |||
| 1487 | Ga0207702_10106927 | |||
| 1488 | Ga0207702_10186192 | |||
| 1489 | Ga0207702_10380959 | |||
| 1490 | Ga0207702_10436225 | |||
| 1491 | Ga0207648_10042881 | |||
| 1492 | Ga0207648_10704914 | |||
| 1493 | Ga0207676_10128955 | |||
| 1494 | Ga0207676_10163439 | |||
| 1495 | Ga0207676_10614381 | |||
| 1496 | Ga0207674_10055839 | |||
| 1497 | Ga0207674_10057340 | |||
| 1498 | Ga0207674_10084699 | |||
| 1499 | Ga0207674_10310289 | |||
| 1500 | Ga0207675_100031542 | |||
| 1501 | Ga0207675_100279247 | |||
| 1502 | Ga0207675_100354860 | |||
| 1503 | Ga0207683_10008695 | |||
| 1504 | Ga0207683_10032517 | |||
| 1505 | Ga0207683_10135169 | |||
| 1506 | Ga0207683_10450052 | |||
| 1507 | Ga0207683_10470438 | |||
| 1508 | Ga0207698_10013446 | |||
| 1509 | Ga0207698_10166178 | |||
| 1510 | Ga0207698_10371088 | |||
| 1511 | Ga0207698_11005794 | |||
| 1512 | Ga0207698_11336862 | |||
| 1513 | Ga0209389_1000055 | |||
| 1514 | Ga0209389_1000494 | |||
| 1515 | Ga0209589_1000005 | |||
| 1516 | Ga0209589_1000024 | |||
| 1517 | Ga0209489_100005 | |||
| 1518 | Ga0209489_100123 | |||
| 1519 | Ga0209489_103769 | |||
| 1520 | Ga0209700_100006 | |||
| 1521 | Ga0209700_100420 | |||
| 1522 | Ga0209588_1014950 | |||
| 1523 | Ga0209588_1031471 | |||
| 1524 | Ga0209813_10024296 | |||
| 1525 | Ga0268266_10000638 | |||
| 1526 | Ga0268266_10001364 | |||
| 1527 | Ga0268266_10030958 | |||
| 1528 | Ga0268266_10070131 | |||
| 1529 | Ga0268266_10085353 | |||
| 1530 | Ga0268266_10117632 | |||
| 1531 | Ga0268266_10366104 | |||
| 1532 | Ga0268266_10712521 | |||
| 1533 | Ga0268266_10768309 | |||
| 1534 | Ga0268266_10774729 | |||
| 1535 | Ga0268266_10848742 | |||
| 1536 | Ga0268265_10178216 | |||
| 1537 | Ga0268265_10396337 | |||
| 1538 | Ga0268265_10678065 | |||
| 1539 | Ga0268265_10770230 | |||
| 1540 | Ga0268264_10000051 | |||
| 1541 | Ga0268264_10295742 | |||
| 1542 | Ga0265337_1006988 | |||
| 1543 | Ga0265334_10005278 | |||
| 1544 | Ga0265318_10031122 | |||
| 1545 | Ga0265323_10000560 | |||
| 1546 | Ga0265336_10000550 | |||
| 1547 | Ga0307517_10000856 | |||
| 1548 | Ga0307515_10027090 | |||
| 1549 | Ga0265338_10000231 | |||
| 1550 | Ga0265324_10005806 | |||
| 1551 | Ga0265339_10034239 | |||
| 1552 | Ga0307513_10125136 | |||
| 1553 | Ga0307509_10085186 | |||
| 1554 | Ga0307508_10014562 | |||
| 1555 | Ga0307508_10567299 | |||
| 1556 | Ga0265314_10069773 | |||
| 1557 | Ga0265342_10003396 | |||
| 1558 | Ga0307516_10011176 | |||
| 1559 | Ga0307405_10374919 | |||
| 1560 | Ga0307413_10103325 | |||
| 1561 | Ga0307409_100119908 | |||
| 1562 | Ga0307416_100286859 | |||
| 1563 | Ga0307415_100143022 | |||
| 1564 | Ga0307510_10004951 | |||
| 1565 | Ga0307510_10022034 | |||
| 1566 | Ga0307510_10121417 | |||
| 1567 | Ga0316215_1002564 | |||
| 1568 | Ga0373934_0076806 | |||
| 1569 | Ga0373949_0020331 | |||
