F489581

General Info

Members Datasets Scaffolds Average Seq Length
1076 395 1076 117

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_11036773|Ga0157375_110367731
Length 134
Sequence MYRGHRDLAALKWRLDMSTMNQPEVLVTVTSAASTEVKKFMSQEGVDPSKGGLRVSVQPGGCSGFKYGLLIEDEAAEDDLIVGQGEWRVFVDPFSAQYLNGVTIDYVSSMQGSGFTFKNPNSTGGCGCGSSFSA

Samples

Sample ID Description Type Environment
1 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
137 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
215 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
230 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
233 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
234 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
260 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
261 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
271 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
291 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
299 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
302 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
303 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
308 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
315 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
316 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
317 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
318 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
319 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
324 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
325 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
326 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
327 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
352 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
353 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
354 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
355 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
359 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
360 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
374 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
395 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.42
Metatranscriptomes 5.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.49
Rhizosphere 97.96
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1021513 3300002076 Bacteria 912
2 Ga0058863_10001545 3300004799 Bacteria 659
3 Ga0058861_10037038 3300004800 Bacteria 535
4 Ga0058861_11938491 3300004800 Bacteria 682
5 Ga0058860_11767703 3300004801 Bacteria 864
6 Ga0058862_10031778 3300004803 Unclassified 515
7 Ga0058862_12313547 3300004803 Bacteria 663
8 Ga0058862_12425160 3300004803 Unclassified 1213
9 Ga0058862_12513443 3300004803 Bacteria 538
10 Ga0058862_12752857 3300004803 Unclassified 515
11 Ga0058862_12817638 3300004803 Bacteria 557
12 Ga0058862_12852883 3300004803 Unclassified 620
13 Ga0065715_10119621 3300005293 Bacteria 2282
14 Ga0065707_10402330 3300005295 Bacteria 851
15 Ga0065707_10590974 3300005295 Unclassified 696
16 Ga0070658_10086928 3300005327 Bacteria 2572
17 Ga0070658_10605391 3300005327 Bacteria 950
18 Ga0070658_10612692 3300005327 Bacteria 944
19 Ga0070658_10727919 3300005327 Bacteria 861
20 Ga0070658_10930598 3300005327 Bacteria 756
21 Ga0070658_11140242 3300005327 Unclassified 678
22 Ga0070676_10004878 3300005328 Bacteria 7103
23 Ga0070676_10057904 3300005328 Unclassified 2295
24 Ga0070676_10067919 3300005328 Bacteria 2133
25 Ga0070676_10675138 3300005328 Bacteria 752
26 Ga0070676_11203677 3300005328 Bacteria 576
27 Ga0070676_11616979 3300005328 Unclassified 501
28 Ga0070683_100002085 3300005329 Bacteria 15786
29 Ga0070683_100017414 3300005329 Bacteria 6351
30 Ga0070683_100033561 3300005329 Bacteria 4681
31 Ga0070683_100038844 3300005329 Bacteria 4366
32 Ga0070683_100097294 3300005329 Bacteria 2769
33 Ga0070683_100138785 3300005329 Unclassified 2303
34 Ga0070683_100160550 3300005329 Bacteria 2133
35 Ga0070683_100252992 3300005329 Bacteria 1675
36 Ga0070683_100260992 3300005329 Unclassified 1648
37 Ga0070683_100371307 3300005329 Unclassified 1363
38 Ga0070683_100505425 3300005329 Unclassified 1155
39 Ga0070683_101229798 3300005329 Bacteria 720
40 Ga0070683_101405102 3300005329 Bacteria 671
41 Ga0070690_100030151 3300005330 Bacteria 3368
42 Ga0070690_100033405 3300005330 Bacteria 3220
43 Ga0070670_100447428 3300005331 Bacteria 1144
44 Ga0070677_10046422 3300005333 Bacteria 1737
45 Ga0070666_10458844 3300005335 Bacteria 921
46 Ga0070666_10495225 3300005335 Bacteria 886
47 Ga0070680_100002196 3300005336 Bacteria 14389
48 Ga0070680_100018010 3300005336 Bacteria 5578
49 Ga0070680_100019927 3300005336 Bacteria 5318
50 Ga0070680_100020843 3300005336 Bacteria 5203
51 Ga0070680_100022197 3300005336 Bacteria 5050
52 Ga0070680_100129250 3300005336 Bacteria 2112
53 Ga0070680_100147849 3300005336 Bacteria 1972
54 Ga0070680_100217060 3300005336 Bacteria 1614
55 Ga0070680_100226554 3300005336 Bacteria 1578
56 Ga0070680_100332749 3300005336 Bacteria 1290
57 Ga0070680_100689896 3300005336 Unclassified 878
58 Ga0070682_100051411 3300005337 Bacteria 2576
59 Ga0070682_100160148 3300005337 Bacteria 1554
60 Ga0070682_100175875 3300005337 Bacteria 1491
61 Ga0068868_100011391 3300005338 Bacteria 6475
62 Ga0068868_100026433 3300005338 Bacteria 4423
63 Ga0068868_100510711 3300005338 Unclassified 1054
64 Ga0068868_100887359 3300005338 Bacteria 810
65 Ga0068868_101761853 3300005338 Bacteria 585
66 Ga0070660_100192175 3300005339 Bacteria 1654
67 Ga0070660_100255842 3300005339 Bacteria 1429
68 Ga0070660_100319831 3300005339 Bacteria 1274
69 Ga0070660_100323795 3300005339 Bacteria 1266
70 Ga0070660_100627484 3300005339 Bacteria 899
71 Ga0070689_100003423 3300005340 Bacteria 10552
72 Ga0070689_100194378 3300005340 Bacteria 1653
73 Ga0070689_100852678 3300005340 Bacteria 804
74 Ga0070691_10019625 3300005341 Bacteria 3120
75 Ga0070687_100002020 3300005343 Bacteria 7442
76 Ga0070687_100003099 3300005343 Bacteria 6394
77 Ga0070661_100001068 3300005344 Bacteria 19426
78 Ga0070661_100046094 3300005344 Bacteria 3188
79 Ga0070661_100105804 3300005344 Bacteria 2098
80 Ga0070661_100562485 3300005344 Unclassified 919
81 Ga0070661_101108264 3300005344 Unclassified 660
82 Ga0070692_10015568 3300005345 Bacteria 3600
83 Ga0070692_10151259 3300005345 Unclassified 1322
84 Ga0070692_10308758 3300005345 Bacteria 968
85 Ga0070668_100005654 3300005347 Bacteria 9268
86 Ga0070668_100023597 3300005347 Bacteria 4654
87 Ga0070668_100141734 3300005347 Bacteria 1938
88 Ga0070669_100007417 3300005353 Bacteria 7859
89 Ga0070669_100065806 3300005353 Bacteria 2670
90 Ga0070675_100007110 3300005354 Bacteria 8617
91 Ga0070675_100370732 3300005354 Bacteria 1273
92 Ga0070675_100391400 3300005354 Unclassified 1238
93 Ga0070675_101022416 3300005354 Unclassified 759
94 Ga0070671_100080453 3300005355 Bacteria 2724
95 Ga0070671_100205691 3300005355 Bacteria 1669
96 Ga0070671_100221472 3300005355 Bacteria 1605
97 Ga0070671_100396860 3300005355 Bacteria 1180
98 Ga0070671_100815806 3300005355 Bacteria 813
99 Ga0070671_101119820 3300005355 Unclassified 692
100 Ga0070671_101192500 3300005355 Unclassified 670
101 Ga0070671_101319656 3300005355 Unclassified 636
102 Ga0070674_100024550 3300005356 Bacteria 3914
103 Ga0070674_100040398 3300005356 Bacteria 3156
104 Ga0070674_100112094 3300005356 Bacteria 2005
105 Ga0070674_100589828 3300005356 Bacteria 938
106 Ga0070674_100760099 3300005356 Bacteria 834
107 Ga0070673_100013585 3300005364 Bacteria 5641
108 Ga0070673_100286559 3300005364 Unclassified 1446
109 Ga0070673_100557421 3300005364 Bacteria 1042
110 Ga0070673_100857657 3300005364 Bacteria 841
111 Ga0070688_100007877 3300005365 Bacteria 5757
112 Ga0070659_100041286 3300005366 Bacteria 3605
113 Ga0070659_100073320 3300005366 Bacteria 2725
114 Ga0070659_100445535 3300005366 Bacteria 1098
115 Ga0070659_101797653 3300005366 Bacteria 549
116 Ga0070667_100079505 3300005367 Bacteria 2803
117 Ga0070667_100098087 3300005367 Bacteria 2528
118 Ga0070667_100276244 3300005367 Bacteria 1507
119 Ga0070667_100780575 3300005367 Bacteria 886
120 Ga0070709_10006275 3300005434 Bacteria 6475
121 Ga0070709_10220343 3300005434 Unclassified 1353
122 Ga0070714_100004555 3300005435 Bacteria 10448
123 Ga0070714_100022164 3300005435 Bacteria 5206
124 Ga0070714_100103316 3300005435 Bacteria 2514
125 Ga0070714_100130194 3300005435 Bacteria 2248
126 Ga0070714_100254463 3300005435 Bacteria 1625
127 Ga0070714_100327881 3300005435 Bacteria 1433
128 Ga0070714_102317998 3300005435 Unclassified 522
129 Ga0070713_100000345 3300005436 Bacteria 30173
130 Ga0070713_100159593 3300005436 Bacteria 2012
131 Ga0070713_100208813 3300005436 Bacteria 1767
132 Ga0070713_100966023 3300005436 Unclassified 821
133 Ga0070713_101192084 3300005436 Bacteria 737
134 Ga0070710_10015426 3300005437 Bacteria 3868
135 Ga0070710_10054896 3300005437 Bacteria 2249
136 Ga0070710_10137289 3300005437 Bacteria 1496
137 Ga0070710_10575681 3300005437 Bacteria 781
138 Ga0070701_10050806 3300005438 Bacteria 2149
139 Ga0070701_10180130 3300005438 Bacteria 1236
140 Ga0070711_100058958 3300005439 Bacteria 2663
141 Ga0070711_100114078 3300005439 Bacteria 1988
142 Ga0070711_100120720 3300005439 Bacteria 1938
143 Ga0070711_100667517 3300005439 Bacteria 873
144 Ga0070705_100066991 3300005440 Bacteria 2155
145 Ga0070705_100693976 3300005440 Unclassified 799
146 Ga0070700_100013015 3300005441 Bacteria 4666
147 Ga0070700_100050670 3300005441 Bacteria 2581
148 Ga0070700_101417456 3300005441 Bacteria 588
149 Ga0070694_100462746 3300005444 Bacteria 1003
150 Ga0070708_100000052 3300005445 Bacteria 78944
151 Ga0070708_100024403 3300005445 Bacteria 5159
152 Ga0070663_100235336 3300005455 Bacteria 1444
153 Ga0070663_100498187 3300005455 Bacteria 1011
154 Ga0070663_100850770 3300005455 Unclassified 785
155 Ga0070678_100292728 3300005456 Bacteria 1381
156 Ga0070678_100296420 3300005456 Bacteria 1373
157 Ga0070678_100314249 3300005456 Bacteria 1336
158 Ga0070678_100316355 3300005456 Bacteria 1332
159 Ga0070662_100008330 3300005457 Bacteria 6756
160 Ga0070662_100173805 3300005457 Bacteria 1694
161 Ga0070662_100205960 3300005457 Bacteria 1563
162 Ga0070662_100468017 3300005457 Unclassified 1048
163 Ga0070662_101056835 3300005457 Unclassified 696
164 Ga0070662_101156452 3300005457 Unclassified 665
165 Ga0070681_10003936 3300005458 Bacteria 14002
166 Ga0070681_10015108 3300005458 Bacteria 7679
167 Ga0070681_10020038 3300005458 Bacteria 6701
168 Ga0070681_10024189 3300005458 Bacteria 6114
169 Ga0070681_10050350 3300005458 Bacteria 4156
170 Ga0070681_10069385 3300005458 Bacteria 3491
171 Ga0070681_10094324 3300005458 Bacteria 2941
172 Ga0070681_10130145 3300005458 Bacteria 2449
173 Ga0070681_10135395 3300005458 Bacteria 2394
174 Ga0070681_10194812 3300005458 Bacteria 1946
175 Ga0070681_10270851 3300005458 Bacteria 1609
176 Ga0070681_10330210 3300005458 Unclassified 1435
177 Ga0070681_10330329 3300005458 Bacteria 1434
178 Ga0070681_10500778 3300005458 Bacteria 1128
179 Ga0070681_10545900 3300005458 Bacteria 1073
180 Ga0070681_10955780 3300005458 Bacteria 776
181 Ga0068867_100008139 3300005459 Bacteria 7409
182 Ga0068867_100012109 3300005459 Bacteria 6091
183 Ga0068867_100130377 3300005459 Bacteria 1953
184 Ga0068867_100385066 3300005459 Unclassified 1179
185 Ga0068867_100741665 3300005459 Bacteria 870
186 Ga0068867_100816135 3300005459 Bacteria 833
187 Ga0070685_10003117 3300005466 Bacteria 8428
188 Ga0070685_10183504 3300005466 Unclassified 1349
189 Ga0070685_10716659 3300005466 Bacteria 731
190 Ga0070706_100042852 3300005467 Unclassified 4181
191 Ga0070707_100000643 3300005468 Bacteria 34864
192 Ga0070707_100236903 3300005468 Unclassified 1776
193 Ga0070698_100009811 3300005471 Bacteria 10235
194 Ga0070698_100028422 3300005471 Bacteria 5808
195 Ga0070699_100001838 3300005518 Bacteria 19266
196 Ga0070699_100245948 3300005518 Bacteria 1598
197 Ga0070699_100336117 3300005518 Bacteria 1359
198 Ga0070699_101645283 3300005518 Bacteria 588
199 Ga0070699_101667295 3300005518 Bacteria 584
200 Ga0070679_100001019 3300005530 Bacteria 24401
201 Ga0070679_100003394 3300005530 Bacteria 14593
202 Ga0070679_100003861 3300005530 Bacteria 13760
203 Ga0070679_100017456 3300005530 Bacteria 6946
204 Ga0070679_100049707 3300005530 Bacteria 4177
205 Ga0070679_100082512 3300005530 Bacteria 3204
206 Ga0070679_100099210 3300005530 Bacteria 2899
207 Ga0070679_100215162 3300005530 Bacteria 1884
208 Ga0070679_100340595 3300005530 Bacteria 1448
209 Ga0070679_100578209 3300005530 Bacteria 1067
210 Ga0070679_101267970 3300005530 Unclassified 682
211 Ga0070679_101511434 3300005530 Bacteria 618
212 Ga0070684_100003384 3300005535 Bacteria 11954
213 Ga0070684_100057265 3300005535 Bacteria 3402
214 Ga0070684_100087437 3300005535 Bacteria 2767
215 Ga0070684_100155228 3300005535 Bacteria 2075
216 Ga0070684_100182497 3300005535 Bacteria 1908
217 Ga0070684_100223557 3300005535 Bacteria 1718
218 Ga0070684_100246373 3300005535 Bacteria 1633
219 Ga0070684_100303441 3300005535 Bacteria 1465
220 Ga0070684_100405278 3300005535 Unclassified 1258
221 Ga0070684_100848453 3300005535 Unclassified 855
222 Ga0070697_100074322 3300005536 Bacteria 2792
223 Ga0070697_100377698 3300005536 Bacteria 1227
224 Ga0070697_100524534 3300005536 Bacteria 1037
225 Ga0068853_100027617 3300005539 Bacteria 4768
226 Ga0068853_100071151 3300005539 Bacteria 3028
227 Ga0068853_100091088 3300005539 Bacteria 2681
228 Ga0068853_100597056 3300005539 Bacteria 1048
229 Ga0068853_100684860 3300005539 Bacteria 977
230 Ga0068853_100843861 3300005539 Unclassified 878
231 Ga0068853_101071533 3300005539 Unclassified 777
232 Ga0070672_100105013 3300005543 Bacteria 2296
233 Ga0070672_100576571 3300005543 Bacteria 978
234 Ga0070672_100841269 3300005543 Unclassified 809
235 Ga0070686_100008268 3300005544 Bacteria 5824
236 Ga0070686_100131025 3300005544 Bacteria 1734
237 Ga0070686_100373207 3300005544 Bacteria 1078
238 Ga0070695_100141978 3300005545 Bacteria 1666
239 Ga0070695_100415760 3300005545 Bacteria 1023
240 Ga0070695_101221112 3300005545 Bacteria 619
241 Ga0070695_101340101 3300005545 Unclassified 592
242 Ga0070695_101404959 3300005545 Bacteria 579
243 Ga0070696_100029982 3300005546 Bacteria 3721
244 Ga0070696_100049164 3300005546 Bacteria 2929
245 Ga0070696_100284293 3300005546 Bacteria 1262
246 Ga0070693_100007204 3300005547 Bacteria 5428
247 Ga0070693_100025640 3300005547 Bacteria 3175
248 Ga0070693_100032154 3300005547 Bacteria 2882
249 Ga0070693_100247100 3300005547 Unclassified 1181
250 Ga0070693_101235547 3300005547 Bacteria 575
251 Ga0070665_100209656 3300005548 Bacteria 1949
252 Ga0070665_100569362 3300005548 Bacteria 1145
253 Ga0070704_100001406 3300005549 Bacteria 12830
254 Ga0070704_100185771 3300005549 Unclassified 1666
255 Ga0070704_100755220 3300005549 Unclassified 866
256 Ga0068855_100085188 3300005563 Bacteria 3657
257 Ga0068855_100404286 3300005563 Bacteria 1496
258 Ga0068855_100456070 3300005563 Bacteria 1394
259 Ga0068855_100770010 3300005563 Bacteria 1025
260 Ga0068855_101120927 3300005563 Bacteria 821
261 Ga0070664_100004031 3300005564 Bacteria 11799
