F489583

General Info

Members Datasets Scaffolds Average Seq Length
1076 607 2152 218

Family's Representative Sequence

Representative Sequence 3300021321|Ga0214542_1021066|Ga0214542_10210665
Length 236
Sequence MTGARAYIRKTGPERDDMTGFGNNGLGPSRRAALTLIGAGALAVGGIVSARAATGDDEVLTEAKVLRDPDTPVAGNPDGNITIVEWSDYNCPYCRKLEPELRQVVQDDGKVRLVMKDWPILGPVSVTAARSALAAKFQGKYHQAHDALIGVSSRLTEPRINELLAAAGVDMDRLKRDLTGHAKDIDAILKRNNEQAEAFGFQGTPSFIVGKYRVPGVLSMTEFEQVIADARKAKMN

Samples

Sample ID Description Type Environment
1 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
81 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
82 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
112 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
115 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
116 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
180 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
181 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
182 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
183 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
189 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
190 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
191 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
192 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
193 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
211 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
212 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
213 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
236 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
237 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
238 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
268 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
269 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
294 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
297 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
303 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
304 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
305 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
306 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
328 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
329 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
330 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
331 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
332 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
333 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
334 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
337 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
338 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
339 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
343 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
344 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
345 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
346 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
347 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
348 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
349 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
352 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
353 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
354 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
355 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
356 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
357 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
358 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
359 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
362 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
363 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
364 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
365 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
366 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
367 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
368 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
369 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
370 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
371 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
372 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
373 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
374 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
375 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
376 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
377 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
378 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
379 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
380 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
381 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
382 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
385 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
386 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
387 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
388 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
391 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
392 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
393 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
394 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
395 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
396 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
397 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
398 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
399 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
400 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
401 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
402 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
403 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
404 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
407 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
408 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
409 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
410 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
411 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
412 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
413 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
414 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
415 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
416 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
417 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
418 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
419 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
420 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
421 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
422 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
423 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
424 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
425 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
426 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
427 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
428 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
429 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
430 2791355199
431 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
432 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
433 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
434 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
435 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
436 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
437 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
438 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
439 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
440 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
441 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
442 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
443 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
444 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
445 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
446 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
447 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
448 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
449 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
450 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
451 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
452 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
453 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
454 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
455 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
456 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
457 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
458 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
459 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
460 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
461 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
462 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
463 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
464 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
465 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
466 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
467 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
468 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
469 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
470 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
471 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
472 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
473 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
474 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
475 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
476 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
477 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
478 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
479 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
480 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
481 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
482 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
483 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
484 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
485 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
486 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
487 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
488 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
489 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
490 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
491 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
492 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
493 2904699407
494 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
495 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
496 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
497 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
498 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
499 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
500 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
501 2922368715
502 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
503 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
504 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
505 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
506 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
507 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
508 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
509 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
510 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
511 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
512 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
513 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
514 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
515 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
516 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
517 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
518 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
519 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
520 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
521 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
522 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
523 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
524 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
525 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
526 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
527 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
528 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
529 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
530 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
531 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
532 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
533 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
534 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