| 1570 | Ga0373952_0006580 | |||
| 1571 | Ga0373945_0209184 | |||
| 1572 | Ga0373954_0052727 | |||
| 1573 | Ga0373956_0087974 | |||
| 1574 | Ga0373960_0132987 | |||
| 1575 | Ga0373943_0157391 | |||
| 1576 | Ga0373943_0234201 | |||
| 1577 | Ga0373955_0108257 | |||
| 1578 | Ga0373955_0122209 | |||
| 1579 | Ga0373924_0027656 | |||
| 1580 | Ga0373931_0008723 | |||
| 1581 | Ga0373935_0557741 | |||
| 1582 | Ga0373927_0012565 | |||
| 1583 | Ga0373927_0263187 | |||
| 1584 | Ga0373927_0363133 | |||
| 1585 | Ga0373933_0000018 | |||
| 1586 | Ga0373937_0069895 | |||
| 1587 | Ga0373937_0227646 | |||
| 1588 | Ga0372808_020869 | |||
| 1589 | Ga0373925_0401179 | |||
| 1590 | Ga0373925_0639533 | |||
| 1591 | Ga0395899_0050587 | |||
| 1592 | Ga0395899_0443317 | |||
| 1593 | Ga0395900_0001051 | |||
| 1594 | Ga0395900_0169700 | |||
| 1595 | Ga0395900_0265761 | |||
| 1596 | Ga0395900_0399957 | |||
| 1597 | Ga0395898_0001503 | |||
| 1598 | Ga0395898_0004875 | |||
| 1599 | Ga0395898_0532852 | |||
| 1600 | Ga0395905_0064717 | |||
| 1601 | Ga0395905_0109320 | |||
| 1602 | Ga0395905_0134424 | |||
| 1603 | Ga0436364_0238267 | |||
| 1604 | Ga0436364_0310036 | |||
| 1605 | Ga0395901_0051645 | |||
| 1606 | Ga0395901_0061578 | |||
| 1607 | Ga0395901_0092858 | |||
| 1608 | Ga0395901_0371972 | |||
| 1609 | Ga0436365_0093274 | |||
| 1610 | Ga0436365_0372041 | |||
| 1611 | Ga0436365_1021233 | |||
| 1612 | Ga0436363_0554977 | |||
| 1613 | Ga0436363_1689393 | |||
| 1614 | Ga0436362_0626323 | |||
| 1615 | Ga0451789_0919161 | |||
| 1616 | Ga0451833_0031051 | |||
| 1617 | Ga0466969_0026762 | |||
| 1618 | Ga0466972_0000124 | |||
| 1619 | Ga0466972_0002537 | |||
| 1620 | Ga0466965_0026765 | |||
| 1621 | Ga0466965_0318596 | |||
| 1622 | Ga0466966_0000411 | |||
| 1623 | Ga0466961_0000065 | |||
| 1624 | Ga0466961_0254334 | |||
| 1625 | Ga0466963_0027444 | |||
| 1626 | Ga0466968_0006334 | |||
| 1627 | Ga0466968_0215322 | |||
| 1628 | Ga0466970_0089040 | |||
| 1629 | Ga0466970_0143814 | |||
| 1630 | Ga0466960_0001481 | |||
| 1631 | Ga0466960_0139165 | |||
| 1632 | Ga0466960_0220761 | |||
| 1633 | Ga0466959_0000634 | |||
| 1634 | Ga0466959_0275904 | |||
| 1635 | Ga0466958_0031405 | |||
| 1636 | Ga0495603_0082839 | |||
| 1637 | Ga0495603_0132329 | |||
| 1638 | Ga0495603_0300832 | |||
| 1639 | Ga0495629_0003519 | |||
| 1640 | Ga0495629_0206705 | |||
| 1641 | Ga0495638_0011267 | |||
| 1642 | Ga0495638_0085181 | |||
| 1643 | Ga0495641_0062004 | |||
| 1644 | Ga0495651_0017692 | |||
| 1645 | Ga0495651_0424287 | |||
| 1646 | Ga0495580_0092623 | |||
| 1647 | Ga0495639_0056409 | |||
| 1648 | Ga0495639_0061813 | |||
| 1649 | Ga0495664_0011915 | |||
| 1650 | Ga0495584_0131529 | |||
| 1651 | Ga0495585_0283872 | |||
| 1652 | Ga0495594_0065555 | |||
| 1653 | Ga0495596_0092262 | |||
| 1654 | Ga0495583_0044422 | |||
