F489581
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1076 | 395 | 1076 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_11036773|Ga0157375_110367731 |
| Length | 134 |
| Sequence | MYRGHRDLAALKWRLDMSTMNQPEVLVTVTSAASTEVKKFMSQEGVDPSKGGLRVSVQPGGCSGFKYGLLIEDEAAEDDLIVGQGEWRVFVDPFSAQYLNGVTIDYVSSMQGSGFTFKNPNSTGGCGCGSSFSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 99 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 137 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 215 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 243 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 253 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 255 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 257 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 260 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 261 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 323 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 324 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 325 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 326 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 352 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 353 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 354 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 355 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 356 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 360 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 378 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.42 |
| Metatranscriptomes | 5.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.49 |
| Rhizosphere | 97.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1021513 | 3300002076 | Bacteria | 912 |
| 2 | Ga0058863_10001545 | 3300004799 | Bacteria | 659 |
| 3 | Ga0058861_10037038 | 3300004800 | Bacteria | 535 |
| 4 | Ga0058861_11938491 | 3300004800 | Bacteria | 682 |
| 5 | Ga0058860_11767703 | 3300004801 | Bacteria | 864 |
| 6 | Ga0058862_10031778 | 3300004803 | Unclassified | 515 |
| 7 | Ga0058862_12313547 | 3300004803 | Bacteria | 663 |
| 8 | Ga0058862_12425160 | 3300004803 | Unclassified | 1213 |
| 9 | Ga0058862_12513443 | 3300004803 | Bacteria | 538 |
| 10 | Ga0058862_12752857 | 3300004803 | Unclassified | 515 |
| 11 | Ga0058862_12817638 | 3300004803 | Bacteria | 557 |
| 12 | Ga0058862_12852883 | 3300004803 | Unclassified | 620 |
| 13 | Ga0065715_10119621 | 3300005293 | Bacteria | 2282 |
| 14 | Ga0065707_10402330 | 3300005295 | Bacteria | 851 |
| 15 | Ga0065707_10590974 | 3300005295 | Unclassified | 696 |
| 16 | Ga0070658_10086928 | 3300005327 | Bacteria | 2572 |
| 17 | Ga0070658_10605391 | 3300005327 | Bacteria | 950 |
| 18 | Ga0070658_10612692 | 3300005327 | Bacteria | 944 |
| 19 | Ga0070658_10727919 | 3300005327 | Bacteria | 861 |
| 20 | Ga0070658_10930598 | 3300005327 | Bacteria | 756 |
| 21 | Ga0070658_11140242 | 3300005327 | Unclassified | 678 |
| 22 | Ga0070676_10004878 | 3300005328 | Bacteria | 7103 |
| 23 | Ga0070676_10057904 | 3300005328 | Unclassified | 2295 |
| 24 | Ga0070676_10067919 | 3300005328 | Bacteria | 2133 |
| 25 | Ga0070676_10675138 | 3300005328 | Bacteria | 752 |
| 26 | Ga0070676_11203677 | 3300005328 | Bacteria | 576 |
| 27 | Ga0070676_11616979 | 3300005328 | Unclassified | 501 |
| 28 | Ga0070683_100002085 | 3300005329 | Bacteria | 15786 |
| 29 | Ga0070683_100017414 | 3300005329 | Bacteria | 6351 |
| 30 | Ga0070683_100033561 | 3300005329 | Bacteria | 4681 |
| 31 | Ga0070683_100038844 | 3300005329 | Bacteria | 4366 |
| 32 | Ga0070683_100097294 | 3300005329 | Bacteria | 2769 |
| 33 | Ga0070683_100138785 | 3300005329 | Unclassified | 2303 |
| 34 | Ga0070683_100160550 | 3300005329 | Bacteria | 2133 |
| 35 | Ga0070683_100252992 | 3300005329 | Bacteria | 1675 |
| 36 | Ga0070683_100260992 | 3300005329 | Unclassified | 1648 |
| 37 | Ga0070683_100371307 | 3300005329 | Unclassified | 1363 |
| 38 | Ga0070683_100505425 | 3300005329 | Unclassified | 1155 |
| 39 | Ga0070683_101229798 | 3300005329 | Bacteria | 720 |
| 40 | Ga0070683_101405102 | 3300005329 | Bacteria | 671 |
| 41 | Ga0070690_100030151 | 3300005330 | Bacteria | 3368 |
| 42 | Ga0070690_100033405 | 3300005330 | Bacteria | 3220 |
| 43 | Ga0070670_100447428 | 3300005331 | Bacteria | 1144 |
| 44 | Ga0070677_10046422 | 3300005333 | Bacteria | 1737 |
| 45 | Ga0070666_10458844 | 3300005335 | Bacteria | 921 |
| 46 | Ga0070666_10495225 | 3300005335 | Bacteria | 886 |
| 47 | Ga0070680_100002196 | 3300005336 | Bacteria | 14389 |
| 48 | Ga0070680_100018010 | 3300005336 | Bacteria | 5578 |
| 49 | Ga0070680_100019927 | 3300005336 | Bacteria | 5318 |
| 50 | Ga0070680_100020843 | 3300005336 | Bacteria | 5203 |
| 51 | Ga0070680_100022197 | 3300005336 | Bacteria | 5050 |
| 52 | Ga0070680_100129250 | 3300005336 | Bacteria | 2112 |
| 53 | Ga0070680_100147849 | 3300005336 | Bacteria | 1972 |
| 54 | Ga0070680_100217060 | 3300005336 | Bacteria | 1614 |
| 55 | Ga0070680_100226554 | 3300005336 | Bacteria | 1578 |
| 56 | Ga0070680_100332749 | 3300005336 | Bacteria | 1290 |
| 57 | Ga0070680_100689896 | 3300005336 | Unclassified | 878 |
| 58 | Ga0070682_100051411 | 3300005337 | Bacteria | 2576 |
| 59 | Ga0070682_100160148 | 3300005337 | Bacteria | 1554 |
| 60 | Ga0070682_100175875 | 3300005337 | Bacteria | 1491 |
| 61 | Ga0068868_100011391 | 3300005338 | Bacteria | 6475 |
| 62 | Ga0068868_100026433 | 3300005338 | Bacteria | 4423 |
| 63 | Ga0068868_100510711 | 3300005338 | Unclassified | 1054 |
| 64 | Ga0068868_100887359 | 3300005338 | Bacteria | 810 |
| 65 | Ga0068868_101761853 | 3300005338 | Bacteria | 585 |
| 66 | Ga0070660_100192175 | 3300005339 | Bacteria | 1654 |
| 67 | Ga0070660_100255842 | 3300005339 | Bacteria | 1429 |
| 68 | Ga0070660_100319831 | 3300005339 | Bacteria | 1274 |
| 69 | Ga0070660_100323795 | 3300005339 | Bacteria | 1266 |
| 70 | Ga0070660_100627484 | 3300005339 | Bacteria | 899 |
| 71 | Ga0070689_100003423 | 3300005340 | Bacteria | 10552 |
| 72 | Ga0070689_100194378 | 3300005340 | Bacteria | 1653 |
| 73 | Ga0070689_100852678 | 3300005340 | Bacteria | 804 |
| 74 | Ga0070691_10019625 | 3300005341 | Bacteria | 3120 |
| 75 | Ga0070687_100002020 | 3300005343 | Bacteria | 7442 |
| 76 | Ga0070687_100003099 | 3300005343 | Bacteria | 6394 |
| 77 | Ga0070661_100001068 | 3300005344 | Bacteria | 19426 |
| 78 | Ga0070661_100046094 | 3300005344 | Bacteria | 3188 |
| 79 | Ga0070661_100105804 | 3300005344 | Bacteria | 2098 |
| 80 | Ga0070661_100562485 | 3300005344 | Unclassified | 919 |
| 81 | Ga0070661_101108264 | 3300005344 | Unclassified | 660 |
| 82 | Ga0070692_10015568 | 3300005345 | Bacteria | 3600 |
| 83 | Ga0070692_10151259 | 3300005345 | Unclassified | 1322 |
| 84 | Ga0070692_10308758 | 3300005345 | Bacteria | 968 |
| 85 | Ga0070668_100005654 | 3300005347 | Bacteria | 9268 |
| 86 | Ga0070668_100023597 | 3300005347 | Bacteria | 4654 |
| 87 | Ga0070668_100141734 | 3300005347 | Bacteria | 1938 |
| 88 | Ga0070669_100007417 | 3300005353 | Bacteria | 7859 |
| 89 | Ga0070669_100065806 | 3300005353 | Bacteria | 2670 |
| 90 | Ga0070675_100007110 | 3300005354 | Bacteria | 8617 |
| 91 | Ga0070675_100370732 | 3300005354 | Bacteria | 1273 |
| 92 | Ga0070675_100391400 | 3300005354 | Unclassified | 1238 |
| 93 | Ga0070675_101022416 | 3300005354 | Unclassified | 759 |
| 94 | Ga0070671_100080453 | 3300005355 | Bacteria | 2724 |
| 95 | Ga0070671_100205691 | 3300005355 | Bacteria | 1669 |
| 96 | Ga0070671_100221472 | 3300005355 | Bacteria | 1605 |
| 97 | Ga0070671_100396860 | 3300005355 | Bacteria | 1180 |
| 98 | Ga0070671_100815806 | 3300005355 | Bacteria | 813 |
| 99 | Ga0070671_101119820 | 3300005355 | Unclassified | 692 |
| 100 | Ga0070671_101192500 | 3300005355 | Unclassified | 670 |
| 101 | Ga0070671_101319656 | 3300005355 | Unclassified | 636 |
| 102 | Ga0070674_100024550 | 3300005356 | Bacteria | 3914 |
| 103 | Ga0070674_100040398 | 3300005356 | Bacteria | 3156 |
| 104 | Ga0070674_100112094 | 3300005356 | Bacteria | 2005 |
| 105 | Ga0070674_100589828 | 3300005356 | Bacteria | 938 |
| 106 | Ga0070674_100760099 | 3300005356 | Bacteria | 834 |
| 107 | Ga0070673_100013585 | 3300005364 | Bacteria | 5641 |
| 108 | Ga0070673_100286559 | 3300005364 | Unclassified | 1446 |
| 109 | Ga0070673_100557421 | 3300005364 | Bacteria | 1042 |
| 110 | Ga0070673_100857657 | 3300005364 | Bacteria | 841 |
| 111 | Ga0070688_100007877 | 3300005365 | Bacteria | 5757 |
| 112 | Ga0070659_100041286 | 3300005366 | Bacteria | 3605 |
| 113 | Ga0070659_100073320 | 3300005366 | Bacteria | 2725 |
| 114 | Ga0070659_100445535 | 3300005366 | Bacteria | 1098 |
| 115 | Ga0070659_101797653 | 3300005366 | Bacteria | 549 |
| 116 | Ga0070667_100079505 | 3300005367 | Bacteria | 2803 |
| 117 | Ga0070667_100098087 | 3300005367 | Bacteria | 2528 |
| 118 | Ga0070667_100276244 | 3300005367 | Bacteria | 1507 |
| 119 | Ga0070667_100780575 | 3300005367 | Bacteria | 886 |
| 120 | Ga0070709_10006275 | 3300005434 | Bacteria | 6475 |
| 121 | Ga0070709_10220343 | 3300005434 | Unclassified | 1353 |
| 122 | Ga0070714_100004555 | 3300005435 | Bacteria | 10448 |
| 123 | Ga0070714_100022164 | 3300005435 | Bacteria | 5206 |
| 124 | Ga0070714_100103316 | 3300005435 | Bacteria | 2514 |
| 125 | Ga0070714_100130194 | 3300005435 | Bacteria | 2248 |
| 126 | Ga0070714_100254463 | 3300005435 | Bacteria | 1625 |
| 127 | Ga0070714_100327881 | 3300005435 | Bacteria | 1433 |
| 128 | Ga0070714_102317998 | 3300005435 | Unclassified | 522 |
| 129 | Ga0070713_100000345 | 3300005436 | Bacteria | 30173 |
| 130 | Ga0070713_100159593 | 3300005436 | Bacteria | 2012 |
| 131 | Ga0070713_100208813 | 3300005436 | Bacteria | 1767 |
| 132 | Ga0070713_100966023 | 3300005436 | Unclassified | 821 |
| 133 | Ga0070713_101192084 | 3300005436 | Bacteria | 737 |
| 134 | Ga0070710_10015426 | 3300005437 | Bacteria | 3868 |
| 135 | Ga0070710_10054896 | 3300005437 | Bacteria | 2249 |
| 136 | Ga0070710_10137289 | 3300005437 | Bacteria | 1496 |
| 137 | Ga0070710_10575681 | 3300005437 | Bacteria | 781 |
| 138 | Ga0070701_10050806 | 3300005438 | Bacteria | 2149 |
| 139 | Ga0070701_10180130 | 3300005438 | Bacteria | 1236 |
| 140 | Ga0070711_100058958 | 3300005439 | Bacteria | 2663 |
| 141 | Ga0070711_100114078 | 3300005439 | Bacteria | 1988 |
| 142 | Ga0070711_100120720 | 3300005439 | Bacteria | 1938 |
| 143 | Ga0070711_100667517 | 3300005439 | Bacteria | 873 |
| 144 | Ga0070705_100066991 | 3300005440 | Bacteria | 2155 |
| 145 | Ga0070705_100693976 | 3300005440 | Unclassified | 799 |
| 146 | Ga0070700_100013015 | 3300005441 | Bacteria | 4666 |
| 147 | Ga0070700_100050670 | 3300005441 | Bacteria | 2581 |
| 148 | Ga0070700_101417456 | 3300005441 | Bacteria | 588 |
| 149 | Ga0070694_100462746 | 3300005444 | Bacteria | 1003 |
| 150 | Ga0070708_100000052 | 3300005445 | Bacteria | 78944 |