262 Ga0070664_100013879 3300005564 Bacteria 6569
263 Ga0070664_100058883 3300005564 Bacteria 3268
264 Ga0070664_100098246 3300005564 Bacteria 2543
265 Ga0070664_100098708 3300005564 Bacteria 2537
266 Ga0070664_100182242 3300005564 Bacteria 1867
267 Ga0070664_100365465 3300005564 Bacteria 1315
268 Ga0070664_100491257 3300005564 Bacteria 1130
269 Ga0068857_100046264 3300005577 Bacteria 3861
270 Ga0068857_100077827 3300005577 Bacteria 2960
271 Ga0068857_100102261 3300005577 Bacteria 2572
272 Ga0068857_100289006 3300005577 Bacteria 1509
273 Ga0068854_100007726 3300005578 Bacteria 6873
274 Ga0068854_100018923 3300005578 Bacteria 4631
275 Ga0068854_100362766 3300005578 Bacteria 1189
276 Ga0068854_101712607 3300005578 Bacteria 575
277 Ga0068854_102075721 3300005578 Unclassified 524
278 Ga0068856_100149755 3300005614 Bacteria 2342
279 Ga0068856_100222314 3300005614 Bacteria 1904
280 Ga0068856_100274959 3300005614 Bacteria 1701
281 Ga0068856_100652536 3300005614 Bacteria 1073
282 Ga0070702_100056169 3300005615 Bacteria 2273
283 Ga0070702_101017779 3300005615 Unclassified 657
284 Ga0070702_101729340 3300005615 Bacteria 521
285 Ga0068852_100010321 3300005616 Bacteria 6974
286 Ga0068852_100034377 3300005616 Bacteria 4217
287 Ga0068852_100233500 3300005616 Bacteria 1754
288 Ga0068852_100336698 3300005616 Bacteria 1470
289 Ga0068852_100578659 3300005616 Bacteria 1125
290 Ga0068852_100868465 3300005616 Viruses 918
291 Ga0068859_100017750 3300005617 Bacteria 7153
292 Ga0068859_101085031 3300005617 Unclassified 880
293 Ga0068864_100027372 3300005618 Bacteria 4815
294 Ga0068864_100786077 3300005618 Bacteria 935
295 Ga0068866_10013098 3300005718 Bacteria 3628
296 Ga0068866_10044511 3300005718 Bacteria 2221
297 Ga0068866_10141985 3300005718 Bacteria 1379
298 Ga0068866_10250188 3300005718 Bacteria 1084
299 Ga0068861_100079007 3300005719 Unclassified 2571
300 Ga0068861_101367312 3300005719 Bacteria 691
301 Ga0068851_10050614 3300005834 Bacteria 2110
302 Ga0068851_10312120 3300005834 Unclassified 906
303 Ga0068870_10345028 3300005840 Bacteria 954
304 Ga0068870_10471574 3300005840 Unclassified 831
305 Ga0068863_100406915 3300005841 Bacteria 1331
306 Ga0068863_100547734 3300005841 Unclassified 1142
307 Ga0068858_100319274 3300005842 Bacteria 1484
308 Ga0068858_100946854 3300005842 Unclassified 843
309 Ga0068858_100971426 3300005842 Bacteria 832
310 Ga0068860_100186028 3300005843 Bacteria 2009
311 Ga0068860_100599681 3300005843 Bacteria 1107
312 Ga0068860_100869795 3300005843 Bacteria 917
313 Ga0068862_100192108 3300005844 Bacteria 1838
314 Ga0068862_101881280 3300005844 Unclassified 608
315 Ga0081455_10035968 3300005937 Bacteria 4416
316 Ga0070717_10007462 3300006028 Bacteria 8120
317 Ga0070717_10737134 3300006028 Bacteria 896
318 Ga0070715_10107478 3300006163 Bacteria 1311
319 Ga0070715_10541740 3300006163 Bacteria 673
320 Ga0070716_100006672 3300006173 Bacteria 5649
321 Ga0070716_100094821 3300006173 Bacteria 1815
322 Ga0070712_100005777 3300006175 Bacteria 7646
323 Ga0070712_100023743 3300006175 Bacteria 4054
324 Ga0070712_101192378 3300006175 Unclassified 662
325 Ga0097621_100267379 3300006237 Bacteria 1502
326 Ga0097621_100534619 3300006237 Bacteria 1065
327 Ga0068871_100301114 3300006358 Bacteria 1407
328 Ga0075428_101175445 3300006844 Bacteria 809
329 Ga0075430_100021501 3300006846 Bacteria 5484
330 Ga0075431_100016490 3300006847 Bacteria 7498
331 Ga0075433_10010271 3300006852 Bacteria 7511
332 Ga0075434_100039783 3300006871 Bacteria 4657
333 Ga0075434_101133376 3300006871 Bacteria 795
334 Ga0075429_100072380 3300006880 Bacteria 3002
335 Ga0075429_100250269 3300006880 Unclassified 1552
336 Ga0075429_101482720 3300006880 Viruses 590
337 Ga0068865_100005690 3300006881 Bacteria 7572
338 Ga0068865_100010439 3300006881 Bacteria 5781
339 Ga0068865_100204855 3300006881 Bacteria 1534
340 Ga0068865_100281149 3300006881 Unclassified 1325
341 Ga0075436_100002007 3300006914 Bacteria 14062
342 Ga0075436_100167953 3300006914 Bacteria 1549
343 Ga0075436_100273491 3300006914 Unclassified 1207
344 Ga0097620_100017750 3300006931 Bacteria 7153
345 Ga0097620_101085015 3300006931 Unclassified 880
346 Ga0075435_100033886 3300007076 Unclassified 4041
347 Ga0099794_10523512 3300007265 Unclassified 625
348 Ga0099795_10524561 3300007788 Bacteria 555
349 Ga0105251_10327025 3300009011 Bacteria 697
350 Ga0105240_10006583 3300009093 Bacteria 17056
351 Ga0105240_10151296 3300009093 Bacteria 2763
352 Ga0105240_10321288 3300009093 Bacteria 1764
353 Ga0105240_10456639 3300009093 Archaea 1428
354 Ga0105240_11276642 3300009093 Bacteria 775
355 Ga0105240_11635700 3300009093 Bacteria 673
356 Ga0105240_12494385 3300009093 Unclassified 535
357 Ga0105240_12711511 3300009093 Unclassified 511
358 Ga0111539_10012567 3300009094 Bacteria 10609
359 Ga0111539_10335657 3300009094 Bacteria 1759
360 Ga0111539_10629649 3300009094 Bacteria 1249
361 Ga0105245_10096938 3300009098 Bacteria 2722
362 Ga0105245_10146892 3300009098 Bacteria 2225
363 Ga0105245_10561164 3300009098 Bacteria 1164
364 Ga0105245_10626921 3300009098 Unclassified 1104
365 Ga0105245_10701329 3300009098 Bacteria 1045
366 Ga0105245_10742536 3300009098 Bacteria 1017
367 Ga0105245_11357541 3300009098 Bacteria 760
368 Ga0105245_11632751 3300009098 Unclassified 696
369 Ga0105245_11762046 3300009098 Bacteria 672
370 Ga0105247_10919875 3300009101 Unclassified 677
371 Ga0105247_10950365 3300009101 Unclassified 667
372 Ga0114129_10019668 3300009147 Bacteria 9611
373 Ga0114129_10020805 3300009147 Bacteria 9320
374 Ga0114129_12553388 3300009147 Unclassified 610
375 Ga0105243_10015680 3300009148 Bacteria 5730
376 Ga0105243_10393149 3300009148 Bacteria 1286
377 Ga0105243_10753810 3300009148 Bacteria 955
378 Ga0105243_11217649 3300009148 Bacteria 767
379 Ga0105243_12263281 3300009148 Unclassified 581
380 Ga0105241_10513915 3300009174 Bacteria 1070
381 Ga0105241_10635622 3300009174 Bacteria 968
382 Ga0105241_10890435 3300009174 Unclassified 826
383 Ga0105241_11194093 3300009174 Bacteria 720
384 Ga0105242_10010910 3300009176 Bacteria 6980
385 Ga0105242_10192810 3300009176 Bacteria 1805
386 Ga0105242_10290095 3300009176 Bacteria 1489
387 Ga0105242_10646645 3300009176 Bacteria 1028
388 Ga0105242_10841769 3300009176 Unclassified 912
389 Ga0105242_12469659 3300009176 Bacteria 568
390 Ga0105248_10044271 3300009177 Bacteria 4992
391 Ga0105248_10324548 3300009177 Bacteria 1734
392 Ga0105248_11506402 3300009177 Unclassified 762
393 Ga0105237_10208875 3300009545 Bacteria 1952
394 Ga0105237_10250893 3300009545 Bacteria 1772
395 Ga0105238_10049306 3300009551 Bacteria 4241
396 Ga0105238_10056335 3300009551 Bacteria 3944
397 Ga0105238_10182881 3300009551 Bacteria 2073
398 Ga0105238_10311252 3300009551 Bacteria 1560
399 Ga0105238_10910240 3300009551 Bacteria 898
400 Ga0105238_12923427 3300009551 Unclassified 514
401 Ga0105249_10000089 3300009553 Bacteria 131175
402 Ga0105249_10149829 3300009553 Bacteria 2245
403 Ga0105249_10981614 3300009553 Bacteria 913
404 Ga0105249_11554969 3300009553 Bacteria 734
405 Ga0105239_10284303 3300010375 Bacteria 1862
406 Ga0105239_10977810 3300010375 Unclassified 973
407 Ga0105239_11165921 3300010375 Bacteria 887
408 Ga0105246_10495140 3300011119 Bacteria 1037
409 Ga0157373_10006497 3300013100 Bacteria 8725
410 Ga0157373_10016738 3300013100 Bacteria 5344
411 Ga0157373_10112150 3300013100 Bacteria 1917
412 Ga0157373_10143744 3300013100 Bacteria 1678
413 Ga0157373_10162332 3300013100 Bacteria 1572
414 Ga0157373_10591317 3300013100 Bacteria 807
415 Ga0157371_10771775 3300013102 Unclassified 723
416 Ga0157370_10000730 3300013104 Bacteria 41278
417 Ga0157370_10010939 3300013104 Bacteria 9525
418 Ga0157370_10047858 3300013104 Bacteria 4097
419 Ga0157370_10172146 3300013104 Bacteria 2012
420 Ga0157370_10238470 3300013104 Bacteria 1683
421 Ga0157370_10524279 3300013104 Unclassified 1087
422 Ga0157370_11147803 3300013104 Bacteria 702
423 Ga0157369_10010715 3300013105 Bacteria 10432
424 Ga0157369_10086060 3300013105 Bacteria 3358
425 Ga0157369_10131204 3300013105 Bacteria 2655
426 Ga0157369_10162045 3300013105 Bacteria 2361
427 Ga0157369_10231779 3300013105 Bacteria 1930
428 Ga0157369_10373059 3300013105 Bacteria 1481
429 Ga0157369_11100773 3300013105 Bacteria 812
430 Ga0157369_11309560 3300013105 Unclassified 738
431 Ga0157369_11393176 3300013105 Unclassified 714
432 Ga0157369_12041594 3300013105 Unclassified 582
433 Ga0157374_10349551 3300013296 Bacteria 1469
434 Ga0157374_10460290 3300013296 Bacteria 1274
435 Ga0157374_10511377 3300013296 Bacteria 1206
436 Ga0157374_12239762 3300013296 Unclassified 573
437 Ga0157374_12459476 3300013296 Bacteria 548
438 Ga0157378_10008553 3300013297 Bacteria 8909
439 Ga0157378_10034272 3300013297 Bacteria 4489
440 Ga0157378_10080140 3300013297 Bacteria 2949
441 Ga0157378_10089406 3300013297 Bacteria 2797
442 Ga0157378_10774533 3300013297 Bacteria 984
443 Ga0157378_10801761 3300013297 Bacteria 967
444 Ga0157378_11165718 3300013297 Bacteria 809
445 Ga0157378_11334252 3300013297 Unclassified 759
446 Ga0163162_10045637 3300013306 Bacteria 4390
447 Ga0163162_10154799 3300013306 Bacteria 2412
448 Ga0163162_10216391 3300013306 Unclassified 2046
449 Ga0163162_10513608 3300013306 Bacteria 1328
450 Ga0163162_11307988 3300013306 Bacteria 824
451 Ga0157372_10017516 3300013307 Bacteria 7687
452 Ga0157372_10018031 3300013307 Bacteria 7588
453 Ga0157372_10036359 3300013307 Bacteria 5427
454 Ga0157372_10123198 3300013307 Bacteria 2980
455 Ga0157372_10147826 3300013307 Bacteria 2710
456 Ga0157372_10163721 3300013307 Bacteria 2571
457 Ga0157372_10204408 3300013307 Bacteria 2288
458 Ga0157372_10228842 3300013307 Unclassified 2155
459 Ga0157372_10342416 3300013307 Unclassified 1742
460 Ga0157372_10519682 3300013307 Bacteria 1388
461 Ga0157372_10574289 3300013307 Bacteria 1314
462 Ga0157372_10840159 3300013307 Bacteria 1066
463 Ga0157372_12413639 3300013307 Bacteria 604
464 Ga0157375_10078765 3300013308 Bacteria 3330
465 Ga0157375_10175123 3300013308 Bacteria 2294
466 Ga0157375_10275307 3300013308 Bacteria 1845
467 Ga0157375_10931717 3300013308 Bacteria 1011
468 Ga0157375_10931739 3300013308 Bacteria 1011
469 Ga0157375_11036773 3300013308 Bacteria 958
470 Ga0157375_13616190 3300013308 Unclassified 514
471 Ga0163163_10263428 3300014325 Bacteria 1775
472 Ga0163163_10372999 3300014325 Unclassified 1484
473 Ga0163163_12382349 3300014325 Bacteria 588
474 Ga0157380_10415774 3300014326 Bacteria 1281
475 Ga0157380_11419676 3300014326 Bacteria 745
476 Ga0182008_10011727 3300014497 Bacteria 4650
477 Ga0157377_10075373 3300014745 Unclassified 1959
478 Ga0157377_10155798 3300014745 Bacteria 1416
479 Ga0157377_11580836 3300014745 Unclassified 524
480 Ga0157379_10375431 3300014968 Bacteria 1304
481 Ga0157379_10493113 3300014968 Bacteria 1135
482 Ga0157376_10430077 3300014969 Bacteria 1283
483 Ga0157376_10562482 3300014969 Unclassified 1130
484 Ga0157376_11447054 3300014969 Unclassified 719
485 Ga0182007_10088522 3300015262 Bacteria 1019
486 Ga0182007_10294957 3300015262 Bacteria 594
487 Ga0182005_1206177 3300015265 Bacteria 593
488 Ga0163161_10155292 3300017792 Bacteria 1742
489 Ga0163161_10242091 3300017792 Bacteria 1403
490 Ga0163161_10987467 3300017792 Unclassified 718
491 Ga0197907_10955397 3300020069 Bacteria 881
492 Ga0206356_11089032 3300020070 Bacteria 1182
493 Ga0206356_11492485 3300020070 Bacteria 1043
494 Ga0206356_11542969 3300020070 Bacteria 521
495 Ga0206356_11623018 3300020070 Bacteria 1419
496 Ga0206356_11860846 3300020070 Unclassified 509
497 Ga0206349_1530089 3300020075 Bacteria 687
498 Ga0206355_1078973 3300020076 Bacteria 987
499 Ga0206355_1723175 3300020076 Unclassified 964
500 Ga0206351_10189109 3300020077 Bacteria 671
501 Ga0206351_10372331 3300020077 Unclassified 516
502 Ga0206352_11216042 3300020078 Unclassified 623
503 Ga0206350_10333601 3300020080 Bacteria 757
504 Ga0206350_11441145 3300020080 Bacteria 891
505 Ga0206354_10426956 3300020081 Bacteria 812
506 Ga0206353_10538341 3300020082 Unclassified 967
507 Ga0206353_11659228 3300020082 Bacteria 517
508 Ga0224712_10194356 3300022467 Bacteria 920
509 Ga0224712_10225657 3300022467 Unclassified 859
510 Ga0224712_10579407 3300022467 Unclassified 547
511 Ga0207697_10020771 3300025315 Bacteria 2687
512 Ga0207697_10036882 3300025315 Bacteria 2003
513 Ga0207656_10129576 3300025321 Bacteria 1181
514 Ga0207653_10020217 3300025885 Unclassified 2106
515 Ga0207682_10014329 3300025893 Bacteria 3087
516 Ga0207682_10481367 3300025893 Unclassified 588
517 Ga0207692_10057750 3300025898 Bacteria 1997
518 Ga0207692_10448935 3300025898 Unclassified 811
519 Ga0207642_10032962 3300025899 Bacteria 2186
520 Ga0207642_10738894 3300025899 Bacteria 622
521 Ga0207688_10113594 3300025901 Bacteria 1574
522 Ga0207688_11069656 3300025901 Bacteria 509
523 Ga0207680_10243756 3300025903 Bacteria 1239
524 Ga0207680_10327665 3300025903 Bacteria 1072
525 Ga0207699_10054995 3300025906 Bacteria 2367
526 Ga0207699_10172457 3300025906 Bacteria 1448
527 Ga0207699_10624334 3300025906 Bacteria 786
528 Ga0207699_11020881 3300025906 Bacteria 612
529 Ga0207645_10016651 3300025907 Bacteria 4863
530 Ga0207645_10029906 3300025907 Bacteria 3511
531 Ga0207645_10095771 3300025907 Bacteria 1911
532 Ga0207645_10232199 3300025907 Bacteria 1218
533 Ga0207645_10323857 3300025907 Bacteria 1028
534 Ga0207645_11185611 3300025907 Unclassified 513
535 Ga0207643_10012554 3300025908 Bacteria 4577
536 Ga0207643_10317851 3300025908 Unclassified 972
537 Ga0207705_10603160 3300025909 Bacteria 854
538 Ga0207684_10031189 3300025910 Unclassified 4536
539 Ga0207684_10103621 3300025910 Bacteria 2433
540 Ga0207654_10572295 3300025911 Bacteria 804
541 Ga0207654_10982222 3300025911 Bacteria 614
542 Ga0207654_11139718 3300025911 Unclassified 568
543 Ga0207707_10014574 3300025912 Bacteria 6848
544 Ga0207707_10015856 3300025912 Bacteria 6572
545 Ga0207707_10032593 3300025912 Bacteria 4560
546 Ga0207707_10039418 3300025912 Bacteria 4129
547 Ga0207707_10059039 3300025912 Bacteria 3337
548 Ga0207707_10065914 3300025912 Bacteria 3153
549 Ga0207707_10146842 3300025912 Bacteria 2062
550 Ga0207707_10166288 3300025912 Bacteria 1928
551 Ga0207707_10396764 3300025912 Bacteria 1185
552 Ga0207707_10425247 3300025912 Bacteria 1138
553 Ga0207707_10436192 3300025912 Bacteria 1122
554 Ga0207707_10714939 3300025912 Bacteria 840
555 Ga0207707_11646177 3300025912 Bacteria 504
556 Ga0207695_10003508 3300025913 Bacteria 21991
557 Ga0207695_10004443 3300025913 Bacteria 19127
558 Ga0207695_10006890 3300025913 Bacteria 14623
559 Ga0207695_10028752 3300025913 Bacteria 6155
560 Ga0207695_10123495 3300025913 Bacteria 2555
561 Ga0207695_10235955 3300025913 Bacteria 1732
562 Ga0207671_10344576 3300025914 Bacteria 1181
563 Ga0207693_10008333 3300025915 Bacteria 8484
564 Ga0207693_10613632 3300025915 Bacteria 846
565 Ga0207693_11287376 3300025915 Unclassified 547
566 Ga0207663_10266806 3300025916 Bacteria 1266
567 Ga0207663_11719895 3300025916 Bacteria 504
568 Ga0207660_10000818 3300025917 Bacteria 20531
569 Ga0207660_10002896 3300025917 Bacteria 11214
570 Ga0207660_10033905 3300025917 Bacteria 3535