535 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
536 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
537 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
538 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
539 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
540 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
541 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
542 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
543 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
544 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
545 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
546 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
547 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
548 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
549 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
550 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
551 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
552 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
553 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
554 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
555 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
556 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
557 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
558 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
559 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
560 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
561 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
562 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
563 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
564 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
565 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
566 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
567 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
568 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
569 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
570 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
571 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
572 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
573 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
574 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
575 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
576 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
577 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
578 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
579 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
580 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
581 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
582 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
583 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
584 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
585 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
586 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
587 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
588 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
589 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
590 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
591 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
592 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
593 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
594 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
595 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
596 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
597 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
598 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
599 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
600 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
601 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
602 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
603 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
604 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
605 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
606 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
607 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.99
Metatranscriptomes 0.56
Isolates 18.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.31
Nodule 15.43
Rhizoplane 5.67
Rhizosphere 54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0214542_1021066 3300021321 Bacteria 4603
2 JGI25406J46586_10006811 3300003203 Bacteria 5249
3 JGI25153J46596_10002547 3300003215 Bacteria 10449
4 JGI25153J46596_10003542 3300003215 Bacteria 8707
5 JGI25153J46596_10004097 3300003215 Bacteria 7925
6 JGI25153J46596_10014855 3300003215 Bacteria 3211
7 rootH1_10016026 3300003323 Bacteria 1867
8 JGI25160J50197_1001680 3300003354 Bacteria 10780
9 JGI25160J50197_1003442 3300003354 Bacteria 7079
10 JGI25160J50197_1005384 3300003354 Bacteria 5338
11 JGI25404J52841_10025272 3300003659 Bacteria 1279
12 JGI25404J52841_10030013 3300003659 Bacteria 1165
13 Ga0055531_10007525 3300003794 Bacteria 5917
14 Ga0055543_1007516 3300004625 Bacteria 2506
15 Ga0065165_1000370 3300005262 Bacteria 73604
16 Ga0065165_1006098 3300005262 Bacteria 6459
17 Ga0065165_1008717 3300005262 Bacteria 4687
18 Ga0070658_10021405 3300005327 Bacteria 5182
19 Ga0070676_10394328 3300005328 Bacteria 961
20 Ga0070683_100042686 3300005329 Bacteria 4176
21 Ga0070683_100139749 3300005329 Bacteria 2294
22 Ga0070683_100521941 3300005329 Bacteria 1135
23 Ga0070670_100124537 3300005331 Bacteria 2224
24 Ga0068869_100013181 3300005334 Bacteria 5491
25 Ga0068869_100064153 3300005334 Bacteria 2701
26 Ga0070680_100019553 3300005336 Bacteria 5369
27 Ga0070680_100079829 3300005336 Bacteria 2697
28 Ga0070680_100104138 3300005336 Bacteria 2358
29 Ga0070680_100221827 3300005336 Bacteria 1596
30 Ga0070682_100110140 3300005337 Bacteria 1834
31 Ga0068868_100063339 3300005338 Bacteria 2933
32 Ga0068868_100284079 3300005338 Bacteria 1401
33 Ga0068868_100658426 3300005338 Bacteria 933
34 Ga0070660_100244847 3300005339 Bacteria 1461
35 Ga0070689_100474764 3300005340 Bacteria 1067
36 Ga0070691_10090375 3300005341 Bacteria 1509
37 Ga0070668_100008756 3300005347 Bacteria 7517
38 Ga0070668_100027658 3300005347 Bacteria 4306
39 Ga0070671_100032245 3300005355 Bacteria 4332
40 Ga0070673_100719100 3300005364 Bacteria 918
41 Ga0070667_100137265 3300005367 Bacteria 2138
42 Ga0070667_100425118 3300005367 Bacteria 1212
43 Ga0070709_10003090 3300005434 Bacteria 8947
44 Ga0070709_10008369 3300005434 Bacteria 5681
45 Ga0070714_100162069 3300005435 Bacteria 2024
46 Ga0070713_100002234 3300005436 Bacteria 12560
47 Ga0070713_100008846 3300005436 Bacteria 7167
48 Ga0070713_101072866 3300005436 Bacteria 778
49 Ga0070710_10000552 3300005437 Bacteria 17723
50 Ga0070710_10172200 3300005437 Bacteria 1349
51 Ga0070701_10348617 3300005438 Bacteria 924
52 Ga0070711_100011221 3300005439 Bacteria 5556
53 Ga0070711_100017038 3300005439 Bacteria 4621
54 Ga0070711_100027986 3300005439 Bacteria 3705
55 Ga0070711_100062871 3300005439 Bacteria 2589
56 Ga0070711_100166520 3300005439 Bacteria 1676
57 Ga0070711_100752190 3300005439 Bacteria 824
58 Ga0070700_100252535 3300005441 Bacteria 1265
59 Ga0070663_100435647 3300005455 Bacteria 1078
60 Ga0070663_100672247 3300005455 Bacteria 878
61 Ga0070678_100012735 3300005456 Bacteria 5243
62 Ga0070678_100029982 3300005456 Bacteria 3732
63 Ga0070678_100164756 3300005456 Bacteria 1800
64 Ga0070678_100862047 3300005456 Bacteria 826
65 Ga0070662_100230394 3300005457 Bacteria 1482
66 Ga0070681_10012819 3300005458 Bacteria 8322
67 Ga0070681_10037527 3300005458 Bacteria 4861
68 Ga0070681_10051933 3300005458 Bacteria 4088
69 Ga0070681_10125936 3300005458 Bacteria 2494
70 Ga0070681_10607547 3300005458 Bacteria 1008
71 Ga0070685_10132407 3300005466 Bacteria 1561
72 Ga0070685_10187510 3300005466 Bacteria 1336
73 Ga0070706_100736318 3300005467 Bacteria 914
74 Ga0070698_100604936 3300005471 Bacteria 1036
75 Ga0070679_100031919 3300005530 Bacteria 5207
76 Ga0070679_100034291 3300005530 Bacteria 5029
77 Ga0070679_100109277 3300005530 Bacteria 2751
78 Ga0070679_100137259 3300005530 Bacteria 2426
79 Ga0070679_100138618 3300005530 Bacteria 2413
80 Ga0070679_100600551 3300005530 Bacteria 1044
81 Ga0070684_100003258 3300005535 Bacteria 12159
82 Ga0068853_100026606 3300005539 Bacteria 4858
83 Ga0068853_100112148 3300005539 Bacteria 2424
84 Ga0070672_100649058 3300005543 Bacteria 922
85 Ga0070696_100164886 3300005546 Bacteria 1635
86 Ga0070693_100262254 3300005547 Bacteria 1150
87 Ga0070665_100028897 3300005548 Bacteria 5581
88 Ga0070665_100045145 3300005548 Bacteria 4425
89 Ga0070665_100071651 3300005548 Bacteria 3472
90 Ga0070665_100135904 3300005548 Bacteria 2461
91 Ga0070665_100136213 3300005548 Bacteria 2458
92 Ga0070665_100161250 3300005548 Bacteria 2245
93 Ga0070665_100472269 3300005548 Bacteria 1265
94 Ga0070665_100554908 3300005548 Bacteria 1161
95 Ga0068855_100015587 3300005563 Bacteria 9146
96 Ga0068855_100073742 3300005563 Bacteria 3965
97 Ga0068855_100188786 3300005563 Bacteria 2326
98 Ga0068855_100217196 3300005563 Bacteria 2146
99 Ga0070664_100249863 3300005564 Bacteria 1594
100 Ga0070664_100516844 3300005564 Bacteria 1102
101 Ga0068857_100125486 3300005577 Bacteria 2313
102 Ga0068857_100264142 3300005577 Bacteria 1580
103 Ga0068856_100013570 3300005614 Bacteria 7888
104 Ga0068856_100152081 3300005614 Bacteria 2324
105 Ga0068856_100253525 3300005614 Bacteria 1775
106 Ga0068856_100255228 3300005614 Bacteria 1768
107 Ga0068856_100467549 3300005614 Bacteria 1282
108 Ga0068856_100832796 3300005614 Bacteria 942
109 Ga0070702_100269391 3300005615 Bacteria 1164
110 Ga0070702_100437731 3300005615 Bacteria 945
111 Ga0070702_100510897 3300005615 Bacteria 884
112 Ga0068852_100002075 3300005616 Bacteria 13685
113 Ga0068852_100185761 3300005616 Bacteria 1958
114 Ga0068859_100127861 3300005617 Bacteria 2611
115 Ga0068859_100538127 3300005617 Bacteria 1263
116 Ga0068864_100182468 3300005618 Bacteria 1919
117 Ga0068864_100257270 3300005618 Bacteria 1623
118 Ga0068861_100139299 3300005719 Bacteria 1978
119 Ga0068861_100151333 3300005719 Bacteria 1904
120 Ga0068851_10113048 3300005834 Bacteria 1451
121 Ga0068863_100776274 3300005841 Bacteria 955
122 Ga0068858_100150433 3300005842 Bacteria 2189
123 Ga0068858_100721009 3300005842 Bacteria 971
124 Ga0068860_100084953 3300005843 Bacteria 3010
125 Ga0068860_100215672 3300005843 Bacteria 1862
126 Ga0068860_100238488 3300005843 Bacteria 1768
127 Ga0068862_100158116 3300005844 Bacteria 2021
128 Ga0068862_100373845 3300005844 Bacteria 1327
129 Ga0068862_100569757 3300005844 Bacteria 1083
130 Ga0081455_10003156 3300005937 Bacteria 19144
131 Ga0081455_10006663 3300005937 Bacteria 12343
132 Ga0081455_10007464 3300005937 Bacteria 11515
133 Ga0081455_10073137 3300005937 Bacteria 2835
134 Ga0081540_1001341 3300005983 Bacteria 21422
135 Ga0081540_1002121 3300005983 Bacteria 16515
136 Ga0081540_1012706 3300005983 Bacteria 5523
137 Ga0081540_1018462 3300005983 Bacteria 4276
138 Ga0081540_1073482 3300005983 Bacteria 1571
139 Ga0081540_1100945 3300005983 Bacteria 1243
140 Ga0081540_1120509 3300005983 Bacteria 1090
141 Ga0081540_1120511 3300005983 Bacteria 1090
142 Ga0081539_10000729 3300005985 Bacteria 65907
143 Ga0081539_10091157 3300005985 Bacteria 1575
144 Ga0081539_10125163 3300005985 Bacteria 1271
145 Ga0070717_10001026 3300006028 Bacteria 18703
146 Ga0070717_10237647 3300006028 Bacteria 1606
147 Ga0075365_10033553 3300006038 Bacteria 3309
148 Ga0075365_10046161 3300006038 Bacteria 2860
149 Ga0075368_10008533 3300006042 Bacteria 3653
150 Ga0075368_10102393 3300006042 Bacteria 1177
151 Ga0075368_10103345 3300006042 Bacteria 1172
152 Ga0075368_10127023 3300006042 Bacteria 1058
153 Ga0075363_100003880 3300006048 Bacteria 6449
154 Ga0075363_100013422 3300006048 Bacteria 3971
155 Ga0075363_100060796 3300006048 Bacteria 2035
156 Ga0075363_100163594 3300006048 Bacteria 1261
157 Ga0075364_10039240 3300006051 Bacteria 3069
158 Ga0070716_100069962 3300006173 Bacteria 2059
159 Ga0070716_100073994 3300006173 Bacteria 2011
160 Ga0070716_100585493 3300006173 Bacteria 837
161 Ga0070712_100044616 3300006175 Bacteria 3057
162 Ga0070712_100502818 3300006175 Bacteria 1016
163 Ga0070712_100840602 3300006175 Bacteria 789
164 Ga0075367_10098911 3300006178 Bacteria 1781
165 Ga0075367_10110452 3300006178 Bacteria 1687
166 Ga0075367_10330846 3300006178 Bacteria 960
167 Ga0075369_10028877 3300006186 Bacteria 2327
168 Ga0075366_10008044 3300006195 Bacteria 5844
169 Ga0075366_10071534 3300006195 Bacteria 2066
170 Ga0075366_10094649 3300006195 Bacteria 1791
171 Ga0097621_100234276 3300006237 Bacteria 1603
172 Ga0097621_100239636 3300006237 Bacteria 1585
173 Ga0075370_10028282 3300006353 Bacteria 3115
174 Ga0075370_10042444 3300006353 Bacteria 2570
175 Ga0075370_10116584 3300006353 Bacteria 1553
176 Ga0075370_10132901 3300006353 Bacteria 1452
177 Ga0075370_10216835 3300006353 Bacteria 1130
178 Ga0075428_100622896 3300006844 Bacteria 1152
179 Ga0075434_100092226 3300006871 Bacteria 3031
180 Ga0075434_100826714 3300006871 Bacteria 942
181 Ga0068865_100069342 3300006881 Bacteria 2495