| 151 | Ga0070708_100024403 | 3300005445 | Bacteria | 5159 |
| 152 | Ga0070663_100235336 | 3300005455 | Bacteria | 1444 |
| 153 | Ga0070663_100498187 | 3300005455 | Bacteria | 1011 |
| 154 | Ga0070663_100850770 | 3300005455 | Unclassified | 785 |
| 155 | Ga0070678_100292728 | 3300005456 | Bacteria | 1381 |
| 156 | Ga0070678_100296420 | 3300005456 | Bacteria | 1373 |
| 157 | Ga0070678_100314249 | 3300005456 | Bacteria | 1336 |
| 158 | Ga0070678_100316355 | 3300005456 | Bacteria | 1332 |
| 159 | Ga0070662_100008330 | 3300005457 | Bacteria | 6756 |
| 160 | Ga0070662_100173805 | 3300005457 | Bacteria | 1694 |
| 161 | Ga0070662_100205960 | 3300005457 | Bacteria | 1563 |
| 162 | Ga0070662_100468017 | 3300005457 | Unclassified | 1048 |
| 163 | Ga0070662_101056835 | 3300005457 | Unclassified | 696 |
| 164 | Ga0070662_101156452 | 3300005457 | Unclassified | 665 |
| 165 | Ga0070681_10003936 | 3300005458 | Bacteria | 14002 |
| 166 | Ga0070681_10015108 | 3300005458 | Bacteria | 7679 |
| 167 | Ga0070681_10020038 | 3300005458 | Bacteria | 6701 |
| 168 | Ga0070681_10024189 | 3300005458 | Bacteria | 6114 |
| 169 | Ga0070681_10050350 | 3300005458 | Bacteria | 4156 |
| 170 | Ga0070681_10069385 | 3300005458 | Bacteria | 3491 |
| 171 | Ga0070681_10094324 | 3300005458 | Bacteria | 2941 |
| 172 | Ga0070681_10130145 | 3300005458 | Bacteria | 2449 |
| 173 | Ga0070681_10135395 | 3300005458 | Bacteria | 2394 |
| 174 | Ga0070681_10194812 | 3300005458 | Bacteria | 1946 |
| 175 | Ga0070681_10270851 | 3300005458 | Bacteria | 1609 |
| 176 | Ga0070681_10330210 | 3300005458 | Unclassified | 1435 |
| 177 | Ga0070681_10330329 | 3300005458 | Bacteria | 1434 |
| 178 | Ga0070681_10500778 | 3300005458 | Bacteria | 1128 |
| 179 | Ga0070681_10545900 | 3300005458 | Bacteria | 1073 |
| 180 | Ga0070681_10955780 | 3300005458 | Bacteria | 776 |
| 181 | Ga0068867_100008139 | 3300005459 | Bacteria | 7409 |
| 182 | Ga0068867_100012109 | 3300005459 | Bacteria | 6091 |
| 183 | Ga0068867_100130377 | 3300005459 | Bacteria | 1953 |
| 184 | Ga0068867_100385066 | 3300005459 | Unclassified | 1179 |
| 185 | Ga0068867_100741665 | 3300005459 | Bacteria | 870 |
| 186 | Ga0068867_100816135 | 3300005459 | Bacteria | 833 |
| 187 | Ga0070685_10003117 | 3300005466 | Bacteria | 8428 |
| 188 | Ga0070685_10183504 | 3300005466 | Unclassified | 1349 |
| 189 | Ga0070685_10716659 | 3300005466 | Bacteria | 731 |
| 190 | Ga0070706_100042852 | 3300005467 | Unclassified | 4181 |
| 191 | Ga0070707_100000643 | 3300005468 | Bacteria | 34864 |
| 192 | Ga0070707_100236903 | 3300005468 | Unclassified | 1776 |
| 193 | Ga0070698_100009811 | 3300005471 | Bacteria | 10235 |
| 194 | Ga0070698_100028422 | 3300005471 | Bacteria | 5808 |
| 195 | Ga0070699_100001838 | 3300005518 | Bacteria | 19266 |
| 196 | Ga0070699_100245948 | 3300005518 | Bacteria | 1598 |
| 197 | Ga0070699_100336117 | 3300005518 | Bacteria | 1359 |
| 198 | Ga0070699_101645283 | 3300005518 | Bacteria | 588 |
| 199 | Ga0070699_101667295 | 3300005518 | Bacteria | 584 |
| 200 | Ga0070679_100001019 | 3300005530 | Bacteria | 24401 |
| 201 | Ga0070679_100003394 | 3300005530 | Bacteria | 14593 |
| 202 | Ga0070679_100003861 | 3300005530 | Bacteria | 13760 |
| 203 | Ga0070679_100017456 | 3300005530 | Bacteria | 6946 |
| 204 | Ga0070679_100049707 | 3300005530 | Bacteria | 4177 |
| 205 | Ga0070679_100082512 | 3300005530 | Bacteria | 3204 |
| 206 | Ga0070679_100099210 | 3300005530 | Bacteria | 2899 |
| 207 | Ga0070679_100215162 | 3300005530 | Bacteria | 1884 |
| 208 | Ga0070679_100340595 | 3300005530 | Bacteria | 1448 |
| 209 | Ga0070679_100578209 | 3300005530 | Bacteria | 1067 |
| 210 | Ga0070679_101267970 | 3300005530 | Unclassified | 682 |
| 211 | Ga0070679_101511434 | 3300005530 | Bacteria | 618 |
| 212 | Ga0070684_100003384 | 3300005535 | Bacteria | 11954 |
| 213 | Ga0070684_100057265 | 3300005535 | Bacteria | 3402 |
| 214 | Ga0070684_100087437 | 3300005535 | Bacteria | 2767 |
| 215 | Ga0070684_100155228 | 3300005535 | Bacteria | 2075 |
| 216 | Ga0070684_100182497 | 3300005535 | Bacteria | 1908 |
| 217 | Ga0070684_100223557 | 3300005535 | Bacteria | 1718 |
| 218 | Ga0070684_100246373 | 3300005535 | Bacteria | 1633 |
| 219 | Ga0070684_100303441 | 3300005535 | Bacteria | 1465 |
| 220 | Ga0070684_100405278 | 3300005535 | Unclassified | 1258 |
| 221 | Ga0070684_100848453 | 3300005535 | Unclassified | 855 |
| 222 | Ga0070697_100074322 | 3300005536 | Bacteria | 2792 |
| 223 | Ga0070697_100377698 | 3300005536 | Bacteria | 1227 |
| 224 | Ga0070697_100524534 | 3300005536 | Bacteria | 1037 |
| 225 | Ga0068853_100027617 | 3300005539 | Bacteria | 4768 |
| 226 | Ga0068853_100071151 | 3300005539 | Bacteria | 3028 |
| 227 | Ga0068853_100091088 | 3300005539 | Bacteria | 2681 |
| 228 | Ga0068853_100597056 | 3300005539 | Bacteria | 1048 |
| 229 | Ga0068853_100684860 | 3300005539 | Bacteria | 977 |
| 230 | Ga0068853_100843861 | 3300005539 | Unclassified | 878 |
| 231 | Ga0068853_101071533 | 3300005539 | Unclassified | 777 |
| 232 | Ga0070672_100105013 | 3300005543 | Bacteria | 2296 |
| 233 | Ga0070672_100576571 | 3300005543 | Bacteria | 978 |
| 234 | Ga0070672_100841269 | 3300005543 | Unclassified | 809 |
| 235 | Ga0070686_100008268 | 3300005544 | Bacteria | 5824 |
| 236 | Ga0070686_100131025 | 3300005544 | Bacteria | 1734 |
| 237 | Ga0070686_100373207 | 3300005544 | Bacteria | 1078 |
| 238 | Ga0070695_100141978 | 3300005545 | Bacteria | 1666 |
| 239 | Ga0070695_100415760 | 3300005545 | Bacteria | 1023 |
| 240 | Ga0070695_101221112 | 3300005545 | Bacteria | 619 |
| 241 | Ga0070695_101340101 | 3300005545 | Unclassified | 592 |
| 242 | Ga0070695_101404959 | 3300005545 | Bacteria | 579 |
| 243 | Ga0070696_100029982 | 3300005546 | Bacteria | 3721 |
| 244 | Ga0070696_100049164 | 3300005546 | Bacteria | 2929 |
| 245 | Ga0070696_100284293 | 3300005546 | Bacteria | 1262 |
| 246 | Ga0070693_100007204 | 3300005547 | Bacteria | 5428 |
| 247 | Ga0070693_100025640 | 3300005547 | Bacteria | 3175 |
| 248 | Ga0070693_100032154 | 3300005547 | Bacteria | 2882 |
| 249 | Ga0070693_100247100 | 3300005547 | Unclassified | 1181 |
| 250 | Ga0070693_101235547 | 3300005547 | Bacteria | 575 |
| 251 | Ga0070665_100209656 | 3300005548 | Bacteria | 1949 |
| 252 | Ga0070665_100569362 | 3300005548 | Bacteria | 1145 |
| 253 | Ga0070704_100001406 | 3300005549 | Bacteria | 12830 |
| 254 | Ga0070704_100185771 | 3300005549 | Unclassified | 1666 |
| 255 | Ga0070704_100755220 | 3300005549 | Unclassified | 866 |
| 256 | Ga0068855_100085188 | 3300005563 | Bacteria | 3657 |
| 257 | Ga0068855_100404286 | 3300005563 | Bacteria | 1496 |
| 258 | Ga0068855_100456070 | 3300005563 | Bacteria | 1394 |
| 259 | Ga0068855_100770010 | 3300005563 | Bacteria | 1025 |
| 260 | Ga0068855_101120927 | 3300005563 | Bacteria | 821 |
| 261 | Ga0070664_100004031 | 3300005564 | Bacteria | 11799 |
| 262 | Ga0070664_100013879 | 3300005564 | Bacteria | 6569 |
| 263 | Ga0070664_100058883 | 3300005564 | Bacteria | 3268 |
| 264 | Ga0070664_100098246 | 3300005564 | Bacteria | 2543 |
| 265 | Ga0070664_100098708 | 3300005564 | Bacteria | 2537 |
| 266 | Ga0070664_100182242 | 3300005564 | Bacteria | 1867 |
| 267 | Ga0070664_100365465 | 3300005564 | Bacteria | 1315 |
| 268 | Ga0070664_100491257 | 3300005564 | Bacteria | 1130 |
| 269 | Ga0068857_100046264 | 3300005577 | Bacteria | 3861 |
| 270 | Ga0068857_100077827 | 3300005577 | Bacteria | 2960 |
| 271 | Ga0068857_100102261 | 3300005577 | Bacteria | 2572 |
| 272 | Ga0068857_100289006 | 3300005577 | Bacteria | 1509 |
| 273 | Ga0068854_100007726 | 3300005578 | Bacteria | 6873 |
| 274 | Ga0068854_100018923 | 3300005578 | Bacteria | 4631 |
| 275 | Ga0068854_100362766 | 3300005578 | Bacteria | 1189 |
| 276 | Ga0068854_101712607 | 3300005578 | Bacteria | 575 |
| 277 | Ga0068854_102075721 | 3300005578 | Unclassified | 524 |
| 278 | Ga0068856_100149755 | 3300005614 | Bacteria | 2342 |
| 279 | Ga0068856_100222314 | 3300005614 | Bacteria | 1904 |
| 280 | Ga0068856_100274959 | 3300005614 | Bacteria | 1701 |
| 281 | Ga0068856_100652536 | 3300005614 | Bacteria | 1073 |
| 282 | Ga0070702_100056169 | 3300005615 | Bacteria | 2273 |
| 283 | Ga0070702_101017779 | 3300005615 | Unclassified | 657 |
| 284 | Ga0070702_101729340 | 3300005615 | Bacteria | 521 |
| 285 | Ga0068852_100010321 | 3300005616 | Bacteria | 6974 |
| 286 | Ga0068852_100034377 | 3300005616 | Bacteria | 4217 |
| 287 | Ga0068852_100233500 | 3300005616 | Bacteria | 1754 |
| 288 | Ga0068852_100336698 | 3300005616 | Bacteria | 1470 |
| 289 | Ga0068852_100578659 | 3300005616 | Bacteria | 1125 |
| 290 | Ga0068852_100868465 | 3300005616 | Viruses | 918 |
| 291 | Ga0068859_100017750 | 3300005617 | Bacteria | 7153 |
| 292 | Ga0068859_101085031 | 3300005617 | Unclassified | 880 |
| 293 | Ga0068864_100027372 | 3300005618 | Bacteria | 4815 |
| 294 | Ga0068864_100786077 | 3300005618 | Bacteria | 935 |
| 295 | Ga0068866_10013098 | 3300005718 | Bacteria | 3628 |
| 296 | Ga0068866_10044511 | 3300005718 | Bacteria | 2221 |
| 297 | Ga0068866_10141985 | 3300005718 | Bacteria | 1379 |
| 298 | Ga0068866_10250188 | 3300005718 | Bacteria | 1084 |
| 299 | Ga0068861_100079007 | 3300005719 | Unclassified | 2571 |
| 300 | Ga0068861_101367312 | 3300005719 | Bacteria | 691 |
| 301 | Ga0068851_10050614 | 3300005834 | Bacteria | 2110 |
| 302 | Ga0068851_10312120 | 3300005834 | Unclassified | 906 |
| 303 | Ga0068870_10345028 | 3300005840 | Bacteria | 954 |
| 304 | Ga0068870_10471574 | 3300005840 | Unclassified | 831 |
| 305 | Ga0068863_100406915 | 3300005841 | Bacteria | 1331 |
| 306 | Ga0068863_100547734 | 3300005841 | Unclassified | 1142 |
| 307 | Ga0068858_100319274 | 3300005842 | Bacteria | 1484 |
| 308 | Ga0068858_100946854 | 3300005842 | Unclassified | 843 |
| 309 | Ga0068858_100971426 | 3300005842 | Bacteria | 832 |
| 310 | Ga0068860_100186028 | 3300005843 | Bacteria | 2009 |
| 311 | Ga0068860_100599681 | 3300005843 | Bacteria | 1107 |
| 312 | Ga0068860_100869795 | 3300005843 | Bacteria | 917 |
| 313 | Ga0068862_100192108 | 3300005844 | Bacteria | 1838 |
| 314 | Ga0068862_101881280 | 3300005844 | Unclassified | 608 |
| 315 | Ga0081455_10035968 | 3300005937 | Bacteria | 4416 |
| 316 | Ga0070717_10007462 | 3300006028 | Bacteria | 8120 |
| 317 | Ga0070717_10737134 | 3300006028 | Bacteria | 896 |
| 318 | Ga0070715_10107478 | 3300006163 | Bacteria | 1311 |
| 319 | Ga0070715_10541740 | 3300006163 | Bacteria | 673 |
| 320 | Ga0070716_100006672 | 3300006173 | Bacteria | 5649 |
| 321 | Ga0070716_100094821 | 3300006173 | Bacteria | 1815 |
| 322 | Ga0070712_100005777 | 3300006175 | Bacteria | 7646 |
| 323 | Ga0070712_100023743 | 3300006175 | Bacteria | 4054 |
| 324 | Ga0070712_101192378 | 3300006175 | Unclassified | 662 |
| 325 | Ga0097621_100267379 | 3300006237 | Bacteria | 1502 |