571 Ga0207660_10059970 3300025917 Bacteria 2733
572 Ga0207660_10092736 3300025917 Bacteria 2242
573 Ga0207660_10211015 3300025917 Bacteria 1520
574 Ga0207660_10218929 3300025917 Bacteria 1493
575 Ga0207660_10278600 3300025917 Bacteria 1327
576 Ga0207660_11170159 3300025917 Bacteria 626
577 Ga0207660_11545141 3300025917 Bacteria 536
578 Ga0207662_10003539 3300025918 Bacteria 8054
579 Ga0207662_10004466 3300025918 Bacteria 7361
580 Ga0207657_10038882 3300025919 Bacteria 4230
581 Ga0207657_10111500 3300025919 Bacteria 2258
582 Ga0207657_10148321 3300025919 Bacteria 1912
583 Ga0207657_10674321 3300025919 Unclassified 804
584 Ga0207649_10026063 3300025920 Bacteria 3416
585 Ga0207649_10355685 3300025920 Unclassified 1085
586 Ga0207649_10398525 3300025920 Bacteria 1029
587 Ga0207649_10711865 3300025920 Bacteria 779
588 Ga0207649_11045494 3300025920 Unclassified 643
589 Ga0207652_10002497 3300025921 Bacteria 15478
590 Ga0207652_10004767 3300025921 Bacteria 10994
591 Ga0207652_10021476 3300025921 Bacteria 5328
592 Ga0207652_10086905 3300025921 Bacteria 2742
593 Ga0207652_10103796 3300025921 Bacteria 2514
594 Ga0207652_10197638 3300025921 Bacteria 1810
595 Ga0207652_10314431 3300025921 Bacteria 1414
596 Ga0207652_10325978 3300025921 Bacteria 1386
597 Ga0207652_10335387 3300025921 Bacteria 1365
598 Ga0207652_10375658 3300025921 Bacteria 1283
599 Ga0207652_10454275 3300025921 Bacteria 1155
600 Ga0207646_10004321 3300025922 Bacteria 15503
601 Ga0207646_10013479 3300025922 Bacteria 7814
602 Ga0207681_10002415 3300025923 Bacteria 11861
603 Ga0207681_10013977 3300025923 Bacteria 4975
604 Ga0207681_10440455 3300025923 Unclassified 1059
605 Ga0207694_10017770 3300025924 Bacteria 5374
606 Ga0207694_10017815 3300025924 Bacteria 5368
607 Ga0207694_10041334 3300025924 Bacteria 3552
608 Ga0207694_10137989 3300025924 Bacteria 1960
609 Ga0207694_10971835 3300025924 Bacteria 718
610 Ga0207650_10173797 3300025925 Bacteria 1713
611 Ga0207650_10210181 3300025925 Bacteria 1562
612 Ga0207650_10954928 3300025925 Bacteria 729
613 Ga0207659_10007815 3300025926 Bacteria 6606
614 Ga0207659_10106456 3300025926 Bacteria 2124
615 Ga0207659_10440069 3300025926 Unclassified 1096
616 Ga0207659_10460170 3300025926 Bacteria 1072
617 Ga0207659_10492158 3300025926 Unclassified 1037
618 Ga0207687_10086323 3300025927 Bacteria 2278
619 Ga0207687_10099200 3300025927 Bacteria 2140
620 Ga0207687_10163444 3300025927 Unclassified 1711
621 Ga0207687_10494852 3300025927 Unclassified 1020
622 Ga0207687_10889106 3300025927 Bacteria 762
623 Ga0207700_10000773 3300025928 Bacteria 18446
624 Ga0207700_10799452 3300025928 Unclassified 844
625 Ga0207664_10014780 3300025929 Bacteria 5651
626 Ga0207664_10083531 3300025929 Bacteria 2603
627 Ga0207664_10174502 3300025929 Bacteria 1842
628 Ga0207664_10242750 3300025929 Bacteria 1569
629 Ga0207664_10673104 3300025929 Bacteria 930
630 Ga0207644_10074312 3300025931 Bacteria 2495
631 Ga0207644_10139062 3300025931 Bacteria 1868
632 Ga0207644_10237320 3300025931 Bacteria 1450
633 Ga0207644_11294695 3300025931 Bacteria 612
634 Ga0207644_11539021 3300025931 Unclassified 558
635 Ga0207644_11616957 3300025931 Unclassified 543
636 Ga0207644_11708123 3300025931 Bacteria 527
637 Ga0207690_10155854 3300025932 Bacteria 1698
638 Ga0207690_10263098 3300025932 Bacteria 1337
639 Ga0207690_10725305 3300025932 Bacteria 818
640 Ga0207690_11348961 3300025932 Bacteria 596
641 Ga0207706_10008341 3300025933 Bacteria 9554
642 Ga0207706_10198599 3300025933 Bacteria 1759
643 Ga0207706_10328157 3300025933 Bacteria 1331
644 Ga0207706_10451175 3300025933 Bacteria 1112
645 Ga0207686_10130616 3300025934 Bacteria 1722
646 Ga0207709_10238216 3300025935 Bacteria 1322
647 Ga0207709_10617346 3300025935 Unclassified 860
648 Ga0207709_10747699 3300025935 Unclassified 786
649 Ga0207670_10023378 3300025936 Bacteria 3847
650 Ga0207670_10547655 3300025936 Bacteria 945
651 Ga0207670_11297989 3300025936 Bacteria 617
652 Ga0207669_10098019 3300025937 Bacteria 1929
653 Ga0207669_10187364 3300025937 Bacteria 1489
654 Ga0207704_10002383 3300025938 Bacteria 8442
655 Ga0207704_10243064 3300025938 Bacteria 1346
656 Ga0207704_10972910 3300025938 Bacteria 717
657 Ga0207665_10000466 3300025939 Bacteria 27684
658 Ga0207665_10195005 3300025939 Bacteria 1473
659 Ga0207665_10446952 3300025939 Unclassified 991
660 Ga0207665_10990476 3300025939 Unclassified 668
661 Ga0207691_10027348 3300025940 Bacteria 5346
662 Ga0207691_10041030 3300025940 Unclassified 4275
663 Ga0207691_10164568 3300025940 Bacteria 1944
664 Ga0207691_10326229 3300025940 Unclassified 1316
665 Ga0207691_10638468 3300025940 Bacteria 900
666 Ga0207691_11637636 3300025940 Bacteria 522
667 Ga0207711_10047601 3300025941 Bacteria 3667
668 Ga0207711_10213627 3300025941 Bacteria 1762
669 Ga0207661_10001131 3300025944 Bacteria 17800
670 Ga0207661_10033051 3300025944 Bacteria 4012
671 Ga0207661_10079709 3300025944 Unclassified 2700
672 Ga0207661_10152230 3300025944 Bacteria 2000
673 Ga0207661_10188109 3300025944 Bacteria 1808
674 Ga0207661_10258574 3300025944 Unclassified 1550
675 Ga0207661_10306176 3300025944 Unclassified 1425
676 Ga0207661_10402411 3300025944 Bacteria 1241
677 Ga0207661_10436894 3300025944 Bacteria 1190
678 Ga0207661_10453001 3300025944 Bacteria 1169
679 Ga0207661_10498764 3300025944 Bacteria 1112
680 Ga0207661_10894206 3300025944 Unclassified 818
681 Ga0207661_10943943 3300025944 Bacteria 794
682 Ga0207661_10992203 3300025944 Bacteria 773
683 Ga0207661_11019028 3300025944 Bacteria 762
684 Ga0207661_11786700 3300025944 Unclassified 560
685 Ga0207661_11909820 3300025944 Bacteria 539
686 Ga0207679_10172202 3300025945 Bacteria 1783
687 Ga0207679_10269921 3300025945 Bacteria 1454
688 Ga0207679_10470072 3300025945 Bacteria 1118
689 Ga0207679_10767680 3300025945 Unclassified 877
690 Ga0207679_10802003 3300025945 Bacteria 858
691 Ga0207679_11181746 3300025945 Bacteria 702
692 Ga0207667_10173101 3300025949 Bacteria 2219
693 Ga0207667_10406468 3300025949 Bacteria 1386
694 Ga0207667_11058113 3300025949 Bacteria 796
695 Ga0207651_10017001 3300025960 Bacteria 4282
696 Ga0207651_10883538 3300025960 Bacteria 795
697 Ga0207651_11242957 3300025960 Bacteria 669
698 Ga0207651_11875001 3300025960 Bacteria 539
699 Ga0207712_10000403 3300025961 Bacteria 37358
700 Ga0207712_10550917 3300025961 Unclassified 992
701 Ga0207712_11225899 3300025961 Bacteria 670
702 Ga0207668_10009579 3300025972 Bacteria 5814
703 Ga0207668_10159003 3300025972 Bacteria 1758
704 Ga0207640_10004360 3300025981 Bacteria 7669
705 Ga0207640_10076568 3300025981 Bacteria 2271
706 Ga0207640_10127247 3300025981 Bacteria 1836
707 Ga0207640_10836713 3300025981 Bacteria 800
708 Ga0207640_10837834 3300025981 Unclassified 799
709 Ga0207640_11570828 3300025981 Bacteria 592
710 Ga0207658_10161741 3300025986 Unclassified 1836
711 Ga0207658_10298313 3300025986 Bacteria 1387
712 Ga0207658_10545267 3300025986 Bacteria 1037
713 Ga0207677_10004927 3300026023 Bacteria 7208
714 Ga0207677_10323075 3300026023 Bacteria 1283
715 Ga0207677_10686557 3300026023 Unclassified 907
716 Ga0207677_11115775 3300026023 Bacteria 719
717 Ga0207703_10261828 3300026035 Bacteria 1563
718 Ga0207703_10324696 3300026035 Bacteria 1410
719 Ga0207639_10006980 3300026041 Bacteria 7695
720 Ga0207639_10092619 3300026041 Bacteria 2422
721 Ga0207639_10328100 3300026041 Bacteria 1361
722 Ga0207639_10472752 3300026041 Bacteria 1141
723 Ga0207639_10652957 3300026041 Bacteria 973
724 Ga0207678_10076175 3300026067 Bacteria 2873
725 Ga0207678_10183539 3300026067 Bacteria 1787
726 Ga0207678_10573108 3300026067 Bacteria 988
727 Ga0207678_10671584 3300026067 Unclassified 911
728 Ga0207678_10918209 3300026067 Bacteria 774
729 Ga0207708_10006225 3300026075 Bacteria 8840
730 Ga0207708_10019142 3300026075 Bacteria 5157
731 Ga0207708_10670505 3300026075 Bacteria 884
732 Ga0207708_10936986 3300026075 Bacteria 751
733 Ga0207702_10089912 3300026078 Bacteria 2686
734 Ga0207702_10406375 3300026078 Bacteria 1314
735 Ga0207702_10704189 3300026078 Bacteria 995
736 Ga0207702_11668201 3300026078 Unclassified 630
737 Ga0207702_11896634 3300026078 Unclassified 587
738 Ga0207641_10524299 3300026088 Unclassified 1153
739 Ga0207648_10017109 3300026089 Bacteria 6607
740 Ga0207648_10034209 3300026089 Bacteria 4481
741 Ga0207648_10076480 3300026089 Unclassified 2918
742 Ga0207648_10125655 3300026089 Bacteria 2256
743 Ga0207648_10145068 3300026089 Bacteria 2094
744 Ga0207648_10341086 3300026089 Bacteria 1349
745 Ga0207648_10455817 3300026089 Unclassified 1165
746 Ga0207676_10036095 3300026095 Bacteria 3758
747 Ga0207676_10223408 3300026095 Bacteria 1679
748 Ga0207674_10005615 3300026116 Bacteria 14866
749 Ga0207674_10014941 3300026116 Bacteria 8555
750 Ga0207674_10209381 3300026116 Bacteria 1899
751 Ga0207674_10306503 3300026116 Bacteria 1537
752 Ga0207674_10505316 3300026116 Bacteria 1168
753 Ga0207675_100366981 3300026118 Bacteria 1413
754 Ga0207683_10012414 3300026121 Bacteria 7269
755 Ga0207683_10395115 3300026121 Bacteria 1272
756 Ga0207683_10405432 3300026121 Bacteria 1254
757 Ga0207683_11628457 3300026121 Unclassified 595
758 Ga0207698_10027735 3300026142 Bacteria 4026
759 Ga0207698_10070046 3300026142 Bacteria 2777
760 Ga0207698_10094497 3300026142 Bacteria 2458
761 Ga0207698_10153048 3300026142 Bacteria 2005
762 Ga0207698_10269601 3300026142 Bacteria 1569
763 Ga0207698_10284098 3300026142 Bacteria 1532
764 Ga0207698_10725673 3300026142 Bacteria 991
765 Ga0207698_11145611 3300026142 Bacteria 791
766 Ga0207698_11411028 3300026142 Bacteria 711
767 Ga0209981_1013967 3300027378 Bacteria 1118
768 Ga0210000_1002573 3300027462 Bacteria 2587
769 Ga0209999_1002764 3300027543 Bacteria 3108
770 Ga0209966_1009819 3300027695 Bacteria 1715
771 Ga0268266_11214417 3300028379 Bacteria 729
772 Ga0268265_10137082 3300028380 Bacteria 2043
773 Ga0268264_10406727 3300028381 Bacteria 1309
774 Ga0316180_1134937 3300030736 Bacteria 797
775 Ga0316182_1362494 3300030745 Bacteria 694
776 Ga0307408_100209033 3300031548 Bacteria 1585
777 Ga0307408_101045005 3300031548 Bacteria 755
778 Ga0307408_102347908 3300031548 Bacteria 517
779 Ga0307408_102458346 3300031548 Unclassified 506
780 Ga0316578_10657619 3300031728 Bacteria 612
781 Ga0307405_10015090 3300031731 Bacteria 4173
782 Ga0307405_10448704 3300031731 Bacteria 1022
783 Ga0307405_10801686 3300031731 Bacteria 789
784 Ga0307413_10099233 3300031824 Bacteria 1919
785 Ga0307413_10412579 3300031824 Bacteria 1061
786 Ga0307410_10077786 3300031852 Bacteria 2320
787 Ga0307410_10140438 3300031852 Bacteria 1786
788 Ga0307410_10202544 3300031852 Bacteria 1516
789 Ga0307410_10339023 3300031852 Bacteria 1198
790 Ga0307406_10041009 3300031901 Bacteria 2882
791 Ga0307406_10050359 3300031901 Bacteria 2640
792 Ga0307406_11301176 3300031901 Unclassified 634
793 Ga0307406_11639798 3300031901 Bacteria 569
794 Ga0307407_10129073 3300031903 Unclassified 1614
795 Ga0307407_10342139 3300031903 Bacteria 1056
796 Ga0307407_10573274 3300031903 Bacteria 837
797 Ga0307412_10157309 3300031911 Bacteria 1684
798 Ga0307409_100052967 3300031995 Bacteria 3115
799 Ga0307409_100140448 3300031995 Bacteria 2080
800 Ga0307409_100256825 3300031995 Bacteria 1601
801 Ga0307409_100737466 3300031995 Bacteria 988
802 Ga0307409_101015184 3300031995 Bacteria 848
803 Ga0307416_100102135 3300032002 Bacteria 2499
804 Ga0307416_100331187 3300032002 Bacteria 1530
805 Ga0307416_100699242 3300032002 Bacteria 1103
806 Ga0307416_101367355 3300032002 Unclassified 814
807 Ga0307414_10154256 3300032004 Unclassified 1816
808 Ga0307414_10588620 3300032004 Bacteria 996
809 Ga0307414_11835712 3300032004 Bacteria 566
810 Ga0307411_10044355 3300032005 Unclassified 2852
811 Ga0307411_10297372 3300032005 Unclassified 1293
812 Ga0307411_10420843 3300032005 Bacteria 1110
813 Ga0307411_10903345 3300032005 Bacteria 785
814 Ga0307415_100086437 3300032126 Bacteria 2256
815 Ga0307415_101057629 3300032126 Bacteria 757
816 Ga0373948_0008842 3300034817 Bacteria 1725
817 Ga0373926_0084345 3300035083 Bacteria 1177
818 Ga0373934_0000463 3300035086 Bacteria 14190
819 Ga0373944_0036358 3300035089 Bacteria 1504
820 Ga0373949_0023357 3300035090 Bacteria 1431
821 Ga0373951_0110682 3300035091 Bacteria 739
822 Ga0373923_0001722 3300035111 Bacteria 6433
823 Ga0373936_0054724 3300035113 Unclassified 1619
824 Ga0373941_0011511 3300035115 Unclassified 2287
825 Ga0373945_0005281 3300035116 Bacteria 4133
826 Ga0373953_0022490 3300035117 Bacteria 2378
827 Ga0373954_0065865 3300035118 Bacteria 1715
828 Ga0373956_0000644 3300035119 Bacteria 14364
829 Ga0373957_0025840 3300035120 Bacteria 2120
830 Ga0373957_0238908 3300035120 Bacteria 763
831 Ga0373960_0321557 3300035121 Bacteria 580
832 Ga0373943_0000618 3300035170 Bacteria 15411
833 Ga0373946_0035605 3300035171 Unclassified 2015
834 Ga0373955_0009773 3300035172 Bacteria 4507
835 Ga0373955_0331780 3300035172 Bacteria 920
836 Ga0373961_0368125 3300035241 Bacteria 545
837 Ga0373931_0110974 3300035691 Bacteria 1556
838 Ga0373931_0858534 3300035691 Bacteria 608
839 Ga0373931_1220283 3300035691 Bacteria 515
840 Ga0373935_0001230 3300035692 Bacteria 14148
841 Ga0373927_0010997 3300035695 Bacteria 6027
842 Ga0373927_0113627 3300035695 Bacteria 1765
843 Ga0373933_0004688 3300035724 Bacteria 7486
844 Ga0373947_0000019 3300035725 Bacteria 101479
845 Ga0373937_0000142 3300036401 Bacteria 69511
846 Ga0373937_1416903 3300036401 Bacteria 643
847 Ga0316582_0172303 3300036647 Bacteria 1470
848 Ga0373925_0000303 3300037068 Bacteria 51655
849 Ga0395900_0547098 3300037418 Bacteria 1103
850 Ga0395905_0054759 3300037471 Bacteria 3733
851 Ga0395905_0602041 3300037471 Bacteria 1001
852 Ga0395901_1036988 3300038443 Unclassified 794
853 Ga0242420_023461 3300038996 Bacteria 1114
854 Ga0436365_0141229 3300039437 Bacteria 2264
855 Ga0436365_1138491 3300039437 Unclassified 1024
856 Ga0451839_0967978 3300041496 Bacteria 803
857 Ga0451853_1892066 3300041512 Unclassified 676
858 Ga0451853_3935002 3300041512 Bacteria 1203
859 Ga0466966_0192934 3300044684 Bacteria 1234
860 Ga0466963_0289789 3300044694 Bacteria 1151
861 Ga0466963_0749985 3300044694 Bacteria 689
862 Ga0466963_0777870 3300044694 Bacteria 675
863 Ga0466964_0470530 3300044706 Unclassified 670
864 Ga0466959_0145435 3300045049 Bacteria 1673
865 Ga0466958_0083501 3300045836 Bacteria 1969
866 Ga0466958_0088156 3300045836 Bacteria 1917
867 Ga0466958_0201449 3300045836 Bacteria 1267
868 Ga0466967_0269257 3300045976 Bacteria 1632
869 Ga0466967_0799220 3300045976 Bacteria 937
870 Ga0466967_1200499 3300045976 Bacteria 756
871 Ga0466967_1347879 3300045976 Bacteria 711
872 Ga0495592_0026016 3300046454 Bacteria 4439
873 Ga0495592_0602698 3300046454 Bacteria 670
874 Ga0495651_0000723 3300046462 Bacteria 25581
875 Ga0495651_0580264 3300046462 Bacteria 709
876 Ga0495651_0795701 3300046462 Bacteria 584
877 Ga0495651_0885881 3300046462 Bacteria 547
878 Ga0495653_0003352 3300046463 Bacteria 12877
879 Ga0495580_0000426 3300046472 Bacteria 34866
880 Ga0495582_0000045 3300046473 Bacteria 62705
881 Ga0495639_0000403 3300046475 Bacteria 20520
882 Ga0495639_0286260 3300046475 Unclassified 820