182 Ga0068865_100316538 3300006881 Bacteria 1254
183 Ga0075436_100134933 3300006914 Bacteria 1732
184 Ga0097620_100127864 3300006931 Bacteria 2611
185 Ga0097620_100538168 3300006931 Bacteria 1263
186 Ga0099824_1002047 3300006942 Bacteria 29222
187 Ga0099824_1018951 3300006942 Bacteria 5500
188 Ga0099822_1004737 3300006943 Bacteria 17740
189 Ga0099822_1063565 3300006943 Bacteria 1165
190 Ga0099823_1071205 3300006944 Bacteria 1538
191 Ga0075435_100109533 3300007076 Bacteria 2296
192 Ga0099794_10112341 3300007265 Bacteria 1366
193 Ga0099795_10017558 3300007788 Bacteria 2284
194 Ga0099795_10161517 3300007788 Bacteria 925
195 Ga0105240_10002295 3300009093 Bacteria 30967
196 Ga0105240_10053247 3300009093 Bacteria 5081
197 Ga0105240_10183475 3300009093 Bacteria 2467
198 Ga0105240_10218361 3300009093 Bacteria 2223
199 Ga0105240_10251298 3300009093 Bacteria 2045
200 Ga0105240_10266078 3300009093 Bacteria 1976
201 Ga0105240_10672889 3300009093 Bacteria 1132
202 Ga0111539_10182022 3300009094 Bacteria 2454
203 Ga0111539_10395278 3300009094 Bacteria 1610
204 Ga0105245_10037331 3300009098 Bacteria 4319
205 Ga0105245_10340923 3300009098 Bacteria 1482
206 Ga0105245_10904070 3300009098 Bacteria 924
207 Ga0105243_10994056 3300009148 Bacteria 841
208 Ga0105241_10012898 3300009174 Bacteria 6131
209 Ga0105241_10046174 3300009174 Bacteria 3307
210 Ga0105241_10066451 3300009174 Bacteria 2788
211 Ga0105241_10444899 3300009174 Bacteria 1145
212 Ga0105242_10234670 3300009176 Bacteria 1646
213 Ga0105242_10458835 3300009176 Bacteria 1203
214 Ga0105248_10042923 3300009177 Bacteria 5071
215 Ga0105248_10144863 3300009177 Bacteria 2681
216 Ga0105248_10211185 3300009177 Bacteria 2187
217 Ga0105237_10002301 3300009545 Bacteria 23744
218 Ga0105237_10006999 3300009545 Bacteria 12427
219 Ga0105237_10026831 3300009545 Bacteria 5887
220 Ga0105237_10080389 3300009545 Bacteria 3250
221 Ga0105237_10259204 3300009545 Bacteria 1741
222 Ga0105237_10346620 3300009545 Bacteria 1489
223 Ga0105237_10358448 3300009545 Bacteria 1463
224 Ga0105237_10430729 3300009545 Bacteria 1325
225 Ga0105237_10807367 3300009545 Bacteria 945
226 Ga0105238_10018488 3300009551 Bacteria 7091
227 Ga0105238_10063133 3300009551 Bacteria 3704
228 Ga0105238_10112590 3300009551 Bacteria 2701
229 Ga0105238_10247537 3300009551 Bacteria 1760
230 Ga0105238_10345957 3300009551 Bacteria 1475
231 Ga0105238_10422128 3300009551 Bacteria 1328
232 Ga0105249_10165545 3300009553 Bacteria 2140
233 Ga0105249_10395205 3300009553 Bacteria 1412
234 Ga0105249_11331530 3300009553 Bacteria 790
235 Ga0105239_10025401 3300010375 Bacteria 6522
236 Ga0105239_10083534 3300010375 Bacteria 3517
237 Ga0105239_10142048 3300010375 Bacteria 2676
238 Ga0105239_10321091 3300010375 Bacteria 1746
239 Ga0105239_11309354 3300010375 Bacteria 836
240 Ga0105246_10114789 3300011119 Bacteria 1985
241 Ga0105246_10484397 3300011119 Bacteria 1047
242 Ga0157370_10061670 3300013104 Bacteria 3559
243 Ga0157370_10497971 3300013104 Bacteria 1119
244 Ga0157369_10017488 3300013105 Bacteria 8058
245 Ga0157369_10102904 3300013105 Bacteria 3042
246 Ga0157369_10570470 3300013105 Bacteria 1169
247 Ga0157374_10191301 3300013296 Bacteria 2002
248 Ga0157378_10057612 3300013297 Bacteria 3463
249 Ga0157378_10146176 3300013297 Bacteria 2199
250 Ga0157378_10573750 3300013297 Bacteria 1136
251 Ga0163162_10155709 3300013306 Bacteria 2405
252 Ga0163162_10362366 3300013306 Bacteria 1583
253 Ga0163162_10475004 3300013306 Bacteria 1382
254 Ga0157372_10118851 3300013307 Bacteria 3033
255 Ga0157375_10069051 3300013308 Bacteria 3538
256 Ga0157375_10076159 3300013308 Bacteria 3381
257 Ga0157375_10137987 3300013308 Bacteria 2564
258 Ga0157375_10541055 3300013308 Bacteria 1327
259 Ga0157375_10784330 3300013308 Bacteria 1102
260 Ga0163163_10002774 3300014325 Bacteria 14789
261 Ga0163163_10043948 3300014325 Bacteria 4382
262 Ga0163163_10129093 3300014325 Bacteria 2567
263 Ga0163163_10183688 3300014325 Bacteria 2139
264 Ga0163163_10203230 3300014325 Bacteria 2030
265 Ga0163163_10910132 3300014325 Bacteria 943
266 Ga0157377_10044206 3300014745 Bacteria 2483
267 Ga0157379_10192263 3300014968 Bacteria 1844
268 Ga0157379_10255394 3300014968 Bacteria 1592
269 Ga0157379_10609805 3300014968 Bacteria 1019
270 Ga0157376_10086282 3300014969 Bacteria 2706
271 Ga0157376_10179560 3300014969 Bacteria 1934
272 Ga0157376_10321788 3300014969 Bacteria 1471
273 Ga0157376_10537824 3300014969 Bacteria 1154
274 Ga0163161_10171094 3300017792 Bacteria 1661
275 Ga0163161_10299170 3300017792 Bacteria 1267
276 Ga0163161_10338303 3300017792 Bacteria 1193
277 Ga0197907_11157109 3300020069 Bacteria 1476
278 Ga0206355_1507511 3300020076 Bacteria 1302
279 Ga0206350_10389318 3300020080 Bacteria 991
280 Ga0206353_10556866 3300020082 Bacteria 959
281 Ga0214544_1000003 3300021320 Bacteria 643752
282 Ga0214542_1000003 3300021321 Bacteria 435700
283 Ga0214545_1000004 3300021324 Bacteria 453352
284 Ga0214545_1021274 3300021324 Bacteria 4909
285 Ga0214543_1000007 3300021327 Bacteria 414744
286 Ga0213876_10002755 3300021384 Bacteria 10233
287 Ga0213876_10094238 3300021384 Bacteria 1586
288 Ga0213875_10130551 3300021388 Bacteria 1175
289 Ga0224712_10107802 3300022467 Bacteria 1191
290 Ga0209563_100438 3300025230 Bacteria 14431
291 Ga0209677_103197 3300025253 Bacteria 5489
292 Ga0209148_1000267 3300025254 Bacteria 81839
293 Ga0209233_1012874 3300025261 Bacteria 2408
294 Ga0209455_1001737 3300025272 Bacteria 9272
295 Ga0209673_1013733 3300025273 Bacteria 3180
296 Ga0209564_1010432 3300025295 Bacteria 4282
297 Ga0209758_1000030 3300025297 Bacteria 509217
298 Ga0209758_1000277 3300025297 Bacteria 102106
299 Ga0209758_1000711 3300025297 Bacteria 49164
300 Ga0209758_1000893 3300025297 Bacteria 40627
301 Ga0209758_1001645 3300025297 Bacteria 25366
302 Ga0209758_1002462 3300025297 Bacteria 18855
303 Ga0209758_1005049 3300025297 Bacteria 10483
304 Ga0209758_1050686 3300025297 Bacteria 1453
305 Ga0207426_1000271 3300025302 Bacteria 108392
306 Ga0207426_1001517 3300025302 Bacteria 18935
307 Ga0207426_1008000 3300025302 Bacteria 4342
308 Ga0209257_1000662 3300025304 Bacteria 54143
309 Ga0209257_1015967 3300025304 Bacteria 3073
310 Ga0207653_10004044 3300025885 Bacteria 4615
311 Ga0207692_10001302 3300025898 Bacteria 9295
312 Ga0207692_10075621 3300025898 Bacteria 1787
313 Ga0207692_10250024 3300025898 Bacteria 1062
314 Ga0207710_10028157 3300025900 Bacteria 2438
315 Ga0207688_10033353 3300025901 Bacteria 2847
316 Ga0207688_10069981 3300025901 Bacteria 1989
317 Ga0207680_10231384 3300025903 Bacteria 1270
318 Ga0207647_10008109 3300025904 Bacteria 7549
319 Ga0207647_10211960 3300025904 Bacteria 1118
320 Ga0207699_10023510 3300025906 Bacteria 3355
321 Ga0207699_10045183 3300025906 Bacteria 2569
322 Ga0207645_10084865 3300025907 Bacteria 2033
323 Ga0207684_10261744 3300025910 Bacteria 1492
324 Ga0207707_10000438 3300025912 Bacteria 43316
325 Ga0207707_10136890 3300025912 Bacteria 2141
326 Ga0207707_10669633 3300025912 Bacteria 873
327 Ga0207695_10000059 3300025913 Bacteria 363920
328 Ga0207695_10027002 3300025913 Bacteria 6397
329 Ga0207695_10043272 3300025913 Bacteria 4800
330 Ga0207695_10218834 3300025913 Bacteria 1812
331 Ga0207671_10001109 3300025914 Bacteria 32478
332 Ga0207671_10035801 3300025914 Bacteria 3681
333 Ga0207671_10069327 3300025914 Bacteria 2629
334 Ga0207671_10162971 3300025914 Bacteria 1727
335 Ga0207671_10173745 3300025914 Bacteria 1674
336 Ga0207693_10027888 3300025915 Bacteria 4463
337 Ga0207693_10104554 3300025915 Bacteria 2221
338 Ga0207693_10114267 3300025915 Bacteria 2118
339 Ga0207693_10235143 3300025915 Bacteria 1439
340 Ga0207693_10463230 3300025915 Bacteria 990
341 Ga0207663_10017392 3300025916 Bacteria 4006
342 Ga0207663_10030104 3300025916 Bacteria 3197
343 Ga0207663_10095514 3300025916 Bacteria 1983
344 Ga0207660_10017792 3300025917 Bacteria 4730
345 Ga0207660_10087395 3300025917 Bacteria 2303
346 Ga0207660_10183018 3300025917 Bacteria 1628
347 Ga0207660_10219447 3300025917 Bacteria 1492
348 Ga0207660_10619273 3300025917 Bacteria 882
349 Ga0207657_10275808 3300025919 Bacteria 1336
350 Ga0207657_10506158 3300025919 Bacteria 946
351 Ga0207652_10047083 3300025921 Bacteria 3683
352 Ga0207652_10518673 3300025921 Bacteria 1072
353 Ga0207694_10173320 3300025924 Bacteria 1747
354 Ga0207694_10356417 3300025924 Bacteria 1211
355 Ga0207650_10158200 3300025925 Bacteria 1793
356 Ga0207659_10263324 3300025926 Bacteria 1403
357 Ga0207700_10067007 3300025928 Bacteria 2746
358 Ga0207700_10234026 3300025928 Bacteria 1563
359 Ga0207700_10634800 3300025928 Bacteria 952
360 Ga0207664_10021535 3300025929 Bacteria 4797
361 Ga0207644_10018254 3300025931 Bacteria 4744
362 Ga0207644_10334329 3300025931 Bacteria 1227
363 Ga0207644_10743095 3300025931 Bacteria 819
364 Ga0207706_10059147 3300025933 Bacteria 3375
365 Ga0207706_10134929 3300025933 Bacteria 2171
366 Ga0207706_10499489 3300025933 Bacteria 1050
367 Ga0207686_10200241 3300025934 Bacteria 1430
368 Ga0207686_10225341 3300025934 Bacteria 1356
369 Ga0207670_10389508 3300025936 Bacteria 1112
370 Ga0207669_10478717 3300025937 Bacteria 992
371 Ga0207669_10624750 3300025937 Bacteria 878
372 Ga0207704_10265709 3300025938 Bacteria 1296
373 Ga0207665_10014858 3300025939 Bacteria 5119
374 Ga0207665_10061914 3300025939 Bacteria 2538
375 Ga0207665_10380452 3300025939 Bacteria 1071
376 Ga0207691_10197132 3300025940 Bacteria 1754
377 Ga0207711_10018230 3300025941 Bacteria 5835
378 Ga0207711_10276472 3300025941 Bacteria 1546
379 Ga0207711_10876686 3300025941 Bacteria 835
380 Ga0207689_10080482 3300025942 Bacteria 2678
381 Ga0207689_10208165 3300025942 Bacteria 1615
382 Ga0207661_10000959 3300025944 Bacteria 18985
383 Ga0207661_10412760 3300025944 Bacteria 1225
384 Ga0207679_10401124 3300025945 Bacteria 1206
385 Ga0207667_10044714 3300025949 Bacteria 4691
386 Ga0207667_10086148 3300025949 Bacteria 3251
387 Ga0207667_10101512 3300025949 Bacteria 2967
388 Ga0207667_10406284 3300025949 Bacteria 1386
389 Ga0207668_10060395 3300025972 Bacteria 2660
390 Ga0207668_10069357 3300025972 Bacteria 2510
391 Ga0207668_10095673 3300025972 Bacteria 2192
392 Ga0207668_10124091 3300025972 Bacteria 1960
393 Ga0207668_10425960 3300025972 Bacteria 1127
394 Ga0207658_10678577 3300025986 Bacteria 930
395 Ga0207677_10461146 3300026023 Bacteria 1091
396 Ga0207703_10050557 3300026035 Bacteria 3365
397 Ga0207703_10181953 3300026035 Bacteria 1855
398 Ga0207639_10023427 3300026041 Bacteria 4459
399 Ga0207639_10160589 3300026041 Bacteria 1893
400 Ga0207639_10163367 3300026041 Bacteria 1879
401 Ga0207639_10267758 3300026041 Bacteria 1497
402 Ga0207678_10021386 3300026067 Bacteria 5673
403 Ga0207678_10023768 3300026067 Bacteria 5359
404 Ga0207678_10025320 3300026067 Bacteria 5180
405 Ga0207678_10040824 3300026067 Bacteria 4022
406 Ga0207678_10052328 3300026067 Bacteria 3523
407 Ga0207678_10064507 3300026067 Bacteria 3147
408 Ga0207678_10698805 3300026067 Bacteria 892
409 Ga0207708_10433723 3300026075 Bacteria 1092
410 Ga0207708_10513717 3300026075 Bacteria 1006
411 Ga0207702_10106927 3300026078 Bacteria 2480
412 Ga0207702_10186192 3300026078 Bacteria 1915
413 Ga0207702_10380959 3300026078 Bacteria 1356
414 Ga0207702_10436225 3300026078 Bacteria 1269
415 Ga0207648_10042881 3300026089 Bacteria 3973
416 Ga0207648_10704914 3300026089 Bacteria 935
417 Ga0207676_10128955 3300026095 Bacteria 2147
418 Ga0207676_10163439 3300026095 Bacteria 1932
419 Ga0207676_10614381 3300026095 Bacteria 1046
420 Ga0207674_10055839 3300026116 Bacteria 4013
421 Ga0207674_10057340 3300026116 Bacteria 3948
422 Ga0207674_10084699 3300026116 Bacteria 3167
423 Ga0207674_10310289 3300026116 Bacteria 1527
424 Ga0207675_100031542 3300026118 Bacteria 4936
425 Ga0207675_100279247 3300026118 Bacteria 1623
426 Ga0207675_100354860 3300026118 Bacteria 1438
427 Ga0207683_10008695 3300026121 Bacteria 8677
428 Ga0207683_10032517 3300026121 Bacteria 4531
429 Ga0207683_10135169 3300026121 Bacteria 2219
430 Ga0207683_10450052 3300026121 Bacteria 1187
431 Ga0207683_10470438 3300026121 Bacteria 1159
432 Ga0207698_10013446 3300026142 Bacteria 5400
433 Ga0207698_10166178 3300026142 Bacteria 1937
434 Ga0207698_10371088 3300026142 Bacteria 1358
435 Ga0207698_11005794 3300026142 Bacteria 844
436 Ga0207698_11336862 3300026142 Bacteria 731
437 Ga0209389_1000055 3300027296 Bacteria 108798
438 Ga0209389_1000494 3300027296 Bacteria 23661
439 Ga0209589_1000005 3300027357 Bacteria 530958
440 Ga0209589_1000024 3300027357 Bacteria 169886
441 Ga0209489_100005 3300027361 Bacteria 530958
442 Ga0209489_100123 3300027361 Bacteria 113105
443 Ga0209489_103769 3300027361 Bacteria 28981
444 Ga0209700_100006 3300027363 Bacteria 530958
445 Ga0209700_100420 3300027363 Bacteria 77617
446 Ga0209588_1014950 3300027671 Bacteria 2383
447 Ga0209588_1031471 3300027671 Bacteria 1698
448 Ga0209813_10024296 3300027866 Bacteria 1732
449 Ga0268266_10000638 3300028379 Bacteria 47680
450 Ga0268266_10001364 3300028379 Bacteria 29475
451 Ga0268266_10030958 3300028379 Bacteria 4544
452 Ga0268266_10070131 3300028379 Bacteria 3037
453 Ga0268266_10085353 3300028379 Bacteria 2758
454 Ga0268266_10117632 3300028379 Bacteria 2362
455 Ga0268266_10366104 3300028379 Bacteria 1357