| 326 | Ga0097621_100534619 | 3300006237 | Bacteria | 1065 |
| 327 | Ga0068871_100301114 | 3300006358 | Bacteria | 1407 |
| 328 | Ga0075428_101175445 | 3300006844 | Bacteria | 809 |
| 329 | Ga0075430_100021501 | 3300006846 | Bacteria | 5484 |
| 330 | Ga0075431_100016490 | 3300006847 | Bacteria | 7498 |
| 331 | Ga0075433_10010271 | 3300006852 | Bacteria | 7511 |
| 332 | Ga0075434_100039783 | 3300006871 | Bacteria | 4657 |
| 333 | Ga0075434_101133376 | 3300006871 | Bacteria | 795 |
| 334 | Ga0075429_100072380 | 3300006880 | Bacteria | 3002 |
| 335 | Ga0075429_100250269 | 3300006880 | Unclassified | 1552 |
| 336 | Ga0075429_101482720 | 3300006880 | Viruses | 590 |
| 337 | Ga0068865_100005690 | 3300006881 | Bacteria | 7572 |
| 338 | Ga0068865_100010439 | 3300006881 | Bacteria | 5781 |
| 339 | Ga0068865_100204855 | 3300006881 | Bacteria | 1534 |
| 340 | Ga0068865_100281149 | 3300006881 | Unclassified | 1325 |
| 341 | Ga0075436_100002007 | 3300006914 | Bacteria | 14062 |
| 342 | Ga0075436_100167953 | 3300006914 | Bacteria | 1549 |
| 343 | Ga0075436_100273491 | 3300006914 | Unclassified | 1207 |
| 344 | Ga0097620_100017750 | 3300006931 | Bacteria | 7153 |
| 345 | Ga0097620_101085015 | 3300006931 | Unclassified | 880 |
| 346 | Ga0075435_100033886 | 3300007076 | Unclassified | 4041 |
| 347 | Ga0099794_10523512 | 3300007265 | Unclassified | 625 |
| 348 | Ga0099795_10524561 | 3300007788 | Bacteria | 555 |
| 349 | Ga0105251_10327025 | 3300009011 | Bacteria | 697 |
| 350 | Ga0105240_10006583 | 3300009093 | Bacteria | 17056 |
| 351 | Ga0105240_10151296 | 3300009093 | Bacteria | 2763 |
| 352 | Ga0105240_10321288 | 3300009093 | Bacteria | 1764 |
| 353 | Ga0105240_10456639 | 3300009093 | Archaea | 1428 |
| 354 | Ga0105240_11276642 | 3300009093 | Bacteria | 775 |
| 355 | Ga0105240_11635700 | 3300009093 | Bacteria | 673 |
| 356 | Ga0105240_12494385 | 3300009093 | Unclassified | 535 |
| 357 | Ga0105240_12711511 | 3300009093 | Unclassified | 511 |
| 358 | Ga0111539_10012567 | 3300009094 | Bacteria | 10609 |
| 359 | Ga0111539_10335657 | 3300009094 | Bacteria | 1759 |
| 360 | Ga0111539_10629649 | 3300009094 | Bacteria | 1249 |
| 361 | Ga0105245_10096938 | 3300009098 | Bacteria | 2722 |
| 362 | Ga0105245_10146892 | 3300009098 | Bacteria | 2225 |
| 363 | Ga0105245_10561164 | 3300009098 | Bacteria | 1164 |
| 364 | Ga0105245_10626921 | 3300009098 | Unclassified | 1104 |
| 365 | Ga0105245_10701329 | 3300009098 | Bacteria | 1045 |
| 366 | Ga0105245_10742536 | 3300009098 | Bacteria | 1017 |
| 367 | Ga0105245_11357541 | 3300009098 | Bacteria | 760 |
| 368 | Ga0105245_11632751 | 3300009098 | Unclassified | 696 |
| 369 | Ga0105245_11762046 | 3300009098 | Bacteria | 672 |
| 370 | Ga0105247_10919875 | 3300009101 | Unclassified | 677 |
| 371 | Ga0105247_10950365 | 3300009101 | Unclassified | 667 |
| 372 | Ga0114129_10019668 | 3300009147 | Bacteria | 9611 |
| 373 | Ga0114129_10020805 | 3300009147 | Bacteria | 9320 |
| 374 | Ga0114129_12553388 | 3300009147 | Unclassified | 610 |
| 375 | Ga0105243_10015680 | 3300009148 | Bacteria | 5730 |
| 376 | Ga0105243_10393149 | 3300009148 | Bacteria | 1286 |
| 377 | Ga0105243_10753810 | 3300009148 | Bacteria | 955 |
| 378 | Ga0105243_11217649 | 3300009148 | Bacteria | 767 |
| 379 | Ga0105243_12263281 | 3300009148 | Unclassified | 581 |
| 380 | Ga0105241_10513915 | 3300009174 | Bacteria | 1070 |
| 381 | Ga0105241_10635622 | 3300009174 | Bacteria | 968 |
| 382 | Ga0105241_10890435 | 3300009174 | Unclassified | 826 |
| 383 | Ga0105241_11194093 | 3300009174 | Bacteria | 720 |
| 384 | Ga0105242_10010910 | 3300009176 | Bacteria | 6980 |
| 385 | Ga0105242_10192810 | 3300009176 | Bacteria | 1805 |
| 386 | Ga0105242_10290095 | 3300009176 | Bacteria | 1489 |
| 387 | Ga0105242_10646645 | 3300009176 | Bacteria | 1028 |
| 388 | Ga0105242_10841769 | 3300009176 | Unclassified | 912 |
| 389 | Ga0105242_12469659 | 3300009176 | Bacteria | 568 |
| 390 | Ga0105248_10044271 | 3300009177 | Bacteria | 4992 |
| 391 | Ga0105248_10324548 | 3300009177 | Bacteria | 1734 |
| 392 | Ga0105248_11506402 | 3300009177 | Unclassified | 762 |
| 393 | Ga0105237_10208875 | 3300009545 | Bacteria | 1952 |
| 394 | Ga0105237_10250893 | 3300009545 | Bacteria | 1772 |
| 395 | Ga0105238_10049306 | 3300009551 | Bacteria | 4241 |
| 396 | Ga0105238_10056335 | 3300009551 | Bacteria | 3944 |
| 397 | Ga0105238_10182881 | 3300009551 | Bacteria | 2073 |
| 398 | Ga0105238_10311252 | 3300009551 | Bacteria | 1560 |
| 399 | Ga0105238_10910240 | 3300009551 | Bacteria | 898 |
| 400 | Ga0105238_12923427 | 3300009551 | Unclassified | 514 |
| 401 | Ga0105249_10000089 | 3300009553 | Bacteria | 131175 |
| 402 | Ga0105249_10149829 | 3300009553 | Bacteria | 2245 |
| 403 | Ga0105249_10981614 | 3300009553 | Bacteria | 913 |
| 404 | Ga0105249_11554969 | 3300009553 | Bacteria | 734 |
| 405 | Ga0105239_10284303 | 3300010375 | Bacteria | 1862 |
| 406 | Ga0105239_10977810 | 3300010375 | Unclassified | 973 |
| 407 | Ga0105239_11165921 | 3300010375 | Bacteria | 887 |
| 408 | Ga0105246_10495140 | 3300011119 | Bacteria | 1037 |
| 409 | Ga0157373_10006497 | 3300013100 | Bacteria | 8725 |
| 410 | Ga0157373_10016738 | 3300013100 | Bacteria | 5344 |
| 411 | Ga0157373_10112150 | 3300013100 | Bacteria | 1917 |
| 412 | Ga0157373_10143744 | 3300013100 | Bacteria | 1678 |
| 413 | Ga0157373_10162332 | 3300013100 | Bacteria | 1572 |
| 414 | Ga0157373_10591317 | 3300013100 | Bacteria | 807 |
| 415 | Ga0157371_10771775 | 3300013102 | Unclassified | 723 |
| 416 | Ga0157370_10000730 | 3300013104 | Bacteria | 41278 |
| 417 | Ga0157370_10010939 | 3300013104 | Bacteria | 9525 |
| 418 | Ga0157370_10047858 | 3300013104 | Bacteria | 4097 |
| 419 | Ga0157370_10172146 | 3300013104 | Bacteria | 2012 |
| 420 | Ga0157370_10238470 | 3300013104 | Bacteria | 1683 |
| 421 | Ga0157370_10524279 | 3300013104 | Unclassified | 1087 |
| 422 | Ga0157370_11147803 | 3300013104 | Bacteria | 702 |
| 423 | Ga0157369_10010715 | 3300013105 | Bacteria | 10432 |
| 424 | Ga0157369_10086060 | 3300013105 | Bacteria | 3358 |
| 425 | Ga0157369_10131204 | 3300013105 | Bacteria | 2655 |
| 426 | Ga0157369_10162045 | 3300013105 | Bacteria | 2361 |
| 427 | Ga0157369_10231779 | 3300013105 | Bacteria | 1930 |
| 428 | Ga0157369_10373059 | 3300013105 | Bacteria | 1481 |
| 429 | Ga0157369_11100773 | 3300013105 | Bacteria | 812 |
| 430 | Ga0157369_11309560 | 3300013105 | Unclassified | 738 |
| 431 | Ga0157369_11393176 | 3300013105 | Unclassified | 714 |
| 432 | Ga0157369_12041594 | 3300013105 | Unclassified | 582 |
| 433 | Ga0157374_10349551 | 3300013296 | Bacteria | 1469 |
| 434 | Ga0157374_10460290 | 3300013296 | Bacteria | 1274 |
| 435 | Ga0157374_10511377 | 3300013296 | Bacteria | 1206 |
| 436 | Ga0157374_12239762 | 3300013296 | Unclassified | 573 |
| 437 | Ga0157374_12459476 | 3300013296 | Bacteria | 548 |
| 438 | Ga0157378_10008553 | 3300013297 | Bacteria | 8909 |
| 439 | Ga0157378_10034272 | 3300013297 | Bacteria | 4489 |
| 440 | Ga0157378_10080140 | 3300013297 | Bacteria | 2949 |
| 441 | Ga0157378_10089406 | 3300013297 | Bacteria | 2797 |
| 442 | Ga0157378_10774533 | 3300013297 | Bacteria | 984 |
| 443 | Ga0157378_10801761 | 3300013297 | Bacteria | 967 |
| 444 | Ga0157378_11165718 | 3300013297 | Bacteria | 809 |
| 445 | Ga0157378_11334252 | 3300013297 | Unclassified | 759 |
| 446 | Ga0163162_10045637 | 3300013306 | Bacteria | 4390 |
| 447 | Ga0163162_10154799 | 3300013306 | Bacteria | 2412 |
| 448 | Ga0163162_10216391 | 3300013306 | Unclassified | 2046 |
| 449 | Ga0163162_10513608 | 3300013306 | Bacteria | 1328 |
| 450 | Ga0163162_11307988 | 3300013306 | Bacteria | 824 |
| 451 | Ga0157372_10017516 | 3300013307 | Bacteria | 7687 |
| 452 | Ga0157372_10018031 | 3300013307 | Bacteria | 7588 |
| 453 | Ga0157372_10036359 | 3300013307 | Bacteria | 5427 |
| 454 | Ga0157372_10123198 | 3300013307 | Bacteria | 2980 |
| 455 | Ga0157372_10147826 | 3300013307 | Bacteria | 2710 |
| 456 | Ga0157372_10163721 | 3300013307 | Bacteria | 2571 |
| 457 | Ga0157372_10204408 | 3300013307 | Bacteria | 2288 |
| 458 | Ga0157372_10228842 | 3300013307 | Unclassified | 2155 |
| 459 | Ga0157372_10342416 | 3300013307 | Unclassified | 1742 |
| 460 | Ga0157372_10519682 | 3300013307 | Bacteria | 1388 |
| 461 | Ga0157372_10574289 | 3300013307 | Bacteria | 1314 |
| 462 | Ga0157372_10840159 | 3300013307 | Bacteria | 1066 |
| 463 | Ga0157372_12413639 | 3300013307 | Bacteria | 604 |
| 464 | Ga0157375_10078765 | 3300013308 | Bacteria | 3330 |
| 465 | Ga0157375_10175123 | 3300013308 | Bacteria | 2294 |
| 466 | Ga0157375_10275307 | 3300013308 | Bacteria | 1845 |
| 467 | Ga0157375_10931717 | 3300013308 | Bacteria | 1011 |
| 468 | Ga0157375_10931739 | 3300013308 | Bacteria | 1011 |
| 469 | Ga0157375_11036773 | 3300013308 | Bacteria | 958 |
| 470 | Ga0157375_13616190 | 3300013308 | Unclassified | 514 |
| 471 | Ga0163163_10263428 | 3300014325 | Bacteria | 1775 |
| 472 | Ga0163163_10372999 | 3300014325 | Unclassified | 1484 |
| 473 | Ga0163163_12382349 | 3300014325 | Bacteria | 588 |
| 474 | Ga0157380_10415774 | 3300014326 | Bacteria | 1281 |
| 475 | Ga0157380_11419676 | 3300014326 | Bacteria | 745 |
| 476 | Ga0182008_10011727 | 3300014497 | Bacteria | 4650 |
| 477 | Ga0157377_10075373 | 3300014745 | Unclassified | 1959 |
| 478 | Ga0157377_10155798 | 3300014745 | Bacteria | 1416 |
| 479 | Ga0157377_11580836 | 3300014745 | Unclassified | 524 |
| 480 | Ga0157379_10375431 | 3300014968 | Bacteria | 1304 |
| 481 | Ga0157379_10493113 | 3300014968 | Bacteria | 1135 |
| 482 | Ga0157376_10430077 | 3300014969 | Bacteria | 1283 |
| 483 | Ga0157376_10562482 | 3300014969 | Unclassified | 1130 |
| 484 | Ga0157376_11447054 | 3300014969 | Unclassified | 719 |
| 485 | Ga0182007_10088522 | 3300015262 | Bacteria | 1019 |
| 486 | Ga0182007_10294957 | 3300015262 | Bacteria | 594 |
| 487 | Ga0182005_1206177 | 3300015265 | Bacteria | 593 |
| 488 | Ga0163161_10155292 | 3300017792 | Bacteria | 1742 |
| 489 | Ga0163161_10242091 | 3300017792 | Bacteria | 1403 |
| 490 | Ga0163161_10987467 | 3300017792 | Unclassified | 718 |
| 491 | Ga0197907_10955397 | 3300020069 | Bacteria | 881 |
| 492 | Ga0206356_11089032 | 3300020070 | Bacteria | 1182 |
| 493 | Ga0206356_11492485 | 3300020070 | Bacteria | 1043 |
| 494 | Ga0206356_11542969 | 3300020070 | Bacteria | 521 |
| 495 | Ga0206356_11623018 | 3300020070 | Bacteria | 1419 |
| 496 | Ga0206356_11860846 | 3300020070 | Unclassified | 509 |
| 497 | Ga0206349_1530089 | 3300020075 | Bacteria | 687 |
| 498 | Ga0206355_1078973 | 3300020076 | Bacteria | 987 |
| 499 | Ga0206355_1723175 | 3300020076 | Unclassified | 964 |
| 500 | Ga0206351_10189109 | 3300020077 | Bacteria | 671 |
| 501 | Ga0206351_10372331 | 3300020077 | Unclassified | 516 |