883 Ga0495662_0392431 3300046476 Bacteria 682
884 Ga0495664_0569994 3300046477 Bacteria 674
885 Ga0495594_0075984 3300046499 Unclassified 1873
886 Ga0495594_0477202 3300046499 Bacteria 709
887 Ga0495608_0002935 3300046511 Bacteria 12203
888 Ga0495608_0032534 3300046511 Bacteria 3525
889 Ga0495608_0184800 3300046511 Bacteria 1318
890 Ga0495618_0333188 3300046514 Bacteria 938
891 Ga0495628_0000674 3300046516 Bacteria 31380
892 Ga0495630_0003749 3300046517 Bacteria 10605
893 Ga0495630_0012293 3300046517 Bacteria 6212
894 Ga0495630_0077935 3300046517 Bacteria 2498
895 Ga0495630_0217970 3300046517 Bacteria 1457
896 Ga0495643_0064527 3300046522 Bacteria 1935
897 Ga0495663_0118759 3300046525 Unclassified 884
898 Ga0495663_0174665 3300046525 Unclassified 742
899 Ga0495666_0500949 3300046526 Bacteria 543
900 Ga0495652_0017042 3300046529 Bacteria 6490
901 Ga0495652_0353847 3300046529 Bacteria 1051
902 Ga0495652_0856079 3300046529 Bacteria 602
903 Ga0495665_0000014 3300046531 Bacteria 67903
904 Ga0495665_0012549 3300046531 Bacteria 4587
905 Ga0495665_0608461 3300046531 Bacteria 546
906 Ga0495640_0103343 3300046533 Bacteria 1868
907 Ga0495586_0247767 3300046535 Bacteria 1016
908 Ga0495587_0000899 3300046536 Bacteria 19712
909 Ga0495587_0033174 3300046536 Bacteria 3118
910 Ga0495598_0060196 3300046537 Bacteria 1169
911 Ga0495621_0132701 3300046539 Bacteria 970
912 Ga0495645_0000642 3300046543 Bacteria 24105
913 Ga0495645_0197509 3300046543 Bacteria 1367
914 Ga0495645_0399672 3300046543 Unclassified 876
915 Ga0495645_0947848 3300046543 Bacteria 509
916 Ga0495622_0296356 3300046557 Bacteria 705
917 Ga0495667_0000783 3300046559 Bacteria 20393
918 Ga0495667_0500999 3300046559 Bacteria 761
919 Ga0495667_0829180 3300046559 Bacteria 569
920 Ga0495656_0421325 3300046615 Unclassified 700
921 Ga0495634_0167420 3300046642 Unclassified 1383
922 Ga0495634_0231004 3300046642 Bacteria 1138
923 Ga0495635_0000476 3300046663 Bacteria 25343
924 Ga0495635_0049264 3300046663 Bacteria 2903
925 Ga0495635_0125122 3300046663 Unclassified 1753
926 Ga0495635_0237297 3300046663 Bacteria 1231
927 Ga0495659_0047114 3300046664 Bacteria 1558
928 Ga0495588_0000923 3300046674 Bacteria 12797
929 Ga0495657_0429893 3300046675 Bacteria 775
930 Ga0495657_0904031 3300046675 Bacteria 502
931 Ga0495599_0000524 3300046678 Bacteria 22058
932 Ga0495623_0000581 3300046679 Bacteria 24383
933 Ga0495646_0005155 3300046680 Bacteria 8244
934 Ga0495646_0443223 3300046680 Bacteria 671
935 Ga0495658_0000038 3300046683 Bacteria 65836
936 Ga0495669_0058544 3300046684 Unclassified 1739
937 Ga0495669_0080218 3300046684 Bacteria 1497
938 Ga0495669_0179647 3300046684 Bacteria 1009
939 Ga0495613_0012452 3300046689 Bacteria 6321
940 Ga0495613_0411479 3300046689 Bacteria 921
941 Ga0495613_0429823 3300046689 Bacteria 897
942 Ga0495613_1062370 3300046689 Bacteria 518
943 Ga0495624_0475835 3300046690 Bacteria 748
944 Ga0495670_0129844 3300046691 Bacteria 1313
945 Ga0495600_0000452 3300046809 Bacteria 21257
946 Ga0495581_0000112 3300047315 Bacteria 34426
947 Ga0495604_0000592 3300047317 Bacteria 31436
948 Ga0495604_0091315 3300047317 Bacteria 2259
949 Ga0495604_0369920 3300047317 Bacteria 949
950 Ga0495604_0983035 3300047317 Bacteria 523
951 Ga0495674_0004595 3300047319 Bacteria 13279
952 Ga0495674_0683776 3300047319 Bacteria 806
953 Ga0495680_0006077 3300047322 Bacteria 11278
954 Ga0495680_0177063 3300047322 Bacteria 1541
955 Ga0495680_0373402 3300047322 Bacteria 989
956 Ga0495675_0001981 3300047444 Bacteria 12224
957 Ga0495675_0381818 3300047444 Bacteria 824
958 Ga0495675_0413452 3300047444 Bacteria 785
959 Ga0495675_0742824 3300047444 Bacteria 547
960 Ga0495685_149135 3300047447 Bacteria 760
961 Ga0495684_0001660 3300047471 Bacteria 17872
962 Ga0495684_0256043 3300047471 Bacteria 1271
963 Ga0495684_1043863 3300047471 Bacteria 516
964 Ga0495593_0000188 3300047673 Bacteria 32373
965 Ga0495593_0724597 3300047673 Bacteria 500
966 Ga0495602_0003690 3300048088 Bacteria 15888
967 Ga0495602_0642928 3300048088 Bacteria 725
968 Ga0495602_0678813 3300048088 Bacteria 701
969 Ga0495602_0679160 3300048088 Bacteria 701
970 Ga0495614_0000013 3300048089 Bacteria 57032
971 Ga0496100_0415240 3300048903 Bacteria 1027
972 Ga0496101_0602988 3300048904 Bacteria 868
973 Ga0496101_1237614 3300048904 Bacteria 584
974 Ga0496104_0090136 3300048907 Bacteria 2930
975 Ga0496105_0168845 3300048908 Bacteria 1794
976 Ga0496106_0424884 3300048909 Bacteria 1068
977 Ga0496107_1322151 3300048910 Bacteria 515
978 Ga0496108_0087841 3300048911 Bacteria 2641
979 Ga0496109_0252506 3300048912 Bacteria 1661
980 Ga0496112_0038661 3300048915 Bacteria 4660
981 Ga0496112_0062878 3300048915 Bacteria 3662
982 Ga0496112_0533269 3300048915 Bacteria 1108
983 Ga0496112_1048747 3300048915 Bacteria 734
984 Ga0496113_0037466 3300048916 Bacteria 3559
985 Ga0496114_0911149 3300048917 Bacteria 761
986 Ga0496115_0136899 3300048918 Bacteria 2019
987 Ga0501306_099691 3300049127 Bacteria 518
988 Ga0501307_089670 3300049162 Bacteria 512
989 Ga0501316_058577 3300049532 Archaea 566
990 Ga0501316_076459 3300049532 Bacteria 513
991 Ga0501317_096461 3300049533 Bacteria 529
992 Ga0501321_052904 3300049537 Bacteria 598
993 Ga0501031_0128102 3300049568 Bacteria 1658
994 Ga0501033_0028071 3300049570 Bacteria 4230
995 Ga0501034_0082214 3300049571 Bacteria 3223
996 Ga0501036_0015341 3300049572 Bacteria 6399
997 Ga0501036_0166847 3300049572 Bacteria 1856
998 Ga0501038_0042595 3300049574 Bacteria 3954
999 Ga0501039_0217063 3300049575 Bacteria 1504
1000 Ga0501040_0213517 3300049576 Bacteria 1372
1001 Ga0501041_0313543 3300049577 Bacteria 989
1002 Ga0501042_0172110 3300049578 Bacteria 1562
1003 Ga0501042_0623750 3300049578 Bacteria 784
1004 Ga0501046_0036969 3300049580 Bacteria 3926
1005 Ga0501047_0245214 3300049581 Bacteria 1641
1006 Ga0501070_0046113 3300049586 Bacteria 3625
1007 Ga0501072_0324535 3300049588 Bacteria 1223
1008 Ga0501074_0126135 3300049590 Bacteria 1831
1009 Ga0501074_0443002 3300049590 Bacteria 921
1010 Ga0501201_028729 3300049651 Bacteria 624
1011 Ga0501235_098770 3300049669 Unclassified 711
1012 Ga0501249_135073 3300049679 Bacteria 611
1013 Ga0501257_146105 3300049686 Bacteria 649
1014 Ga0501229_054342 3300049706 Bacteria 598
1015 Ga0501079_0160259 3300049741 Bacteria 1754
1016 Ga0501080_0554634 3300049742 Bacteria 1023
1017 Ga0501080_1796127 3300049742 Bacteria 515
1018 Ga0501081_0057133 3300049743 Bacteria 2698
1019 Ga0501081_0177973 3300049743 Bacteria 1537
1020 Ga0501264_044742 3300049761 Bacteria 554
1021 Ga0501273_020123 3300049770 Bacteria 899
1022 Ga0501035_0077656 3300049822 Bacteria 2934
1023 Ga0501044_0050994 3300049823 Bacteria 4268
1024 Ga0501045_0072581 3300049824 Bacteria 2534
1025 nmdc:mga05p37_1294589_c1 3300050507 Bacteria 744
1026 nmdc:mga05p37_236139_c1 3300050507 Bacteria 2200
1027 nmdc:mga09592_217138_c1 3300050508 Unclassified 1657
1028 nmdc:mga09592_69437_c1 3300050508 Bacteria 2989
1029 nmdc:mga0qj67_5557_c1 3300050509 Bacteria 9219
1030 nmdc:mga06r32_1430251_c1 3300050510 Bacteria 633
1031 nmdc:mga06r32_178005_c1 3300050510 Unclassified 2112
1032 nmdc:mga06r32_185170_c1 3300050510 Bacteria 2069
1033 nmdc:mga08y16_56756_c1 3300050511 Unclassified 4092
1034 nmdc:mga08y16_742576_c1 3300050511 Bacteria 978
1035 nmdc:mga0n895_184069_c1 3300050512 Bacteria 2120
1036 nmdc:mga0n895_975465_c1 3300050512 Bacteria 830
1037 nmdc:mga0rr50_124612_c1 3300050513 Bacteria 2055
1038 nmdc:mga08x19_150445_c1 3300050514 Bacteria 1576
1039 nmdc:mga08x19_196401_c1 3300050514 Bacteria 1382
1040 nmdc:mga08x19_3616_c1 3300050514 Bacteria 9206
1041 nmdc:mga08x19_5563_c1 3300050514 Bacteria 7450
1042 nmdc:mga0a205_892667_c1 3300050515 Bacteria 736
1043 Ga0495601_0005901 3300053077 Bacteria 7141
1044 Ga0495612_0018548 3300053078 Bacteria 2785
1045 Ga0495619_0003300 3300053085 Bacteria 10427
1046 Ga0495619_0540789 3300053085 Bacteria 800
1047 Ga0501084_0192633 3300054114 Bacteria 1720
1048 Ga0501084_0714380 3300054114 Bacteria 845
1049 Ga0590075_141592 3300059424 Bacteria 633
1050 Ga0587066_187366 3300059490 Bacteria 537
1051 Ga0587066_197312 3300059490 Bacteria 527
1052 Ga0587080_180016 3300059503 Bacteria 506
1053 Ga0587082_140745 3300059504 Bacteria 562
1054 Ga0587088_042385 3300059508 Unclassified 862
1055 Ga0587088_107474 3300059508 Unclassified 630
1056 Ga0587088_175248 3300059508 Bacteria 534
1057 Ga0587091_029655 3300059511 Bacteria 1018
1058 Ga0587091_167816 3300059511 Bacteria 569
1059 Ga0587094_022552 3300059513 Bacteria 925
1060 Ga0587101_085480 3300059623 Bacteria 605
1061 Ga0587115_036883 3300059626 Unclassified 749
1062 Ga0587115_122384 3300059626 Bacteria 502
1063 Ga0587128_028052 3300059630 Bacteria 914
1064 Ga0587067_135511 3300059640 Unclassified 605
1065 Ga0587067_188716 3300059640 Bacteria 541
1066 Ga0587069_125180 3300059642 Unclassified 549
1067 Ga0587075_024895 3300059644 Unclassified 916
1068 Ga0587075_144129 3300059644 Bacteria 511
1069 Ga0587079_034151 3300059647 Bacteria 994
1070 Ga0587107_088081 3300059652 Bacteria 595
1071 Ga0587114_006593 3300059655 Bacteria 1303
1072 Ga0587119_034582 3300059658 Bacteria 704
1073 Ga0501082_0295535 3300060353 Bacteria 1410
1074 Ga0501082_0487679 3300060353 Bacteria 1077
1075 Ga0501082_1179277 3300060353 Bacteria 669
1076 Ga0530510_0170125 3300061734 Bacteria 1614

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_100140448 Ga0307409_1001404482 96
2 3300049127 Ga0501306_099691 Ga0501306_099691_119_502 96
3 3300049162 Ga0501307_089670 Ga0501307_089670_22_405 96
4 3300049537 Ga0501321_052904 Ga0501321_052904_22_405 96
5 3300004803 Ga0058862_10031778 Ga0058862_100317781 99
6 3300005327 Ga0070658_11140242 Ga0070658_111402422 99
7 3300005336 Ga0070680_100226554 Ga0070680_1002265541 99
8 3300005339 Ga0070660_100627484 Ga0070660_1006274841 99
9 3300005344 Ga0070661_100001068 Ga0070661_1000010681 99
10 3300005455 Ga0070663_100850770 Ga0070663_1008507702 99
11 3300005458 Ga0070681_10330329 Ga0070681_103303292 99
12 3300005518 Ga0070699_100001838 Ga0070699_1000018381 99
13 3300005530 Ga0070679_101267970 Ga0070679_1012679702 99
14 3300005535 Ga0070684_100003384 Ga0070684_1000033848 99
15 3300005539 Ga0068853_101071533 Ga0068853_1010715332 99
16 3300005546 Ga0070696_100029982 Ga0070696_1000299821 99
17 3300005578 Ga0068854_100007726 Ga0068854_1000077266 99
18 3300009093 Ga0105240_12494385 Ga0105240_124943851 99
19 3300009174 Ga0105241_10890435 Ga0105241_108904352 99
20 3300013100 Ga0157373_10006497 Ga0157373_100064972 99
21 3300013105 Ga0157369_10131204 Ga0157369_101312043 99
22 3300013105 Ga0157369_12041594 Ga0157369_120415941 99
23 3300013307 Ga0157372_10018031 Ga0157372_100180311 99
24 3300022467 Ga0224712_10579407 Ga0224712_105794071 99
25 3300025911 Ga0207654_11139718 Ga0207654_111397181 99
26 3300025912 Ga0207707_10032593 Ga0207707_100325934 99
27 3300025913 Ga0207695_10003508 Ga0207695_100035083 99
28 3300025917 Ga0207660_10002896 Ga0207660_100028961 99
29 3300025919 Ga0207657_10674321 Ga0207657_106743212 99
30 3300025920 Ga0207649_10026063 Ga0207649_100260633 99
31 3300025921 Ga0207652_10004767 Ga0207652_100047671 99
32 3300025944 Ga0207661_10188109 Ga0207661_101881091 99
33 3300025981 Ga0207640_10004360 Ga0207640_100043603 99
34 3300026041 Ga0207639_10328100 Ga0207639_103281001 99
35 3300026067 Ga0207678_10671584 Ga0207678_106715842 99
36 3300026078 Ga0207702_11668201 Ga0207702_116682011 99
37 3300026142 Ga0207698_10070046 Ga0207698_100700463 99
38 3300005329 Ga0070683_100002085 Ga0070683_1000020858 100
39 3300005337 Ga0070682_100051411 Ga0070682_1000514111 100
40 3300005458 Ga0070681_10015108 Ga0070681_100151083 100
41 3300005530 Ga0070679_100001019 Ga0070679_10000101917 100
42 3300005616 Ga0068852_100034377 Ga0068852_1000343774 100
43 3300009093 Ga0105240_10006583 Ga0105240_100065839 100
44 3300009093 Ga0105240_12711511 Ga0105240_127115111 100
45 3300013104 Ga0157370_10000730 Ga0157370_1000073015 100
46 3300013307 Ga0157372_10036359 Ga0157372_100363593 100
47 3300025912 Ga0207707_10039418 Ga0207707_100394182 100
48 3300025913 Ga0207695_10004443 Ga0207695_100044439 100
49 3300025917 Ga0207660_11545141 Ga0207660_115451411 100
50 3300025921 Ga0207652_10002497 Ga0207652_100024972 100
51 3300025944 Ga0207661_10001131 Ga0207661_1000113112 100
52 3300002076 JGI24749J21850_1021513 JGI24749J21850_10215132 108
53 3300004799 Ga0058863_10001545 Ga0058863_100015452 108
54 3300004800 Ga0058861_10037038 Ga0058861_100370381 108
55 3300004800 Ga0058861_11938491 Ga0058861_119384911 108
56 3300004801 Ga0058860_11767703 Ga0058860_117677032 108
57 3300004803 Ga0058862_12313547 Ga0058862_123135472 108
58 3300004803 Ga0058862_12425160 Ga0058862_124251602 108
59 3300004803 Ga0058862_12513443 Ga0058862_125134431 108
60 3300004803 Ga0058862_12752857 Ga0058862_127528571 108
61 3300004803 Ga0058862_12817638 Ga0058862_128176381 108
62 3300004803 Ga0058862_12852883 Ga0058862_128528832 108
63 3300005293 Ga0065715_10119621 Ga0065715_101196212 108
64 3300005295 Ga0065707_10402330 Ga0065707_104023301 108
65 3300005295 Ga0065707_10590974 Ga0065707_105909741 108
66 3300005327 Ga0070658_10086928 Ga0070658_100869282 108
67 3300005327 Ga0070658_10605391 Ga0070658_106053912 108
68 3300005327 Ga0070658_10612692 Ga0070658_106126922 108
69 3300005327 Ga0070658_10727919 Ga0070658_107279192 108
70 3300005327 Ga0070658_10930598 Ga0070658_109305981 108
71 3300005328 Ga0070676_10004878 Ga0070676_100048782 108
72 3300005328 Ga0070676_10057904 Ga0070676_100579042 108
73 3300005328 Ga0070676_10067919 Ga0070676_100679191 108
74 3300005328 Ga0070676_10675138 Ga0070676_106751381 108
75 3300005328 Ga0070676_11203677 Ga0070676_112036772 108
76 3300005328 Ga0070676_11616979 Ga0070676_116169791 108
77 3300005329 Ga0070683_100017414 Ga0070683_1000174142 108
78 3300005329 Ga0070683_100033561 Ga0070683_1000335612 108
79 3300005329 Ga0070683_100038844 Ga0070683_1000388442 108
80 3300005329 Ga0070683_100097294 Ga0070683_1000972942 108
81 3300005329 Ga0070683_100138785 Ga0070683_1001387852 108
82 3300005329 Ga0070683_100160550 Ga0070683_1001605502 108
83 3300005329 Ga0070683_100252992 Ga0070683_1002529922 108
84 3300005329 Ga0070683_100260992 Ga0070683_1002609922 108
85 3300005329 Ga0070683_100371307 Ga0070683_1003713072 108
86 3300005329 Ga0070683_100505425 Ga0070683_1005054252 108
87 3300005329 Ga0070683_101229798 Ga0070683_1012297982 108
88 3300005329 Ga0070683_101405102 Ga0070683_1014051022 108
89 3300005330 Ga0070690_100030151 Ga0070690_1000301512 108
90 3300005330 Ga0070690_100033405 Ga0070690_1000334052 108
91 3300005331 Ga0070670_100447428 Ga0070670_1004474282 108
92 3300005333 Ga0070677_10046422 Ga0070677_100464222 108
93 3300005335 Ga0070666_10458844 Ga0070666_104588442 108
94 3300005335 Ga0070666_10495225 Ga0070666_104952252 108
95 3300005336 Ga0070680_100002196 Ga0070680_1000021961 108
96 3300005336 Ga0070680_100018010 Ga0070680_1000180104 108
97 3300005336 Ga0070680_100019927 Ga0070680_1000199272 108
98 3300005336 Ga0070680_100020843 Ga0070680_1000208432 108
99 3300005336 Ga0070680_100022197 Ga0070680_1000221972 108
100 3300005336 Ga0070680_100129250 Ga0070680_1001292502 108
101 3300005336 Ga0070680_100147849 Ga0070680_1001478494 108