| 1655 | Ga0495606_0065243 | |||
| 1656 | Ga0495606_0160809 | |||
| 1657 | Ga0495610_0078267 | |||
| 1658 | Ga0495616_0057328 | |||
| 1659 | Ga0495616_0084560 | |||
| 1660 | Ga0495616_0253094 | |||
| 1661 | Ga0495618_0141248 | |||
| 1662 | Ga0495620_0020979 | |||
| 1663 | Ga0495643_0045119 | |||
| 1664 | Ga0495648_0008955 | |||
| 1665 | Ga0495648_0218345 | |||
| 1666 | Ga0495666_0133388 | |||
| 1667 | Ga0495652_0089784 | |||
| 1668 | Ga0495652_0122342 | |||
| 1669 | Ga0495652_0391588 | |||
| 1670 | Ga0495652_0457905 | |||
| 1671 | Ga0495654_0129733 | |||
| 1672 | Ga0495640_0027614 | |||
| 1673 | Ga0495640_0081673 | |||
| 1674 | Ga0495640_0087035 | |||
| 1675 | Ga0495586_0158427 | |||
| 1676 | Ga0495587_0269474 | |||
| 1677 | Ga0495609_0090829 | |||
| 1678 | Ga0495645_0017494 | |||
| 1679 | Ga0495645_0163321 | |||
| 1680 | Ga0495622_0014799 | |||
| 1681 | Ga0495622_0265165 | |||
| 1682 | Ga0495667_0044811 | |||
| 1683 | Ga0495668_0084179 | |||
| 1684 | Ga0495668_0379536 | |||
| 1685 | Ga0495634_0056964 | |||
| 1686 | Ga0495611_0244628 | |||
| 1687 | Ga0495625_0225233 | |||
| 1688 | Ga0495635_0158351 | |||
| 1689 | Ga0495635_0366258 | |||
| 1690 | Ga0495588_0001353 | |||
| 1691 | Ga0495657_0002384 | |||
| 1692 | Ga0495657_0014532 | |||
| 1693 | Ga0495599_0004607 | |||
| 1694 | Ga0495599_0065022 | |||
| 1695 | Ga0495599_0067383 | |||
| 1696 | Ga0495623_0010248 | |||
| 1697 | Ga0495623_0320794 | |||
| 1698 | Ga0495646_0113582 | |||
| 1699 | Ga0495646_0120906 | |||
| 1700 | Ga0495613_0062464 | |||
| 1701 | Ga0495613_0274008 | |||
| 1702 | Ga0495613_0756129 | |||
| 1703 | Ga0495624_0067145 | |||
| 1704 | Ga0495624_0110799 | |||
| 1705 | Ga0495670_0115431 | |||
| 1706 | Ga0495671_0043951 | |||
| 1707 | Ga0495671_0072278 | |||
| 1708 | Ga0495671_0286670 | |||
| 1709 | Ga0495649_0024307 | |||
| 1710 | Ga0495600_0210544 | |||
| 1711 | Ga0495660_0076880 | |||
| 1712 | Ga0495581_0014180 | |||
| 1713 | Ga0495581_0041048 | |||
| 1714 | Ga0495604_0002741 | |||
| 1715 | Ga0495604_0006835 | |||
| 1716 | Ga0495674_0018428 | |||
| 1717 | Ga0495672_0017605 | |||
| 1718 | Ga0495672_0050250 | |||
| 1719 | Ga0495676_0055266 | |||
| 1720 | Ga0495676_0102528 | |||
| 1721 | Ga0495676_0374195 | |||
| 1722 | Ga0495680_0001876 | |||
| 1723 | Ga0495680_0085161 | |||
| 1724 | Ga0495687_016979 | |||
| 1725 | Ga0495675_0007387 | |||
| 1726 | Ga0495685_082541 | |||
| 1727 | Ga0495673_0060041 | |||
| 1728 | Ga0495673_0061680 | |||
| 1729 | Ga0495673_0108676 | |||
| 1730 | Ga0495684_0012933 | |||
| 1731 | Ga0495684_0436988 | |||
| 1732 | Ga0495686_0114233 | |||
| 1733 | Ga0495686_0147890 | |||
| 1734 | Ga0495686_0179200 | |||
| 1735 | Ga0495593_0079436 | |||
| 1736 | Ga0495602_0134279 | |||
| 1737 | Ga0495602_0543596 | |||
| 1738 | Ga0496101_0055034 | |||
| 1739 | Ga0496101_0149898 | |||