| 502 | Ga0206352_11216042 | 3300020078 | Unclassified | 623 |
| 503 | Ga0206350_10333601 | 3300020080 | Bacteria | 757 |
| 504 | Ga0206350_11441145 | 3300020080 | Bacteria | 891 |
| 505 | Ga0206354_10426956 | 3300020081 | Bacteria | 812 |
| 506 | Ga0206353_10538341 | 3300020082 | Unclassified | 967 |
| 507 | Ga0206353_11659228 | 3300020082 | Bacteria | 517 |
| 508 | Ga0224712_10194356 | 3300022467 | Bacteria | 920 |
| 509 | Ga0224712_10225657 | 3300022467 | Unclassified | 859 |
| 510 | Ga0224712_10579407 | 3300022467 | Unclassified | 547 |
| 511 | Ga0207697_10020771 | 3300025315 | Bacteria | 2687 |
| 512 | Ga0207697_10036882 | 3300025315 | Bacteria | 2003 |
| 513 | Ga0207656_10129576 | 3300025321 | Bacteria | 1181 |
| 514 | Ga0207653_10020217 | 3300025885 | Unclassified | 2106 |
| 515 | Ga0207682_10014329 | 3300025893 | Bacteria | 3087 |
| 516 | Ga0207682_10481367 | 3300025893 | Unclassified | 588 |
| 517 | Ga0207692_10057750 | 3300025898 | Bacteria | 1997 |
| 518 | Ga0207692_10448935 | 3300025898 | Unclassified | 811 |
| 519 | Ga0207642_10032962 | 3300025899 | Bacteria | 2186 |
| 520 | Ga0207642_10738894 | 3300025899 | Bacteria | 622 |
| 521 | Ga0207688_10113594 | 3300025901 | Bacteria | 1574 |
| 522 | Ga0207688_11069656 | 3300025901 | Bacteria | 509 |
| 523 | Ga0207680_10243756 | 3300025903 | Bacteria | 1239 |
| 524 | Ga0207680_10327665 | 3300025903 | Bacteria | 1072 |
| 525 | Ga0207699_10054995 | 3300025906 | Bacteria | 2367 |
| 526 | Ga0207699_10172457 | 3300025906 | Bacteria | 1448 |
| 527 | Ga0207699_10624334 | 3300025906 | Bacteria | 786 |
| 528 | Ga0207699_11020881 | 3300025906 | Bacteria | 612 |
| 529 | Ga0207645_10016651 | 3300025907 | Bacteria | 4863 |
| 530 | Ga0207645_10029906 | 3300025907 | Bacteria | 3511 |
| 531 | Ga0207645_10095771 | 3300025907 | Bacteria | 1911 |
| 532 | Ga0207645_10232199 | 3300025907 | Bacteria | 1218 |
| 533 | Ga0207645_10323857 | 3300025907 | Bacteria | 1028 |
| 534 | Ga0207645_11185611 | 3300025907 | Unclassified | 513 |
| 535 | Ga0207643_10012554 | 3300025908 | Bacteria | 4577 |
| 536 | Ga0207643_10317851 | 3300025908 | Unclassified | 972 |
| 537 | Ga0207705_10603160 | 3300025909 | Bacteria | 854 |
| 538 | Ga0207684_10031189 | 3300025910 | Unclassified | 4536 |
| 539 | Ga0207684_10103621 | 3300025910 | Bacteria | 2433 |
| 540 | Ga0207654_10572295 | 3300025911 | Bacteria | 804 |
| 541 | Ga0207654_10982222 | 3300025911 | Bacteria | 614 |
| 542 | Ga0207654_11139718 | 3300025911 | Unclassified | 568 |
| 543 | Ga0207707_10014574 | 3300025912 | Bacteria | 6848 |
| 544 | Ga0207707_10015856 | 3300025912 | Bacteria | 6572 |
| 545 | Ga0207707_10032593 | 3300025912 | Bacteria | 4560 |
| 546 | Ga0207707_10039418 | 3300025912 | Bacteria | 4129 |
| 547 | Ga0207707_10059039 | 3300025912 | Bacteria | 3337 |
| 548 | Ga0207707_10065914 | 3300025912 | Bacteria | 3153 |
| 549 | Ga0207707_10146842 | 3300025912 | Bacteria | 2062 |
| 550 | Ga0207707_10166288 | 3300025912 | Bacteria | 1928 |
| 551 | Ga0207707_10396764 | 3300025912 | Bacteria | 1185 |
| 552 | Ga0207707_10425247 | 3300025912 | Bacteria | 1138 |
| 553 | Ga0207707_10436192 | 3300025912 | Bacteria | 1122 |
| 554 | Ga0207707_10714939 | 3300025912 | Bacteria | 840 |
| 555 | Ga0207707_11646177 | 3300025912 | Bacteria | 504 |
| 556 | Ga0207695_10003508 | 3300025913 | Bacteria | 21991 |
| 557 | Ga0207695_10004443 | 3300025913 | Bacteria | 19127 |
| 558 | Ga0207695_10006890 | 3300025913 | Bacteria | 14623 |
| 559 | Ga0207695_10028752 | 3300025913 | Bacteria | 6155 |
| 560 | Ga0207695_10123495 | 3300025913 | Bacteria | 2555 |
| 561 | Ga0207695_10235955 | 3300025913 | Bacteria | 1732 |
| 562 | Ga0207671_10344576 | 3300025914 | Bacteria | 1181 |
| 563 | Ga0207693_10008333 | 3300025915 | Bacteria | 8484 |
| 564 | Ga0207693_10613632 | 3300025915 | Bacteria | 846 |
| 565 | Ga0207693_11287376 | 3300025915 | Unclassified | 547 |
| 566 | Ga0207663_10266806 | 3300025916 | Bacteria | 1266 |
| 567 | Ga0207663_11719895 | 3300025916 | Bacteria | 504 |
| 568 | Ga0207660_10000818 | 3300025917 | Bacteria | 20531 |
| 569 | Ga0207660_10002896 | 3300025917 | Bacteria | 11214 |
| 570 | Ga0207660_10033905 | 3300025917 | Bacteria | 3535 |
| 571 | Ga0207660_10059970 | 3300025917 | Bacteria | 2733 |
| 572 | Ga0207660_10092736 | 3300025917 | Bacteria | 2242 |
| 573 | Ga0207660_10211015 | 3300025917 | Bacteria | 1520 |
| 574 | Ga0207660_10218929 | 3300025917 | Bacteria | 1493 |
| 575 | Ga0207660_10278600 | 3300025917 | Bacteria | 1327 |
| 576 | Ga0207660_11170159 | 3300025917 | Bacteria | 626 |
| 577 | Ga0207660_11545141 | 3300025917 | Bacteria | 536 |
| 578 | Ga0207662_10003539 | 3300025918 | Bacteria | 8054 |
| 579 | Ga0207662_10004466 | 3300025918 | Bacteria | 7361 |
| 580 | Ga0207657_10038882 | 3300025919 | Bacteria | 4230 |
| 581 | Ga0207657_10111500 | 3300025919 | Bacteria | 2258 |
| 582 | Ga0207657_10148321 | 3300025919 | Bacteria | 1912 |
| 583 | Ga0207657_10674321 | 3300025919 | Unclassified | 804 |
| 584 | Ga0207649_10026063 | 3300025920 | Bacteria | 3416 |
| 585 | Ga0207649_10355685 | 3300025920 | Unclassified | 1085 |
| 586 | Ga0207649_10398525 | 3300025920 | Bacteria | 1029 |
| 587 | Ga0207649_10711865 | 3300025920 | Bacteria | 779 |
| 588 | Ga0207649_11045494 | 3300025920 | Unclassified | 643 |
| 589 | Ga0207652_10002497 | 3300025921 | Bacteria | 15478 |
| 590 | Ga0207652_10004767 | 3300025921 | Bacteria | 10994 |
| 591 | Ga0207652_10021476 | 3300025921 | Bacteria | 5328 |
| 592 | Ga0207652_10086905 | 3300025921 | Bacteria | 2742 |
| 593 | Ga0207652_10103796 | 3300025921 | Bacteria | 2514 |
| 594 | Ga0207652_10197638 | 3300025921 | Bacteria | 1810 |
| 595 | Ga0207652_10314431 | 3300025921 | Bacteria | 1414 |
| 596 | Ga0207652_10325978 | 3300025921 | Bacteria | 1386 |
| 597 | Ga0207652_10335387 | 3300025921 | Bacteria | 1365 |
| 598 | Ga0207652_10375658 | 3300025921 | Bacteria | 1283 |
| 599 | Ga0207652_10454275 | 3300025921 | Bacteria | 1155 |
| 600 | Ga0207646_10004321 | 3300025922 | Bacteria | 15503 |
| 601 | Ga0207646_10013479 | 3300025922 | Bacteria | 7814 |
| 602 | Ga0207681_10002415 | 3300025923 | Bacteria | 11861 |
| 603 | Ga0207681_10013977 | 3300025923 | Bacteria | 4975 |
| 604 | Ga0207681_10440455 | 3300025923 | Unclassified | 1059 |
| 605 | Ga0207694_10017770 | 3300025924 | Bacteria | 5374 |
| 606 | Ga0207694_10017815 | 3300025924 | Bacteria | 5368 |
| 607 | Ga0207694_10041334 | 3300025924 | Bacteria | 3552 |
| 608 | Ga0207694_10137989 | 3300025924 | Bacteria | 1960 |
| 609 | Ga0207694_10971835 | 3300025924 | Bacteria | 718 |
| 610 | Ga0207650_10173797 | 3300025925 | Bacteria | 1713 |
| 611 | Ga0207650_10210181 | 3300025925 | Bacteria | 1562 |
| 612 | Ga0207650_10954928 | 3300025925 | Bacteria | 729 |
| 613 | Ga0207659_10007815 | 3300025926 | Bacteria | 6606 |
| 614 | Ga0207659_10106456 | 3300025926 | Bacteria | 2124 |
| 615 | Ga0207659_10440069 | 3300025926 | Unclassified | 1096 |
| 616 | Ga0207659_10460170 | 3300025926 | Bacteria | 1072 |
| 617 | Ga0207659_10492158 | 3300025926 | Unclassified | 1037 |
| 618 | Ga0207687_10086323 | 3300025927 | Bacteria | 2278 |
| 619 | Ga0207687_10099200 | 3300025927 | Bacteria | 2140 |
| 620 | Ga0207687_10163444 | 3300025927 | Unclassified | 1711 |
| 621 | Ga0207687_10494852 | 3300025927 | Unclassified | 1020 |
| 622 | Ga0207687_10889106 | 3300025927 | Bacteria | 762 |
| 623 | Ga0207700_10000773 | 3300025928 | Bacteria | 18446 |
| 624 | Ga0207700_10799452 | 3300025928 | Unclassified | 844 |
| 625 | Ga0207664_10014780 | 3300025929 | Bacteria | 5651 |
| 626 | Ga0207664_10083531 | 3300025929 | Bacteria | 2603 |
| 627 | Ga0207664_10174502 | 3300025929 | Bacteria | 1842 |
| 628 | Ga0207664_10242750 | 3300025929 | Bacteria | 1569 |
| 629 | Ga0207664_10673104 | 3300025929 | Bacteria | 930 |
| 630 | Ga0207644_10074312 | 3300025931 | Bacteria | 2495 |
| 631 | Ga0207644_10139062 | 3300025931 | Bacteria | 1868 |
| 632 | Ga0207644_10237320 | 3300025931 | Bacteria | 1450 |
| 633 | Ga0207644_11294695 | 3300025931 | Bacteria | 612 |
| 634 | Ga0207644_11539021 | 3300025931 | Unclassified | 558 |
| 635 | Ga0207644_11616957 | 3300025931 | Unclassified | 543 |
| 636 | Ga0207644_11708123 | 3300025931 | Bacteria | 527 |
| 637 | Ga0207690_10155854 | 3300025932 | Bacteria | 1698 |
| 638 | Ga0207690_10263098 | 3300025932 | Bacteria | 1337 |
| 639 | Ga0207690_10725305 | 3300025932 | Bacteria | 818 |
| 640 | Ga0207690_11348961 | 3300025932 | Bacteria | 596 |
| 641 | Ga0207706_10008341 | 3300025933 | Bacteria | 9554 |
| 642 | Ga0207706_10198599 | 3300025933 | Bacteria | 1759 |
| 643 | Ga0207706_10328157 | 3300025933 | Bacteria | 1331 |
| 644 | Ga0207706_10451175 | 3300025933 | Bacteria | 1112 |
| 645 | Ga0207686_10130616 | 3300025934 | Bacteria | 1722 |
| 646 | Ga0207709_10238216 | 3300025935 | Bacteria | 1322 |
| 647 | Ga0207709_10617346 | 3300025935 | Unclassified | 860 |
| 648 | Ga0207709_10747699 | 3300025935 | Unclassified | 786 |
| 649 | Ga0207670_10023378 | 3300025936 | Bacteria | 3847 |
| 650 | Ga0207670_10547655 | 3300025936 | Bacteria | 945 |
| 651 | Ga0207670_11297989 | 3300025936 | Bacteria | 617 |
| 652 | Ga0207669_10098019 | 3300025937 | Bacteria | 1929 |
| 653 | Ga0207669_10187364 | 3300025937 | Bacteria | 1489 |
| 654 | Ga0207704_10002383 | 3300025938 | Bacteria | 8442 |
| 655 | Ga0207704_10243064 | 3300025938 | Bacteria | 1346 |
| 656 | Ga0207704_10972910 | 3300025938 | Bacteria | 717 |
| 657 | Ga0207665_10000466 | 3300025939 | Bacteria | 27684 |
| 658 | Ga0207665_10195005 | 3300025939 | Bacteria | 1473 |
| 659 | Ga0207665_10446952 | 3300025939 | Unclassified | 991 |
| 660 | Ga0207665_10990476 | 3300025939 | Unclassified | 668 |
| 661 | Ga0207691_10027348 | 3300025940 | Bacteria | 5346 |
| 662 | Ga0207691_10041030 | 3300025940 | Unclassified | 4275 |
| 663 | Ga0207691_10164568 | 3300025940 | Bacteria | 1944 |
| 664 | Ga0207691_10326229 | 3300025940 | Unclassified | 1316 |
| 665 | Ga0207691_10638468 | 3300025940 | Bacteria | 900 |
| 666 | Ga0207691_11637636 | 3300025940 | Bacteria | 522 |
| 667 | Ga0207711_10047601 | 3300025941 | Bacteria | 3667 |
| 668 | Ga0207711_10213627 | 3300025941 | Bacteria | 1762 |
| 669 | Ga0207661_10001131 | 3300025944 | Bacteria | 17800 |
| 670 | Ga0207661_10033051 | 3300025944 | Bacteria | 4012 |
| 671 | Ga0207661_10079709 | 3300025944 | Unclassified | 2700 |
| 672 | Ga0207661_10152230 | 3300025944 | Bacteria | 2000 |
| 673 | Ga0207661_10188109 | 3300025944 | Bacteria | 1808 |
| 674 | Ga0207661_10258574 | 3300025944 | Unclassified | 1550 |
| 675 | Ga0207661_10306176 | 3300025944 | Unclassified | 1425 |
| 676 | Ga0207661_10402411 | 3300025944 | Bacteria | 1241 |
| 677 | Ga0207661_10436894 | 3300025944 | Bacteria | 1190 |
| 678 | Ga0207661_10453001 | 3300025944 | Bacteria | 1169 |
| 679 | Ga0207661_10498764 | 3300025944 | Bacteria | 1112 |