102 3300005336 Ga0070680_100217060 Ga0070680_1002170602 108
103 3300005336 Ga0070680_100332749 Ga0070680_1003327492 108
104 3300005336 Ga0070680_100689896 Ga0070680_1006898961 108
105 3300005337 Ga0070682_100160148 Ga0070682_1001601482 108
106 3300005337 Ga0070682_100175875 Ga0070682_1001758752 108
107 3300005338 Ga0068868_100011391 Ga0068868_1000113916 108
108 3300005338 Ga0068868_100026433 Ga0068868_1000264332 108
109 3300005338 Ga0068868_100510711 Ga0068868_1005107111 108
110 3300005338 Ga0068868_100887359 Ga0068868_1008873591 108
111 3300005338 Ga0068868_101761853 Ga0068868_1017618531 108
112 3300005339 Ga0070660_100192175 Ga0070660_1001921752 108
113 3300005339 Ga0070660_100255842 Ga0070660_1002558422 108
114 3300005339 Ga0070660_100319831 Ga0070660_1003198311 108
115 3300005339 Ga0070660_100323795 Ga0070660_1003237952 108
116 3300005340 Ga0070689_100003423 Ga0070689_1000034236 108
117 3300005340 Ga0070689_100194378 Ga0070689_1001943781 108
118 3300005340 Ga0070689_100852678 Ga0070689_1008526781 108
119 3300005341 Ga0070691_10019625 Ga0070691_100196253 108
120 3300005343 Ga0070687_100002020 Ga0070687_1000020205 108
121 3300005343 Ga0070687_100003099 Ga0070687_1000030993 108
122 3300005344 Ga0070661_100046094 Ga0070661_1000460941 108
123 3300005344 Ga0070661_100105804 Ga0070661_1001058042 108
124 3300005344 Ga0070661_100562485 Ga0070661_1005624851 108
125 3300005344 Ga0070661_101108264 Ga0070661_1011082641 108
126 3300005345 Ga0070692_10015568 Ga0070692_100155683 108
127 3300005345 Ga0070692_10151259 Ga0070692_101512592 108
128 3300005345 Ga0070692_10308758 Ga0070692_103087582 108
129 3300005347 Ga0070668_100005654 Ga0070668_1000056543 108
130 3300005347 Ga0070668_100023597 Ga0070668_1000235972 108
131 3300005347 Ga0070668_100141734 Ga0070668_1001417342 108
132 3300005353 Ga0070669_100007417 Ga0070669_1000074177 108
133 3300005353 Ga0070669_100065806 Ga0070669_1000658062 108
134 3300005354 Ga0070675_100007110 Ga0070675_1000071107 108
135 3300005354 Ga0070675_100370732 Ga0070675_1003707322 108
136 3300005354 Ga0070675_100391400 Ga0070675_1003914002 108
137 3300005354 Ga0070675_101022416 Ga0070675_1010224162 108
138 3300005355 Ga0070671_100080453 Ga0070671_1000804532 108
139 3300005355 Ga0070671_100205691 Ga0070671_1002056912 108
140 3300005355 Ga0070671_100221472 Ga0070671_1002214722 108
141 3300005355 Ga0070671_100396860 Ga0070671_1003968601 108
142 3300005355 Ga0070671_100815806 Ga0070671_1008158061 108
143 3300005355 Ga0070671_101119820 Ga0070671_1011198202 108
144 3300005355 Ga0070671_101192500 Ga0070671_1011925001 108
145 3300005355 Ga0070671_101319656 Ga0070671_1013196562 108
146 3300005356 Ga0070674_100024550 Ga0070674_1000245502 108
147 3300005356 Ga0070674_100040398 Ga0070674_1000403982 108
148 3300005356 Ga0070674_100112094 Ga0070674_1001120942 108
149 3300005356 Ga0070674_100589828 Ga0070674_1005898281 108
150 3300005356 Ga0070674_100760099 Ga0070674_1007600991 108
151 3300005364 Ga0070673_100013585 Ga0070673_1000135852 108
152 3300005364 Ga0070673_100286559 Ga0070673_1002865592 108
153 3300005364 Ga0070673_100557421 Ga0070673_1005574212 108
154 3300005364 Ga0070673_100857657 Ga0070673_1008576571 108
155 3300005365 Ga0070688_100007877 Ga0070688_1000078773 108
156 3300005366 Ga0070659_100041286 Ga0070659_1000412863 108
157 3300005366 Ga0070659_100073320 Ga0070659_1000733202 108
158 3300005366 Ga0070659_100445535 Ga0070659_1004455351 108
159 3300005366 Ga0070659_101797653 Ga0070659_1017976531 108
160 3300005367 Ga0070667_100079505 Ga0070667_1000795052 108
161 3300005367 Ga0070667_100098087 Ga0070667_1000980872 108
162 3300005367 Ga0070667_100276244 Ga0070667_1002762442 108
163 3300005367 Ga0070667_100780575 Ga0070667_1007805752 108
164 3300005434 Ga0070709_10006275 Ga0070709_100062755 108
165 3300005434 Ga0070709_10220343 Ga0070709_102203432 108
166 3300005435 Ga0070714_100004555 Ga0070714_10000455510 108
167 3300005435 Ga0070714_100022164 Ga0070714_1000221642 108
168 3300005435 Ga0070714_100103316 Ga0070714_1001033162 108
169 3300005435 Ga0070714_100130194 Ga0070714_1001301941 108
170 3300005435 Ga0070714_100254463 Ga0070714_1002544632 108
171 3300005435 Ga0070714_100327881 Ga0070714_1003278812 108
172 3300005435 Ga0070714_102317998 Ga0070714_1023179981 108
173 3300005436 Ga0070713_100000345 Ga0070713_1000003452 108
174 3300005436 Ga0070713_100159593 Ga0070713_1001595932 108
175 3300005436 Ga0070713_100208813 Ga0070713_1002088132 108
176 3300005436 Ga0070713_100966023 Ga0070713_1009660232 108
177 3300005436 Ga0070713_101192084 Ga0070713_1011920841 108
178 3300005437 Ga0070710_10015426 Ga0070710_100154262 108
179 3300005437 Ga0070710_10054896 Ga0070710_100548962 108
180 3300005437 Ga0070710_10137289 Ga0070710_101372892 108
181 3300005437 Ga0070710_10575681 Ga0070710_105756812 108
182 3300005438 Ga0070701_10050806 Ga0070701_100508062 108
183 3300005438 Ga0070701_10180130 Ga0070701_101801302 108
184 3300005439 Ga0070711_100058958 Ga0070711_1000589582 108
185 3300005439 Ga0070711_100114078 Ga0070711_1001140782 108
186 3300005439 Ga0070711_100120720 Ga0070711_1001207202 108
187 3300005439 Ga0070711_100667517 Ga0070711_1006675172 108
188 3300005440 Ga0070705_100066991 Ga0070705_1000669912 108
189 3300005440 Ga0070705_100693976 Ga0070705_1006939762 108
190 3300005441 Ga0070700_100013015 Ga0070700_1000130152 108
191 3300005441 Ga0070700_100050670 Ga0070700_1000506702 108
192 3300005441 Ga0070700_101417456 Ga0070700_1014174561 108
193 3300005444 Ga0070694_100462746 Ga0070694_1004627462 108
194 3300005445 Ga0070708_100000052 Ga0070708_10000005235 108
195 3300005445 Ga0070708_100024403 Ga0070708_1000244032 108
196 3300005455 Ga0070663_100235336 Ga0070663_1002353361 108
197 3300005455 Ga0070663_100498187 Ga0070663_1004981872 108
198 3300005456 Ga0070678_100292728 Ga0070678_1002927282 108
199 3300005456 Ga0070678_100296420 Ga0070678_1002964202 108
200 3300005456 Ga0070678_100314249 Ga0070678_1003142492 108
201 3300005456 Ga0070678_100316355 Ga0070678_1003163551 108
202 3300005457 Ga0070662_100008330 Ga0070662_1000083306 108
203 3300005457 Ga0070662_100173805 Ga0070662_1001738052 108
204 3300005457 Ga0070662_100205960 Ga0070662_1002059601 108
205 3300005457 Ga0070662_100468017 Ga0070662_1004680172 108
206 3300005457 Ga0070662_101056835 Ga0070662_1010568351 108
207 3300005457 Ga0070662_101156452 Ga0070662_1011564522 108
208 3300005458 Ga0070681_10003936 Ga0070681_1000393610 108
209 3300005458 Ga0070681_10020038 Ga0070681_100200384 108
210 3300005458 Ga0070681_10024189 Ga0070681_100241894 108
211 3300005458 Ga0070681_10050350 Ga0070681_100503501 108
212 3300005458 Ga0070681_10069385 Ga0070681_100693852 108
213 3300005458 Ga0070681_10094324 Ga0070681_100943242 108
214 3300005458 Ga0070681_10130145 Ga0070681_101301452 108
215 3300005458 Ga0070681_10135395 Ga0070681_101353952 108
216 3300005458 Ga0070681_10194812 Ga0070681_101948121 108
217 3300005458 Ga0070681_10270851 Ga0070681_102708512 108
218 3300005458 Ga0070681_10330210 Ga0070681_103302102 108
219 3300005458 Ga0070681_10500778 Ga0070681_105007782 108
220 3300005458 Ga0070681_10545900 Ga0070681_105459001 108
221 3300005458 Ga0070681_10955780 Ga0070681_109557802 108
222 3300005459 Ga0068867_100008139 Ga0068867_1000081392 108
223 3300005459 Ga0068867_100012109 Ga0068867_1000121095 108
224 3300005459 Ga0068867_100130377 Ga0068867_1001303772 108
225 3300005459 Ga0068867_100385066 Ga0068867_1003850662 108
226 3300005459 Ga0068867_100741665 Ga0068867_1007416652 108
227 3300005459 Ga0068867_100816135 Ga0068867_1008161351 108
228 3300005466 Ga0070685_10003117 Ga0070685_100031178 108
229 3300005466 Ga0070685_10183504 Ga0070685_101835042 108
230 3300005466 Ga0070685_10716659 Ga0070685_107166591 108
231 3300005467 Ga0070706_100042852 Ga0070706_1000428522 108
232 3300005468 Ga0070707_100000643 Ga0070707_10000064313 108
233 3300005468 Ga0070707_100236903 Ga0070707_1002369032 108
234 3300005471 Ga0070698_100009811 Ga0070698_1000098112 108
235 3300005471 Ga0070698_100028422 Ga0070698_1000284222 108
236 3300005518 Ga0070699_100245948 Ga0070699_1002459482 108
237 3300005518 Ga0070699_100336117 Ga0070699_1003361172 108
238 3300005518 Ga0070699_101645283 Ga0070699_1016452831 108
239 3300005518 Ga0070699_101667295 Ga0070699_1016672952 108
240 3300005530 Ga0070679_100003394 Ga0070679_1000033943 108
241 3300005530 Ga0070679_100003861 Ga0070679_10000386111 108
242 3300005530 Ga0070679_100017456 Ga0070679_1000174564 108
243 3300005530 Ga0070679_100049707 Ga0070679_1000497073 108
244 3300005530 Ga0070679_100082512 Ga0070679_1000825122 108
245 3300005530 Ga0070679_100099210 Ga0070679_1000992102 108
246 3300005530 Ga0070679_100215162 Ga0070679_1002151622 108
247 3300005530 Ga0070679_100340595 Ga0070679_1003405952 108
248 3300005530 Ga0070679_100578209 Ga0070679_1005782092 108
249 3300005530 Ga0070679_101511434 Ga0070679_1015114342 108
250 3300005535 Ga0070684_100057265 Ga0070684_1000572652 108
251 3300005535 Ga0070684_100087437 Ga0070684_1000874372 108
252 3300005535 Ga0070684_100155228 Ga0070684_1001552282 108
253 3300005535 Ga0070684_100182497 Ga0070684_1001824972 108
254 3300005535 Ga0070684_100223557 Ga0070684_1002235572 108
255 3300005535 Ga0070684_100246373 Ga0070684_1002463732 108
256 3300005535 Ga0070684_100303441 Ga0070684_1003034412 108
257 3300005535 Ga0070684_100405278 Ga0070684_1004052782 108
258 3300005535 Ga0070684_100848453 Ga0070684_1008484531 108
259 3300005536 Ga0070697_100074322 Ga0070697_1000743222 108
260 3300005536 Ga0070697_100377698 Ga0070697_1003776982 108
261 3300005536 Ga0070697_100524534 Ga0070697_1005245342 108
262 3300005539 Ga0068853_100027617 Ga0068853_1000276174 108
263 3300005539 Ga0068853_100071151 Ga0068853_1000711516 108
264 3300005539 Ga0068853_100091088 Ga0068853_1000910882 108
265 3300005539 Ga0068853_100597056 Ga0068853_1005970561 108
266 3300005539 Ga0068853_100684860 Ga0068853_1006848602 108
267 3300005539 Ga0068853_100843861 Ga0068853_1008438612 108
268 3300005543 Ga0070672_100105013 Ga0070672_1001050132 108
269 3300005543 Ga0070672_100576571 Ga0070672_1005765711 108
270 3300005543 Ga0070672_100841269 Ga0070672_1008412692 108
271 3300005544 Ga0070686_100008268 Ga0070686_1000082684 108
272 3300005544 Ga0070686_100131025 Ga0070686_1001310251 108
273 3300005544 Ga0070686_100373207 Ga0070686_1003732072 108
274 3300005545 Ga0070695_100141978 Ga0070695_1001419781 108
275 3300005545 Ga0070695_100415760 Ga0070695_1004157602 108
276 3300005545 Ga0070695_101221112 Ga0070695_1012211121 108
277 3300005545 Ga0070695_101340101 Ga0070695_1013401011 108
278 3300005545 Ga0070695_101404959 Ga0070695_1014049592 108
279 3300005546 Ga0070696_100049164 Ga0070696_1000491643 108
280 3300005546 Ga0070696_100284293 Ga0070696_1002842932 108
281 3300005547 Ga0070693_100007204 Ga0070693_1000072043 108
282 3300005547 Ga0070693_100025640 Ga0070693_1000256403 108
283 3300005547 Ga0070693_100032154 Ga0070693_1000321541 108
284 3300005547 Ga0070693_100247100 Ga0070693_1002471002 108
285 3300005547 Ga0070693_101235547 Ga0070693_1012355471 108
286 3300005548 Ga0070665_100209656 Ga0070665_1002096562 108
287 3300005548 Ga0070665_100569362 Ga0070665_1005693622 108
288 3300005549 Ga0070704_100001406 Ga0070704_10000140611 108
289 3300005549 Ga0070704_100185771 Ga0070704_1001857712 108
290 3300005549 Ga0070704_100755220 Ga0070704_1007552202 108
291 3300005563 Ga0068855_100085188 Ga0068855_1000851884 108
292 3300005563 Ga0068855_100404286 Ga0068855_1004042861 108
293 3300005563 Ga0068855_100456070 Ga0068855_1004560702 108
294 3300005563 Ga0068855_100770010 Ga0068855_1007700102 108
295 3300005563 Ga0068855_101120927 Ga0068855_1011209272 108
296 3300005564 Ga0070664_100004031 Ga0070664_1000040317 108
297 3300005564 Ga0070664_100013879 Ga0070664_1000138792 108
298 3300005564 Ga0070664_100058883 Ga0070664_1000588833 108
299 3300005564 Ga0070664_100098246 Ga0070664_1000982462 108
300 3300005564 Ga0070664_100098708 Ga0070664_1000987082 108
301 3300005564 Ga0070664_100182242 Ga0070664_1001822422 108
302 3300005564 Ga0070664_100365465 Ga0070664_1003654652 108
303 3300005564 Ga0070664_100491257 Ga0070664_1004912572 108
304 3300005577 Ga0068857_100046264 Ga0068857_1000462642 108
305 3300005577 Ga0068857_100077827 Ga0068857_1000778272 108
306 3300005577 Ga0068857_100102261 Ga0068857_1001022613 108
307 3300005577 Ga0068857_100289006 Ga0068857_1002890062 108
308 3300005578 Ga0068854_100018923 Ga0068854_1000189234 108
309 3300005578 Ga0068854_100362766 Ga0068854_1003627661 108
310 3300005578 Ga0068854_101712607 Ga0068854_1017126071 108
311 3300005578 Ga0068854_102075721 Ga0068854_1020757211 108
312 3300005614 Ga0068856_100149755 Ga0068856_1001497552 108
313 3300005614 Ga0068856_100222314 Ga0068856_1002223142 108
314 3300005614 Ga0068856_100274959 Ga0068856_1002749592 108
315 3300005614 Ga0068856_100652536 Ga0068856_1006525362 108
316 3300005615 Ga0070702_100056169 Ga0070702_1000561692 108
317 3300005615 Ga0070702_101017779 Ga0070702_1010177792 108
318 3300005615 Ga0070702_101729340 Ga0070702_1017293401 108
319 3300005616 Ga0068852_100010321 Ga0068852_1000103215 108
320 3300005616 Ga0068852_100233500 Ga0068852_1002335001 108
321 3300005616 Ga0068852_100336698 Ga0068852_1003366981 108
322 3300005616 Ga0068852_100578659 Ga0068852_1005786592 108
323 3300005616 Ga0068852_100868465 Ga0068852_1008684652 108
324 3300005617 Ga0068859_100017750 Ga0068859_1000177502 108
325 3300005617 Ga0068859_101085031 Ga0068859_1010850312 108
326 3300005618 Ga0068864_100027372 Ga0068864_1000273723 108
327 3300005618 Ga0068864_100786077 Ga0068864_1007860771 108
328 3300005718 Ga0068866_10013098 Ga0068866_100130983 108
329 3300005718 Ga0068866_10044511 Ga0068866_100445112 108
330 3300005718 Ga0068866_10141985 Ga0068866_101419852 108
331 3300005718 Ga0068866_10250188 Ga0068866_102501881 108
332 3300005719 Ga0068861_100079007 Ga0068861_1000790073 108
333 3300005719 Ga0068861_101367312 Ga0068861_1013673121 108
334 3300005834 Ga0068851_10050614 Ga0068851_100506142 108
335 3300005834 Ga0068851_10312120 Ga0068851_103121202 108
336 3300005840 Ga0068870_10345028 Ga0068870_103450282 108
337 3300005840 Ga0068870_10471574 Ga0068870_104715742 108
338 3300005841 Ga0068863_100406915 Ga0068863_1004069152 108
339 3300005841 Ga0068863_100547734 Ga0068863_1005477342 108
340 3300005842 Ga0068858_100319274 Ga0068858_1003192743 108
341 3300005842 Ga0068858_100946854 Ga0068858_1009468541 108
342 3300005842 Ga0068858_100971426 Ga0068858_1009714262 108
343 3300005843 Ga0068860_100186028 Ga0068860_1001860282 108
344 3300005843 Ga0068860_100599681 Ga0068860_1005996812 108
345 3300005843 Ga0068860_100869795 Ga0068860_1008697952 108
346 3300005844 Ga0068862_100192108 Ga0068862_1001921082 108
347 3300005844 Ga0068862_101881280 Ga0068862_1018812801 108
348 3300005937 Ga0081455_10035968 Ga0081455_100359683 108
349 3300006028 Ga0070717_10007462 Ga0070717_100074625 108
350 3300006028 Ga0070717_10737134 Ga0070717_107371342 108
351 3300006163 Ga0070715_10107478 Ga0070715_101074782 108
352 3300006163 Ga0070715_10541740 Ga0070715_105417402 108
353 3300006173 Ga0070716_100006672 Ga0070716_1000066724 108