| 1740 | Ga0496101_0559044 | |||
| 1741 | Ga0496102_0107971 | |||
| 1742 | Ga0496102_0125274 | |||
| 1743 | Ga0496102_0134420 | |||
| 1744 | Ga0496102_0252451 | |||
| 1745 | Ga0496103_0080553 | |||
| 1746 | Ga0496103_0338198 | |||
| 1747 | Ga0496103_0629569 | |||
| 1748 | Ga0496104_0009070 | |||
| 1749 | Ga0496104_0024225 | |||
| 1750 | Ga0496104_0037936 | |||
| 1751 | Ga0496104_0068302 | |||
| 1752 | Ga0496104_0103508 | |||
| 1753 | Ga0496104_0375050 | |||
| 1754 | Ga0496105_0022832 | |||
| 1755 | Ga0496105_0039456 | |||
| 1756 | Ga0496105_0099088 | |||
| 1757 | Ga0496105_0589435 | |||
| 1758 | Ga0496106_0026873 | |||
| 1759 | Ga0496106_0038587 | |||
| 1760 | Ga0496106_0264939 | |||
| 1761 | Ga0496106_0271437 | |||
| 1762 | Ga0496106_0285674 | |||
| 1763 | Ga0496107_0011974 | |||
| 1764 | Ga0496107_0164616 | |||
| 1765 | Ga0496107_0237925 | |||
| 1766 | Ga0496107_0709954 | |||
| 1767 | Ga0496108_0012004 | |||
| 1768 | Ga0496108_0013488 | |||
| 1769 | Ga0496108_0080117 | |||
| 1770 | Ga0496108_0243202 | |||
| 1771 | Ga0496108_0467421 | |||
| 1772 | Ga0496109_0023442 | |||
| 1773 | Ga0496109_0222517 | |||
| 1774 | Ga0496109_0275200 | |||
| 1775 | Ga0496109_0296979 | |||
| 1776 | Ga0496109_0721487 | |||
| 1777 | Ga0496109_0893173 | |||
| 1778 | Ga0496110_0015719 | |||
| 1779 | Ga0496110_0015752 | |||
| 1780 | Ga0496110_0980438 | |||
| 1781 | Ga0496111_0056301 | |||
| 1782 | Ga0496111_0152814 | |||
| 1783 | Ga0496111_0583484 | |||
| 1784 | Ga0496112_0045698 | |||
| 1785 | Ga0496112_0053279 | |||
| 1786 | Ga0496112_0242029 | |||
| 1787 | Ga0496112_0704478 | |||
| 1788 | Ga0496112_0938372 | |||
| 1789 | Ga0496113_0004044 | |||
| 1790 | Ga0496113_0055910 | |||
| 1791 | Ga0496113_0297442 | |||
| 1792 | Ga0496113_0534347 | |||
| 1793 | Ga0496114_0014145 | |||
| 1794 | Ga0496114_0121968 | |||
| 1795 | Ga0496115_0005405 | |||
| 1796 | Ga0496115_0032960 | |||
| 1797 | Ga0496115_0069485 | |||
| 1798 | Ga0496116_0028887 | |||
| 1799 | Ga0496116_0032538 | |||
| 1800 | Ga0496116_0242663 | |||
| 1801 | Ga0496117_0061833 | |||
| 1802 | Ga0496117_0071741 | |||
| 1803 | Ga0496117_0301026 | |||
| 1804 | Ga0496118_0002445 | |||
| 1805 | Ga0496119_0015983 | |||
| 1806 | Ga0496119_0069417 | |||
| 1807 | Ga0496119_0215489 | |||
| 1808 | Ga0496120_0035858 | |||
| 1809 | Ga0496121_0000452 | |||
| 1810 | Ga0496121_0000571 | |||
| 1811 | Ga0496121_0024152 | |||
| 1812 | Ga0496121_0043447 | |||
| 1813 | Ga0496121_0050510 | |||
| 1814 | Ga0496121_0051348 | |||
| 1815 | Ga0496121_0071559 | |||
| 1816 | Ga0496121_0114848 | |||
| 1817 | Ga0496121_0322890 | |||
| 1818 | Ga0496122_0205725 | |||
| 1819 | Ga0496124_0000267 | |||
| 1820 | Ga0496124_0026050 | |||
| 1821 | Ga0496124_0053485 | |||
| 1822 | Ga0496125_0043745 | |||
| 1823 | Ga0496125_0059362 | |||
| 1824 | Ga0496125_0069134 | |||
| 1825 | Ga0496126_0015704 | |||