| 680 | Ga0207661_10894206 | 3300025944 | Unclassified | 818 |
| 681 | Ga0207661_10943943 | 3300025944 | Bacteria | 794 |
| 682 | Ga0207661_10992203 | 3300025944 | Bacteria | 773 |
| 683 | Ga0207661_11019028 | 3300025944 | Bacteria | 762 |
| 684 | Ga0207661_11786700 | 3300025944 | Unclassified | 560 |
| 685 | Ga0207661_11909820 | 3300025944 | Bacteria | 539 |
| 686 | Ga0207679_10172202 | 3300025945 | Bacteria | 1783 |
| 687 | Ga0207679_10269921 | 3300025945 | Bacteria | 1454 |
| 688 | Ga0207679_10470072 | 3300025945 | Bacteria | 1118 |
| 689 | Ga0207679_10767680 | 3300025945 | Unclassified | 877 |
| 690 | Ga0207679_10802003 | 3300025945 | Bacteria | 858 |
| 691 | Ga0207679_11181746 | 3300025945 | Bacteria | 702 |
| 692 | Ga0207667_10173101 | 3300025949 | Bacteria | 2219 |
| 693 | Ga0207667_10406468 | 3300025949 | Bacteria | 1386 |
| 694 | Ga0207667_11058113 | 3300025949 | Bacteria | 796 |
| 695 | Ga0207651_10017001 | 3300025960 | Bacteria | 4282 |
| 696 | Ga0207651_10883538 | 3300025960 | Bacteria | 795 |
| 697 | Ga0207651_11242957 | 3300025960 | Bacteria | 669 |
| 698 | Ga0207651_11875001 | 3300025960 | Bacteria | 539 |
| 699 | Ga0207712_10000403 | 3300025961 | Bacteria | 37358 |
| 700 | Ga0207712_10550917 | 3300025961 | Unclassified | 992 |
| 701 | Ga0207712_11225899 | 3300025961 | Bacteria | 670 |
| 702 | Ga0207668_10009579 | 3300025972 | Bacteria | 5814 |
| 703 | Ga0207668_10159003 | 3300025972 | Bacteria | 1758 |
| 704 | Ga0207640_10004360 | 3300025981 | Bacteria | 7669 |
| 705 | Ga0207640_10076568 | 3300025981 | Bacteria | 2271 |
| 706 | Ga0207640_10127247 | 3300025981 | Bacteria | 1836 |
| 707 | Ga0207640_10836713 | 3300025981 | Bacteria | 800 |
| 708 | Ga0207640_10837834 | 3300025981 | Unclassified | 799 |
| 709 | Ga0207640_11570828 | 3300025981 | Bacteria | 592 |
| 710 | Ga0207658_10161741 | 3300025986 | Unclassified | 1836 |
| 711 | Ga0207658_10298313 | 3300025986 | Bacteria | 1387 |
| 712 | Ga0207658_10545267 | 3300025986 | Bacteria | 1037 |
| 713 | Ga0207677_10004927 | 3300026023 | Bacteria | 7208 |
| 714 | Ga0207677_10323075 | 3300026023 | Bacteria | 1283 |
| 715 | Ga0207677_10686557 | 3300026023 | Unclassified | 907 |
| 716 | Ga0207677_11115775 | 3300026023 | Bacteria | 719 |
| 717 | Ga0207703_10261828 | 3300026035 | Bacteria | 1563 |
| 718 | Ga0207703_10324696 | 3300026035 | Bacteria | 1410 |
| 719 | Ga0207639_10006980 | 3300026041 | Bacteria | 7695 |
| 720 | Ga0207639_10092619 | 3300026041 | Bacteria | 2422 |
| 721 | Ga0207639_10328100 | 3300026041 | Bacteria | 1361 |
| 722 | Ga0207639_10472752 | 3300026041 | Bacteria | 1141 |
| 723 | Ga0207639_10652957 | 3300026041 | Bacteria | 973 |
| 724 | Ga0207678_10076175 | 3300026067 | Bacteria | 2873 |
| 725 | Ga0207678_10183539 | 3300026067 | Bacteria | 1787 |
| 726 | Ga0207678_10573108 | 3300026067 | Bacteria | 988 |
| 727 | Ga0207678_10671584 | 3300026067 | Unclassified | 911 |
| 728 | Ga0207678_10918209 | 3300026067 | Bacteria | 774 |
| 729 | Ga0207708_10006225 | 3300026075 | Bacteria | 8840 |
| 730 | Ga0207708_10019142 | 3300026075 | Bacteria | 5157 |
| 731 | Ga0207708_10670505 | 3300026075 | Bacteria | 884 |
| 732 | Ga0207708_10936986 | 3300026075 | Bacteria | 751 |
| 733 | Ga0207702_10089912 | 3300026078 | Bacteria | 2686 |
| 734 | Ga0207702_10406375 | 3300026078 | Bacteria | 1314 |
| 735 | Ga0207702_10704189 | 3300026078 | Bacteria | 995 |
| 736 | Ga0207702_11668201 | 3300026078 | Unclassified | 630 |
| 737 | Ga0207702_11896634 | 3300026078 | Unclassified | 587 |
| 738 | Ga0207641_10524299 | 3300026088 | Unclassified | 1153 |
| 739 | Ga0207648_10017109 | 3300026089 | Bacteria | 6607 |
| 740 | Ga0207648_10034209 | 3300026089 | Bacteria | 4481 |
| 741 | Ga0207648_10076480 | 3300026089 | Unclassified | 2918 |
| 742 | Ga0207648_10125655 | 3300026089 | Bacteria | 2256 |
| 743 | Ga0207648_10145068 | 3300026089 | Bacteria | 2094 |
| 744 | Ga0207648_10341086 | 3300026089 | Bacteria | 1349 |
| 745 | Ga0207648_10455817 | 3300026089 | Unclassified | 1165 |
| 746 | Ga0207676_10036095 | 3300026095 | Bacteria | 3758 |
| 747 | Ga0207676_10223408 | 3300026095 | Bacteria | 1679 |
| 748 | Ga0207674_10005615 | 3300026116 | Bacteria | 14866 |
| 749 | Ga0207674_10014941 | 3300026116 | Bacteria | 8555 |
| 750 | Ga0207674_10209381 | 3300026116 | Bacteria | 1899 |
| 751 | Ga0207674_10306503 | 3300026116 | Bacteria | 1537 |
| 752 | Ga0207674_10505316 | 3300026116 | Bacteria | 1168 |
| 753 | Ga0207675_100366981 | 3300026118 | Bacteria | 1413 |
| 754 | Ga0207683_10012414 | 3300026121 | Bacteria | 7269 |
| 755 | Ga0207683_10395115 | 3300026121 | Bacteria | 1272 |
| 756 | Ga0207683_10405432 | 3300026121 | Bacteria | 1254 |
| 757 | Ga0207683_11628457 | 3300026121 | Unclassified | 595 |
| 758 | Ga0207698_10027735 | 3300026142 | Bacteria | 4026 |
| 759 | Ga0207698_10070046 | 3300026142 | Bacteria | 2777 |
| 760 | Ga0207698_10094497 | 3300026142 | Bacteria | 2458 |
| 761 | Ga0207698_10153048 | 3300026142 | Bacteria | 2005 |
| 762 | Ga0207698_10269601 | 3300026142 | Bacteria | 1569 |
| 763 | Ga0207698_10284098 | 3300026142 | Bacteria | 1532 |
| 764 | Ga0207698_10725673 | 3300026142 | Bacteria | 991 |
| 765 | Ga0207698_11145611 | 3300026142 | Bacteria | 791 |
| 766 | Ga0207698_11411028 | 3300026142 | Bacteria | 711 |
| 767 | Ga0209981_1013967 | 3300027378 | Bacteria | 1118 |
| 768 | Ga0210000_1002573 | 3300027462 | Bacteria | 2587 |
| 769 | Ga0209999_1002764 | 3300027543 | Bacteria | 3108 |
| 770 | Ga0209966_1009819 | 3300027695 | Bacteria | 1715 |
| 771 | Ga0268266_11214417 | 3300028379 | Bacteria | 729 |
| 772 | Ga0268265_10137082 | 3300028380 | Bacteria | 2043 |
| 773 | Ga0268264_10406727 | 3300028381 | Bacteria | 1309 |
| 774 | Ga0316180_1134937 | 3300030736 | Bacteria | 797 |
| 775 | Ga0316182_1362494 | 3300030745 | Bacteria | 694 |
| 776 | Ga0307408_100209033 | 3300031548 | Bacteria | 1585 |
| 777 | Ga0307408_101045005 | 3300031548 | Bacteria | 755 |
| 778 | Ga0307408_102347908 | 3300031548 | Bacteria | 517 |
| 779 | Ga0307408_102458346 | 3300031548 | Unclassified | 506 |
| 780 | Ga0316578_10657619 | 3300031728 | Bacteria | 612 |
| 781 | Ga0307405_10015090 | 3300031731 | Bacteria | 4173 |
| 782 | Ga0307405_10448704 | 3300031731 | Bacteria | 1022 |
| 783 | Ga0307405_10801686 | 3300031731 | Bacteria | 789 |
| 784 | Ga0307413_10099233 | 3300031824 | Bacteria | 1919 |
| 785 | Ga0307413_10412579 | 3300031824 | Bacteria | 1061 |
| 786 | Ga0307410_10077786 | 3300031852 | Bacteria | 2320 |
| 787 | Ga0307410_10140438 | 3300031852 | Bacteria | 1786 |
| 788 | Ga0307410_10202544 | 3300031852 | Bacteria | 1516 |
| 789 | Ga0307410_10339023 | 3300031852 | Bacteria | 1198 |
| 790 | Ga0307406_10041009 | 3300031901 | Bacteria | 2882 |
| 791 | Ga0307406_10050359 | 3300031901 | Bacteria | 2640 |
| 792 | Ga0307406_11301176 | 3300031901 | Unclassified | 634 |
| 793 | Ga0307406_11639798 | 3300031901 | Bacteria | 569 |
| 794 | Ga0307407_10129073 | 3300031903 | Unclassified | 1614 |
| 795 | Ga0307407_10342139 | 3300031903 | Bacteria | 1056 |
| 796 | Ga0307407_10573274 | 3300031903 | Bacteria | 837 |
| 797 | Ga0307412_10157309 | 3300031911 | Bacteria | 1684 |
| 798 | Ga0307409_100052967 | 3300031995 | Bacteria | 3115 |
| 799 | Ga0307409_100140448 | 3300031995 | Bacteria | 2080 |
| 800 | Ga0307409_100256825 | 3300031995 | Bacteria | 1601 |
| 801 | Ga0307409_100737466 | 3300031995 | Bacteria | 988 |
| 802 | Ga0307409_101015184 | 3300031995 | Bacteria | 848 |
| 803 | Ga0307416_100102135 | 3300032002 | Bacteria | 2499 |
| 804 | Ga0307416_100331187 | 3300032002 | Bacteria | 1530 |
| 805 | Ga0307416_100699242 | 3300032002 | Bacteria | 1103 |
| 806 | Ga0307416_101367355 | 3300032002 | Unclassified | 814 |
| 807 | Ga0307414_10154256 | 3300032004 | Unclassified | 1816 |
| 808 | Ga0307414_10588620 | 3300032004 | Bacteria | 996 |
| 809 | Ga0307414_11835712 | 3300032004 | Bacteria | 566 |
| 810 | Ga0307411_10044355 | 3300032005 | Unclassified | 2852 |
| 811 | Ga0307411_10297372 | 3300032005 | Unclassified | 1293 |
| 812 | Ga0307411_10420843 | 3300032005 | Bacteria | 1110 |
| 813 | Ga0307411_10903345 | 3300032005 | Bacteria | 785 |
| 814 | Ga0307415_100086437 | 3300032126 | Bacteria | 2256 |
| 815 | Ga0307415_101057629 | 3300032126 | Bacteria | 757 |
| 816 | Ga0373948_0008842 | 3300034817 | Bacteria | 1725 |
| 817 | Ga0373926_0084345 | 3300035083 | Bacteria | 1177 |
| 818 | Ga0373934_0000463 | 3300035086 | Bacteria | 14190 |
| 819 | Ga0373944_0036358 | 3300035089 | Bacteria | 1504 |
| 820 | Ga0373949_0023357 | 3300035090 | Bacteria | 1431 |
| 821 | Ga0373951_0110682 | 3300035091 | Bacteria | 739 |
| 822 | Ga0373923_0001722 | 3300035111 | Bacteria | 6433 |
| 823 | Ga0373936_0054724 | 3300035113 | Unclassified | 1619 |
| 824 | Ga0373941_0011511 | 3300035115 | Unclassified | 2287 |
| 825 | Ga0373945_0005281 | 3300035116 | Bacteria | 4133 |
| 826 | Ga0373953_0022490 | 3300035117 | Bacteria | 2378 |
| 827 | Ga0373954_0065865 | 3300035118 | Bacteria | 1715 |
| 828 | Ga0373956_0000644 | 3300035119 | Bacteria | 14364 |
| 829 | Ga0373957_0025840 | 3300035120 | Bacteria | 2120 |
| 830 | Ga0373957_0238908 | 3300035120 | Bacteria | 763 |
| 831 | Ga0373960_0321557 | 3300035121 | Bacteria | 580 |
| 832 | Ga0373943_0000618 | 3300035170 | Bacteria | 15411 |
| 833 | Ga0373946_0035605 | 3300035171 | Unclassified | 2015 |
| 834 | Ga0373955_0009773 | 3300035172 | Bacteria | 4507 |
| 835 | Ga0373955_0331780 | 3300035172 | Bacteria | 920 |
| 836 | Ga0373961_0368125 | 3300035241 | Bacteria | 545 |
| 837 | Ga0373931_0110974 | 3300035691 | Bacteria | 1556 |
| 838 | Ga0373931_0858534 | 3300035691 | Bacteria | 608 |
| 839 | Ga0373931_1220283 | 3300035691 | Bacteria | 515 |
| 840 | Ga0373935_0001230 | 3300035692 | Bacteria | 14148 |
| 841 | Ga0373927_0010997 | 3300035695 | Bacteria | 6027 |
| 842 | Ga0373927_0113627 | 3300035695 | Bacteria | 1765 |
| 843 | Ga0373933_0004688 | 3300035724 | Bacteria | 7486 |
| 844 | Ga0373947_0000019 | 3300035725 | Bacteria | 101479 |
| 845 | Ga0373937_0000142 | 3300036401 | Bacteria | 69511 |
| 846 | Ga0373937_1416903 | 3300036401 | Bacteria | 643 |
| 847 | Ga0316582_0172303 | 3300036647 | Bacteria | 1470 |
| 848 | Ga0373925_0000303 | 3300037068 | Bacteria | 51655 |
| 849 | Ga0395900_0547098 | 3300037418 | Bacteria | 1103 |
| 850 | Ga0395905_0054759 | 3300037471 | Bacteria | 3733 |
| 851 | Ga0395905_0602041 | 3300037471 | Bacteria | 1001 |
| 852 | Ga0395901_1036988 | 3300038443 | Unclassified | 794 |
| 853 | Ga0242420_023461 | 3300038996 | Bacteria | 1114 |
| 854 | Ga0436365_0141229 | 3300039437 | Bacteria | 2264 |
| 855 | Ga0436365_1138491 | 3300039437 | Unclassified | 1024 |
| 856 | Ga0451839_0967978 | 3300041496 | Bacteria | 803 |
| 857 | Ga0451853_1892066 | 3300041512 | Unclassified | 676 |