354 3300006173 Ga0070716_100094821 Ga0070716_1000948212 108
355 3300006175 Ga0070712_100005777 Ga0070712_1000057775 108
356 3300006175 Ga0070712_100023743 Ga0070712_1000237432 108
357 3300006175 Ga0070712_101192378 Ga0070712_1011923781 108
358 3300006237 Ga0097621_100267379 Ga0097621_1002673792 108
359 3300006237 Ga0097621_100534619 Ga0097621_1005346192 108
360 3300006358 Ga0068871_100301114 Ga0068871_1003011142 108
361 3300006844 Ga0075428_101175445 Ga0075428_1011754452 108
362 3300006846 Ga0075430_100021501 Ga0075430_1000215012 108
363 3300006847 Ga0075431_100016490 Ga0075431_1000164902 108
364 3300006852 Ga0075433_10010271 Ga0075433_100102713 108
365 3300006871 Ga0075434_100039783 Ga0075434_1000397833 108
366 3300006871 Ga0075434_101133376 Ga0075434_1011333762 108
367 3300006880 Ga0075429_100072380 Ga0075429_1000723802 108
368 3300006880 Ga0075429_100250269 Ga0075429_1002502692 108
369 3300006880 Ga0075429_101482720 Ga0075429_1014827201 108
370 3300006881 Ga0068865_100005690 Ga0068865_1000056902 108
371 3300006881 Ga0068865_100010439 Ga0068865_1000104395 108
372 3300006881 Ga0068865_100204855 Ga0068865_1002048552 108
373 3300006881 Ga0068865_100281149 Ga0068865_1002811492 108
374 3300006914 Ga0075436_100002007 Ga0075436_1000020076 108
375 3300006914 Ga0075436_100167953 Ga0075436_1001679532 108
376 3300006914 Ga0075436_100273491 Ga0075436_1002734912 108
377 3300006931 Ga0097620_100017750 Ga0097620_1000177506 108
378 3300006931 Ga0097620_101085015 Ga0097620_1010850152 108
379 3300007076 Ga0075435_100033886 Ga0075435_1000338863 108
380 3300007265 Ga0099794_10523512 Ga0099794_105235121 108
381 3300007788 Ga0099795_10524561 Ga0099795_105245611 108
382 3300009011 Ga0105251_10327025 Ga0105251_103270251 108
383 3300009093 Ga0105240_10151296 Ga0105240_101512962 108
384 3300009093 Ga0105240_10321288 Ga0105240_103212882 108
385 3300009093 Ga0105240_10456639 Ga0105240_104566392 108
386 3300009093 Ga0105240_11276642 Ga0105240_112766422 108
387 3300009093 Ga0105240_11635700 Ga0105240_116357002 108
388 3300009094 Ga0111539_10012567 Ga0111539_1001256711 108
389 3300009094 Ga0111539_10335657 Ga0111539_103356571 108
390 3300009094 Ga0111539_10629649 Ga0111539_106296492 108
391 3300009098 Ga0105245_10096938 Ga0105245_100969382 108
392 3300009098 Ga0105245_10146892 Ga0105245_101468922 108
393 3300009098 Ga0105245_10561164 Ga0105245_105611642 108
394 3300009098 Ga0105245_10626921 Ga0105245_106269213 108
395 3300009098 Ga0105245_10701329 Ga0105245_107013292 108
396 3300009098 Ga0105245_10742536 Ga0105245_107425361 108
397 3300009098 Ga0105245_11357541 Ga0105245_113575412 108
398 3300009098 Ga0105245_11632751 Ga0105245_116327512 108
399 3300009098 Ga0105245_11762046 Ga0105245_117620462 108
400 3300009101 Ga0105247_10919875 Ga0105247_109198752 108
401 3300009101 Ga0105247_10950365 Ga0105247_109503652 108
402 3300009147 Ga0114129_10019668 Ga0114129_100196685 108
403 3300009147 Ga0114129_10020805 Ga0114129_100208052 108
404 3300009147 Ga0114129_12553388 Ga0114129_125533881 108
405 3300009148 Ga0105243_10015680 Ga0105243_100156801 108
406 3300009148 Ga0105243_10393149 Ga0105243_103931492 108
407 3300009148 Ga0105243_10753810 Ga0105243_107538102 108
408 3300009148 Ga0105243_11217649 Ga0105243_112176492 108
409 3300009148 Ga0105243_12263281 Ga0105243_122632811 108
410 3300009174 Ga0105241_10513915 Ga0105241_105139152 108
411 3300009174 Ga0105241_10635622 Ga0105241_106356222 108
412 3300009174 Ga0105241_11194093 Ga0105241_111940932 108
413 3300009176 Ga0105242_10010910 Ga0105242_100109102 108
414 3300009176 Ga0105242_10192810 Ga0105242_101928101 108
415 3300009176 Ga0105242_10290095 Ga0105242_102900952 108
416 3300009176 Ga0105242_10646645 Ga0105242_106466451 108
417 3300009176 Ga0105242_10841769 Ga0105242_108417692 108
418 3300009176 Ga0105242_12469659 Ga0105242_124696591 108
419 3300009177 Ga0105248_10044271 Ga0105248_100442712 108
420 3300009177 Ga0105248_10324548 Ga0105248_103245482 108
421 3300009177 Ga0105248_11506402 Ga0105248_115064021 108
422 3300009545 Ga0105237_10208875 Ga0105237_102088752 108
423 3300009545 Ga0105237_10250893 Ga0105237_102508932 108
424 3300009551 Ga0105238_10049306 Ga0105238_100493062 108
425 3300009551 Ga0105238_10056335 Ga0105238_100563353 108
426 3300009551 Ga0105238_10182881 Ga0105238_101828812 108
427 3300009551 Ga0105238_10311252 Ga0105238_103112522 108
428 3300009551 Ga0105238_10910240 Ga0105238_109102402 108
429 3300009551 Ga0105238_12923427 Ga0105238_129234271 108
430 3300009553 Ga0105249_10000089 Ga0105249_1000008998 108
431 3300009553 Ga0105249_10149829 Ga0105249_101498293 108
432 3300009553 Ga0105249_10981614 Ga0105249_109816142 108
433 3300009553 Ga0105249_11554969 Ga0105249_115549692 108
434 3300010375 Ga0105239_10284303 Ga0105239_102843033 108
435 3300010375 Ga0105239_10977810 Ga0105239_109778101 108
436 3300010375 Ga0105239_11165921 Ga0105239_111659212 108
437 3300011119 Ga0105246_10495140 Ga0105246_104951402 108
438 3300013100 Ga0157373_10016738 Ga0157373_100167382 108
439 3300013100 Ga0157373_10112150 Ga0157373_101121502 108
440 3300013100 Ga0157373_10143744 Ga0157373_101437442 108
441 3300013100 Ga0157373_10162332 Ga0157373_101623322 108
442 3300013100 Ga0157373_10591317 Ga0157373_105913172 108
443 3300013102 Ga0157371_10771775 Ga0157371_107717751 108
444 3300013104 Ga0157370_10010939 Ga0157370_100109397 108
445 3300013104 Ga0157370_10047858 Ga0157370_100478582 108
446 3300013104 Ga0157370_10172146 Ga0157370_101721462 108
447 3300013104 Ga0157370_10238470 Ga0157370_102384701 108
448 3300013104 Ga0157370_10524279 Ga0157370_105242792 108
449 3300013104 Ga0157370_11147803 Ga0157370_111478032 108
450 3300013105 Ga0157369_10010715 Ga0157369_100107158 108
451 3300013105 Ga0157369_10086060 Ga0157369_100860602 108
452 3300013105 Ga0157369_10162045 Ga0157369_101620452 108
453 3300013105 Ga0157369_10231779 Ga0157369_102317792 108
454 3300013105 Ga0157369_10373059 Ga0157369_103730592 108
455 3300013105 Ga0157369_11100773 Ga0157369_111007732 108
456 3300013105 Ga0157369_11309560 Ga0157369_113095602 108
457 3300013105 Ga0157369_11393176 Ga0157369_113931761 108
458 3300013296 Ga0157374_10349551 Ga0157374_103495512 108
459 3300013296 Ga0157374_10460290 Ga0157374_104602902 108
460 3300013296 Ga0157374_10511377 Ga0157374_105113771 108
461 3300013296 Ga0157374_12239762 Ga0157374_122397621 108
462 3300013296 Ga0157374_12459476 Ga0157374_124594761 108
463 3300013297 Ga0157378_10008553 Ga0157378_100085533 108
464 3300013297 Ga0157378_10034272 Ga0157378_100342723 108
465 3300013297 Ga0157378_10080140 Ga0157378_100801402 108
466 3300013297 Ga0157378_10089406 Ga0157378_100894062 108
467 3300013297 Ga0157378_10774533 Ga0157378_107745332 108
468 3300013297 Ga0157378_10801761 Ga0157378_108017612 108
469 3300013297 Ga0157378_11165718 Ga0157378_111657182 108
470 3300013297 Ga0157378_11334252 Ga0157378_113342522 108
471 3300013306 Ga0163162_10045637 Ga0163162_100456373 108
472 3300013306 Ga0163162_10154799 Ga0163162_101547992 108
473 3300013306 Ga0163162_10216391 Ga0163162_102163912 108
474 3300013306 Ga0163162_10513608 Ga0163162_105136082 108
475 3300013306 Ga0163162_11307988 Ga0163162_113079882 108
476 3300013307 Ga0157372_10017516 Ga0157372_100175162 108
477 3300013307 Ga0157372_10123198 Ga0157372_101231982 108
478 3300013307 Ga0157372_10147826 Ga0157372_101478262 108
479 3300013307 Ga0157372_10163721 Ga0157372_101637212 108
480 3300013307 Ga0157372_10204408 Ga0157372_102044082 108
481 3300013307 Ga0157372_10228842 Ga0157372_102288422 108
482 3300013307 Ga0157372_10342416 Ga0157372_103424161 108
483 3300013307 Ga0157372_10519682 Ga0157372_105196821 108
484 3300013307 Ga0157372_10574289 Ga0157372_105742892 108
485 3300013307 Ga0157372_10840159 Ga0157372_108401592 108
486 3300013307 Ga0157372_12413639 Ga0157372_124136391 108
487 3300013308 Ga0157375_10078765 Ga0157375_100787653 108
488 3300013308 Ga0157375_10175123 Ga0157375_101751232 108
489 3300013308 Ga0157375_10275307 Ga0157375_102753072 108
490 3300013308 Ga0157375_10931717 Ga0157375_109317172 108
491 3300013308 Ga0157375_10931739 Ga0157375_109317392 108
492 3300013308 Ga0157375_11036773 Ga0157375_110367731 108
493 3300013308 Ga0157375_13616190 Ga0157375_136161901 108
494 3300014325 Ga0163163_10263428 Ga0163163_102634282 108
495 3300014325 Ga0163163_10372999 Ga0163163_103729992 108
496 3300014325 Ga0163163_12382349 Ga0163163_123823491 108
497 3300014326 Ga0157380_10415774 Ga0157380_104157741 108
498 3300014326 Ga0157380_11419676 Ga0157380_114196762 108
499 3300014497 Ga0182008_10011727 Ga0182008_100117272 108
500 3300014745 Ga0157377_10075373 Ga0157377_100753731 108
501 3300014745 Ga0157377_10155798 Ga0157377_101557982 108
502 3300014745 Ga0157377_11580836 Ga0157377_115808361 108
503 3300014968 Ga0157379_10375431 Ga0157379_103754312 108
504 3300014968 Ga0157379_10493113 Ga0157379_104931132 108
505 3300014969 Ga0157376_10430077 Ga0157376_104300772 108
506 3300014969 Ga0157376_10562482 Ga0157376_105624822 108
507 3300014969 Ga0157376_11447054 Ga0157376_114470541 108
508 3300015262 Ga0182007_10088522 Ga0182007_100885222 108
509 3300015262 Ga0182007_10294957 Ga0182007_102949572 108
510 3300015265 Ga0182005_1206177 Ga0182005_12061772 108
511 3300017792 Ga0163161_10155292 Ga0163161_101552922 108
512 3300017792 Ga0163161_10242091 Ga0163161_102420911 108
513 3300017792 Ga0163161_10987467 Ga0163161_109874672 108
514 3300020069 Ga0197907_10955397 Ga0197907_109553972 108
515 3300020070 Ga0206356_11089032 Ga0206356_110890321 108
516 3300020070 Ga0206356_11492485 Ga0206356_114924851 108
517 3300020070 Ga0206356_11542969 Ga0206356_115429691 108
518 3300020070 Ga0206356_11623018 Ga0206356_116230182 108
519 3300020070 Ga0206356_11860846 Ga0206356_118608461 108
520 3300020075 Ga0206349_1530089 Ga0206349_15300891 108
521 3300020076 Ga0206355_1078973 Ga0206355_10789732 108
522 3300020076 Ga0206355_1723175 Ga0206355_17231751 108
523 3300020077 Ga0206351_10189109 Ga0206351_101891091 108
524 3300020077 Ga0206351_10372331 Ga0206351_103723311 108
525 3300020078 Ga0206352_11216042 Ga0206352_112160422 108
526 3300020080 Ga0206350_10333601 Ga0206350_103336011 108
527 3300020080 Ga0206350_11441145 Ga0206350_114411452 108
528 3300020081 Ga0206354_10426956 Ga0206354_104269562 108
529 3300020082 Ga0206353_10538341 Ga0206353_105383411 108
530 3300020082 Ga0206353_11659228 Ga0206353_116592281 108
531 3300022467 Ga0224712_10194356 Ga0224712_101943562 108
532 3300022467 Ga0224712_10225657 Ga0224712_102256571 108
533 3300025315 Ga0207697_10020771 Ga0207697_100207713 108
534 3300025315 Ga0207697_10036882 Ga0207697_100368821 108
535 3300025321 Ga0207656_10129576 Ga0207656_101295762 108
536 3300025885 Ga0207653_10020217 Ga0207653_100202172 108
537 3300025893 Ga0207682_10014329 Ga0207682_100143292 108
538 3300025893 Ga0207682_10481367 Ga0207682_104813671 108
539 3300025898 Ga0207692_10057750 Ga0207692_100577502 108
540 3300025898 Ga0207692_10448935 Ga0207692_104489351 108
541 3300025899 Ga0207642_10032962 Ga0207642_100329622 108
542 3300025899 Ga0207642_10738894 Ga0207642_107388942 108
543 3300025901 Ga0207688_10113594 Ga0207688_101135942 108
544 3300025901 Ga0207688_11069656 Ga0207688_110696561 108
545 3300025903 Ga0207680_10243756 Ga0207680_102437562 108
546 3300025903 Ga0207680_10327665 Ga0207680_103276652 108
547 3300025906 Ga0207699_10054995 Ga0207699_100549952 108
548 3300025906 Ga0207699_10172457 Ga0207699_101724572 108
549 3300025906 Ga0207699_10624334 Ga0207699_106243341 108
550 3300025906 Ga0207699_11020881 Ga0207699_110208811 108
551 3300025907 Ga0207645_10016651 Ga0207645_100166515 108
552 3300025907 Ga0207645_10029906 Ga0207645_100299062 108
553 3300025907 Ga0207645_10095771 Ga0207645_100957712 108
554 3300025907 Ga0207645_10232199 Ga0207645_102321992 108
555 3300025907 Ga0207645_10323857 Ga0207645_103238572 108
556 3300025907 Ga0207645_11185611 Ga0207645_111856111 108
557 3300025908 Ga0207643_10012554 Ga0207643_100125542 108
558 3300025908 Ga0207643_10317851 Ga0207643_103178511 108
559 3300025909 Ga0207705_10603160 Ga0207705_106031601 108
560 3300025910 Ga0207684_10031189 Ga0207684_100311892 108
561 3300025910 Ga0207684_10103621 Ga0207684_101036212 108
562 3300025911 Ga0207654_10572295 Ga0207654_105722952 108
563 3300025911 Ga0207654_10982222 Ga0207654_109822221 108
564 3300025912 Ga0207707_10014574 Ga0207707_100145745 108
565 3300025912 Ga0207707_10015856 Ga0207707_100158563 108
566 3300025912 Ga0207707_10059039 Ga0207707_100590392 108
567 3300025912 Ga0207707_10065914 Ga0207707_100659143 108
568 3300025912 Ga0207707_10146842 Ga0207707_101468422 108
569 3300025912 Ga0207707_10166288 Ga0207707_101662882 108
570 3300025912 Ga0207707_10396764 Ga0207707_103967642 108
571 3300025912 Ga0207707_10425247 Ga0207707_104252472 108
572 3300025912 Ga0207707_10436192 Ga0207707_104361922 108
573 3300025912 Ga0207707_10714939 Ga0207707_107149391 108
574 3300025912 Ga0207707_11646177 Ga0207707_116461771 108
575 3300025913 Ga0207695_10006890 Ga0207695_1000689013 108
576 3300025913 Ga0207695_10028752 Ga0207695_100287525 108
577 3300025913 Ga0207695_10123495 Ga0207695_101234952 108
578 3300025913 Ga0207695_10235955 Ga0207695_102359552 108
579 3300025914 Ga0207671_10344576 Ga0207671_103445762 108
580 3300025915 Ga0207693_10008333 Ga0207693_100083335 108
581 3300025915 Ga0207693_10613632 Ga0207693_106136322 108
582 3300025915 Ga0207693_11287376 Ga0207693_112873761 108
583 3300025916 Ga0207663_10266806 Ga0207663_102668062 108
584 3300025916 Ga0207663_11719895 Ga0207663_117198951 108
585 3300025917 Ga0207660_10000818 Ga0207660_1000081816 108
586 3300025917 Ga0207660_10033905 Ga0207660_100339052 108
587 3300025917 Ga0207660_10059970 Ga0207660_100599702 108
588 3300025917 Ga0207660_10092736 Ga0207660_100927362 108
589 3300025917 Ga0207660_10211015 Ga0207660_102110153 108
590 3300025917 Ga0207660_10218929 Ga0207660_102189291 108
591 3300025917 Ga0207660_10278600 Ga0207660_102786002 108
592 3300025917 Ga0207660_11170159 Ga0207660_111701592 108
593 3300025918 Ga0207662_10003539 Ga0207662_100035395 108
594 3300025918 Ga0207662_10004466 Ga0207662_100044666 108
595 3300025919 Ga0207657_10038882 Ga0207657_100388823 108
596 3300025919 Ga0207657_10111500 Ga0207657_101115002 108
597 3300025919 Ga0207657_10148321 Ga0207657_101483212 108
598 3300025920 Ga0207649_10355685 Ga0207649_103556851 108
599 3300025920 Ga0207649_10398525 Ga0207649_103985252 108
600 3300025920 Ga0207649_10711865 Ga0207649_107118652 108
601 3300025920 Ga0207649_11045494 Ga0207649_110454942 108
602 3300025921 Ga0207652_10021476 Ga0207652_100214764 108
603 3300025921 Ga0207652_10086905 Ga0207652_100869053 108
604 3300025921 Ga0207652_10103796 Ga0207652_101037962 108
605 3300025921 Ga0207652_10197638 Ga0207652_101976382 108
606 3300025921 Ga0207652_10314431 Ga0207652_103144311 108
607 3300025921 Ga0207652_10325978 Ga0207652_103259782 108
608 3300025921 Ga0207652_10335387 Ga0207652_103353872 108
609 3300025921 Ga0207652_10375658 Ga0207652_103756582 108
610 3300025921 Ga0207652_10454275 Ga0207652_104542751 108
611 3300025922 Ga0207646_10004321 Ga0207646_1000432113 108