| 1826 | Ga0496126_0035587 | |||
| 1827 | Ga0496126_0052619 | |||
| 1828 | Ga0496126_0059836 | |||
| 1829 | Ga0496126_0071503 | |||
| 1830 | Ga0496126_0355971 | |||
| 1831 | Ga0496126_0366683 | |||
| 1832 | Ga0496126_0580061 | |||
| 1833 | Ga0496126_0676636 | |||
| 1834 | Ga0495682_0014877 | |||
| 1835 | Ga0495682_0139946 | |||
| 1836 | Ga0501069_0480989 | |||
| 1837 | Ga0501071_0175538 | |||
| 1838 | Ga0501076_0123356 | |||
| 1839 | Ga0501080_0060360 | |||
| 1840 | Ga0501035_0618962 | |||
| 1841 | nmdc:mga03683_133639_c1 | |||
| 1842 | nmdc:mga03683_184261_c1 | |||
| 1843 | nmdc:mga03n38_155829_c1 | |||
| 1844 | nmdc:mga03n38_208_c1 | |||
| 1845 | nmdc:mga03n38_58574_c1 | |||
| 1846 | nmdc:mga00v17_145883_c1 | |||
| 1847 | nmdc:mga00v17_439992_c1 | |||
| 1848 | nmdc:mga00v17_55068_c1 | |||
| 1849 | nmdc:mga0yw44_14616_c1 | |||
| 1850 | nmdc:mga0yw44_223543_c1 | |||
| 1851 | nmdc:mga0yw44_557513_c1 | |||
| 1852 | nmdc:mga0yw44_66485_c1 | |||
| 1853 | nmdc:mga0k408_122214_c1 | |||
| 1854 | nmdc:mga0k408_211493_c1 | |||
| 1855 | nmdc:mga0k408_4612_c1 | |||
| 1856 | nmdc:mga06z11_118063_c1 | |||
| 1857 | nmdc:mga06z11_199908_c1 | |||
| 1858 | nmdc:mga06z11_57073_c1 | |||
| 1859 | nmdc:mga06z11_73502_c1 | |||
| 1860 | nmdc:mga04h51_17986_c1 | |||
| 1861 | nmdc:mga04h51_53954_c1 | |||
| 1862 | nmdc:mga07m45_14648_c1 | |||
| 1863 | nmdc:mga07m45_182616_c1 | |||
| 1864 | nmdc:mga07m45_488800_c1 | |||
| 1865 | nmdc:mga07m45_74631_c1 | |||
| 1866 | nmdc:mga08y16_211641_c1 | |||
| 1867 | nmdc:mga08y16_527905_c1 | |||
| 1868 | nmdc:mga0n895_1120456_c1 | |||
| 1869 | nmdc:mga0n895_21774_c1 | |||
| 1870 | nmdc:mga0rr50_171235_c1 | |||
| 1871 | nmdc:mga08x19_97007_c1 | |||
| 1872 | nmdc:mga0a205_133434_c1 | |||
| 1873 | nmdc:mga0sz30_23037_c2 | |||
| 1874 | nmdc:mga0sz30_55224_c1 | |||
| 1875 | Ga0495612_0053958 | |||
| 1876 | Ga0500610_0158106 | |||
| 1877 | Ga0500635_0006464 | |||
| 1878 | Ga0500635_0062937 | |||
| 1879 | Ga0495655_0014011 | |||
| 1880 | Ga0495619_0007832 | |||
| 1881 | Ga0495619_0514646 | |||
| 1882 | Ga0500578_0120031 | |||
| 1883 | Ga0500578_0297900 | |||
| 1884 | Ga0500643_000028 | |||
| 1885 | Ga0500644_0052058 | |||
| 1886 | Ga0500646_0064528 | |||
| 1887 | Ga0500647_0018007 | |||
| 1888 | Ga0500583_0022614 | |||
| 1889 | Ga0500651_0038098 | |||
| 1890 | Ga0500566_0000245 | |||
| 1891 | Ga0500566_0002949 | |||
| 1892 | Ga0500566_0069046 | |||
| 1893 | Ga0500641_0027837 | |||
| 1894 | Ga0500641_0065899 | |||
| 1895 | Ga0500650_0092938 | |||
| 1896 | Ga0500650_0114678 | |||
| 1897 | Ga0500555_002075 | |||
| 1898 | Ga0500556_0017153 | |||
| 1899 | Ga0500557_000116 | |||
| 1900 | Ga0500562_044412 | |||
| 1901 | Ga0500569_002793 | |||
| 1902 | Ga0500572_004309 | |||
| 1903 | Ga0500595_000580 | |||
| 1904 | Ga0500595_004072 | |||
| 1905 | Ga0500595_035681 | |||