456 Ga0268266_10712521 3300028379 Bacteria 967
457 Ga0268266_10768309 3300028379 Bacteria 930
458 Ga0268266_10774729 3300028379 Bacteria 926
459 Ga0268266_10848742 3300028379 Bacteria 883
460 Ga0268265_10178216 3300028380 Bacteria 1824
461 Ga0268265_10396337 3300028380 Bacteria 1274
462 Ga0268265_10678065 3300028380 Bacteria 993
463 Ga0268265_10770230 3300028380 Bacteria 935
464 Ga0268264_10000051 3300028381 Bacteria 321565
465 Ga0268264_10295742 3300028381 Bacteria 1522
466 Ga0265337_1006988 3300028556 Bacteria 4274
467 Ga0265334_10005278 3300028573 Bacteria 5652
468 Ga0265318_10031122 3300028577 Bacteria 2071
469 Ga0265323_10000560 3300028653 Bacteria 20568
470 Ga0265336_10000550 3300028666 Bacteria 21394
471 Ga0307517_10000856 3300028786 Bacteria 51999
472 Ga0307515_10027090 3300028794 Bacteria 9818
473 Ga0265338_10000231 3300028800 Bacteria 103805
474 Ga0265324_10005806 3300029957 Bacteria 5250
475 Ga0265339_10034239 3300031249 Bacteria 2855
476 Ga0307513_10125136 3300031456 Bacteria 2528
477 Ga0307509_10085186 3300031507 Bacteria 3253
478 Ga0307508_10014562 3300031616 Bacteria 7175
479 Ga0307508_10567299 3300031616 Bacteria 734
480 Ga0265314_10069773 3300031711 Bacteria 2357
481 Ga0265342_10003396 3300031712 Bacteria 13107
482 Ga0307516_10011176 3300031730 Bacteria 9797
483 Ga0307405_10374919 3300031731 Bacteria 1106
484 Ga0307413_10103325 3300031824 Bacteria 1889
485 Ga0307409_100119908 3300031995 Bacteria 2225
486 Ga0307416_100286859 3300032002 Bacteria 1627
487 Ga0307415_100143022 3300032126 Bacteria 1830
488 Ga0307510_10004951 3300033180 Bacteria 15758
489 Ga0307510_10022034 3300033180 Bacteria 7406
490 Ga0307510_10121417 3300033180 Bacteria 2316
491 Ga0316215_1002564 3300033544 Bacteria 1719
492 Ga0373934_0076806 3300035086 Bacteria 1340
493 Ga0373949_0020331 3300035090 Bacteria 1518
494 Ga0373952_0006580 3300035092 Bacteria 2152
495 Ga0373945_0209184 3300035116 Bacteria 812
496 Ga0373954_0052727 3300035118 Bacteria 1911
497 Ga0373956_0087974 3300035119 Bacteria 1431
498 Ga0373960_0132987 3300035121 Bacteria 836
499 Ga0373943_0157391 3300035170 Bacteria 1235
500 Ga0373943_0234201 3300035170 Bacteria 1027
501 Ga0373955_0108257 3300035172 Bacteria 1604
502 Ga0373955_0122209 3300035172 Bacteria 1514
503 Ga0373924_0027656 3300035410 Bacteria 2256
504 Ga0373931_0008723 3300035691 Bacteria 4824
505 Ga0373935_0557741 3300035692 Bacteria 835
506 Ga0373927_0012565 3300035695 Bacteria 5638
507 Ga0373927_0263187 3300035695 Bacteria 1134
508 Ga0373927_0363133 3300035695 Bacteria 954
509 Ga0373933_0000018 3300035724 Bacteria 98044
510 Ga0373937_0069895 3300036401 Bacteria 3238
511 Ga0373937_0227646 3300036401 Bacteria 1755
512 Ga0372808_020869 3300036459 Bacteria 942
513 Ga0373925_0401179 3300037068 Bacteria 1118
514 Ga0373925_0639533 3300037068 Bacteria 876
515 Ga0395899_0050587 3300037312 Bacteria 3085
516 Ga0395899_0443317 3300037312 Bacteria 852
517 Ga0395900_0001051 3300037418 Bacteria 35383
518 Ga0395900_0169700 3300037418 Bacteria 2222
519 Ga0395900_0265761 3300037418 Bacteria 1711
520 Ga0395900_0399957 3300037418 Bacteria 1338
521 Ga0395898_0001503 3300037466 Bacteria 32214
522 Ga0395898_0004875 3300037466 Bacteria 14570
523 Ga0395898_0532852 3300037466 Bacteria 1116
524 Ga0395905_0064717 3300037471 Bacteria 3422
525 Ga0395905_0109320 3300037471 Bacteria 2596
526 Ga0395905_0134424 3300037471 Bacteria 2326
527 Ga0436364_0238267 3300037853 Bacteria 846
528 Ga0436364_0310036 3300037853 Bacteria 2843
529 Ga0395901_0051645 3300038443 Bacteria 4275
530 Ga0395901_0061578 3300038443 Bacteria 3905
531 Ga0395901_0092858 3300038443 Bacteria 3159
532 Ga0395901_0371972 3300038443 Bacteria 1472
533 Ga0436365_0093274 3300039437 Bacteria 81442
534 Ga0436365_0372041 3300039437 Bacteria 3768
535 Ga0436365_1021233 3300039437 Bacteria 861
536 Ga0436363_0554977 3300039450 Bacteria 1279
537 Ga0436363_1689393 3300039450 Bacteria 959
538 Ga0436362_0626323 3300039453 Bacteria 7982
539 Ga0451789_0919161 3300041443 Bacteria 1052
540 Ga0451833_0031051 3300041491 Bacteria 1104
541 Ga0466969_0026762 3300044656 Bacteria 2957
542 Ga0466972_0000124 3300044658 Bacteria 65163
543 Ga0466972_0002537 3300044658 Bacteria 9032
544 Ga0466965_0026765 3300044683 Bacteria 2796
545 Ga0466965_0318596 3300044683 Bacteria 847
546 Ga0466966_0000411 3300044684 Bacteria 27522
547 Ga0466961_0000065 3300044693 Bacteria 63259
548 Ga0466961_0254334 3300044693 Bacteria 1078
549 Ga0466963_0027444 3300044694 Bacteria 3646
550 Ga0466968_0006334 3300044735 Bacteria 4457
551 Ga0466968_0215322 3300044735 Bacteria 903
552 Ga0466970_0089040 3300044765 Bacteria 1674
553 Ga0466970_0143814 3300044765 Bacteria 1315
554 Ga0466960_0001481 3300044901 Bacteria 8559
555 Ga0466960_0139165 3300044901 Bacteria 1288
556 Ga0466960_0220761 3300044901 Bacteria 1043
557 Ga0466959_0000634 3300045049 Bacteria 20407
558 Ga0466959_0275904 3300045049 Bacteria 1155
559 Ga0466958_0031405 3300045836 Bacteria 3157
560 Ga0495603_0082839 3300046455 Bacteria 1879
561 Ga0495603_0132329 3300046455 Bacteria 1452
562 Ga0495603_0300832 3300046455 Bacteria 921
563 Ga0495629_0003519 3300046459 Bacteria 11838
564 Ga0495629_0206705 3300046459 Bacteria 1357
565 Ga0495638_0011267 3300046460 Bacteria 6167
566 Ga0495638_0085181 3300046460 Bacteria 1912
567 Ga0495641_0062004 3300046461 Bacteria 1687
568 Ga0495651_0017692 3300046462 Bacteria 5518
569 Ga0495651_0424287 3300046462 Bacteria 864
570 Ga0495580_0092623 3300046472 Bacteria 2104
571 Ga0495639_0056409 3300046475 Bacteria 1793
572 Ga0495639_0061813 3300046475 Bacteria 1718
573 Ga0495664_0011915 3300046477 Bacteria 4914
574 Ga0495584_0131529 3300046491 Bacteria 1270
575 Ga0495585_0283872 3300046492 Bacteria 818
576 Ga0495594_0065555 3300046499 Bacteria 2014
577 Ga0495596_0092262 3300046500 Bacteria 1176
578 Ga0495583_0044422 3300046506 Bacteria 2062
579 Ga0495606_0065243 3300046507 Bacteria 2314
580 Ga0495606_0160809 3300046507 Bacteria 1310
581 Ga0495610_0078267 3300046512 Bacteria 1525
582 Ga0495616_0057328 3300046513 Bacteria 1921
583 Ga0495616_0084560 3300046513 Bacteria 1512
584 Ga0495616_0253094 3300046513 Bacteria 756
585 Ga0495618_0141248 3300046514 Bacteria 1540
586 Ga0495620_0020979 3300046515 Bacteria 3180
587 Ga0495643_0045119 3300046522 Bacteria 2393
588 Ga0495648_0008955 3300046524 Bacteria 7820
589 Ga0495648_0218345 3300046524 Bacteria 942
590 Ga0495666_0133388 3300046526 Bacteria 1160
591 Ga0495652_0089784 3300046529 Bacteria 2515
592 Ga0495652_0122342 3300046529 Bacteria 2073
593 Ga0495652_0391588 3300046529 Bacteria 986
594 Ga0495652_0457905 3300046529 Bacteria 892
595 Ga0495654_0129733 3300046530 Bacteria 1133
596 Ga0495640_0027614 3300046533 Bacteria 4091
597 Ga0495640_0081673 3300046533 Bacteria 2148
598 Ga0495640_0087035 3300046533 Bacteria 2067
599 Ga0495586_0158427 3300046535 Bacteria 1276
600 Ga0495587_0269474 3300046536 Bacteria 955
601 Ga0495609_0090829 3300046538 Bacteria 1328
602 Ga0495645_0017494 3300046543 Bacteria 5135
603 Ga0495645_0163321 3300046543 Bacteria 1538
604 Ga0495622_0014799 3300046557 Bacteria 3626
605 Ga0495622_0265165 3300046557 Bacteria 753
606 Ga0495667_0044811 3300046559 Bacteria 2929
607 Ga0495668_0084179 3300046616 Bacteria 1744
608 Ga0495668_0379536 3300046616 Bacteria 776
609 Ga0495634_0056964 3300046642 Bacteria 2610
610 Ga0495611_0244628 3300046648 Bacteria 832
611 Ga0495625_0225233 3300046660 Bacteria 1227
612 Ga0495635_0158351 3300046663 Bacteria 1541
613 Ga0495635_0366258 3300046663 Bacteria 960
614 Ga0495588_0001353 3300046674 Bacteria 10458
615 Ga0495657_0002384 3300046675 Bacteria 15809
616 Ga0495657_0014532 3300046675 Bacteria 5776
617 Ga0495599_0004607 3300046678 Bacteria 8178
618 Ga0495599_0065022 3300046678 Bacteria 2279
619 Ga0495599_0067383 3300046678 Bacteria 2236
620 Ga0495623_0010248 3300046679 Bacteria 6064
621 Ga0495623_0320794 3300046679 Bacteria 851
622 Ga0495646_0113582 3300046680 Bacteria 1540
623 Ga0495646_0120906 3300046680 Bacteria 1482
624 Ga0495613_0062464 3300046689 Bacteria 2726
625 Ga0495613_0274008 3300046689 Bacteria 1173
626 Ga0495613_0756129 3300046689 Bacteria 637
627 Ga0495624_0067145 3300046690 Bacteria 2238
628 Ga0495624_0110799 3300046690 Bacteria 1688
629 Ga0495670_0115431 3300046691 Bacteria 1392
630 Ga0495671_0043951 3300046692 Bacteria 2241
631 Ga0495671_0072278 3300046692 Bacteria 1694
632 Ga0495671_0286670 3300046692 Bacteria 793
633 Ga0495649_0024307 3300046694 Bacteria 3379
634 Ga0495600_0210544 3300046809 Bacteria 1246
635 Ga0495660_0076880 3300046810 Bacteria 1758
636 Ga0495581_0014180 3300047315 Bacteria 4620
637 Ga0495581_0041048 3300047315 Bacteria 2677
638 Ga0495604_0002741 3300047317 Bacteria 14128
639 Ga0495604_0006835 3300047317 Bacteria 9039
640 Ga0495674_0018428 3300047319 Bacteria 6499
641 Ga0495672_0017605 3300047320 Bacteria 4776
642 Ga0495672_0050250 3300047320 Bacteria 2463
643 Ga0495676_0055266 3300047321 Bacteria 3149
644 Ga0495676_0102528 3300047321 Bacteria 2114
645 Ga0495676_0374195 3300047321 Bacteria 949
646 Ga0495680_0001876 3300047322 Bacteria 22116
647 Ga0495680_0085161 3300047322 Bacteria 2380
648 Ga0495687_016979 3300047443 Bacteria 3645
649 Ga0495675_0007387 3300047444 Bacteria 6766
650 Ga0495685_082541 3300047447 Bacteria 1070
651 Ga0495673_0060041 3300047469 Bacteria 1632
652 Ga0495673_0061680 3300047469 Bacteria 1604
653 Ga0495673_0108676 3300047469 Bacteria 1112
654 Ga0495684_0012933 3300047471 Bacteria 6442
655 Ga0495684_0436988 3300047471 Bacteria 912
656 Ga0495686_0114233 3300047472 Bacteria 1616
657 Ga0495686_0147890 3300047472 Bacteria 1381
658 Ga0495686_0179200 3300047472 Bacteria 1229
659 Ga0495593_0079436 3300047673 Bacteria 1698
660 Ga0495602_0134279 3300048088 Bacteria 1968
661 Ga0495602_0543596 3300048088 Bacteria 806
662 Ga0496101_0055034 3300048904 Bacteria 2873
663 Ga0496101_0149898 3300048904 Bacteria 1783
664 Ga0496101_0559044 3300048904 Bacteria 905
665 Ga0496102_0107971 3300048905 Bacteria 2592
666 Ga0496102_0125274 3300048905 Bacteria 2401
667 Ga0496102_0134420 3300048905 Bacteria 2317
668 Ga0496102_0252451 3300048905 Bacteria 1663
669 Ga0496103_0080553 3300048906 Bacteria 2047
670 Ga0496103_0338198 3300048906 Bacteria 968
671 Ga0496103_0629569 3300048906 Bacteria 682
672 Ga0496104_0009070 3300048907 Bacteria 8843
673 Ga0496104_0024225 3300048907 Bacteria 5582
674 Ga0496104_0037936 3300048907 Bacteria 4506
675 Ga0496104_0068302 3300048907 Bacteria 3377
676 Ga0496104_0103508 3300048907 Bacteria 2727
677 Ga0496104_0375050 3300048907 Bacteria 1335
678 Ga0496105_0022832 3300048908 Bacteria 5070
679 Ga0496105_0039456 3300048908 Bacteria 3892
680 Ga0496105_0099088 3300048908 Bacteria 2407
681 Ga0496105_0589435 3300048908 Bacteria 864
682 Ga0496106_0026873 3300048909 Bacteria 4286
683 Ga0496106_0038587 3300048909 Bacteria 3575
684 Ga0496106_0264939 3300048909 Bacteria 1375
685 Ga0496106_0271437 3300048909 Bacteria 1358
686 Ga0496106_0285674 3300048909 Bacteria 1322
687 Ga0496107_0011974 3300048910 Bacteria 6054
688 Ga0496107_0164616 3300048910 Bacteria 1644
689 Ga0496107_0237925 3300048910 Bacteria 1355
690 Ga0496107_0709954 3300048910 Bacteria 739
691 Ga0496108_0012004 3300048911 Bacteria 7048
692 Ga0496108_0013488 3300048911 Bacteria 6669
693 Ga0496108_0080117 3300048911 Bacteria 2766
694 Ga0496108_0243202 3300048911 Bacteria 1565
695 Ga0496108_0467421 3300048911 Bacteria 1102
696 Ga0496109_0023442 3300048912 Bacteria 5480
697 Ga0496109_0222517 3300048912 Bacteria 1775
698 Ga0496109_0275200 3300048912 Bacteria 1586
699 Ga0496109_0296979 3300048912 Bacteria 1523
700 Ga0496109_0721487 3300048912 Bacteria 934
701 Ga0496109_0893173 3300048912 Bacteria 826
702 Ga0496110_0015719 3300048913 Bacteria 6306
703 Ga0496110_0015752 3300048913 Bacteria 6301
704 Ga0496110_0980438 3300048913 Bacteria 752
705 Ga0496111_0056301 3300048914 Bacteria 2845
706 Ga0496111_0152814 3300048914 Bacteria 1712
707 Ga0496111_0583484 3300048914 Bacteria 819
708 Ga0496112_0045698 3300048915 Bacteria 4293
709 Ga0496112_0053279 3300048915 Bacteria 3973
710 Ga0496112_0242029 3300048915 Bacteria 1756
711 Ga0496112_0704478 3300048915 Bacteria 937
712 Ga0496112_0938372 3300048915 Bacteria 786
713 Ga0496113_0004044 3300048916 Bacteria 8931
714 Ga0496113_0055910 3300048916 Bacteria 2960
715 Ga0496113_0297442 3300048916 Bacteria 1292
716 Ga0496113_0534347 3300048916 Bacteria 941
717 Ga0496114_0014145 3300048917 Bacteria 6399
718 Ga0496114_0121968 3300048917 Bacteria 2242
719 Ga0496115_0005405 3300048918 Bacteria 9289
720 Ga0496115_0032960 3300048918 Bacteria 4089
721 Ga0496115_0069485 3300048918 Bacteria 2853
722 Ga0496116_0028887 3300048919 Bacteria 4009
723 Ga0496116_0032538 3300048919 Bacteria 3715
724 Ga0496116_0242663 3300048919 Bacteria 904
725 Ga0496117_0061833 3300048920 Bacteria 2571
726 Ga0496117_0071741 3300048920 Bacteria 2319
727 Ga0496117_0301026 3300048920 Bacteria 849
728 Ga0496118_0002445 3300048921 Bacteria 25000
729 Ga0496119_0015983 3300048922 Bacteria 5739
730 Ga0496119_0069417 3300048922 Bacteria 2071
731 Ga0496119_0215489 3300048922 Bacteria 985
732 Ga0496120_0035858 3300048923 Bacteria 2958
733 Ga0496121_0000452 3300048924 Bacteria 80796
734 Ga0496121_0000571 3300048924 Bacteria 69504
735 Ga0496121_0024152 3300048924 Bacteria 5823