| 858 | Ga0451853_3935002 | 3300041512 | Bacteria | 1203 |
| 859 | Ga0466966_0192934 | 3300044684 | Bacteria | 1234 |
| 860 | Ga0466963_0289789 | 3300044694 | Bacteria | 1151 |
| 861 | Ga0466963_0749985 | 3300044694 | Bacteria | 689 |
| 862 | Ga0466963_0777870 | 3300044694 | Bacteria | 675 |
| 863 | Ga0466964_0470530 | 3300044706 | Unclassified | 670 |
| 864 | Ga0466959_0145435 | 3300045049 | Bacteria | 1673 |
| 865 | Ga0466958_0083501 | 3300045836 | Bacteria | 1969 |
| 866 | Ga0466958_0088156 | 3300045836 | Bacteria | 1917 |
| 867 | Ga0466958_0201449 | 3300045836 | Bacteria | 1267 |
| 868 | Ga0466967_0269257 | 3300045976 | Bacteria | 1632 |
| 869 | Ga0466967_0799220 | 3300045976 | Bacteria | 937 |
| 870 | Ga0466967_1200499 | 3300045976 | Bacteria | 756 |
| 871 | Ga0466967_1347879 | 3300045976 | Bacteria | 711 |
| 872 | Ga0495592_0026016 | 3300046454 | Bacteria | 4439 |
| 873 | Ga0495592_0602698 | 3300046454 | Bacteria | 670 |
| 874 | Ga0495651_0000723 | 3300046462 | Bacteria | 25581 |
| 875 | Ga0495651_0580264 | 3300046462 | Bacteria | 709 |
| 876 | Ga0495651_0795701 | 3300046462 | Bacteria | 584 |
| 877 | Ga0495651_0885881 | 3300046462 | Bacteria | 547 |
| 878 | Ga0495653_0003352 | 3300046463 | Bacteria | 12877 |
| 879 | Ga0495580_0000426 | 3300046472 | Bacteria | 34866 |
| 880 | Ga0495582_0000045 | 3300046473 | Bacteria | 62705 |
| 881 | Ga0495639_0000403 | 3300046475 | Bacteria | 20520 |
| 882 | Ga0495639_0286260 | 3300046475 | Unclassified | 820 |
| 883 | Ga0495662_0392431 | 3300046476 | Bacteria | 682 |
| 884 | Ga0495664_0569994 | 3300046477 | Bacteria | 674 |
| 885 | Ga0495594_0075984 | 3300046499 | Unclassified | 1873 |
| 886 | Ga0495594_0477202 | 3300046499 | Bacteria | 709 |
| 887 | Ga0495608_0002935 | 3300046511 | Bacteria | 12203 |
| 888 | Ga0495608_0032534 | 3300046511 | Bacteria | 3525 |
| 889 | Ga0495608_0184800 | 3300046511 | Bacteria | 1318 |
| 890 | Ga0495618_0333188 | 3300046514 | Bacteria | 938 |
| 891 | Ga0495628_0000674 | 3300046516 | Bacteria | 31380 |
| 892 | Ga0495630_0003749 | 3300046517 | Bacteria | 10605 |
| 893 | Ga0495630_0012293 | 3300046517 | Bacteria | 6212 |
| 894 | Ga0495630_0077935 | 3300046517 | Bacteria | 2498 |
| 895 | Ga0495630_0217970 | 3300046517 | Bacteria | 1457 |
| 896 | Ga0495643_0064527 | 3300046522 | Bacteria | 1935 |
| 897 | Ga0495663_0118759 | 3300046525 | Unclassified | 884 |
| 898 | Ga0495663_0174665 | 3300046525 | Unclassified | 742 |
| 899 | Ga0495666_0500949 | 3300046526 | Bacteria | 543 |
| 900 | Ga0495652_0017042 | 3300046529 | Bacteria | 6490 |
| 901 | Ga0495652_0353847 | 3300046529 | Bacteria | 1051 |
| 902 | Ga0495652_0856079 | 3300046529 | Bacteria | 602 |
| 903 | Ga0495665_0000014 | 3300046531 | Bacteria | 67903 |
| 904 | Ga0495665_0012549 | 3300046531 | Bacteria | 4587 |
| 905 | Ga0495665_0608461 | 3300046531 | Bacteria | 546 |
| 906 | Ga0495640_0103343 | 3300046533 | Bacteria | 1868 |
| 907 | Ga0495586_0247767 | 3300046535 | Bacteria | 1016 |
| 908 | Ga0495587_0000899 | 3300046536 | Bacteria | 19712 |
| 909 | Ga0495587_0033174 | 3300046536 | Bacteria | 3118 |
| 910 | Ga0495598_0060196 | 3300046537 | Bacteria | 1169 |
| 911 | Ga0495621_0132701 | 3300046539 | Bacteria | 970 |
| 912 | Ga0495645_0000642 | 3300046543 | Bacteria | 24105 |
| 913 | Ga0495645_0197509 | 3300046543 | Bacteria | 1367 |
| 914 | Ga0495645_0399672 | 3300046543 | Unclassified | 876 |
| 915 | Ga0495645_0947848 | 3300046543 | Bacteria | 509 |
| 916 | Ga0495622_0296356 | 3300046557 | Bacteria | 705 |
| 917 | Ga0495667_0000783 | 3300046559 | Bacteria | 20393 |
| 918 | Ga0495667_0500999 | 3300046559 | Bacteria | 761 |
| 919 | Ga0495667_0829180 | 3300046559 | Bacteria | 569 |
| 920 | Ga0495656_0421325 | 3300046615 | Unclassified | 700 |
| 921 | Ga0495634_0167420 | 3300046642 | Unclassified | 1383 |
| 922 | Ga0495634_0231004 | 3300046642 | Bacteria | 1138 |
| 923 | Ga0495635_0000476 | 3300046663 | Bacteria | 25343 |
| 924 | Ga0495635_0049264 | 3300046663 | Bacteria | 2903 |
| 925 | Ga0495635_0125122 | 3300046663 | Unclassified | 1753 |
| 926 | Ga0495635_0237297 | 3300046663 | Bacteria | 1231 |
| 927 | Ga0495659_0047114 | 3300046664 | Bacteria | 1558 |
| 928 | Ga0495588_0000923 | 3300046674 | Bacteria | 12797 |
| 929 | Ga0495657_0429893 | 3300046675 | Bacteria | 775 |
| 930 | Ga0495657_0904031 | 3300046675 | Bacteria | 502 |
| 931 | Ga0495599_0000524 | 3300046678 | Bacteria | 22058 |
| 932 | Ga0495623_0000581 | 3300046679 | Bacteria | 24383 |
| 933 | Ga0495646_0005155 | 3300046680 | Bacteria | 8244 |
| 934 | Ga0495646_0443223 | 3300046680 | Bacteria | 671 |
| 935 | Ga0495658_0000038 | 3300046683 | Bacteria | 65836 |
| 936 | Ga0495669_0058544 | 3300046684 | Unclassified | 1739 |
| 937 | Ga0495669_0080218 | 3300046684 | Bacteria | 1497 |
| 938 | Ga0495669_0179647 | 3300046684 | Bacteria | 1009 |
| 939 | Ga0495613_0012452 | 3300046689 | Bacteria | 6321 |
| 940 | Ga0495613_0411479 | 3300046689 | Bacteria | 921 |
| 941 | Ga0495613_0429823 | 3300046689 | Bacteria | 897 |
| 942 | Ga0495613_1062370 | 3300046689 | Bacteria | 518 |
| 943 | Ga0495624_0475835 | 3300046690 | Bacteria | 748 |
| 944 | Ga0495670_0129844 | 3300046691 | Bacteria | 1313 |
| 945 | Ga0495600_0000452 | 3300046809 | Bacteria | 21257 |
| 946 | Ga0495581_0000112 | 3300047315 | Bacteria | 34426 |
| 947 | Ga0495604_0000592 | 3300047317 | Bacteria | 31436 |
| 948 | Ga0495604_0091315 | 3300047317 | Bacteria | 2259 |
| 949 | Ga0495604_0369920 | 3300047317 | Bacteria | 949 |
| 950 | Ga0495604_0983035 | 3300047317 | Bacteria | 523 |
| 951 | Ga0495674_0004595 | 3300047319 | Bacteria | 13279 |
| 952 | Ga0495674_0683776 | 3300047319 | Bacteria | 806 |
| 953 | Ga0495680_0006077 | 3300047322 | Bacteria | 11278 |
| 954 | Ga0495680_0177063 | 3300047322 | Bacteria | 1541 |
| 955 | Ga0495680_0373402 | 3300047322 | Bacteria | 989 |
| 956 | Ga0495675_0001981 | 3300047444 | Bacteria | 12224 |
| 957 | Ga0495675_0381818 | 3300047444 | Bacteria | 824 |
| 958 | Ga0495675_0413452 | 3300047444 | Bacteria | 785 |
| 959 | Ga0495675_0742824 | 3300047444 | Bacteria | 547 |
| 960 | Ga0495685_149135 | 3300047447 | Bacteria | 760 |
| 961 | Ga0495684_0001660 | 3300047471 | Bacteria | 17872 |
| 962 | Ga0495684_0256043 | 3300047471 | Bacteria | 1271 |
| 963 | Ga0495684_1043863 | 3300047471 | Bacteria | 516 |
| 964 | Ga0495593_0000188 | 3300047673 | Bacteria | 32373 |
| 965 | Ga0495593_0724597 | 3300047673 | Bacteria | 500 |
| 966 | Ga0495602_0003690 | 3300048088 | Bacteria | 15888 |
| 967 | Ga0495602_0642928 | 3300048088 | Bacteria | 725 |
| 968 | Ga0495602_0678813 | 3300048088 | Bacteria | 701 |
| 969 | Ga0495602_0679160 | 3300048088 | Bacteria | 701 |
| 970 | Ga0495614_0000013 | 3300048089 | Bacteria | 57032 |
| 971 | Ga0496100_0415240 | 3300048903 | Bacteria | 1027 |
| 972 | Ga0496101_0602988 | 3300048904 | Bacteria | 868 |
| 973 | Ga0496101_1237614 | 3300048904 | Bacteria | 584 |
| 974 | Ga0496104_0090136 | 3300048907 | Bacteria | 2930 |
| 975 | Ga0496105_0168845 | 3300048908 | Bacteria | 1794 |
| 976 | Ga0496106_0424884 | 3300048909 | Bacteria | 1068 |
| 977 | Ga0496107_1322151 | 3300048910 | Bacteria | 515 |
| 978 | Ga0496108_0087841 | 3300048911 | Bacteria | 2641 |
| 979 | Ga0496109_0252506 | 3300048912 | Bacteria | 1661 |
| 980 | Ga0496112_0038661 | 3300048915 | Bacteria | 4660 |
| 981 | Ga0496112_0062878 | 3300048915 | Bacteria | 3662 |
| 982 | Ga0496112_0533269 | 3300048915 | Bacteria | 1108 |
| 983 | Ga0496112_1048747 | 3300048915 | Bacteria | 734 |
| 984 | Ga0496113_0037466 | 3300048916 | Bacteria | 3559 |
| 985 | Ga0496114_0911149 | 3300048917 | Bacteria | 761 |
| 986 | Ga0496115_0136899 | 3300048918 | Bacteria | 2019 |
| 987 | Ga0501306_099691 | 3300049127 | Bacteria | 518 |
| 988 | Ga0501307_089670 | 3300049162 | Bacteria | 512 |
| 989 | Ga0501316_058577 | 3300049532 | Archaea | 566 |
| 990 | Ga0501316_076459 | 3300049532 | Bacteria | 513 |
| 991 | Ga0501317_096461 | 3300049533 | Bacteria | 529 |
| 992 | Ga0501321_052904 | 3300049537 | Bacteria | 598 |
| 993 | Ga0501031_0128102 | 3300049568 | Bacteria | 1658 |
| 994 | Ga0501033_0028071 | 3300049570 | Bacteria | 4230 |
| 995 | Ga0501034_0082214 | 3300049571 | Bacteria | 3223 |
| 996 | Ga0501036_0015341 | 3300049572 | Bacteria | 6399 |
| 997 | Ga0501036_0166847 | 3300049572 | Bacteria | 1856 |
| 998 | Ga0501038_0042595 | 3300049574 | Bacteria | 3954 |
| 999 | Ga0501039_0217063 | 3300049575 | Bacteria | 1504 |
| 1000 | Ga0501040_0213517 | 3300049576 | Bacteria | 1372 |
| 1001 | Ga0501041_0313543 | 3300049577 | Bacteria | 989 |
| 1002 | Ga0501042_0172110 | 3300049578 | Bacteria | 1562 |
| 1003 | Ga0501042_0623750 | 3300049578 | Bacteria | 784 |
| 1004 | Ga0501046_0036969 | 3300049580 | Bacteria | 3926 |
| 1005 | Ga0501047_0245214 | 3300049581 | Bacteria | 1641 |
| 1006 | Ga0501070_0046113 | 3300049586 | Bacteria | 3625 |
| 1007 | Ga0501072_0324535 | 3300049588 | Bacteria | 1223 |
| 1008 | Ga0501074_0126135 | 3300049590 | Bacteria | 1831 |
| 1009 | Ga0501074_0443002 | 3300049590 | Bacteria | 921 |
| 1010 | Ga0501201_028729 | 3300049651 | Bacteria | 624 |
| 1011 | Ga0501235_098770 | 3300049669 | Unclassified | 711 |
| 1012 | Ga0501249_135073 | 3300049679 | Bacteria | 611 |
| 1013 | Ga0501257_146105 | 3300049686 | Bacteria | 649 |
| 1014 | Ga0501229_054342 | 3300049706 | Bacteria | 598 |
| 1015 | Ga0501079_0160259 | 3300049741 | Bacteria | 1754 |
| 1016 | Ga0501080_0554634 | 3300049742 | Bacteria | 1023 |
| 1017 | Ga0501080_1796127 | 3300049742 | Bacteria | 515 |
| 1018 | Ga0501081_0057133 | 3300049743 | Bacteria | 2698 |
| 1019 | Ga0501081_0177973 | 3300049743 | Bacteria | 1537 |
| 1020 | Ga0501264_044742 | 3300049761 | Bacteria | 554 |
| 1021 | Ga0501273_020123 | 3300049770 | Bacteria | 899 |
| 1022 | Ga0501035_0077656 | 3300049822 | Bacteria | 2934 |
| 1023 | Ga0501044_0050994 | 3300049823 | Bacteria | 4268 |
| 1024 | Ga0501045_0072581 | 3300049824 | Bacteria | 2534 |
| 1025 | nmdc:mga05p37_1294589_c1 | 3300050507 | Bacteria | 744 |
| 1026 | nmdc:mga05p37_236139_c1 | 3300050507 | Bacteria | 2200 |
| 1027 | nmdc:mga09592_217138_c1 | 3300050508 | Unclassified | 1657 |
| 1028 | nmdc:mga09592_69437_c1 | 3300050508 | Bacteria | 2989 |
| 1029 | nmdc:mga0qj67_5557_c1 | 3300050509 | Bacteria | 9219 |
| 1030 | nmdc:mga06r32_1430251_c1 | 3300050510 | Bacteria | 633 |
| 1031 | nmdc:mga06r32_178005_c1 | 3300050510 | Unclassified | 2112 |
| 1032 | nmdc:mga06r32_185170_c1 | 3300050510 | Bacteria | 2069 |
| 1033 | nmdc:mga08y16_56756_c1 | 3300050511 | Unclassified | 4092 |
| 1034 | nmdc:mga08y16_742576_c1 | 3300050511 | Bacteria | 978 |
| 1035 | nmdc:mga0n895_184069_c1 | 3300050512 | Bacteria | 2120 |
| 1036 | nmdc:mga0n895_975465_c1 | 3300050512 | Bacteria | 830 |
| 1037 | nmdc:mga0rr50_124612_c1 | 3300050513 | Bacteria | 2055 |