| 1906 | Ga0500595_058462 | |||
| 1907 | Ga0500607_228960 | |||
| 1908 | Ga0500642_0000113 | |||
| 1909 | Ga0500642_0001807 | |||
| 1910 | Ga0500642_0233797 | |||
| 1911 | Ga0500655_017624 | |||
| 1912 | Ga0500655_017634 | |||
| 1913 | Ga0500559_0000103 | |||
| 1914 | Ga0500559_0016441 | |||
| 1915 | Ga0500559_0115729 | |||
| 1916 | Ga0500564_180237 | |||
| 1917 | Ga0500568_0005758 | |||
| 1918 | Ga0500568_0043749 | |||
| 1919 | Ga0500577_0040536 | |||
| 1920 | Ga0500577_0103682 | |||
| 1921 | Ga0500577_0228024 | |||
| 1922 | Ga0500579_184734 | |||
| 1923 | Ga0500590_080114 | |||
| 1924 | Ga0500590_083689 | |||
| 1925 | Ga0500603_016640 | |||
| 1926 | Ga0500604_0006950 | |||
| 1927 | Ga0500616_0000046 | |||
| 1928 | Ga0500620_026632 | |||
| 1929 | Ga0500622_0188348 | |||
| 1930 | Ga0500633_0131813 | |||
| 1931 | Ga0500634_0053113 | |||
| 1932 | Ga0500638_016392 | |||
| 1933 | Ga0500638_042327 | |||
| 1934 | Ga0500638_094379 | |||
| 1935 | Ga0500636_0000054 | |||
| 1936 | Ga0500636_0108981 | |||
| 1937 | Ga0500637_0000303 | |||
| 1938 | Ga0500637_0027373 | |||
| 1939 | Ga0500637_0273034 | |||
| 1940 | Ga0500611_005942 | |||
| 1941 | Ga0500625_017426 | |||
| 1942 | Ga0500645_005369 | |||
| 1943 | Ga0500645_048584 | |||
| 1944 | Ga0500552_020370 | |||
| 1945 | Ga0500596_005620 | |||
| 1946 | Ga0500596_006582 | |||
| 1947 | Ga0500599_002194 | |||
| 1948 | Ga0500601_000834 | |||
| 1949 | Ga0500661_001086 | |||
| 1950 | Ga0501082_0090266 | |||
| 1951 | Ga0530510_0254120 | |||
| 1952 | 2507504485 | |||
| 1953 | 2508545909 | |||
| 1954 | 2508694741 | |||
| 1955 | 2511400264 | |||
| 1956 | 2513624280 | |||
| 1957 | 2513638767 | |||
| 1958 | 2513649243 | |||
| 1959 | 2513694581 | |||
| 1960 | 2513701643 | |||
| 1961 | 2513716656 | |||
| 1962 | 2513874131 | |||
| 1963 | 2514010104 | |||
| 1964 | 2515624338 | |||
| 1965 | 2517103029 | |||
| 1966 | 2524438868 | |||
| 1967 | 2528849486 | |||
| 1968 | 2617350256 | |||
| 1969 | 2617374346 | |||
| 1970 | 2723842398 | |||
| 1971 | 2728748321 | |||
| 1972 | 2745080371 | |||
| 1973 | 2793059257 | |||
| 1974 | 2793070197 | |||
| 1975 | 2793078764 | |||
| 1976 | 2805920850 | |||
| 1977 | 2818240632 | |||
| 1978 | 2824607602 | |||
| 1979 | 2824615346 | |||
| 1980 | 2824618797 | |||
| 1981 | 2824628903 | |||
| 1982 | 2824638414 | |||
| 1983 | 2824648046 | |||
| 1984 | 2824657967 | |||
| 1985 | 2824665883 | |||
| 1986 | 2824675853 | |||
| 1987 | 2824681638 | |||
| 1988 | 2824692814 | |||
| 1989 | 2824699391 | |||
| 1990 | 2824710856 | |||
| 1991 | 2824722615 | |||
| 1992 | 2824726005 | |||
| 1993 | 2824736433 | |||
| 1994 | 2824751039 | |||
| 1995 | 2824761521 | |||
| 1996 | 2824765064 | |||
| 1997 | 2824778047 | |||
| 1998 | 2838125984 | |||
| 1999 | 2841942621 | |||
| 2000 | 2841953027 | |||
| 2001 | 2841963878 | |||