736 Ga0496121_0043447 3300048924 Bacteria 3891
737 Ga0496121_0050510 3300048924 Bacteria 3512
738 Ga0496121_0051348 3300048924 Bacteria 3473
739 Ga0496121_0071559 3300048924 Bacteria 2788
740 Ga0496121_0114848 3300048924 Bacteria 2045
741 Ga0496121_0322890 3300048924 Bacteria 1039
742 Ga0496122_0205725 3300048925 Bacteria 1146
743 Ga0496124_0000267 3300048927 Bacteria 101138
744 Ga0496124_0026050 3300048927 Bacteria 5280
745 Ga0496124_0053485 3300048927 Bacteria 3422
746 Ga0496125_0043745 3300048928 Bacteria 3796
747 Ga0496125_0059362 3300048928 Bacteria 3083
748 Ga0496125_0069134 3300048928 Bacteria 2773
749 Ga0496126_0015704 3300048929 Bacteria 7609
750 Ga0496126_0035587 3300048929 Bacteria 4665
751 Ga0496126_0052619 3300048929 Bacteria 3699
752 Ga0496126_0059836 3300048929 Bacteria 3429
753 Ga0496126_0071503 3300048929 Bacteria 3088
754 Ga0496126_0355971 3300048929 Bacteria 1196
755 Ga0496126_0366683 3300048929 Bacteria 1175
756 Ga0496126_0580061 3300048929 Bacteria 886
757 Ga0496126_0676636 3300048929 Bacteria 804
758 Ga0495682_0014877 3300049460 Bacteria 2948
759 Ga0495682_0139946 3300049460 Bacteria 864
760 Ga0501069_0480989 3300049585 Bacteria 740
761 Ga0501071_0175538 3300049587 Bacteria 1605
762 Ga0501076_0123356 3300049592 Bacteria 2098
763 Ga0501080_0060360 3300049742 Bacteria 3530
764 Ga0501035_0618962 3300049822 Bacteria 881
765 nmdc:mga03683_133639_c1 3300050489 Bacteria 1111
766 nmdc:mga03683_184261_c1 3300050489 Bacteria 953
767 nmdc:mga03n38_155829_c1 3300050490 Bacteria 1153
768 nmdc:mga03n38_208_c1 3300050490 Bacteria 12446
769 nmdc:mga03n38_58574_c1 3300050490 Bacteria 1746
770 nmdc:mga00v17_145883_c1 3300050491 Bacteria 1519
771 nmdc:mga00v17_439992_c1 3300050491 Bacteria 847
772 nmdc:mga00v17_55068_c1 3300050491 Bacteria 2428
773 nmdc:mga0yw44_14616_c1 3300050492 Bacteria 4175
774 nmdc:mga0yw44_223543_c1 3300050492 Bacteria 1248
775 nmdc:mga0yw44_557513_c1 3300050492 Bacteria 778
776 nmdc:mga0yw44_66485_c1 3300050492 Bacteria 2225
777 nmdc:mga0k408_122214_c1 3300050493 Bacteria 1543
778 nmdc:mga0k408_211493_c1 3300050493 Bacteria 1158
779 nmdc:mga0k408_4612_c1 3300050493 Bacteria 5915
780 nmdc:mga06z11_118063_c1 3300050494 Bacteria 1477
781 nmdc:mga06z11_199908_c1 3300050494 Bacteria 1160
782 nmdc:mga06z11_57073_c1 3300050494 Bacteria 2021
783 nmdc:mga06z11_73502_c1 3300050494 Bacteria 1816
784 nmdc:mga04h51_17986_c1 3300050495 Bacteria 2075
785 nmdc:mga04h51_53954_c1 3300050495 Bacteria 1357
786 nmdc:mga07m45_14648_c1 3300050496 Bacteria 4182
787 nmdc:mga07m45_182616_c1 3300050496 Bacteria 1220
788 nmdc:mga07m45_488800_c1 3300050496 Bacteria 713
789 nmdc:mga07m45_74631_c1 3300050496 Bacteria 1932
790 nmdc:mga08y16_211641_c1 3300050511 Bacteria 2008
791 nmdc:mga08y16_527905_c1 3300050511 Bacteria 1196
792 nmdc:mga0n895_1120456_c1 3300050512 Bacteria 764
793 nmdc:mga0n895_21774_c1 3300050512 Bacteria 6000
794 nmdc:mga0rr50_171235_c1 3300050513 Bacteria 1769
795 nmdc:mga08x19_97007_c1 3300050514 Bacteria 1951
796 nmdc:mga0a205_133434_c1 3300050515 Bacteria 2383
797 nmdc:mga0sz30_23037_c2 3300050516 Bacteria 1851
798 nmdc:mga0sz30_55224_c1 3300050516 Bacteria 1690
799 Ga0495612_0053958 3300053078 Bacteria 1655
800 Ga0500610_0158106 3300053079 Bacteria 1130
801 Ga0500635_0006464 3300053080 Bacteria 3131
802 Ga0500635_0062937 3300053080 Bacteria 1299
803 Ga0495655_0014011 3300053083 Bacteria 1672
804 Ga0495619_0007832 3300053085 Bacteria 6762
805 Ga0495619_0514646 3300053085 Bacteria 822
806 Ga0500578_0120031 3300053086 Bacteria 1653
807 Ga0500578_0297900 3300053086 Bacteria 957
808 Ga0500643_000028 3300053087 Bacteria 245672
809 Ga0500644_0052058 3300053088 Bacteria 1408
810 Ga0500646_0064528 3300053090 Bacteria 1085
811 Ga0500647_0018007 3300053091 Bacteria 3267
812 Ga0500583_0022614 3300053092 Bacteria 2636
813 Ga0500651_0038098 3300053093 Bacteria 3029
814 Ga0500566_0000245 3300053094 Bacteria 28976
815 Ga0500566_0002949 3300053094 Bacteria 10161
816 Ga0500566_0069046 3300053094 Bacteria 1986
817 Ga0500641_0027837 3300053096 Bacteria 2203
818 Ga0500641_0065899 3300053096 Bacteria 1516
819 Ga0500650_0092938 3300053098 Bacteria 1412
820 Ga0500650_0114678 3300053098 Bacteria 1257
821 Ga0500555_002075 3300053103 Bacteria 5892
822 Ga0500556_0017153 3300053104 Bacteria 2264
823 Ga0500557_000116 3300053105 Bacteria 22549
824 Ga0500562_044412 3300053108 Bacteria 1183
825 Ga0500569_002793 3300053109 Bacteria 3483
826 Ga0500572_004309 3300053111 Bacteria 3231
827 Ga0500595_000580 3300053119 Bacteria 21802
828 Ga0500595_004072 3300053119 Bacteria 6645
829 Ga0500595_035681 3300053119 Bacteria 1635
830 Ga0500595_058462 3300053119 Bacteria 1172
831 Ga0500607_228960 3300053121 Bacteria 764
832 Ga0500642_0000113 3300053130 Bacteria 37567
833 Ga0500642_0001807 3300053130 Bacteria 6174
834 Ga0500642_0233797 3300053130 Bacteria 848
835 Ga0500655_017624 3300053133 Bacteria 1322
836 Ga0500655_017634 3300053133 Bacteria 1322
837 Ga0500559_0000103 3300053136 Bacteria 66422
838 Ga0500559_0016441 3300053136 Bacteria 3124
839 Ga0500559_0115729 3300053136 Bacteria 1244
840 Ga0500564_180237 3300053138 Bacteria 881
841 Ga0500568_0005758 3300053139 Bacteria 6344
842 Ga0500568_0043749 3300053139 Bacteria 1789
843 Ga0500577_0040536 3300053142 Bacteria 1694
844 Ga0500577_0103682 3300053142 Bacteria 1166
845 Ga0500577_0228024 3300053142 Bacteria 807
846 Ga0500579_184734 3300053143 Bacteria 811
847 Ga0500590_080114 3300053148 Bacteria 1606
848 Ga0500590_083689 3300053148 Bacteria 1563
849 Ga0500603_016640 3300053150 Bacteria 1748
850 Ga0500604_0006950 3300053151 Bacteria 2996
851 Ga0500616_0000046 3300053153 Bacteria 333409
852 Ga0500620_026632 3300053155 Bacteria 1792
853 Ga0500622_0188348 3300053156 Bacteria 947
854 Ga0500633_0131813 3300053160 Bacteria 933
855 Ga0500634_0053113 3300053161 Bacteria 2175
856 Ga0500638_016392 3300053162 Bacteria 3418
857 Ga0500638_042327 3300053162 Bacteria 2212
858 Ga0500638_094379 3300053162 Bacteria 1404
859 Ga0500636_0000054 3300053177 Bacteria 54446
860 Ga0500636_0108981 3300053177 Bacteria 1567
861 Ga0500637_0000303 3300053178 Bacteria 18607
862 Ga0500637_0027373 3300053178 Bacteria 3147
863 Ga0500637_0273034 3300053178 Bacteria 934
864 Ga0500611_005942 3300053727 Bacteria 1749
865 Ga0500625_017426 3300053729 Bacteria 3355
866 Ga0500645_005369 3300053730 Bacteria 4733
867 Ga0500645_048584 3300053730 Bacteria 1242
868 Ga0500552_020370 3300053733 Bacteria 938
869 Ga0500596_005620 3300053735 Bacteria 2185
870 Ga0500596_006582 3300053735 Bacteria 1955
871 Ga0500599_002194 3300053736 Bacteria 2321
872 Ga0500601_000834 3300053737 Bacteria 3791
873 Ga0500661_001086 3300055283 Bacteria 5115
874 Ga0501082_0090266 3300060353 Bacteria 2646
875 Ga0530510_0254120 3300061734 Bacteria 1310
876 2507504485 2507262055 Bacteria 8048963
877 2508545909 2508501009 Bacteria 7784016
878 2508694741 2508501042 Bacteria 8719808
879 2511400264 2511231028 Bacteria 8046582
880 2513624280 2513237092 Bacteria 8341956
881 2513638767 2513237094 Bacteria 8789602
882 2513649243 2513237095 Bacteria 8976980
883 2513694581 2513237101 Bacteria 7952346
884 2513701643 2513237102 Bacteria 7703324
885 2513716656 2513237104 Bacteria 10034502
886 2513874131 2513237139 Bacteria 8737671
887 2514010104 2513237161 Bacteria 8871253
888 2515624338 2515154112 Bacteria 8294334
889 2517103029 2517093001 Bacteria 9002274
890 2524438868 2524023205 Bacteria 8918781
891 2528849486 2528768022 Bacteria 10457665
892 2617350256 2617270735 Bacteria 9163226
893 2617374346 2617270741 Bacteria 8201522
894 2723842398 2721755755 Bacteria 8322773
895 2728748321 2728368998 Bacteria 8720350
896 2745080371 2744054633 Bacteria 8678936
897 2793059257 2791355196 Bacteria 7323613
898 2793070197 2791355197 Bacteria 8420563
899 2793078764
900 2805920850 2802429603 Bacteria 8777136
901 2818240632 2816332527 Bacteria 8933356
902 2824607602 2824600985 Bacteria 8488197
903 2824615346 2824609381 Bacteria 8672835
904 2824618797 2824617872 Bacteria 8814715
905 2824628903 2824626560 Bacteria 8813858
906 2824638414 2824635225 Bacteria 8785348
907 2824648046 2824644064 Bacteria 8743947
908 2824657967 2824653114 Bacteria 8493680
909 2824665883 2824661429 Bacteria 9877870
910 2824675853 2824671348 Bacteria 8369588
911 2824681638 2824679649 Bacteria 8248951
912 2824692814 2824687955 Bacteria 8360029
913 2824699391 2824696289 Bacteria 8335049
914 2824710856 2824704595 Bacteria 9667483
915 2824722615 2824714736 Bacteria 8717648
916 2824726005 2824723954 Bacteria 8758240
917 2824736433 2824732956 Bacteria 7810675
918 2824751039 2824746037 Bacteria 7911610
919 2824761521 2824753945 Bacteria 9787441
920 2824765064 2824763712 Bacteria 9792355
921 2824778047 2824773399 Bacteria 8360218
922 2838125984 2838122688 Bacteria 8803140
923 2841942621 2841941048 Bacteria 8688029
924 2841953027 2841949485 Bacteria 8680857
925 2841963878 2841957949 Bacteria 8652217
926 2841970947 2841966195 Bacteria 8673214
927 2841977795 2841974524 Bacteria 8931498
928 2841984643 2841983080 Bacteria 8395090
929 2842041636 2842038055 Bacteria 8002051
930 2842049678 2842045827 Bacteria 8006841
931 2844321468 2844315083 Bacteria 8138177
932 2847931928 2847930680 Bacteria 9342022
933 2847943168 2847939898 Bacteria 8606328
934 2849076908 2849076700 Bacteria 7039503
935 2857514828 2857509624 Bacteria 7472071
936 2874595375 2874590934 Bacteria 8299676
937 2874608911 2874604998 Bacteria 7834745
938 2874620424 2874612657 Bacteria 8252029
939 2874621914 2874620515 Bacteria 8290088
940 2874629592 2874628541 Bacteria 8630250
941 2874651801 2874645413 Bacteria 8214782
942 2876763622 2876761206 Bacteria 10111113
943 2876775569 2876771140 Bacteria 8287509
944 2876812910 2876808645 Bacteria 8824342
945 2876823561 2876818435 Bacteria 8274608
946 2879079660 2879074833 Bacteria 8279565
947 2879091162 2879083081 Bacteria 8587928
948 2879104443 2879099564 Bacteria 10442239
949 2879112371 2879110137 Bacteria 8907982
950 2879133936 2879127579 Bacteria 8294491
951 2879145069 2879142872 Bacteria 8267021
952 2881364580 2881364244 Bacteria 7710352
953 2881673323 2881665667 Bacteria 8175609
954 2885374340 2885366525 Bacteria 8326213
955 2885413720 2885409591 Bacteria 9235467
956 2888387312 2888378607 Bacteria 9652610
957 2888391395 2888388044 Bacteria 7304136
958 2888426991 2888419890 Bacteria 7857137
959 2889034384 2889033259 Bacteria 9099371
960 2903727953 2903727486 Bacteria 8281579
961 2904669493 2904666416 Bacteria 8226587
962 2904711305
963 2904716497 2904711408 Bacteria 9771557
964 2906602563 2906602504 Bacteria 8295279
965 2906629677 2906626472 Bacteria 8826946
966 2906645793 2906643746 Bacteria 8722424
967 2908757590 2908756301 Bacteria 8864324
968 2908776828 2908775508 Bacteria 8092255
969 2922364836 2922361189 Bacteria 7436256
970 2922370260
971 2922400120 2922393267 Bacteria 8285685
972 2929622687 2929615660 Bacteria 9193770
973 2929632210 2929624759 Bacteria 9339455
974 2932789975 2932784394 Bacteria 9704911
975 2932800652 2932794094 Bacteria 7915132
976 2932808383 2932801729 Bacteria 7987968
977 2932815517 2932809354 Bacteria 9135765
978 2932824907 2932818245 Bacteria 9955613
979 2932829169 2932828146 Bacteria 9745859
980 2933584682 2933577622 Bacteria 9116884
981 2935613111 2935608549 Bacteria 8203142
982 2935617644 2935616580 Bacteria 9032984
983 2935632986 2935630451 Bacteria 8169952
984 2935643689 2935638405 Bacteria 10015038
985 2935654067 2935648319 Bacteria 8801166
986 2935662831 2935656913 Bacteria 8965014
987 2935671001 2935665750 Bacteria 9571747
988 2935681644 2935675223 Bacteria 9928132
989 2935692621 2935684952 Bacteria 9590419
990 2935702607 2935694250 Bacteria 9291695
991 2935711895 2935703347 Bacteria 10242284
992 2935721239 2935713505 Bacteria 9608509
993 2935730767 2935722832 Bacteria 9608746
994 2935739929 2935732158 Bacteria 9706831
995 2935748967 2935741537 Bacteria 9707219
996 2935758837 2935750917 Bacteria 9590372
997 2935767101 2935760218 Bacteria 9817913
998 2935774863 2935769743 Bacteria 7878163
999 2935779951 2935777560 Bacteria 8077691
1000 2935792219 2935785616 Bacteria 7962367
1001 2935798612 2935793552 Bacteria 8012592
1002 2935806866 2935801545 Bacteria 9301974
1003 2935818869 2935810662 Bacteria 9401221
1004 2935825037 2935819856 Bacteria 8261050
1005 2935834374 2935827899 Bacteria 10038562
1006 2935843901 2935837841 Bacteria 9454360
1007 2935852256 2935847175 Bacteria 8228321
1008 2935856857 2935855204 Bacteria 9035059
1009 2935868384 2935864058 Bacteria 9784707
1010 2935879694 2935873716 Bacteria 9632195
1011 2935883490 2935883170 Bacteria 7964738
1012 2935910689 2935908558 Bacteria 8568796
1013 2935921869 2935916978 Bacteria 9113783
1014 2935929992 2935926038 Bacteria 8601059
1015 2935937660 2935934488 Bacteria 8602579
1016 2935949764 2935942939 Bacteria 8599779
1017 2935956860 2935951376 Bacteria 8602333
1018 2935965322 2935959822 Bacteria 7869783
1019 2935970883 2935967501 Bacteria 8603075
1020 2935982983 2935975950 Bacteria 8347125
1021 2935984370 2935984226 Bacteria 8302647
1022 2935997200 2935992306 Bacteria 9802711
1023 2936009947 2936002035 Bacteria 9362176
1024 2936016972 2936011229 Bacteria 8801034
1025 2936025620 2936019824 Bacteria 8804134
1026 2936034462 2936028420 Bacteria 8965941