| 1038 | nmdc:mga08x19_150445_c1 | 3300050514 | Bacteria | 1576 |
| 1039 | nmdc:mga08x19_196401_c1 | 3300050514 | Bacteria | 1382 |
| 1040 | nmdc:mga08x19_3616_c1 | 3300050514 | Bacteria | 9206 |
| 1041 | nmdc:mga08x19_5563_c1 | 3300050514 | Bacteria | 7450 |
| 1042 | nmdc:mga0a205_892667_c1 | 3300050515 | Bacteria | 736 |
| 1043 | Ga0495601_0005901 | 3300053077 | Bacteria | 7141 |
| 1044 | Ga0495612_0018548 | 3300053078 | Bacteria | 2785 |
| 1045 | Ga0495619_0003300 | 3300053085 | Bacteria | 10427 |
| 1046 | Ga0495619_0540789 | 3300053085 | Bacteria | 800 |
| 1047 | Ga0501084_0192633 | 3300054114 | Bacteria | 1720 |
| 1048 | Ga0501084_0714380 | 3300054114 | Bacteria | 845 |
| 1049 | Ga0590075_141592 | 3300059424 | Bacteria | 633 |
| 1050 | Ga0587066_187366 | 3300059490 | Bacteria | 537 |
| 1051 | Ga0587066_197312 | 3300059490 | Bacteria | 527 |
| 1052 | Ga0587080_180016 | 3300059503 | Bacteria | 506 |
| 1053 | Ga0587082_140745 | 3300059504 | Bacteria | 562 |
| 1054 | Ga0587088_042385 | 3300059508 | Unclassified | 862 |
| 1055 | Ga0587088_107474 | 3300059508 | Unclassified | 630 |
| 1056 | Ga0587088_175248 | 3300059508 | Bacteria | 534 |
| 1057 | Ga0587091_029655 | 3300059511 | Bacteria | 1018 |
| 1058 | Ga0587091_167816 | 3300059511 | Bacteria | 569 |
| 1059 | Ga0587094_022552 | 3300059513 | Bacteria | 925 |
| 1060 | Ga0587101_085480 | 3300059623 | Bacteria | 605 |
| 1061 | Ga0587115_036883 | 3300059626 | Unclassified | 749 |
| 1062 | Ga0587115_122384 | 3300059626 | Bacteria | 502 |
| 1063 | Ga0587128_028052 | 3300059630 | Bacteria | 914 |
| 1064 | Ga0587067_135511 | 3300059640 | Unclassified | 605 |
| 1065 | Ga0587067_188716 | 3300059640 | Bacteria | 541 |
| 1066 | Ga0587069_125180 | 3300059642 | Unclassified | 549 |
| 1067 | Ga0587075_024895 | 3300059644 | Unclassified | 916 |
| 1068 | Ga0587075_144129 | 3300059644 | Bacteria | 511 |
| 1069 | Ga0587079_034151 | 3300059647 | Bacteria | 994 |
| 1070 | Ga0587107_088081 | 3300059652 | Bacteria | 595 |
| 1071 | Ga0587114_006593 | 3300059655 | Bacteria | 1303 |
| 1072 | Ga0587119_034582 | 3300059658 | Bacteria | 704 |
| 1073 | Ga0501082_0295535 | 3300060353 | Bacteria | 1410 |
| 1074 | Ga0501082_0487679 | 3300060353 | Bacteria | 1077 |
| 1075 | Ga0501082_1179277 | 3300060353 | Bacteria | 669 |
| 1076 | Ga0530510_0170125 | 3300061734 | Bacteria | 1614 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031995 | Ga0307409_100140448 | Ga0307409_1001404482 | 96 |
| 2 | 3300049127 | Ga0501306_099691 | Ga0501306_099691_119_502 | 96 |
| 3 | 3300049162 | Ga0501307_089670 | Ga0501307_089670_22_405 | 96 |
| 4 | 3300049537 | Ga0501321_052904 | Ga0501321_052904_22_405 | 96 |
| 5 | 3300004803 | Ga0058862_10031778 | Ga0058862_100317781 | 99 |
| 6 | 3300005327 | Ga0070658_11140242 | Ga0070658_111402422 | 99 |
| 7 | 3300005336 | Ga0070680_100226554 | Ga0070680_1002265541 | 99 |
| 8 | 3300005339 | Ga0070660_100627484 | Ga0070660_1006274841 | 99 |
| 9 | 3300005344 | Ga0070661_100001068 | Ga0070661_1000010681 | 99 |
| 10 | 3300005455 | Ga0070663_100850770 | Ga0070663_1008507702 | 99 |
| 11 | 3300005458 | Ga0070681_10330329 | Ga0070681_103303292 | 99 |
| 12 | 3300005518 | Ga0070699_100001838 | Ga0070699_1000018381 | 99 |
| 13 | 3300005530 | Ga0070679_101267970 | Ga0070679_1012679702 | 99 |
| 14 | 3300005535 | Ga0070684_100003384 | Ga0070684_1000033848 | 99 |
| 15 | 3300005539 | Ga0068853_101071533 | Ga0068853_1010715332 | 99 |
| 16 | 3300005546 | Ga0070696_100029982 | Ga0070696_1000299821 | 99 |
| 17 | 3300005578 | Ga0068854_100007726 | Ga0068854_1000077266 | 99 |
| 18 | 3300009093 | Ga0105240_12494385 | Ga0105240_124943851 | 99 |
| 19 | 3300009174 | Ga0105241_10890435 | Ga0105241_108904352 | 99 |
| 20 | 3300013100 | Ga0157373_10006497 | Ga0157373_100064972 | 99 |
| 21 | 3300013105 | Ga0157369_10131204 | Ga0157369_101312043 | 99 |
| 22 | 3300013105 | Ga0157369_12041594 | Ga0157369_120415941 | 99 |
| 23 | 3300013307 | Ga0157372_10018031 | Ga0157372_100180311 | 99 |
| 24 | 3300022467 | Ga0224712_10579407 | Ga0224712_105794071 | 99 |
| 25 | 3300025911 | Ga0207654_11139718 | Ga0207654_111397181 | 99 |
| 26 | 3300025912 | Ga0207707_10032593 | Ga0207707_100325934 | 99 |
| 27 | 3300025913 | Ga0207695_10003508 | Ga0207695_100035083 | 99 |
| 28 | 3300025917 | Ga0207660_10002896 | Ga0207660_100028961 | 99 |
| 29 | 3300025919 | Ga0207657_10674321 | Ga0207657_106743212 | 99 |
| 30 | 3300025920 | Ga0207649_10026063 | Ga0207649_100260633 | 99 |
| 31 | 3300025921 | Ga0207652_10004767 | Ga0207652_100047671 | 99 |
| 32 | 3300025944 | Ga0207661_10188109 | Ga0207661_101881091 | 99 |
| 33 | 3300025981 | Ga0207640_10004360 | Ga0207640_100043603 | 99 |
| 34 | 3300026041 | Ga0207639_10328100 | Ga0207639_103281001 | 99 |
| 35 | 3300026067 | Ga0207678_10671584 | Ga0207678_106715842 | 99 |
| 36 | 3300026078 | Ga0207702_11668201 | Ga0207702_116682011 | 99 |
| 37 | 3300026142 | Ga0207698_10070046 | Ga0207698_100700463 | 99 |
| 38 | 3300005329 | Ga0070683_100002085 | Ga0070683_1000020858 | 100 |
| 39 | 3300005337 | Ga0070682_100051411 | Ga0070682_1000514111 | 100 |
| 40 | 3300005458 | Ga0070681_10015108 | Ga0070681_100151083 | 100 |
| 41 | 3300005530 | Ga0070679_100001019 | Ga0070679_10000101917 | 100 |
| 42 | 3300005616 | Ga0068852_100034377 | Ga0068852_1000343774 | 100 |
| 43 | 3300009093 | Ga0105240_10006583 | Ga0105240_100065839 | 100 |
| 44 | 3300009093 | Ga0105240_12711511 | Ga0105240_127115111 | 100 |
| 45 | 3300013104 | Ga0157370_10000730 | Ga0157370_1000073015 | 100 |
| 46 | 3300013307 | Ga0157372_10036359 | Ga0157372_100363593 | 100 |
| 47 | 3300025912 | Ga0207707_10039418 | Ga0207707_100394182 | 100 |
| 48 | 3300025913 | Ga0207695_10004443 | Ga0207695_100044439 | 100 |
| 49 | 3300025917 | Ga0207660_11545141 | Ga0207660_115451411 | 100 |
| 50 | 3300025921 | Ga0207652_10002497 | Ga0207652_100024972 | 100 |
| 51 | 3300025944 | Ga0207661_10001131 | Ga0207661_1000113112 | 100 |
| 52 | 3300002076 | JGI24749J21850_1021513 | JGI24749J21850_10215132 | 108 |
| 53 | 3300004799 | Ga0058863_10001545 | Ga0058863_100015452 | 108 |
| 54 | 3300004800 | Ga0058861_10037038 | Ga0058861_100370381 | 108 |
| 55 | 3300004800 | Ga0058861_11938491 | Ga0058861_119384911 | 108 |
| 56 | 3300004801 | Ga0058860_11767703 | Ga0058860_117677032 | 108 |
| 57 | 3300004803 | Ga0058862_12313547 | Ga0058862_123135472 | 108 |
| 58 | 3300004803 | Ga0058862_12425160 | Ga0058862_124251602 | 108 |
| 59 | 3300004803 | Ga0058862_12513443 | Ga0058862_125134431 | 108 |
| 60 | 3300004803 | Ga0058862_12752857 | Ga0058862_127528571 | 108 |
| 61 | 3300004803 | Ga0058862_12817638 | Ga0058862_128176381 | 108 |
| 62 | 3300004803 | Ga0058862_12852883 | Ga0058862_128528832 | 108 |
| 63 | 3300005293 | Ga0065715_10119621 | Ga0065715_101196212 | 108 |
| 64 | 3300005295 | Ga0065707_10402330 | Ga0065707_104023301 | 108 |
| 65 | 3300005295 | Ga0065707_10590974 | Ga0065707_105909741 | 108 |
| 66 | 3300005327 | Ga0070658_10086928 | Ga0070658_100869282 | 108 |
| 67 | 3300005327 | Ga0070658_10605391 | Ga0070658_106053912 | 108 |
| 68 | 3300005327 | Ga0070658_10612692 | Ga0070658_106126922 | 108 |
| 69 | 3300005327 | Ga0070658_10727919 | Ga0070658_107279192 | 108 |
| 70 | 3300005327 | Ga0070658_10930598 | Ga0070658_109305981 | 108 |
| 71 | 3300005328 | Ga0070676_10004878 | Ga0070676_100048782 | 108 |
| 72 | 3300005328 | Ga0070676_10057904 | Ga0070676_100579042 | 108 |
| 73 | 3300005328 | Ga0070676_10067919 | Ga0070676_100679191 | 108 |
| 74 | 3300005328 | Ga0070676_10675138 | Ga0070676_106751381 | 108 |
| 75 | 3300005328 | Ga0070676_11203677 | Ga0070676_112036772 | 108 |
| 76 | 3300005328 | Ga0070676_11616979 | Ga0070676_116169791 | 108 |
| 77 | 3300005329 | Ga0070683_100017414 | Ga0070683_1000174142 | 108 |
| 78 | 3300005329 | Ga0070683_100033561 | Ga0070683_1000335612 | 108 |
| 79 | 3300005329 | Ga0070683_100038844 | Ga0070683_1000388442 | 108 |
| 80 | 3300005329 | Ga0070683_100097294 | Ga0070683_1000972942 | 108 |
| 81 | 3300005329 | Ga0070683_100138785 | Ga0070683_1001387852 | 108 |
| 82 | 3300005329 | Ga0070683_100160550 | Ga0070683_1001605502 | 108 |
| 83 | 3300005329 | Ga0070683_100252992 | Ga0070683_1002529922 | 108 |
| 84 | 3300005329 | Ga0070683_100260992 | Ga0070683_1002609922 | 108 |
| 85 | 3300005329 | Ga0070683_100371307 | Ga0070683_1003713072 | 108 |
| 86 | 3300005329 | Ga0070683_100505425 | Ga0070683_1005054252 | 108 |
| 87 | 3300005329 | Ga0070683_101229798 | Ga0070683_1012297982 | 108 |
| 88 | 3300005329 | Ga0070683_101405102 | Ga0070683_1014051022 | 108 |
| 89 | 3300005330 | Ga0070690_100030151 | Ga0070690_1000301512 | 108 |
| 90 | 3300005330 | Ga0070690_100033405 | Ga0070690_1000334052 | 108 |
| 91 | 3300005331 | Ga0070670_100447428 | Ga0070670_1004474282 | 108 |
| 92 | 3300005333 | Ga0070677_10046422 | Ga0070677_100464222 | 108 |
| 93 | 3300005335 | Ga0070666_10458844 | Ga0070666_104588442 | 108 |
| 94 | 3300005335 | Ga0070666_10495225 | Ga0070666_104952252 | 108 |
| 95 | 3300005336 | Ga0070680_100002196 | Ga0070680_1000021961 | 108 |
| 96 | 3300005336 | Ga0070680_100018010 | Ga0070680_1000180104 | 108 |
| 97 | 3300005336 | Ga0070680_100019927 | Ga0070680_1000199272 | 108 |
| 98 | 3300005336 | Ga0070680_100020843 | Ga0070680_1000208432 | 108 |
| 99 | 3300005336 | Ga0070680_100022197 | Ga0070680_1000221972 | 108 |
| 100 | 3300005336 | Ga0070680_100129250 | Ga0070680_1001292502 | 108 |
| 101 | 3300005336 | Ga0070680_100147849 | Ga0070680_1001478494 | 108 |
| 102 | 3300005336 | Ga0070680_100217060 | Ga0070680_1002170602 | 108 |
| 103 | 3300005336 | Ga0070680_100332749 | Ga0070680_1003327492 | 108 |
| 104 | 3300005336 | Ga0070680_100689896 | Ga0070680_1006898961 | 108 |
| 105 | 3300005337 | Ga0070682_100160148 | Ga0070682_1001601482 | 108 |
| 106 | 3300005337 | Ga0070682_100175875 | Ga0070682_1001758752 | 108 |
| 107 | 3300005338 | Ga0068868_100011391 | Ga0068868_1000113916 | 108 |
| 108 | 3300005338 | Ga0068868_100026433 | Ga0068868_1000264332 | 108 |
| 109 | 3300005338 | Ga0068868_100510711 | Ga0068868_1005107111 | 108 |
| 110 | 3300005338 | Ga0068868_100887359 | Ga0068868_1008873591 | 108 |
| 111 | 3300005338 | Ga0068868_101761853 | Ga0068868_1017618531 | 108 |
| 112 | 3300005339 | Ga0070660_100192175 | Ga0070660_1001921752 | 108 |
| 113 | 3300005339 | Ga0070660_100255842 | Ga0070660_1002558422 | 108 |
| 114 | 3300005339 | Ga0070660_100319831 | Ga0070660_1003198311 | 108 |
| 115 | 3300005339 | Ga0070660_100323795 | Ga0070660_1003237952 | 108 |
| 116 | 3300005340 | Ga0070689_100003423 | Ga0070689_1000034236 | 108 |
| 117 | 3300005340 | Ga0070689_100194378 | Ga0070689_1001943781 | 108 |
| 118 | 3300005340 | Ga0070689_100852678 | Ga0070689_1008526781 | 108 |
| 119 | 3300005341 | Ga0070691_10019625 | Ga0070691_100196253 | 108 |
| 120 | 3300005343 | Ga0070687_100002020 | Ga0070687_1000020205 | 108 |