| 2002 | 2841970947 | |||
| 2003 | 2841977795 | |||
| 2004 | 2841984643 | |||
| 2005 | 2842041636 | |||
| 2006 | 2842049678 | |||
| 2007 | 2844321468 | |||
| 2008 | 2847931928 | |||
| 2009 | 2847943168 | |||
| 2010 | 2849076908 | |||
| 2011 | 2857514828 | |||
| 2012 | 2874595375 | |||
| 2013 | 2874608911 | |||
| 2014 | 2874620424 | |||
| 2015 | 2874621914 | |||
| 2016 | 2874629592 | |||
| 2017 | 2874651801 | |||
| 2018 | 2876763622 | |||
| 2019 | 2876775569 | |||
| 2020 | 2876812910 | |||
| 2021 | 2876823561 | |||
| 2022 | 2879079660 | |||
| 2023 | 2879091162 | |||
| 2024 | 2879104443 | |||
| 2025 | 2879112371 | |||
| 2026 | 2879133936 | |||
| 2027 | 2879145069 | |||
| 2028 | 2881364580 | |||
| 2029 | 2881673323 | |||
| 2030 | 2885374340 | |||
| 2031 | 2885413720 | |||
| 2032 | 2888387312 | |||
| 2033 | 2888391395 | |||
| 2034 | 2888426991 | |||
| 2035 | 2889034384 | |||
| 2036 | 2903727953 | |||
| 2037 | 2904669493 | |||
| 2038 | 2904711305 | |||
| 2039 | 2904716497 | |||
| 2040 | 2906602563 | |||
| 2041 | 2906629677 | |||
| 2042 | 2906645793 | |||
| 2043 | 2908757590 | |||
| 2044 | 2908776828 | |||
| 2045 | 2922364836 | |||
| 2046 | 2922370260 | |||
| 2047 | 2922400120 | |||
| 2048 | 2929622687 | |||
| 2049 | 2929632210 | |||
| 2050 | 2932789975 | |||
| 2051 | 2932800652 | |||
| 2052 | 2932808383 | |||
| 2053 | 2932815517 | |||
| 2054 | 2932824907 | |||
| 2055 | 2932829169 | |||
| 2056 | 2933584682 | |||
| 2057 | 2935613111 | |||
| 2058 | 2935617644 | |||
| 2059 | 2935632986 | |||
| 2060 | 2935643689 | |||
| 2061 | 2935654067 | |||
| 2062 | 2935662831 | |||
| 2063 | 2935671001 | |||
| 2064 | 2935681644 | |||
| 2065 | 2935692621 | |||
| 2066 | 2935702607 | |||
| 2067 | 2935711895 | |||
| 2068 | 2935721239 | |||
| 2069 | 2935730767 | |||
| 2070 | 2935739929 | |||
| 2071 | 2935748967 | |||
| 2072 | 2935758837 | |||
| 2073 | 2935767101 | |||
| 2074 | 2935774863 | |||
| 2075 | 2935779951 | |||
| 2076 | 2935792219 | |||
| 2077 | 2935798612 | |||
| 2078 | 2935806866 | |||
| 2079 | 2935818869 | |||
| 2080 | 2935825037 | |||
| 2081 | 2935834374 | |||
| 2082 | 2935843901 | |||
| 2083 | 2935852256 | |||
| 2084 | 2935856857 | |||
| 2085 | 2935868384 | |||
| 2086 | 2935879694 | |||
| 2087 | 2935883490 | |||
| 2088 | 2935910689 | |||
| 2089 | 2935921869 | |||
| 2090 | 2935929992 | |||
| 2091 | 2935937660 | |||
| 2092 | 2935949764 | |||
| 2093 | 2935956860 | |||
| 2094 | 2935965322 | |||
| 2095 | 2935970883 | |||
| 2096 | 2935982983 | |||
| 2097 | 2935984370 | |||
| 2098 | 2935997200 | |||
| 2099 | 2936009947 | |||
| 2100 | 2936016972 | |||
| 2101 | 2936025620 | |||
| 2102 | 2936034462 | |||
| 2103 | 2936045445 | |||
| 2104 | 2936052504 | |||
| 2105 | 2936055450 | |||
| 2106 | 2940564573 | |||
| 2107 | 2941509712 | |||
| 2108 | 2941517541 | |||
| 2109 | 2941526506 | |||