1027 2936045445 2936037263 Bacteria 9446081
1028 2936052504 2936046547 Bacteria 8903709
1029 2936055450 2936055302 Bacteria 8785755
1030 2940564573 2940556831 Bacteria 9590747
1031 2941509712 2941507105 Bacteria 8166816
1032 2941517541 2941515067 Bacteria 8166720
1033 2941526506 2941523033 Bacteria 8169134
1034 2941532050 2941531003 Bacteria 7653939
1035 2941545149 2941538514 Bacteria 9402094
1036 3005490881 3005483717 Bacteria 7877331
1037 3005506527 3005506211 Bacteria 6943378
1038 3005593200 3005587118 Bacteria 7794411
1039 3005717572 3005710791 Bacteria 7622528
1040 3005724621 3005718088 Bacteria 8283608
1041 8006928330 8006926726 Bacteria 6749210
1042 8006937312 8006933436 Bacteria 10410654
1043 8006965273 8006964411 Bacteria 8966052
1044 8006977344 8006973647 Bacteria 10679141
1045 8006991605 8006984368 Bacteria 9651211
1046 8006995426 8006994254 Bacteria 8309700
1047 8016519043 8016511872 Bacteria 9921665
1048 8016525261 8016522445 Bacteria 8156687
1049 8016538843 8016530956 Bacteria 8155261
1050 8016543126 8016539877 Bacteria 8155419
1051 8016550163 8016548790 Bacteria 8155074
1052 8016558572 8016557553 Bacteria 8154380
1053 8016581183 8016575299 Bacteria 8154085
1054 8016587521 8016583857 Bacteria 10421953
1055 8016596555 8016595262 Bacteria 8149947
1056 8016619222 8016613128 Bacteria 8794220
1057 8016630377 8016622563 Bacteria 7999408
1058 8016636758 8016630954 Bacteria 9217207
1059 8017057653 8017057580 Bacteria 10023680
1060 8019541311 8019538911 Bacteria 7872763
1061 8019549320 8019547302 Bacteria 7996444
1062 8019578165 8019576017 Bacteria 10049540
1063 8019596195 8019586578 Bacteria 10212056
1064 8019605499 8019597564 Bacteria 10041141
1065 8019613039 8019608314 Bacteria 10042931
1066 8019623726 8019619141 Bacteria 9218857
1067 8019638308 8019629233 Bacteria 8687553
1068 8019641328 8019638758 Bacteria 9062356
1069 8019651697 8019648815 Bacteria 10014479
1070 8019666232 8019659431 Bacteria 8577854
1071 8019675734 8019668869 Bacteria 8791617
1072 8019680365 8019678201 Bacteria 8863603
1073 8019695453 8019687851 Bacteria 8712826
1074 8055750570 8055742211 Bacteria 9226248
1075 8056679066 8056673599 Bacteria 7871253
1076 8056975347 8056967851 Bacteria 9038162
1077 Ga0214542_1021066
1078 JGI25406J46586_10006811
1079 JGI25153J46596_10002547
1080 JGI25153J46596_10003542
1081 JGI25153J46596_10004097
1082 JGI25153J46596_10014855
1083 rootH1_10016026
1084 JGI25160J50197_1001680
1085 JGI25160J50197_1003442
1086 JGI25160J50197_1005384
1087 JGI25404J52841_10025272
1088 JGI25404J52841_10030013
1089 Ga0055531_10007525
1090 Ga0055543_1007516
1091 Ga0065165_1000370
1092 Ga0065165_1006098
1093 Ga0065165_1008717
1094 Ga0070658_10021405
1095 Ga0070676_10394328
1096 Ga0070683_100042686
1097 Ga0070683_100139749
1098 Ga0070683_100521941
1099 Ga0070670_100124537
1100 Ga0068869_100013181
1101 Ga0068869_100064153
1102 Ga0070680_100019553
1103 Ga0070680_100079829
1104 Ga0070680_100104138
1105 Ga0070680_100221827
1106 Ga0070682_100110140
1107 Ga0068868_100063339
1108 Ga0068868_100284079
1109 Ga0068868_100658426
1110 Ga0070660_100244847
1111 Ga0070689_100474764
1112 Ga0070691_10090375
1113 Ga0070668_100008756
1114 Ga0070668_100027658
1115 Ga0070671_100032245
1116 Ga0070673_100719100
1117 Ga0070667_100137265
1118 Ga0070667_100425118
1119 Ga0070709_10003090
1120 Ga0070709_10008369
1121 Ga0070714_100162069
1122 Ga0070713_100002234
1123 Ga0070713_100008846
1124 Ga0070713_101072866
1125 Ga0070710_10000552
1126 Ga0070710_10172200
1127 Ga0070701_10348617
1128 Ga0070711_100011221
1129 Ga0070711_100017038
1130 Ga0070711_100027986
1131 Ga0070711_100062871
1132 Ga0070711_100166520
1133 Ga0070711_100752190
1134 Ga0070700_100252535
1135 Ga0070663_100435647
1136 Ga0070663_100672247
1137 Ga0070678_100012735
1138 Ga0070678_100029982
1139 Ga0070678_100164756
1140 Ga0070678_100862047
1141 Ga0070662_100230394
1142 Ga0070681_10012819
1143 Ga0070681_10037527
1144 Ga0070681_10051933
1145 Ga0070681_10125936
1146 Ga0070681_10607547
1147 Ga0070685_10132407
1148 Ga0070685_10187510
1149 Ga0070706_100736318
1150 Ga0070698_100604936
1151 Ga0070679_100031919
1152 Ga0070679_100034291
1153 Ga0070679_100109277
1154 Ga0070679_100137259
1155 Ga0070679_100138618
1156 Ga0070679_100600551
1157 Ga0070684_100003258
1158 Ga0068853_100026606
1159 Ga0068853_100112148
1160 Ga0070672_100649058
1161 Ga0070696_100164886
1162 Ga0070693_100262254
1163 Ga0070665_100028897
1164 Ga0070665_100045145
1165 Ga0070665_100071651
1166 Ga0070665_100135904
1167 Ga0070665_100136213
1168 Ga0070665_100161250
1169 Ga0070665_100472269
1170 Ga0070665_100554908
1171 Ga0068855_100015587
1172 Ga0068855_100073742
1173 Ga0068855_100188786
1174 Ga0068855_100217196
1175 Ga0070664_100249863
1176 Ga0070664_100516844
1177 Ga0068857_100125486
1178 Ga0068857_100264142
1179 Ga0068856_100013570
1180 Ga0068856_100152081
1181 Ga0068856_100253525
1182 Ga0068856_100255228
1183 Ga0068856_100467549
1184 Ga0068856_100832796
1185 Ga0070702_100269391
1186 Ga0070702_100437731
1187 Ga0070702_100510897
1188 Ga0068852_100002075
1189 Ga0068852_100185761
1190 Ga0068859_100127861
1191 Ga0068859_100538127
1192 Ga0068864_100182468
1193 Ga0068864_100257270
1194 Ga0068861_100139299
1195 Ga0068861_100151333
1196 Ga0068851_10113048
1197 Ga0068863_100776274
1198 Ga0068858_100150433
1199 Ga0068858_100721009
1200 Ga0068860_100084953
1201 Ga0068860_100215672
1202 Ga0068860_100238488
1203 Ga0068862_100158116
1204 Ga0068862_100373845
1205 Ga0068862_100569757
1206 Ga0081455_10003156
1207 Ga0081455_10006663
1208 Ga0081455_10007464
1209 Ga0081455_10073137
1210 Ga0081540_1001341
1211 Ga0081540_1002121
1212 Ga0081540_1012706
1213 Ga0081540_1018462
1214 Ga0081540_1073482
1215 Ga0081540_1100945
1216 Ga0081540_1120509
1217 Ga0081540_1120511
1218 Ga0081539_10000729
1219 Ga0081539_10091157
1220 Ga0081539_10125163
1221 Ga0070717_10001026
1222 Ga0070717_10237647
1223 Ga0075365_10033553
1224 Ga0075365_10046161
1225 Ga0075368_10008533
1226 Ga0075368_10102393
1227 Ga0075368_10103345
1228 Ga0075368_10127023
1229 Ga0075363_100003880
1230 Ga0075363_100013422
1231 Ga0075363_100060796
1232 Ga0075363_100163594
1233 Ga0075364_10039240
1234 Ga0070716_100069962
1235 Ga0070716_100073994
1236 Ga0070716_100585493
1237 Ga0070712_100044616
1238 Ga0070712_100502818
1239 Ga0070712_100840602
1240 Ga0075367_10098911
1241 Ga0075367_10110452
1242 Ga0075367_10330846
1243 Ga0075369_10028877
1244 Ga0075366_10008044
1245 Ga0075366_10071534
1246 Ga0075366_10094649
1247 Ga0097621_100234276
1248 Ga0097621_100239636
1249 Ga0075370_10028282
1250 Ga0075370_10042444
1251 Ga0075370_10116584
1252 Ga0075370_10132901
1253 Ga0075370_10216835
1254 Ga0075428_100622896
1255 Ga0075434_100092226
1256 Ga0075434_100826714
1257 Ga0068865_100069342
1258 Ga0068865_100316538
1259 Ga0075436_100134933
1260 Ga0097620_100127864
1261 Ga0097620_100538168
1262 Ga0099824_1002047
1263 Ga0099824_1018951
1264 Ga0099822_1004737
1265 Ga0099822_1063565
1266 Ga0099823_1071205
1267 Ga0075435_100109533
1268 Ga0099794_10112341
1269 Ga0099795_10017558
1270 Ga0099795_10161517
1271 Ga0105240_10002295
1272 Ga0105240_10053247
1273 Ga0105240_10183475
1274 Ga0105240_10218361
1275 Ga0105240_10251298
1276 Ga0105240_10266078
1277 Ga0105240_10672889
1278 Ga0111539_10182022
1279 Ga0111539_10395278
1280 Ga0105245_10037331
1281 Ga0105245_10340923
1282 Ga0105245_10904070
1283 Ga0105243_10994056
1284 Ga0105241_10012898
1285 Ga0105241_10046174
1286 Ga0105241_10066451
1287 Ga0105241_10444899
1288 Ga0105242_10234670
1289 Ga0105242_10458835
1290 Ga0105248_10042923
1291 Ga0105248_10144863
1292 Ga0105248_10211185
1293 Ga0105237_10002301
1294 Ga0105237_10006999
1295 Ga0105237_10026831
1296 Ga0105237_10080389
1297 Ga0105237_10259204
1298 Ga0105237_10346620
1299 Ga0105237_10358448
1300 Ga0105237_10430729
1301 Ga0105237_10807367
1302 Ga0105238_10018488
1303 Ga0105238_10063133
1304 Ga0105238_10112590
1305 Ga0105238_10247537
1306 Ga0105238_10345957
1307 Ga0105238_10422128
1308 Ga0105249_10165545
1309 Ga0105249_10395205
1310 Ga0105249_11331530
1311 Ga0105239_10025401
1312 Ga0105239_10083534
1313 Ga0105239_10142048
1314 Ga0105239_10321091
1315 Ga0105239_11309354
1316 Ga0105246_10114789
1317 Ga0105246_10484397
1318 Ga0157370_10061670
1319 Ga0157370_10497971
1320 Ga0157369_10017488
1321 Ga0157369_10102904
1322 Ga0157369_10570470
1323 Ga0157374_10191301
1324 Ga0157378_10057612
1325 Ga0157378_10146176
1326 Ga0157378_10573750
1327 Ga0163162_10155709
1328 Ga0163162_10362366
1329 Ga0163162_10475004
1330 Ga0157372_10118851
1331 Ga0157375_10069051
1332 Ga0157375_10076159
1333 Ga0157375_10137987
1334 Ga0157375_10541055
1335 Ga0157375_10784330
1336 Ga0163163_10002774
1337 Ga0163163_10043948
1338 Ga0163163_10129093
1339 Ga0163163_10183688
1340 Ga0163163_10203230
1341 Ga0163163_10910132
1342 Ga0157377_10044206
1343 Ga0157379_10192263
1344 Ga0157379_10255394
1345 Ga0157379_10609805
1346 Ga0157376_10086282
1347 Ga0157376_10179560
1348 Ga0157376_10321788
1349 Ga0157376_10537824
1350 Ga0163161_10171094
1351 Ga0163161_10299170
1352 Ga0163161_10338303
1353 Ga0197907_11157109
1354 Ga0206355_1507511
1355 Ga0206350_10389318
1356 Ga0206353_10556866
1357 Ga0214544_1000003
1358 Ga0214542_1000003
1359 Ga0214545_1000004
1360 Ga0214545_1021274
1361 Ga0214543_1000007
1362 Ga0213876_10002755
1363 Ga0213876_10094238
1364 Ga0213875_10130551
1365 Ga0224712_10107802
1366 Ga0209563_100438
1367 Ga0209677_103197
1368 Ga0209148_1000267
1369 Ga0209233_1012874
1370 Ga0209455_1001737
1371 Ga0209673_1013733
1372 Ga0209564_1010432
1373 Ga0209758_1000030
1374 Ga0209758_1000277
1375 Ga0209758_1000711
1376 Ga0209758_1000893
1377 Ga0209758_1001645
1378 Ga0209758_1002462
1379 Ga0209758_1005049
1380 Ga0209758_1050686
1381 Ga0207426_1000271
1382 Ga0207426_1001517
1383 Ga0207426_1008000
1384 Ga0209257_1000662
1385 Ga0209257_1015967
1386 Ga0207653_10004044
1387 Ga0207692_10001302
1388 Ga0207692_10075621
1389 Ga0207692_10250024
1390 Ga0207710_10028157
1391 Ga0207688_10033353
1392 Ga0207688_10069981
1393 Ga0207680_10231384
1394 Ga0207647_10008109
1395 Ga0207647_10211960
1396 Ga0207699_10023510
1397 Ga0207699_10045183
1398 Ga0207645_10084865
1399 Ga0207684_10261744
1400 Ga0207707_10000438
1401 Ga0207707_10136890
1402 Ga0207707_10669633
1403 Ga0207695_10000059
1404 Ga0207695_10027002
1405 Ga0207695_10043272
1406 Ga0207695_10218834
1407 Ga0207671_10001109
1408 Ga0207671_10035801
1409 Ga0207671_10069327
1410 Ga0207671_10162971
1411 Ga0207671_10173745
1412 Ga0207693_10027888
1413 Ga0207693_10104554
1414 Ga0207693_10114267
1415 Ga0207693_10235143
1416 Ga0207693_10463230
1417 Ga0207663_10017392
1418 Ga0207663_10030104
1419 Ga0207663_10095514
1420 Ga0207660_10017792
1421 Ga0207660_10087395
1422 Ga0207660_10183018
1423 Ga0207660_10219447
1424 Ga0207660_10619273
1425 Ga0207657_10275808
1426 Ga0207657_10506158
1427 Ga0207652_10047083
1428 Ga0207652_10518673
1429 Ga0207694_10173320
1430 Ga0207694_10356417
1431 Ga0207650_10158200
1432 Ga0207659_10263324
1433 Ga0207700_10067007
1434 Ga0207700_10234026
1435 Ga0207700_10634800
1436 Ga0207664_10021535
1437 Ga0207644_10018254
1438 Ga0207644_10334329
1439 Ga0207644_10743095
1440 Ga0207706_10059147
1441 Ga0207706_10134929
1442 Ga0207706_10499489
1443 Ga0207686_10200241
1444 Ga0207686_10225341
1445 Ga0207670_10389508
1446 Ga0207669_10478717
1447 Ga0207669_10624750
1448 Ga0207704_10265709
1449 Ga0207665_10014858
1450 Ga0207665_10061914
1451 Ga0207665_10380452
1452 Ga0207691_10197132
1453 Ga0207711_10018230
1454 Ga0207711_10276472
1455 Ga0207711_10876686
1456 Ga0207689_10080482
1457 Ga0207689_10208165
1458 Ga0207661_10000959
1459 Ga0207661_10412760
1460 Ga0207679_10401124
1461 Ga0207667_10044714
1462 Ga0207667_10086148
1463 Ga0207667_10101512
1464 Ga0207667_10406284
1465 Ga0207668_10060395
1466 Ga0207668_10069357
1467 Ga0207668_10095673
1468 Ga0207668_10124091
1469 Ga0207668_10425960
1470 Ga0207658_10678577
1471 Ga0207677_10461146
1472 Ga0207703_10050557
1473 Ga0207703_10181953
1474 Ga0207639_10023427
1475 Ga0207639_10160589
1476 Ga0207639_10163367
1477 Ga0207639_10267758
1478 Ga0207678_10021386
1479 Ga0207678_10023768
1480 Ga0207678_10025320
1481 Ga0207678_10040824
1482 Ga0207678_10052328
1483 Ga0207678_10064507
1484 Ga0207678_10698805
1485 Ga0207708_10433723
1486 Ga0207708_10513717
1487 Ga0207702_10106927
1488 Ga0207702_10186192
1489 Ga0207702_10380959
1490 Ga0207702_10436225
1491 Ga0207648_10042881
1492 Ga0207648_10704914
1493 Ga0207676_10128955
1494 Ga0207676_10163439
1495 Ga0207676_10614381
1496 Ga0207674_10055839
1497 Ga0207674_10057340
1498 Ga0207674_10084699
1499 Ga0207674_10310289
1500 Ga0207675_100031542
1501 Ga0207675_100279247
1502 Ga0207675_100354860
1503 Ga0207683_10008695
1504 Ga0207683_10032517
1505 Ga0207683_10135169
1506 Ga0207683_10450052
1507 Ga0207683_10470438
1508 Ga0207698_10013446
1509 Ga0207698_10166178
1510 Ga0207698_10371088
1511 Ga0207698_11005794
1512 Ga0207698_11336862
1513 Ga0209389_1000055
1514 Ga0209389_1000494
1515 Ga0209589_1000005
1516 Ga0209589_1000024
1517 Ga0209489_100005
1518 Ga0209489_100123
1519 Ga0209489_103769
1520 Ga0209700_100006
1521 Ga0209700_100420
1522 Ga0209588_1014950
1523 Ga0209588_1031471
1524 Ga0209813_10024296
1525 Ga0268266_10000638
1526 Ga0268266_10001364
1527 Ga0268266_10030958