612 3300025922 Ga0207646_10013479 Ga0207646_100134793 108
613 3300025923 Ga0207681_10002415 Ga0207681_1000241512 108
614 3300025923 Ga0207681_10013977 Ga0207681_100139774 108
615 3300025923 Ga0207681_10440455 Ga0207681_104404551 108
616 3300025924 Ga0207694_10017770 Ga0207694_100177703 108
617 3300025924 Ga0207694_10017815 Ga0207694_100178151 108
618 3300025924 Ga0207694_10041334 Ga0207694_100413343 108
619 3300025924 Ga0207694_10137989 Ga0207694_101379892 108
620 3300025924 Ga0207694_10971835 Ga0207694_109718351 108
621 3300025925 Ga0207650_10173797 Ga0207650_101737971 108
622 3300025925 Ga0207650_10210181 Ga0207650_102101812 108
623 3300025925 Ga0207650_10954928 Ga0207650_109549281 108
624 3300025926 Ga0207659_10007815 Ga0207659_100078155 108
625 3300025926 Ga0207659_10106456 Ga0207659_101064562 108
626 3300025926 Ga0207659_10440069 Ga0207659_104400692 108
627 3300025926 Ga0207659_10460170 Ga0207659_104601702 108
628 3300025926 Ga0207659_10492158 Ga0207659_104921582 108
629 3300025927 Ga0207687_10086323 Ga0207687_100863232 108
630 3300025927 Ga0207687_10099200 Ga0207687_100992002 108
631 3300025927 Ga0207687_10163444 Ga0207687_101634442 108
632 3300025927 Ga0207687_10494852 Ga0207687_104948521 108
633 3300025927 Ga0207687_10889106 Ga0207687_108891061 108
634 3300025928 Ga0207700_10000773 Ga0207700_100007733 108
635 3300025928 Ga0207700_10799452 Ga0207700_107994522 108
636 3300025929 Ga0207664_10014780 Ga0207664_100147802 108
637 3300025929 Ga0207664_10083531 Ga0207664_100835312 108
638 3300025929 Ga0207664_10174502 Ga0207664_101745022 108
639 3300025929 Ga0207664_10242750 Ga0207664_102427502 108
640 3300025929 Ga0207664_10673104 Ga0207664_106731041 108
641 3300025931 Ga0207644_10074312 Ga0207644_100743121 108
642 3300025931 Ga0207644_10139062 Ga0207644_101390622 108
643 3300025931 Ga0207644_10237320 Ga0207644_102373202 108
644 3300025931 Ga0207644_11294695 Ga0207644_112946951 108
645 3300025931 Ga0207644_11539021 Ga0207644_115390212 108
646 3300025931 Ga0207644_11616957 Ga0207644_116169572 108
647 3300025931 Ga0207644_11708123 Ga0207644_117081231 108
648 3300025932 Ga0207690_10155854 Ga0207690_101558542 108
649 3300025932 Ga0207690_10263098 Ga0207690_102630982 108
650 3300025932 Ga0207690_10725305 Ga0207690_107253051 108
651 3300025932 Ga0207690_11348961 Ga0207690_113489611 108
652 3300025933 Ga0207706_10008341 Ga0207706_100083416 108
653 3300025933 Ga0207706_10198599 Ga0207706_101985992 108
654 3300025933 Ga0207706_10328157 Ga0207706_103281571 108
655 3300025933 Ga0207706_10451175 Ga0207706_104511751 108
656 3300025934 Ga0207686_10130616 Ga0207686_101306162 108
657 3300025935 Ga0207709_10238216 Ga0207709_102382162 108
658 3300025935 Ga0207709_10617346 Ga0207709_106173461 108
659 3300025935 Ga0207709_10747699 Ga0207709_107476992 108
660 3300025936 Ga0207670_10023378 Ga0207670_100233783 108
661 3300025936 Ga0207670_10547655 Ga0207670_105476552 108
662 3300025936 Ga0207670_11297989 Ga0207670_112979891 108
663 3300025937 Ga0207669_10098019 Ga0207669_100980192 108
664 3300025937 Ga0207669_10187364 Ga0207669_101873642 108
665 3300025938 Ga0207704_10002383 Ga0207704_100023832 108
666 3300025938 Ga0207704_10243064 Ga0207704_102430642 108
667 3300025938 Ga0207704_10972910 Ga0207704_109729102 108
668 3300025939 Ga0207665_10000466 Ga0207665_100004666 108
669 3300025939 Ga0207665_10195005 Ga0207665_101950051 108
670 3300025939 Ga0207665_10446952 Ga0207665_104469522 108
671 3300025939 Ga0207665_10990476 Ga0207665_109904761 108
672 3300025940 Ga0207691_10027348 Ga0207691_100273485 108
673 3300025940 Ga0207691_10041030 Ga0207691_100410305 108
674 3300025940 Ga0207691_10164568 Ga0207691_101645682 108
675 3300025940 Ga0207691_10326229 Ga0207691_103262292 108
676 3300025940 Ga0207691_10638468 Ga0207691_106384682 108
677 3300025940 Ga0207691_11637636 Ga0207691_116376361 108
678 3300025941 Ga0207711_10047601 Ga0207711_100476012 108
679 3300025941 Ga0207711_10213627 Ga0207711_102136271 108
680 3300025944 Ga0207661_10033051 Ga0207661_100330512 108
681 3300025944 Ga0207661_10079709 Ga0207661_100797092 108
682 3300025944 Ga0207661_10152230 Ga0207661_101522302 108
683 3300025944 Ga0207661_10258574 Ga0207661_102585742 108
684 3300025944 Ga0207661_10306176 Ga0207661_103061762 108
685 3300025944 Ga0207661_10402411 Ga0207661_104024112 108
686 3300025944 Ga0207661_10436894 Ga0207661_104368942 108
687 3300025944 Ga0207661_10453001 Ga0207661_104530012 108
688 3300025944 Ga0207661_10498764 Ga0207661_104987641 108
689 3300025944 Ga0207661_10894206 Ga0207661_108942062 108
690 3300025944 Ga0207661_10943943 Ga0207661_109439432 108
691 3300025944 Ga0207661_10992203 Ga0207661_109922031 108
692 3300025944 Ga0207661_11019028 Ga0207661_110190282 108
693 3300025944 Ga0207661_11786700 Ga0207661_117867002 108
694 3300025944 Ga0207661_11909820 Ga0207661_119098201 108
695 3300025945 Ga0207679_10172202 Ga0207679_101722022 108
696 3300025945 Ga0207679_10269921 Ga0207679_102699212 108
697 3300025945 Ga0207679_10470072 Ga0207679_104700722 108
698 3300025945 Ga0207679_10767680 Ga0207679_107676802 108
699 3300025945 Ga0207679_10802003 Ga0207679_108020032 108
700 3300025945 Ga0207679_11181746 Ga0207679_111817461 108
701 3300025949 Ga0207667_10173101 Ga0207667_101731012 108
702 3300025949 Ga0207667_10406468 Ga0207667_104064683 108
703 3300025949 Ga0207667_11058113 Ga0207667_110581131 108
704 3300025960 Ga0207651_10017001 Ga0207651_100170013 108
705 3300025960 Ga0207651_10883538 Ga0207651_108835381 108
706 3300025960 Ga0207651_11242957 Ga0207651_112429572 108
707 3300025960 Ga0207651_11875001 Ga0207651_118750011 108
708 3300025961 Ga0207712_10000403 Ga0207712_1000040332 108
709 3300025961 Ga0207712_10550917 Ga0207712_105509172 108
710 3300025961 Ga0207712_11225899 Ga0207712_112258991 108
711 3300025972 Ga0207668_10009579 Ga0207668_100095796 108
712 3300025972 Ga0207668_10159003 Ga0207668_101590032 108
713 3300025981 Ga0207640_10076568 Ga0207640_100765682 108
714 3300025981 Ga0207640_10127247 Ga0207640_101272472 108
715 3300025981 Ga0207640_10836713 Ga0207640_108367132 108
716 3300025981 Ga0207640_10837834 Ga0207640_108378341 108
717 3300025981 Ga0207640_11570828 Ga0207640_115708282 108
718 3300025986 Ga0207658_10161741 Ga0207658_101617411 108
719 3300025986 Ga0207658_10298313 Ga0207658_102983131 108
720 3300025986 Ga0207658_10545267 Ga0207658_105452671 108
721 3300026023 Ga0207677_10004927 Ga0207677_100049274 108
722 3300026023 Ga0207677_10323075 Ga0207677_103230752 108
723 3300026023 Ga0207677_10686557 Ga0207677_106865572 108
724 3300026023 Ga0207677_11115775 Ga0207677_111157751 108
725 3300026035 Ga0207703_10261828 Ga0207703_102618281 108
726 3300026035 Ga0207703_10324696 Ga0207703_103246961 108
727 3300026041 Ga0207639_10006980 Ga0207639_100069805 108
728 3300026041 Ga0207639_10092619 Ga0207639_100926192 108
729 3300026041 Ga0207639_10472752 Ga0207639_104727522 108
730 3300026041 Ga0207639_10652957 Ga0207639_106529572 108
731 3300026067 Ga0207678_10076175 Ga0207678_100761752 108
732 3300026067 Ga0207678_10183539 Ga0207678_101835392 108
733 3300026067 Ga0207678_10573108 Ga0207678_105731082 108
734 3300026067 Ga0207678_10918209 Ga0207678_109182092 108
735 3300026075 Ga0207708_10006225 Ga0207708_100062256 108
736 3300026075 Ga0207708_10019142 Ga0207708_100191424 108
737 3300026075 Ga0207708_10670505 Ga0207708_106705052 108
738 3300026075 Ga0207708_10936986 Ga0207708_109369862 108
739 3300026078 Ga0207702_10089912 Ga0207702_100899122 108
740 3300026078 Ga0207702_10406375 Ga0207702_104063752 108
741 3300026078 Ga0207702_10704189 Ga0207702_107041892 108
742 3300026078 Ga0207702_11896634 Ga0207702_118966342 108
743 3300026088 Ga0207641_10524299 Ga0207641_105242992 108
744 3300026089 Ga0207648_10017109 Ga0207648_100171093 108
745 3300026089 Ga0207648_10034209 Ga0207648_100342093 108
746 3300026089 Ga0207648_10076480 Ga0207648_100764803 108
747 3300026089 Ga0207648_10125655 Ga0207648_101256552 108
748 3300026089 Ga0207648_10145068 Ga0207648_101450682 108
749 3300026089 Ga0207648_10341086 Ga0207648_103410862 108
750 3300026089 Ga0207648_10455817 Ga0207648_104558172 108
751 3300026095 Ga0207676_10036095 Ga0207676_100360952 108
752 3300026095 Ga0207676_10223408 Ga0207676_102234082 108
753 3300026116 Ga0207674_10005615 Ga0207674_100056159 108
754 3300026116 Ga0207674_10014941 Ga0207674_100149412 108
755 3300026116 Ga0207674_10209381 Ga0207674_102093812 108
756 3300026116 Ga0207674_10306503 Ga0207674_103065032 108
757 3300026116 Ga0207674_10505316 Ga0207674_105053162 108
758 3300026118 Ga0207675_100366981 Ga0207675_1003669812 108
759 3300026121 Ga0207683_10012414 Ga0207683_100124143 108
760 3300026121 Ga0207683_10395115 Ga0207683_103951152 108
761 3300026121 Ga0207683_10405432 Ga0207683_104054322 108
762 3300026121 Ga0207683_11628457 Ga0207683_116284571 108
763 3300026142 Ga0207698_10027735 Ga0207698_100277353 108
764 3300026142 Ga0207698_10094497 Ga0207698_100944971 108
765 3300026142 Ga0207698_10153048 Ga0207698_101530482 108
766 3300026142 Ga0207698_10269601 Ga0207698_102696012 108
767 3300026142 Ga0207698_10284098 Ga0207698_102840982 108
768 3300026142 Ga0207698_10725673 Ga0207698_107256732 108
769 3300026142 Ga0207698_11145611 Ga0207698_111456111 108
770 3300026142 Ga0207698_11411028 Ga0207698_114110282 108
771 3300027378 Ga0209981_1013967 Ga0209981_10139672 108
772 3300027462 Ga0210000_1002573 Ga0210000_10025732 108
773 3300027543 Ga0209999_1002764 Ga0209999_10027642 108
774 3300027695 Ga0209966_1009819 Ga0209966_10098192 108
775 3300028379 Ga0268266_11214417 Ga0268266_112144172 108
776 3300028380 Ga0268265_10137082 Ga0268265_101370822 108
777 3300028381 Ga0268264_10406727 Ga0268264_104067271 108
778 3300030736 Ga0316180_1134937 Ga0316180_11349371 108
779 3300030745 Ga0316182_1362494 Ga0316182_13624941 108
780 3300031548 Ga0307408_100209033 Ga0307408_1002090332 108
781 3300031548 Ga0307408_101045005 Ga0307408_1010450052 108
782 3300031548 Ga0307408_102347908 Ga0307408_1023479081 108
783 3300031548 Ga0307408_102458346 Ga0307408_1024583461 108
784 3300031728 Ga0316578_10657619 Ga0316578_106576191 108
785 3300031731 Ga0307405_10015090 Ga0307405_100150903 108
786 3300031731 Ga0307405_10448704 Ga0307405_104487042 108
787 3300031731 Ga0307405_10801686 Ga0307405_108016861 108
788 3300031824 Ga0307413_10099233 Ga0307413_100992332 108
789 3300031824 Ga0307413_10412579 Ga0307413_104125792 108
790 3300031852 Ga0307410_10077786 Ga0307410_100777862 108
791 3300031852 Ga0307410_10140438 Ga0307410_101404382 108
792 3300031852 Ga0307410_10202544 Ga0307410_102025441 108
793 3300031852 Ga0307410_10339023 Ga0307410_103390232 108
794 3300031901 Ga0307406_10041009 Ga0307406_100410092 108
795 3300031901 Ga0307406_10050359 Ga0307406_100503592 108
796 3300031901 Ga0307406_11301176 Ga0307406_113011761 108
797 3300031901 Ga0307406_11639798 Ga0307406_116397982 108
798 3300031903 Ga0307407_10129073 Ga0307407_101290732 108
799 3300031903 Ga0307407_10342139 Ga0307407_103421392 108
800 3300031903 Ga0307407_10573274 Ga0307407_105732742 108
801 3300031911 Ga0307412_10157309 Ga0307412_101573092 108
802 3300031995 Ga0307409_100052967 Ga0307409_1000529672 108
803 3300031995 Ga0307409_100256825 Ga0307409_1002568252 108
804 3300031995 Ga0307409_100737466 Ga0307409_1007374661 108
805 3300031995 Ga0307409_101015184 Ga0307409_1010151842 108
806 3300032002 Ga0307416_100102135 Ga0307416_1001021352 108
807 3300032002 Ga0307416_100331187 Ga0307416_1003311871 108
808 3300032002 Ga0307416_100699242 Ga0307416_1006992422 108
809 3300032002 Ga0307416_101367355 Ga0307416_1013673551 108
810 3300032004 Ga0307414_10154256 Ga0307414_101542561 108
811 3300032004 Ga0307414_10588620 Ga0307414_105886202 108
812 3300032004 Ga0307414_11835712 Ga0307414_118357121 108
813 3300032005 Ga0307411_10044355 Ga0307411_100443552 108
814 3300032005 Ga0307411_10297372 Ga0307411_102973722 108
815 3300032005 Ga0307411_10420843 Ga0307411_104208432 108
816 3300032005 Ga0307411_10903345 Ga0307411_109033451 108
817 3300032126 Ga0307415_100086437 Ga0307415_1000864372 108
818 3300032126 Ga0307415_101057629 Ga0307415_1010576292 108
819 3300034817 Ga0373948_0008842 Ga0373948_0008842_545_901 108
820 3300035083 Ga0373926_0084345 Ga0373926_0084345_105_452 108
821 3300035086 Ga0373934_0000463 Ga0373934_0000463_3753_4100 108
822 3300035089 Ga0373944_0036358 Ga0373944_0036358_519_866 108
823 3300035090 Ga0373949_0023357 Ga0373949_0023357_1010_1336 108
824 3300035091 Ga0373951_0110682 Ga0373951_0110682_15_371 108
825 3300035111 Ga0373923_0001722 Ga0373923_0001722_428_775 108
826 3300035113 Ga0373936_0054724 Ga0373936_0054724_459_806 108
827 3300035115 Ga0373941_0011511 Ga0373941_0011511_1387_1743 108
828 3300035116 Ga0373945_0005281 Ga0373945_0005281_2134_2481 108
829 3300035117 Ga0373953_0022490 Ga0373953_0022490_1228_1575 108
830 3300035118 Ga0373954_0065865 Ga0373954_0065865_903_1250 108
831 3300035119 Ga0373956_0000644 Ga0373956_0000644_11890_12237 108
832 3300035120 Ga0373957_0025840 Ga0373957_0025840_974_1321 108
833 3300035120 Ga0373957_0238908 Ga0373957_0238908_242_643 108
834 3300035121 Ga0373960_0321557 Ga0373960_0321557_103_459 108
835 3300035170 Ga0373943_0000618 Ga0373943_0000618_3515_3862 108
836 3300035171 Ga0373946_0035605 Ga0373946_0035605_512_859 108
837 3300035172 Ga0373955_0009773 Ga0373955_0009773_1674_2021 108
838 3300035172 Ga0373955_0331780 Ga0373955_0331780_334_690 108
839 3300035241 Ga0373961_0368125 Ga0373961_0368125_95_451 108
840 3300035691 Ga0373931_0110974 Ga0373931_0110974_857_1213 108
841 3300035691 Ga0373931_0858534 Ga0373931_0858534_110_457 108
842 3300035691 Ga0373931_1220283 Ga0373931_1220283_65_466 108
843 3300035692 Ga0373935_0001230 Ga0373935_0001230_3189_3536 108
844 3300035695 Ga0373927_0010997 Ga0373927_0010997_1739_2086 108
845 3300035695 Ga0373927_0113627 Ga0373927_0113627_877_1224 108
846 3300035724 Ga0373933_0004688 Ga0373933_0004688_3752_4099 108
847 3300035725 Ga0373947_0000019 Ga0373947_0000019_55996_56343 108
848 3300036401 Ga0373937_0000142 Ga0373937_0000142_56555_56902 108
849 3300036401 Ga0373937_1416903 Ga0373937_1416903_119_475 108
850 3300036647 Ga0316582_0172303 Ga0316582_0172303_196_558 108
851 3300037068 Ga0373925_0000303 Ga0373925_0000303_31363_31710 108
852 3300037418 Ga0395900_0547098 Ga0395900_0547098_590_916 108
853 3300037471 Ga0395905_0054759 Ga0395905_0054759_1179_1535 108
854 3300037471 Ga0395905_0602041 Ga0395905_0602041_411_812 108
855 3300038443 Ga0395901_1036988 Ga0395901_1036988_243_590 108
856 3300038996 Ga0242420_023461 Ga0242420_023461_699_1055 108
857 3300039437 Ga0436365_0141229 Ga0436365_0141229_1734_2090 108
858 3300039437 Ga0436365_1138491 Ga0436365_1138491_442_798 108
859 3300041496 Ga0451839_0967978 Ga0451839_0967978_183_539 108
860 3300041512 Ga0451853_1892066 Ga0451853_1892066_111_467 108
861 3300041512 Ga0451853_3935002 Ga0451853_3935002_674_1030 108
862 3300044684 Ga0466966_0192934 Ga0466966_0192934_816_1163 108
863 3300044694 Ga0466963_0289789 Ga0466963_0289789_742_1098 108
864 3300044694 Ga0466963_0749985 Ga0466963_0749985_31_378 108
865 3300044694 Ga0466963_0777870 Ga0466963_0777870_279_635 108
866 3300044706 Ga0466964_0470530 Ga0466964_0470530_151_507 108