| 2110 | 2941532050 | |||
| 2111 | 2941545149 | |||
| 2112 | 3005490881 | |||
| 2113 | 3005506527 | |||
| 2114 | 3005593200 | |||
| 2115 | 3005717572 | |||
| 2116 | 3005724621 | |||
| 2117 | 8006928330 | |||
| 2118 | 8006937312 | |||
| 2119 | 8006965273 | |||
| 2120 | 8006977344 | |||
| 2121 | 8006991605 | |||
| 2122 | 8006995426 | |||
| 2123 | 8016519043 | |||
| 2124 | 8016525261 | |||
| 2125 | 8016538843 | |||
| 2126 | 8016543126 | |||
| 2127 | 8016550163 | |||
| 2128 | 8016558572 | |||
| 2129 | 8016581183 | |||
| 2130 | 8016587521 | |||
| 2131 | 8016596555 | |||
| 2132 | 8016619222 | |||
| 2133 | 8016630377 | |||
| 2134 | 8016636758 | |||
| 2135 | 8017057653 | |||
| 2136 | 8019541311 | |||
| 2137 | 8019549320 | |||
| 2138 | 8019578165 | |||
| 2139 | 8019596195 | |||
| 2140 | 8019605499 | |||
| 2141 | 8019613039 | |||
| 2142 | 8019623726 | |||
| 2143 | 8019638308 | |||
| 2144 | 8019641328 | |||
| 2145 | 8019651697 | |||
| 2146 | 8019666232 | |||
| 2147 | 8019675734 | |||
| 2148 | 8019680365 | |||
| 2149 | 8019695453 | |||
| 2150 | 8055750570 | |||
| 2151 | 8056679066 | |||
| 2152 | 8056975347 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gyk-assembly4.cif.gz_D | the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 | 0.9675 | 46 | 217 |
| 3gyk-assembly4.cif.gz_D | the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 | 0.9458 | 46 | 217 |
| 4gxz-assembly3.cif.gz_C | crystal structure of a periplasmic thioredoxin-like protein from salmonella enterica serovar typhimurium | 0.8956 | 48 | 215 |
| 6eez-assembly1.cif.gz_A | crystal structure of the thiol-disulfide exchange protein alpha-dsba2 from wolbachia pipientis | 0.8889 | 38 | 214 |
| 5nyl-assembly2.cif.gz_B | crystal structure of an atypical poplar thioredoxin-like2.1 active site mutant | 0.8849 | 66 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3gykA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9445 | 40 | 218 | 3.40.30.10 |
| 3gykA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9284 | 40 | 218 | 3.40.30.10 |
| af_I1K367_67_180_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9235 | 66 | 102 | 3.40.30.10 |
| af_Q7XSQ7_19_127_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8906 | 66 | 102 | 3.40.30.10 |
| af_Q8LCH9_1_124_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8842 | 66 | 102 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U8KRA5-F1-model_v4 | deleted | 0.9797 | 46 | 217 |
|
| AF-A0A7W0XMI2-F1-model_v4 | DsbA family protein | 0.9694 | 59 | 216 |
GO:0016491
|
| AF-T0HJ65-F1-model_v4 | Thioredoxin domain-containing protein | 0.969 | 67 | 216 |
GO:0016491
|
| AF-A0A529PRT1-F1-model_v4 | Disulfide bond formation protein DsbA | 0.9683 | 48 | 218 |
GO:0016491
|
| AF-A0A2E9X9V3-F1-model_v4 | Thioredoxin domain-containing protein | 0.9662 | 48 | 222 |
GO:0015036
|