1528 Ga0268266_10070131
1529 Ga0268266_10085353
1530 Ga0268266_10117632
1531 Ga0268266_10366104
1532 Ga0268266_10712521
1533 Ga0268266_10768309
1534 Ga0268266_10774729
1535 Ga0268266_10848742
1536 Ga0268265_10178216
1537 Ga0268265_10396337
1538 Ga0268265_10678065
1539 Ga0268265_10770230
1540 Ga0268264_10000051
1541 Ga0268264_10295742
1542 Ga0265337_1006988
1543 Ga0265334_10005278
1544 Ga0265318_10031122
1545 Ga0265323_10000560
1546 Ga0265336_10000550
1547 Ga0307517_10000856
1548 Ga0307515_10027090
1549 Ga0265338_10000231
1550 Ga0265324_10005806
1551 Ga0265339_10034239
1552 Ga0307513_10125136
1553 Ga0307509_10085186
1554 Ga0307508_10014562
1555 Ga0307508_10567299
1556 Ga0265314_10069773
1557 Ga0265342_10003396
1558 Ga0307516_10011176
1559 Ga0307405_10374919
1560 Ga0307413_10103325
1561 Ga0307409_100119908
1562 Ga0307416_100286859
1563 Ga0307415_100143022
1564 Ga0307510_10004951
1565 Ga0307510_10022034
1566 Ga0307510_10121417
1567 Ga0316215_1002564
1568 Ga0373934_0076806
1569 Ga0373949_0020331
1570 Ga0373952_0006580
1571 Ga0373945_0209184
1572 Ga0373954_0052727
1573 Ga0373956_0087974
1574 Ga0373960_0132987
1575 Ga0373943_0157391
1576 Ga0373943_0234201
1577 Ga0373955_0108257
1578 Ga0373955_0122209
1579 Ga0373924_0027656
1580 Ga0373931_0008723
1581 Ga0373935_0557741
1582 Ga0373927_0012565
1583 Ga0373927_0263187
1584 Ga0373927_0363133
1585 Ga0373933_0000018
1586 Ga0373937_0069895
1587 Ga0373937_0227646
1588 Ga0372808_020869
1589 Ga0373925_0401179
1590 Ga0373925_0639533
1591 Ga0395899_0050587
1592 Ga0395899_0443317
1593 Ga0395900_0001051
1594 Ga0395900_0169700
1595 Ga0395900_0265761
1596 Ga0395900_0399957
1597 Ga0395898_0001503
1598 Ga0395898_0004875
1599 Ga0395898_0532852
1600 Ga0395905_0064717
1601 Ga0395905_0109320
1602 Ga0395905_0134424
1603 Ga0436364_0238267
1604 Ga0436364_0310036
1605 Ga0395901_0051645
1606 Ga0395901_0061578
1607 Ga0395901_0092858
1608 Ga0395901_0371972
1609 Ga0436365_0093274
1610 Ga0436365_0372041
1611 Ga0436365_1021233
1612 Ga0436363_0554977
1613 Ga0436363_1689393
1614 Ga0436362_0626323
1615 Ga0451789_0919161
1616 Ga0451833_0031051
1617 Ga0466969_0026762
1618 Ga0466972_0000124
1619 Ga0466972_0002537
1620 Ga0466965_0026765
1621 Ga0466965_0318596
1622 Ga0466966_0000411
1623 Ga0466961_0000065
1624 Ga0466961_0254334
1625 Ga0466963_0027444
1626 Ga0466968_0006334
1627 Ga0466968_0215322
1628 Ga0466970_0089040
1629 Ga0466970_0143814
1630 Ga0466960_0001481
1631 Ga0466960_0139165
1632 Ga0466960_0220761
1633 Ga0466959_0000634
1634 Ga0466959_0275904
1635 Ga0466958_0031405
1636 Ga0495603_0082839
1637 Ga0495603_0132329
1638 Ga0495603_0300832
1639 Ga0495629_0003519
1640 Ga0495629_0206705
1641 Ga0495638_0011267
1642 Ga0495638_0085181
1643 Ga0495641_0062004
1644 Ga0495651_0017692
1645 Ga0495651_0424287
1646 Ga0495580_0092623
1647 Ga0495639_0056409
1648 Ga0495639_0061813
1649 Ga0495664_0011915
1650 Ga0495584_0131529
1651 Ga0495585_0283872
1652 Ga0495594_0065555
1653 Ga0495596_0092262
1654 Ga0495583_0044422
1655 Ga0495606_0065243
1656 Ga0495606_0160809
1657 Ga0495610_0078267
1658 Ga0495616_0057328
1659 Ga0495616_0084560
1660 Ga0495616_0253094
1661 Ga0495618_0141248
1662 Ga0495620_0020979
1663 Ga0495643_0045119
1664 Ga0495648_0008955
1665 Ga0495648_0218345
1666 Ga0495666_0133388
1667 Ga0495652_0089784
1668 Ga0495652_0122342
1669 Ga0495652_0391588
1670 Ga0495652_0457905
1671 Ga0495654_0129733
1672 Ga0495640_0027614
1673 Ga0495640_0081673
1674 Ga0495640_0087035
1675 Ga0495586_0158427
1676 Ga0495587_0269474
1677 Ga0495609_0090829
1678 Ga0495645_0017494
1679 Ga0495645_0163321
1680 Ga0495622_0014799
1681 Ga0495622_0265165
1682 Ga0495667_0044811
1683 Ga0495668_0084179
1684 Ga0495668_0379536
1685 Ga0495634_0056964
1686 Ga0495611_0244628
1687 Ga0495625_0225233
1688 Ga0495635_0158351
1689 Ga0495635_0366258
1690 Ga0495588_0001353
1691 Ga0495657_0002384
1692 Ga0495657_0014532
1693 Ga0495599_0004607
1694 Ga0495599_0065022
1695 Ga0495599_0067383
1696 Ga0495623_0010248
1697 Ga0495623_0320794
1698 Ga0495646_0113582
1699 Ga0495646_0120906
1700 Ga0495613_0062464
1701 Ga0495613_0274008
1702 Ga0495613_0756129
1703 Ga0495624_0067145
1704 Ga0495624_0110799
1705 Ga0495670_0115431
1706 Ga0495671_0043951
1707 Ga0495671_0072278
1708 Ga0495671_0286670
1709 Ga0495649_0024307
1710 Ga0495600_0210544
1711 Ga0495660_0076880
1712 Ga0495581_0014180
1713 Ga0495581_0041048
1714 Ga0495604_0002741
1715 Ga0495604_0006835
1716 Ga0495674_0018428
1717 Ga0495672_0017605
1718 Ga0495672_0050250
1719 Ga0495676_0055266
1720 Ga0495676_0102528
1721 Ga0495676_0374195
1722 Ga0495680_0001876
1723 Ga0495680_0085161
1724 Ga0495687_016979
1725 Ga0495675_0007387
1726 Ga0495685_082541
1727 Ga0495673_0060041
1728 Ga0495673_0061680
1729 Ga0495673_0108676
1730 Ga0495684_0012933
1731 Ga0495684_0436988
1732 Ga0495686_0114233
1733 Ga0495686_0147890
1734 Ga0495686_0179200
1735 Ga0495593_0079436
1736 Ga0495602_0134279
1737 Ga0495602_0543596
1738 Ga0496101_0055034
1739 Ga0496101_0149898
1740 Ga0496101_0559044
1741 Ga0496102_0107971
1742 Ga0496102_0125274
1743 Ga0496102_0134420
1744 Ga0496102_0252451
1745 Ga0496103_0080553
1746 Ga0496103_0338198
1747 Ga0496103_0629569
1748 Ga0496104_0009070
1749 Ga0496104_0024225
1750 Ga0496104_0037936
1751 Ga0496104_0068302
1752 Ga0496104_0103508
1753 Ga0496104_0375050
1754 Ga0496105_0022832
1755 Ga0496105_0039456
1756 Ga0496105_0099088
1757 Ga0496105_0589435
1758 Ga0496106_0026873
1759 Ga0496106_0038587
1760 Ga0496106_0264939
1761 Ga0496106_0271437
1762 Ga0496106_0285674
1763 Ga0496107_0011974
1764 Ga0496107_0164616
1765 Ga0496107_0237925
1766 Ga0496107_0709954
1767 Ga0496108_0012004
1768 Ga0496108_0013488
1769 Ga0496108_0080117
1770 Ga0496108_0243202
1771 Ga0496108_0467421
1772 Ga0496109_0023442
1773 Ga0496109_0222517
1774 Ga0496109_0275200
1775 Ga0496109_0296979
1776 Ga0496109_0721487
1777 Ga0496109_0893173
1778 Ga0496110_0015719
1779 Ga0496110_0015752
1780 Ga0496110_0980438
1781 Ga0496111_0056301
1782 Ga0496111_0152814
1783 Ga0496111_0583484
1784 Ga0496112_0045698
1785 Ga0496112_0053279
1786 Ga0496112_0242029
1787 Ga0496112_0704478
1788 Ga0496112_0938372
1789 Ga0496113_0004044
1790 Ga0496113_0055910
1791 Ga0496113_0297442
1792 Ga0496113_0534347
1793 Ga0496114_0014145
1794 Ga0496114_0121968
1795 Ga0496115_0005405
1796 Ga0496115_0032960
1797 Ga0496115_0069485
1798 Ga0496116_0028887
1799 Ga0496116_0032538
1800 Ga0496116_0242663
1801 Ga0496117_0061833
1802 Ga0496117_0071741
1803 Ga0496117_0301026
1804 Ga0496118_0002445
1805 Ga0496119_0015983
1806 Ga0496119_0069417
1807 Ga0496119_0215489
1808 Ga0496120_0035858
1809 Ga0496121_0000452
1810 Ga0496121_0000571
1811 Ga0496121_0024152
1812 Ga0496121_0043447
1813 Ga0496121_0050510
1814 Ga0496121_0051348
1815 Ga0496121_0071559
1816 Ga0496121_0114848
1817 Ga0496121_0322890
1818 Ga0496122_0205725
1819 Ga0496124_0000267
1820 Ga0496124_0026050
1821 Ga0496124_0053485
1822 Ga0496125_0043745
1823 Ga0496125_0059362
1824 Ga0496125_0069134
1825 Ga0496126_0015704
1826 Ga0496126_0035587
1827 Ga0496126_0052619
1828 Ga0496126_0059836
1829 Ga0496126_0071503
1830 Ga0496126_0355971
1831 Ga0496126_0366683
1832 Ga0496126_0580061
1833 Ga0496126_0676636
1834 Ga0495682_0014877
1835 Ga0495682_0139946
1836 Ga0501069_0480989
1837 Ga0501071_0175538
1838 Ga0501076_0123356
1839 Ga0501080_0060360
1840 Ga0501035_0618962
1841 nmdc:mga03683_133639_c1
1842 nmdc:mga03683_184261_c1
1843 nmdc:mga03n38_155829_c1
1844 nmdc:mga03n38_208_c1
1845 nmdc:mga03n38_58574_c1
1846 nmdc:mga00v17_145883_c1
1847 nmdc:mga00v17_439992_c1
1848 nmdc:mga00v17_55068_c1
1849 nmdc:mga0yw44_14616_c1
1850 nmdc:mga0yw44_223543_c1
1851 nmdc:mga0yw44_557513_c1
1852 nmdc:mga0yw44_66485_c1
1853 nmdc:mga0k408_122214_c1
1854 nmdc:mga0k408_211493_c1
1855 nmdc:mga0k408_4612_c1
1856 nmdc:mga06z11_118063_c1
1857 nmdc:mga06z11_199908_c1
1858 nmdc:mga06z11_57073_c1
1859 nmdc:mga06z11_73502_c1
1860 nmdc:mga04h51_17986_c1
1861 nmdc:mga04h51_53954_c1
1862 nmdc:mga07m45_14648_c1
1863 nmdc:mga07m45_182616_c1
1864 nmdc:mga07m45_488800_c1
1865 nmdc:mga07m45_74631_c1
1866 nmdc:mga08y16_211641_c1
1867 nmdc:mga08y16_527905_c1
1868 nmdc:mga0n895_1120456_c1
1869 nmdc:mga0n895_21774_c1
1870 nmdc:mga0rr50_171235_c1
1871 nmdc:mga08x19_97007_c1
1872 nmdc:mga0a205_133434_c1
1873 nmdc:mga0sz30_23037_c2
1874 nmdc:mga0sz30_55224_c1
1875 Ga0495612_0053958
1876 Ga0500610_0158106
1877 Ga0500635_0006464
1878 Ga0500635_0062937
1879 Ga0495655_0014011
1880 Ga0495619_0007832
1881 Ga0495619_0514646
1882 Ga0500578_0120031
1883 Ga0500578_0297900
1884 Ga0500643_000028
1885 Ga0500644_0052058
1886 Ga0500646_0064528
1887 Ga0500647_0018007
1888 Ga0500583_0022614
1889 Ga0500651_0038098
1890 Ga0500566_0000245
1891 Ga0500566_0002949
1892 Ga0500566_0069046
1893 Ga0500641_0027837
1894 Ga0500641_0065899
1895 Ga0500650_0092938
1896 Ga0500650_0114678
1897 Ga0500555_002075
1898 Ga0500556_0017153
1899 Ga0500557_000116
1900 Ga0500562_044412
1901 Ga0500569_002793
1902 Ga0500572_004309
1903 Ga0500595_000580
1904 Ga0500595_004072
1905 Ga0500595_035681
1906 Ga0500595_058462
1907 Ga0500607_228960
1908 Ga0500642_0000113
1909 Ga0500642_0001807
1910 Ga0500642_0233797
1911 Ga0500655_017624
1912 Ga0500655_017634
1913 Ga0500559_0000103
1914 Ga0500559_0016441
1915 Ga0500559_0115729
1916 Ga0500564_180237
1917 Ga0500568_0005758
1918 Ga0500568_0043749
1919 Ga0500577_0040536
1920 Ga0500577_0103682
1921 Ga0500577_0228024
1922 Ga0500579_184734
1923 Ga0500590_080114
1924 Ga0500590_083689
1925 Ga0500603_016640
1926 Ga0500604_0006950
1927 Ga0500616_0000046
1928 Ga0500620_026632
1929 Ga0500622_0188348
1930 Ga0500633_0131813
1931 Ga0500634_0053113
1932 Ga0500638_016392
1933 Ga0500638_042327
1934 Ga0500638_094379
1935 Ga0500636_0000054
1936 Ga0500636_0108981
1937 Ga0500637_0000303
1938 Ga0500637_0027373
1939 Ga0500637_0273034
1940 Ga0500611_005942
1941 Ga0500625_017426
1942 Ga0500645_005369
1943 Ga0500645_048584
1944 Ga0500552_020370
1945 Ga0500596_005620
1946 Ga0500596_006582
1947 Ga0500599_002194
1948 Ga0500601_000834
1949 Ga0500661_001086
1950 Ga0501082_0090266
1951 Ga0530510_0254120
1952 2507504485
1953 2508545909
1954 2508694741
1955 2511400264
1956 2513624280
1957 2513638767
1958 2513649243
1959 2513694581
1960 2513701643
1961 2513716656
1962 2513874131
1963 2514010104
1964 2515624338
1965 2517103029
1966 2524438868
1967 2528849486
1968 2617350256
1969 2617374346
1970 2723842398
1971 2728748321
1972 2745080371
1973 2793059257
1974 2793070197
1975 2793078764
1976 2805920850
1977 2818240632
1978 2824607602
1979 2824615346
1980 2824618797
1981 2824628903
1982 2824638414
1983 2824648046
1984 2824657967
1985 2824665883
1986 2824675853
1987 2824681638
1988 2824692814
1989 2824699391
1990 2824710856
1991 2824722615
1992 2824726005
1993 2824736433
1994 2824751039
1995 2824761521
1996 2824765064
1997 2824778047
1998 2838125984
1999 2841942621
2000 2841953027
2001 2841963878
2002 2841970947
2003 2841977795
2004 2841984643
2005 2842041636
2006 2842049678
2007 2844321468
2008 2847931928
2009 2847943168
2010 2849076908
2011 2857514828
2012 2874595375
2013 2874608911
2014 2874620424
2015 2874621914
2016 2874629592
2017 2874651801
2018 2876763622
2019 2876775569
2020 2876812910
2021 2876823561
2022 2879079660
2023 2879091162
2024 2879104443
2025 2879112371
2026 2879133936
2027 2879145069
2028 2881364580
2029 2881673323
2030 2885374340
2031 2885413720
2032 2888387312
2033 2888391395
2034 2888426991
2035 2889034384
2036 2903727953
2037 2904669493
2038 2904711305
2039 2904716497
2040 2906602563
2041 2906629677
2042 2906645793
2043 2908757590
2044 2908776828
2045 2922364836
2046 2922370260
2047 2922400120
2048 2929622687
2049 2929632210
2050 2932789975
2051 2932800652
2052 2932808383
2053 2932815517
2054 2932824907
2055 2932829169
2056 2933584682
2057 2935613111
2058 2935617644
2059 2935632986
2060 2935643689
2061 2935654067
2062 2935662831
2063 2935671001
2064 2935681644
2065 2935692621
2066 2935702607
2067 2935711895
2068 2935721239
2069 2935730767
2070 2935739929
2071 2935748967
2072 2935758837
2073 2935767101
2074 2935774863
2075 2935779951
2076 2935792219
2077 2935798612
2078 2935806866
2079 2935818869
2080 2935825037
2081 2935834374
2082 2935843901
2083 2935852256
2084 2935856857
2085 2935868384
2086 2935879694
2087 2935883490
2088 2935910689
2089 2935921869
2090 2935929992
2091 2935937660
2092 2935949764
2093 2935956860
2094 2935965322
2095 2935970883
2096 2935982983
2097 2935984370
2098 2935997200
2099 2936009947
2100 2936016972
2101 2936025620
2102 2936034462
2103 2936045445
2104 2936052504
2105 2936055450
2106 2940564573
2107 2941509712
2108 2941517541
2109 2941526506
2110 2941532050
2111 2941545149
2112 3005490881
2113 3005506527
2114 3005593200
2115 3005717572
2116 3005724621
2117 8006928330
2118 8006937312
2119 8006965273
2120 8006977344
2121 8006991605
2122 8006995426
2123 8016519043
2124 8016525261
2125 8016538843
2126 8016543126
2127 8016550163
2128 8016558572
2129 8016581183
2130 8016587521
2131 8016596555
2132 8016619222
2133 8016630377
2134 8016636758
2135 8017057653
2136 8019541311
2137 8019549320
2138 8019578165
2139 8019596195
2140 8019605499
2141 8019613039
2142 8019623726
2143 8019638308
2144 8019641328
2145 8019651697
2146 8019666232
2147 8019675734
2148 8019680365
2149 8019695453
2150 8055750570
2151 8056679066
2152 8056975347