867 3300045049 Ga0466959_0145435 Ga0466959_0145435_993_1340 108
868 3300045836 Ga0466958_0083501 Ga0466958_0083501_356_712 108
869 3300045836 Ga0466958_0088156 Ga0466958_0088156_1413_1760 108
870 3300045836 Ga0466958_0201449 Ga0466958_0201449_20_367 108
871 3300045976 Ga0466967_0269257 Ga0466967_0269257_774_1121 108
872 3300045976 Ga0466967_0799220 Ga0466967_0799220_334_690 108
873 3300045976 Ga0466967_1200499 Ga0466967_1200499_360_716 108
874 3300045976 Ga0466967_1347879 Ga0466967_1347879_269_616 108
875 3300046454 Ga0495592_0026016 Ga0495592_0026016_3353_3700 108
876 3300046454 Ga0495592_0602698 Ga0495592_0602698_233_589 108
877 3300046462 Ga0495651_0000723 Ga0495651_0000723_5117_5464 108
878 3300046462 Ga0495651_0580264 Ga0495651_0580264_189_545 108
879 3300046462 Ga0495651_0795701 Ga0495651_0795701_201_557 108
880 3300046462 Ga0495651_0885881 Ga0495651_0885881_138_494 108
881 3300046463 Ga0495653_0003352 Ga0495653_0003352_2241_2588 108
882 3300046472 Ga0495580_0000426 Ga0495580_0000426_27662_28009 108
883 3300046473 Ga0495582_0000045 Ga0495582_0000045_42541_42888 108
884 3300046475 Ga0495639_0000403 Ga0495639_0000403_11939_12286 108
885 3300046475 Ga0495639_0286260 Ga0495639_0286260_261_617 108
886 3300046476 Ga0495662_0392431 Ga0495662_0392431_187_543 108
887 3300046477 Ga0495664_0569994 Ga0495664_0569994_37_393 108
888 3300046499 Ga0495594_0075984 Ga0495594_0075984_622_969 108
889 3300046499 Ga0495594_0477202 Ga0495594_0477202_119_445 108
890 3300046511 Ga0495608_0002935 Ga0495608_0002935_6169_6516 108
891 3300046511 Ga0495608_0032534 Ga0495608_0032534_3016_3372 108
892 3300046511 Ga0495608_0184800 Ga0495608_0184800_157_513 108
893 3300046514 Ga0495618_0333188 Ga0495618_0333188_455_811 108
894 3300046516 Ga0495628_0000674 Ga0495628_0000674_7856_8203 108
895 3300046517 Ga0495630_0003749 Ga0495630_0003749_9885_10232 108
896 3300046517 Ga0495630_0012293 Ga0495630_0012293_5162_5509 108
897 3300046517 Ga0495630_0077935 Ga0495630_0077935_1907_2263 108
898 3300046517 Ga0495630_0217970 Ga0495630_0217970_233_589 108
899 3300046522 Ga0495643_0064527 Ga0495643_0064527_1024_1380 108
900 3300046525 Ga0495663_0118759 Ga0495663_0118759_491_847 108
901 3300046525 Ga0495663_0174665 Ga0495663_0174665_223_624 108
902 3300046526 Ga0495666_0500949 Ga0495666_0500949_30_356 108
903 3300046529 Ga0495652_0017042 Ga0495652_0017042_1624_1971 108
904 3300046529 Ga0495652_0353847 Ga0495652_0353847_543_899 108
905 3300046529 Ga0495652_0856079 Ga0495652_0856079_173_529 108
906 3300046531 Ga0495665_0000014 Ga0495665_0000014_29257_29604 108
907 3300046531 Ga0495665_0012549 Ga0495665_0012549_4182_4529 108
908 3300046531 Ga0495665_0608461 Ga0495665_0608461_71_397 108
909 3300046533 Ga0495640_0103343 Ga0495640_0103343_425_781 108
910 3300046535 Ga0495586_0247767 Ga0495586_0247767_59_415 108
911 3300046536 Ga0495587_0000899 Ga0495587_0000899_12015_12362 108
912 3300046536 Ga0495587_0033174 Ga0495587_0033174_526_882 108
913 3300046537 Ga0495598_0060196 Ga0495598_0060196_729_1073 108
914 3300046539 Ga0495621_0132701 Ga0495621_0132701_302_703 108
915 3300046543 Ga0495645_0000642 Ga0495645_0000642_20516_20863 108
916 3300046543 Ga0495645_0197509 Ga0495645_0197509_852_1208 108
917 3300046543 Ga0495645_0399672 Ga0495645_0399672_429_785 108
918 3300046543 Ga0495645_0947848 Ga0495645_0947848_35_391 108
919 3300046557 Ga0495622_0296356 Ga0495622_0296356_83_430 108
920 3300046559 Ga0495667_0000783 Ga0495667_0000783_10506_10853 108
921 3300046559 Ga0495667_0500999 Ga0495667_0500999_297_653 108
922 3300046559 Ga0495667_0829180 Ga0495667_0829180_131_532 108
923 3300046615 Ga0495656_0421325 Ga0495656_0421325_344_688 108
924 3300046642 Ga0495634_0167420 Ga0495634_0167420_149_505 108
925 3300046642 Ga0495634_0231004 Ga0495634_0231004_638_994 108
926 3300046663 Ga0495635_0000476 Ga0495635_0000476_17774_18121 108
927 3300046663 Ga0495635_0049264 Ga0495635_0049264_435_791 108
928 3300046663 Ga0495635_0125122 Ga0495635_0125122_392_739 108
929 3300046663 Ga0495635_0237297 Ga0495635_0237297_560_961 108
930 3300046664 Ga0495659_0047114 Ga0495659_0047114_973_1317 108
931 3300046674 Ga0495588_0000923 Ga0495588_0000923_1943_2290 108
932 3300046675 Ga0495657_0429893 Ga0495657_0429893_221_577 108
933 3300046675 Ga0495657_0904031 Ga0495657_0904031_59_460 108
934 3300046678 Ga0495599_0000524 Ga0495599_0000524_19444_19791 108
935 3300046679 Ga0495623_0000581 Ga0495623_0000581_2381_2728 108
936 3300046680 Ga0495646_0005155 Ga0495646_0005155_5456_5803 108
937 3300046680 Ga0495646_0443223 Ga0495646_0443223_140_496 108
938 3300046683 Ga0495658_0000038 Ga0495658_0000038_42842_43189 108
939 3300046684 Ga0495669_0058544 Ga0495669_0058544_407_763 108
940 3300046684 Ga0495669_0080218 Ga0495669_0080218_281_607 108
941 3300046684 Ga0495669_0179647 Ga0495669_0179647_475_876 108
942 3300046689 Ga0495613_0012452 Ga0495613_0012452_79_426 108
943 3300046689 Ga0495613_0411479 Ga0495613_0411479_554_901 108
944 3300046689 Ga0495613_0429823 Ga0495613_0429823_46_402 108
945 3300046689 Ga0495613_1062370 Ga0495613_1062370_39_395 108
946 3300046690 Ga0495624_0475835 Ga0495624_0475835_137_484 108
947 3300046691 Ga0495670_0129844 Ga0495670_0129844_17_361 108
948 3300046809 Ga0495600_0000452 Ga0495600_0000452_13297_13644 108
949 3300047315 Ga0495581_0000112 Ga0495581_0000112_31236_31583 108
950 3300047317 Ga0495604_0000592 Ga0495604_0000592_10574_10921 108
951 3300047317 Ga0495604_0091315 Ga0495604_0091315_138_494 108
952 3300047317 Ga0495604_0369920 Ga0495604_0369920_428_829 108
953 3300047317 Ga0495604_0983035 Ga0495604_0983035_99_455 108
954 3300047319 Ga0495674_0004595 Ga0495674_0004595_5017_5364 108
955 3300047319 Ga0495674_0683776 Ga0495674_0683776_428_784 108
956 3300047322 Ga0495680_0006077 Ga0495680_0006077_7560_7907 108
957 3300047322 Ga0495680_0177063 Ga0495680_0177063_175_531 108
958 3300047322 Ga0495680_0373402 Ga0495680_0373402_243_644 108
959 3300047444 Ga0495675_0001981 Ga0495675_0001981_3318_3665 108
960 3300047444 Ga0495675_0381818 Ga0495675_0381818_32_388 108
961 3300047444 Ga0495675_0413452 Ga0495675_0413452_56_412 108
962 3300047444 Ga0495675_0742824 Ga0495675_0742824_126_482 108
963 3300047447 Ga0495685_149135 Ga0495685_149135_296_697 108
964 3300047471 Ga0495684_0001660 Ga0495684_0001660_10809_11156 108
965 3300047471 Ga0495684_0256043 Ga0495684_0256043_506_862 108
966 3300047471 Ga0495684_1043863 Ga0495684_1043863_85_441 108
967 3300047673 Ga0495593_0000188 Ga0495593_0000188_20235_20582 108
968 3300047673 Ga0495593_0724597 Ga0495593_0724597_33_389 108
969 3300048088 Ga0495602_0003690 Ga0495602_0003690_11860_12207 108
970 3300048088 Ga0495602_0642928 Ga0495602_0642928_221_577 108
971 3300048088 Ga0495602_0678813 Ga0495602_0678813_255_611 108
972 3300048088 Ga0495602_0679160 Ga0495602_0679160_109_510 108
973 3300048089 Ga0495614_0000013 Ga0495614_0000013_26568_26915 108
974 3300048903 Ga0496100_0415240 Ga0496100_0415240_427_753 108
975 3300048904 Ga0496101_0602988 Ga0496101_0602988_434_835 108
976 3300048904 Ga0496101_1237614 Ga0496101_1237614_38_364 108
977 3300048907 Ga0496104_0090136 Ga0496104_0090136_1331_1657 108
978 3300048908 Ga0496105_0168845 Ga0496105_0168845_1328_1654 108
979 3300048909 Ga0496106_0424884 Ga0496106_0424884_596_922 108
980 3300048910 Ga0496107_1322151 Ga0496107_1322151_82_438 108
981 3300048911 Ga0496108_0087841 Ga0496108_0087841_448_849 108
982 3300048912 Ga0496109_0252506 Ga0496109_0252506_1171_1497 108
983 3300048915 Ga0496112_0038661 Ga0496112_0038661_3913_4269 108
984 3300048915 Ga0496112_0062878 Ga0496112_0062878_2024_2425 108
985 3300048915 Ga0496112_0533269 Ga0496112_0533269_32_388 108
986 3300048915 Ga0496112_1048747 Ga0496112_1048747_152_478 108
987 3300048916 Ga0496113_0037466 Ga0496113_0037466_427_828 108
988 3300048917 Ga0496114_0911149 Ga0496114_0911149_309_665 108
989 3300048918 Ga0496115_0136899 Ga0496115_0136899_82_438 108
990 3300049532 Ga0501316_058577 Ga0501316_058577_150_533 108
991 3300049532 Ga0501316_076459 Ga0501316_076459_59_460 108
992 3300049533 Ga0501317_096461 Ga0501317_096461_59_460 108
993 3300049568 Ga0501031_0128102 Ga0501031_0128102_1077_1433 108
994 3300049570 Ga0501033_0028071 Ga0501033_0028071_1420_1767 108
995 3300049571 Ga0501034_0082214 Ga0501034_0082214_1684_2031 108
996 3300049572 Ga0501036_0015341 Ga0501036_0015341_4791_5138 108
997 3300049572 Ga0501036_0166847 Ga0501036_0166847_843_1199 108
998 3300049574 Ga0501038_0042595 Ga0501038_0042595_969_1316 108
999 3300049575 Ga0501039_0217063 Ga0501039_0217063_431_787 108
1000 3300049576 Ga0501040_0213517 Ga0501040_0213517_105_461 108
1001 3300049577 Ga0501041_0313543 Ga0501041_0313543_394_750 108
1002 3300049578 Ga0501042_0172110 Ga0501042_0172110_952_1308 108
1003 3300049578 Ga0501042_0623750 Ga0501042_0623750_220_576 108
1004 3300049580 Ga0501046_0036969 Ga0501046_0036969_1925_2281 108
1005 3300049581 Ga0501047_0245214 Ga0501047_0245214_1117_1464 108
1006 3300049586 Ga0501070_0046113 Ga0501070_0046113_2958_3314 108
1007 3300049588 Ga0501072_0324535 Ga0501072_0324535_636_992 108
1008 3300049590 Ga0501074_0126135 Ga0501074_0126135_1138_1494 108
1009 3300049590 Ga0501074_0443002 Ga0501074_0443002_250_606 108
1010 3300049651 Ga0501201_028729 Ga0501201_028729_66_449 108
1011 3300049669 Ga0501235_098770 Ga0501235_098770_102_458 108
1012 3300049679 Ga0501249_135073 Ga0501249_135073_200_583 108
1013 3300049686 Ga0501257_146105 Ga0501257_146105_175_558 108
1014 3300049706 Ga0501229_054342 Ga0501229_054342_80_481 108
1015 3300049741 Ga0501079_0160259 Ga0501079_0160259_142_498 108
1016 3300049742 Ga0501080_0554634 Ga0501080_0554634_25_381 108
1017 3300049742 Ga0501080_1796127 Ga0501080_1796127_129_485 108
1018 3300049743 Ga0501081_0057133 Ga0501081_0057133_1023_1379 108
1019 3300049743 Ga0501081_0177973 Ga0501081_0177973_164_520 108
1020 3300049761 Ga0501264_044742 Ga0501264_044742_80_481 108
1021 3300049770 Ga0501273_020123 Ga0501273_020123_476_832 108
1022 3300049822 Ga0501035_0077656 Ga0501035_0077656_1294_1641 108
1023 3300049823 Ga0501044_0050994 Ga0501044_0050994_65_412 108
1024 3300049824 Ga0501045_0072581 Ga0501045_0072581_710_1066 108
1025 3300050507 nmdc:mga05p37_1294589_c1 nmdc:mga05p37_1294589_c1_59_388 108
1026 3300050507 nmdc:mga05p37_236139_c1 nmdc:mga05p37_236139_c1_1592_1948 108
1027 3300050508 nmdc:mga09592_217138_c1 nmdc:mga09592_217138_c1_949_1305 108
1028 3300050508 nmdc:mga09592_69437_c1 nmdc:mga09592_69437_c1_2530_2859 108
1029 3300050509 nmdc:mga0qj67_5557_c1 nmdc:mga0qj67_5557_c1_2531_2887 108
1030 3300050510 nmdc:mga06r32_1430251_c1 nmdc:mga06r32_1430251_c1_197_526 108
1031 3300050510 nmdc:mga06r32_178005_c1 nmdc:mga06r32_178005_c1_298_654 108
1032 3300050510 nmdc:mga06r32_185170_c1 nmdc:mga06r32_185170_c1_290_619 108
1033 3300050511 nmdc:mga08y16_56756_c1 nmdc:mga08y16_56756_c1_176_532 108
1034 3300050511 nmdc:mga08y16_742576_c1 nmdc:mga08y16_742576_c1_414_740 108
1035 3300050512 nmdc:mga0n895_184069_c1 nmdc:mga0n895_184069_c1_1745_2092 108
1036 3300050512 nmdc:mga0n895_975465_c1 nmdc:mga0n895_975465_c1_398_745 108
1037 3300050513 nmdc:mga0rr50_124612_c1 nmdc:mga0rr50_124612_c1_1157_1513 108
1038 3300050514 nmdc:mga08x19_150445_c1 nmdc:mga08x19_150445_c1_1098_1454 108
1039 3300050514 nmdc:mga08x19_196401_c1 nmdc:mga08x19_196401_c1_436_792 108
1040 3300050514 nmdc:mga08x19_3616_c1 nmdc:mga08x19_3616_c1_4449_4805 108
1041 3300050514 nmdc:mga08x19_5563_c1 nmdc:mga08x19_5563_c1_4623_4979 108
1042 3300050515 nmdc:mga0a205_892667_c1 nmdc:mga0a205_892667_c1_246_647 108
1043 3300053077 Ga0495601_0005901 Ga0495601_0005901_2359_2706 108
1044 3300053078 Ga0495612_0018548 Ga0495612_0018548_2247_2594 108
1045 3300053085 Ga0495619_0003300 Ga0495619_0003300_3719_4066 108
1046 3300053085 Ga0495619_0540789 Ga0495619_0540789_341_697 108
1047 3300054114 Ga0501084_0192633 Ga0501084_0192633_1160_1516 108
1048 3300054114 Ga0501084_0714380 Ga0501084_0714380_355_711 108
1049 3300059424 Ga0590075_141592 Ga0590075_141592_159_515 108
1050 3300059490 Ga0587066_187366 Ga0587066_187366_124_480 108
1051 3300059490 Ga0587066_197312 Ga0587066_197312_155_511 108
1052 3300059503 Ga0587080_180016 Ga0587080_180016_22_378 108
1053 3300059504 Ga0587082_140745 Ga0587082_140745_60_416 108
1054 3300059508 Ga0587088_042385 Ga0587088_042385_235_591 108
1055 3300059508 Ga0587088_107474 Ga0587088_107474_59_415 108
1056 3300059508 Ga0587088_175248 Ga0587088_175248_22_378 108
1057 3300059511 Ga0587091_029655 Ga0587091_029655_393_749 108
1058 3300059511 Ga0587091_167816 Ga0587091_167816_122_523 108
1059 3300059513 Ga0587094_022552 Ga0587094_022552_176_532 108
1060 3300059623 Ga0587101_085480 Ga0587101_085480_173_574 108
1061 3300059626 Ga0587115_036883 Ga0587115_036883_10_366 108
1062 3300059626 Ga0587115_122384 Ga0587115_122384_72_428 108
1063 3300059630 Ga0587128_028052 Ga0587128_028052_392_748 108
1064 3300059640 Ga0587067_135511 Ga0587067_135511_14_370 108
1065 3300059640 Ga0587067_188716 Ga0587067_188716_12_368 108
1066 3300059642 Ga0587069_125180 Ga0587069_125180_93_449 108
1067 3300059644 Ga0587075_024895 Ga0587075_024895_167_523 108
1068 3300059644 Ga0587075_144129 Ga0587075_144129_38_439 108
1069 3300059647 Ga0587079_034151 Ga0587079_034151_471_827 108
1070 3300059652 Ga0587107_088081 Ga0587107_088081_169_570 108
1071 3300059655 Ga0587114_006593 Ga0587114_006593_600_956 108
1072 3300059658 Ga0587119_034582 Ga0587119_034582_218_574 108
1073 3300060353 Ga0501082_0295535 Ga0501082_0295535_960_1316 108
1074 3300060353 Ga0501082_0487679 Ga0501082_0487679_65_421 108
1075 3300060353 Ga0501082_1179277 Ga0501082_1179277_94_450 108
1076 3300061734 Ga0530510_0170125 Ga0530510_0170125_936_1292 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

25

130

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8877 2 95
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8638 2 95
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.8575 2 96
1x0g-assembly1.cif.gz_A crystal structure of isca with the [2fe-2s] cluster 0.8358 3 106
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.829 2 95
ID Description Score Start End Superfamily
1s98A00 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8638 2 95 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8575 2 96 2.60.300.12
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.851 2 83 2.60.300.12
af_Q2FZV8_4_111_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8466 1 106 2.60.300.12
af_B6SR68_68_176_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8441 2 106 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A7X5WH35-F1-model_v4 deleted 0.9631 2 100
AF-A0A531KMU7-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9332 2 96 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A7X5WH35-F1-model_v4 deleted 0.9264 2 100
AF-A0A7Y5PBL3-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9256 1 108 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A7X9HXH7-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9224 2 94 GO:0005506
GO:0016020
GO:0016226
GO:0051537
GO:0051539
GO:0106035

Feature Viewer

pLDDT pTM Quality
82.15 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map