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

82

228

0.96

PF13098

Thioredoxin_2

Thioredoxin-like domain

75

227

0.92

PF13462

Thioredoxin_4

Thioredoxin

67

229

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gyk-assembly4.cif.gz_D the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 0.9675 46 217
3gyk-assembly4.cif.gz_D the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 0.9458 46 217
4gxz-assembly3.cif.gz_C crystal structure of a periplasmic thioredoxin-like protein from salmonella enterica serovar typhimurium 0.8956 48 215
6eez-assembly1.cif.gz_A crystal structure of the thiol-disulfide exchange protein alpha-dsba2 from wolbachia pipientis 0.8889 38 214
5nyl-assembly2.cif.gz_B crystal structure of an atypical poplar thioredoxin-like2.1 active site mutant 0.8849 66 102
ID Description Score Start End Superfamily
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9445 40 218 3.40.30.10
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9284 40 218 3.40.30.10
af_I1K367_67_180_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9235 66 102 3.40.30.10
af_Q7XSQ7_19_127_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8906 66 102 3.40.30.10
af_Q8LCH9_1_124_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8842 66 102 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7U8KRA5-F1-model_v4 deleted 0.9797 46 217
AF-A0A7W0XMI2-F1-model_v4 DsbA family protein 0.9694 59 216 GO:0016491
AF-T0HJ65-F1-model_v4 Thioredoxin domain-containing protein 0.969 67 216 GO:0016491
AF-A0A529PRT1-F1-model_v4 Disulfide bond formation protein DsbA 0.9683 48 218 GO:0016491
AF-A0A2E9X9V3-F1-model_v4 Thioredoxin domain-containing protein 0.9662 48 222 GO:0015036

Map