| 121 | 3300005343 | Ga0070687_100003099 | Ga0070687_1000030993 | 108 |
| 122 | 3300005344 | Ga0070661_100046094 | Ga0070661_1000460941 | 108 |
| 123 | 3300005344 | Ga0070661_100105804 | Ga0070661_1001058042 | 108 |
| 124 | 3300005344 | Ga0070661_100562485 | Ga0070661_1005624851 | 108 |
| 125 | 3300005344 | Ga0070661_101108264 | Ga0070661_1011082641 | 108 |
| 126 | 3300005345 | Ga0070692_10015568 | Ga0070692_100155683 | 108 |
| 127 | 3300005345 | Ga0070692_10151259 | Ga0070692_101512592 | 108 |
| 128 | 3300005345 | Ga0070692_10308758 | Ga0070692_103087582 | 108 |
| 129 | 3300005347 | Ga0070668_100005654 | Ga0070668_1000056543 | 108 |
| 130 | 3300005347 | Ga0070668_100023597 | Ga0070668_1000235972 | 108 |
| 131 | 3300005347 | Ga0070668_100141734 | Ga0070668_1001417342 | 108 |
| 132 | 3300005353 | Ga0070669_100007417 | Ga0070669_1000074177 | 108 |
| 133 | 3300005353 | Ga0070669_100065806 | Ga0070669_1000658062 | 108 |
| 134 | 3300005354 | Ga0070675_100007110 | Ga0070675_1000071107 | 108 |
| 135 | 3300005354 | Ga0070675_100370732 | Ga0070675_1003707322 | 108 |
| 136 | 3300005354 | Ga0070675_100391400 | Ga0070675_1003914002 | 108 |
| 137 | 3300005354 | Ga0070675_101022416 | Ga0070675_1010224162 | 108 |
| 138 | 3300005355 | Ga0070671_100080453 | Ga0070671_1000804532 | 108 |
| 139 | 3300005355 | Ga0070671_100205691 | Ga0070671_1002056912 | 108 |
| 140 | 3300005355 | Ga0070671_100221472 | Ga0070671_1002214722 | 108 |
| 141 | 3300005355 | Ga0070671_100396860 | Ga0070671_1003968601 | 108 |
| 142 | 3300005355 | Ga0070671_100815806 | Ga0070671_1008158061 | 108 |
| 143 | 3300005355 | Ga0070671_101119820 | Ga0070671_1011198202 | 108 |
| 144 | 3300005355 | Ga0070671_101192500 | Ga0070671_1011925001 | 108 |
| 145 | 3300005355 | Ga0070671_101319656 | Ga0070671_1013196562 | 108 |
| 146 | 3300005356 | Ga0070674_100024550 | Ga0070674_1000245502 | 108 |
| 147 | 3300005356 | Ga0070674_100040398 | Ga0070674_1000403982 | 108 |
| 148 | 3300005356 | Ga0070674_100112094 | Ga0070674_1001120942 | 108 |
| 149 | 3300005356 | Ga0070674_100589828 | Ga0070674_1005898281 | 108 |
| 150 | 3300005356 | Ga0070674_100760099 | Ga0070674_1007600991 | 108 |
| 151 | 3300005364 | Ga0070673_100013585 | Ga0070673_1000135852 | 108 |
| 152 | 3300005364 | Ga0070673_100286559 | Ga0070673_1002865592 | 108 |
| 153 | 3300005364 | Ga0070673_100557421 | Ga0070673_1005574212 | 108 |
| 154 | 3300005364 | Ga0070673_100857657 | Ga0070673_1008576571 | 108 |
| 155 | 3300005365 | Ga0070688_100007877 | Ga0070688_1000078773 | 108 |
| 156 | 3300005366 | Ga0070659_100041286 | Ga0070659_1000412863 | 108 |
| 157 | 3300005366 | Ga0070659_100073320 | Ga0070659_1000733202 | 108 |
| 158 | 3300005366 | Ga0070659_100445535 | Ga0070659_1004455351 | 108 |
| 159 | 3300005366 | Ga0070659_101797653 | Ga0070659_1017976531 | 108 |
| 160 | 3300005367 | Ga0070667_100079505 | Ga0070667_1000795052 | 108 |
| 161 | 3300005367 | Ga0070667_100098087 | Ga0070667_1000980872 | 108 |
| 162 | 3300005367 | Ga0070667_100276244 | Ga0070667_1002762442 | 108 |
| 163 | 3300005367 | Ga0070667_100780575 | Ga0070667_1007805752 | 108 |
| 164 | 3300005434 | Ga0070709_10006275 | Ga0070709_100062755 | 108 |
| 165 | 3300005434 | Ga0070709_10220343 | Ga0070709_102203432 | 108 |
| 166 | 3300005435 | Ga0070714_100004555 | Ga0070714_10000455510 | 108 |
| 167 | 3300005435 | Ga0070714_100022164 | Ga0070714_1000221642 | 108 |
| 168 | 3300005435 | Ga0070714_100103316 | Ga0070714_1001033162 | 108 |
| 169 | 3300005435 | Ga0070714_100130194 | Ga0070714_1001301941 | 108 |
| 170 | 3300005435 | Ga0070714_100254463 | Ga0070714_1002544632 | 108 |
| 171 | 3300005435 | Ga0070714_100327881 | Ga0070714_1003278812 | 108 |
| 172 | 3300005435 | Ga0070714_102317998 | Ga0070714_1023179981 | 108 |
| 173 | 3300005436 | Ga0070713_100000345 | Ga0070713_1000003452 | 108 |
| 174 | 3300005436 | Ga0070713_100159593 | Ga0070713_1001595932 | 108 |
| 175 | 3300005436 | Ga0070713_100208813 | Ga0070713_1002088132 | 108 |
| 176 | 3300005436 | Ga0070713_100966023 | Ga0070713_1009660232 | 108 |
| 177 | 3300005436 | Ga0070713_101192084 | Ga0070713_1011920841 | 108 |
| 178 | 3300005437 | Ga0070710_10015426 | Ga0070710_100154262 | 108 |
| 179 | 3300005437 | Ga0070710_10054896 | Ga0070710_100548962 | 108 |
| 180 | 3300005437 | Ga0070710_10137289 | Ga0070710_101372892 | 108 |
| 181 | 3300005437 | Ga0070710_10575681 | Ga0070710_105756812 | 108 |
| 182 | 3300005438 | Ga0070701_10050806 | Ga0070701_100508062 | 108 |
| 183 | 3300005438 | Ga0070701_10180130 | Ga0070701_101801302 | 108 |
| 184 | 3300005439 | Ga0070711_100058958 | Ga0070711_1000589582 | 108 |
| 185 | 3300005439 | Ga0070711_100114078 | Ga0070711_1001140782 | 108 |
| 186 | 3300005439 | Ga0070711_100120720 | Ga0070711_1001207202 | 108 |
| 187 | 3300005439 | Ga0070711_100667517 | Ga0070711_1006675172 | 108 |
| 188 | 3300005440 | Ga0070705_100066991 | Ga0070705_1000669912 | 108 |
| 189 | 3300005440 | Ga0070705_100693976 | Ga0070705_1006939762 | 108 |
| 190 | 3300005441 | Ga0070700_100013015 | Ga0070700_1000130152 | 108 |
| 191 | 3300005441 | Ga0070700_100050670 | Ga0070700_1000506702 | 108 |
| 192 | 3300005441 | Ga0070700_101417456 | Ga0070700_1014174561 | 108 |
| 193 | 3300005444 | Ga0070694_100462746 | Ga0070694_1004627462 | 108 |
| 194 | 3300005445 | Ga0070708_100000052 | Ga0070708_10000005235 | 108 |
| 195 | 3300005445 | Ga0070708_100024403 | Ga0070708_1000244032 | 108 |
| 196 | 3300005455 | Ga0070663_100235336 | Ga0070663_1002353361 | 108 |
| 197 | 3300005455 | Ga0070663_100498187 | Ga0070663_1004981872 | 108 |
| 198 | 3300005456 | Ga0070678_100292728 | Ga0070678_1002927282 | 108 |
| 199 | 3300005456 | Ga0070678_100296420 | Ga0070678_1002964202 | 108 |
| 200 | 3300005456 | Ga0070678_100314249 | Ga0070678_1003142492 | 108 |
| 201 | 3300005456 | Ga0070678_100316355 | Ga0070678_1003163551 | 108 |
| 202 | 3300005457 | Ga0070662_100008330 | Ga0070662_1000083306 | 108 |
| 203 | 3300005457 | Ga0070662_100173805 | Ga0070662_1001738052 | 108 |
| 204 | 3300005457 | Ga0070662_100205960 | Ga0070662_1002059601 | 108 |
| 205 | 3300005457 | Ga0070662_100468017 | Ga0070662_1004680172 | 108 |
| 206 | 3300005457 | Ga0070662_101056835 | Ga0070662_1010568351 | 108 |
| 207 | 3300005457 | Ga0070662_101156452 | Ga0070662_1011564522 | 108 |
| 208 | 3300005458 | Ga0070681_10003936 | Ga0070681_1000393610 | 108 |
| 209 | 3300005458 | Ga0070681_10020038 | Ga0070681_100200384 | 108 |
| 210 | 3300005458 | Ga0070681_10024189 | Ga0070681_100241894 | 108 |
| 211 | 3300005458 | Ga0070681_10050350 | Ga0070681_100503501 | 108 |
| 212 | 3300005458 | Ga0070681_10069385 | Ga0070681_100693852 | 108 |
| 213 | 3300005458 | Ga0070681_10094324 | Ga0070681_100943242 | 108 |
| 214 | 3300005458 | Ga0070681_10130145 | Ga0070681_101301452 | 108 |
| 215 | 3300005458 | Ga0070681_10135395 | Ga0070681_101353952 | 108 |
| 216 | 3300005458 | Ga0070681_10194812 | Ga0070681_101948121 | 108 |
| 217 | 3300005458 | Ga0070681_10270851 | Ga0070681_102708512 | 108 |
| 218 | 3300005458 | Ga0070681_10330210 | Ga0070681_103302102 | 108 |
| 219 | 3300005458 | Ga0070681_10500778 | Ga0070681_105007782 | 108 |
| 220 | 3300005458 | Ga0070681_10545900 | Ga0070681_105459001 | 108 |
| 221 | 3300005458 | Ga0070681_10955780 | Ga0070681_109557802 | 108 |
| 222 | 3300005459 | Ga0068867_100008139 | Ga0068867_1000081392 | 108 |
| 223 | 3300005459 | Ga0068867_100012109 | Ga0068867_1000121095 | 108 |
| 224 | 3300005459 | Ga0068867_100130377 | Ga0068867_1001303772 | 108 |
| 225 | 3300005459 | Ga0068867_100385066 | Ga0068867_1003850662 | 108 |
| 226 | 3300005459 | Ga0068867_100741665 | Ga0068867_1007416652 | 108 |
| 227 | 3300005459 | Ga0068867_100816135 | Ga0068867_1008161351 | 108 |
| 228 | 3300005466 | Ga0070685_10003117 | Ga0070685_100031178 | 108 |
| 229 | 3300005466 | Ga0070685_10183504 | Ga0070685_101835042 | 108 |
| 230 | 3300005466 | Ga0070685_10716659 | Ga0070685_107166591 | 108 |
| 231 | 3300005467 | Ga0070706_100042852 | Ga0070706_1000428522 | 108 |
| 232 | 3300005468 | Ga0070707_100000643 | Ga0070707_10000064313 | 108 |
| 233 | 3300005468 | Ga0070707_100236903 | Ga0070707_1002369032 | 108 |
| 234 | 3300005471 | Ga0070698_100009811 | Ga0070698_1000098112 | 108 |
| 235 | 3300005471 | Ga0070698_100028422 | Ga0070698_1000284222 | 108 |
| 236 | 3300005518 | Ga0070699_100245948 | Ga0070699_1002459482 | 108 |
| 237 | 3300005518 | Ga0070699_100336117 | Ga0070699_1003361172 | 108 |
| 238 | 3300005518 | Ga0070699_101645283 | Ga0070699_1016452831 | 108 |
| 239 | 3300005518 | Ga0070699_101667295 | Ga0070699_1016672952 | 108 |
| 240 | 3300005530 | Ga0070679_100003394 | Ga0070679_1000033943 | 108 |
| 241 | 3300005530 | Ga0070679_100003861 | Ga0070679_10000386111 | 108 |
| 242 | 3300005530 | Ga0070679_100017456 | Ga0070679_1000174564 | 108 |
| 243 | 3300005530 | Ga0070679_100049707 | Ga0070679_1000497073 | 108 |
| 244 | 3300005530 | Ga0070679_100082512 | Ga0070679_1000825122 | 108 |
| 245 | 3300005530 | Ga0070679_100099210 | Ga0070679_1000992102 | 108 |
| 246 | 3300005530 | Ga0070679_100215162 | Ga0070679_1002151622 | 108 |
| 247 | 3300005530 | Ga0070679_100340595 | Ga0070679_1003405952 | 108 |
| 248 | 3300005530 | Ga0070679_100578209 | Ga0070679_1005782092 | 108 |
| 249 | 3300005530 | Ga0070679_101511434 | Ga0070679_1015114342 | 108 |
| 250 | 3300005535 | Ga0070684_100057265 | Ga0070684_1000572652 | 108 |
| 251 | 3300005535 | Ga0070684_100087437 | Ga0070684_1000874372 | 108 |
| 252 | 3300005535 | Ga0070684_100155228 | Ga0070684_1001552282 | 108 |
| 253 | 3300005535 | Ga0070684_100182497 | Ga0070684_1001824972 | 108 |
| 254 | 3300005535 | Ga0070684_100223557 | Ga0070684_1002235572 | 108 |
| 255 | 3300005535 | Ga0070684_100246373 | Ga0070684_1002463732 | 108 |
| 256 | 3300005535 | Ga0070684_100303441 | Ga0070684_1003034412 | 108 |
| 257 | 3300005535 | Ga0070684_100405278 | Ga0070684_1004052782 | 108 |
| 258 | 3300005535 | Ga0070684_100848453 | Ga0070684_1008484531 | 108 |
| 259 | 3300005536 | Ga0070697_100074322 | Ga0070697_1000743222 | 108 |
| 260 | 3300005536 | Ga0070697_100377698 | Ga0070697_1003776982 | 108 |
| 261 | 3300005536 | Ga0070697_100524534 | Ga0070697_1005245342 | 108 |
| 262 | 3300005539 | Ga0068853_100027617 | Ga0068853_1000276174 | 108 |
| 263 | 3300005539 | Ga0068853_100071151 | Ga0068853_1000711516 | 108 |
| 264 | 3300005539 | Ga0068853_100091088 | Ga0068853_1000910882 | 108 |
| 265 | 3300005539 | Ga0068853_100597056 | Ga0068853_1005970561 | 108 |
| 266 | 3300005539 | Ga0068853_100684860 | Ga0068853_1006848602 | 108 |
| 267 | 3300005539 | Ga0068853_100843861 | Ga0068853_1008438612 | 108 |
| 268 | 3300005543 | Ga0070672_100105013 | Ga0070672_1001050132 | 108 |
| 269 | 3300005543 | Ga0070672_100576571 | Ga0070672_1005765711 | 108 |
| 270 | 3300005543 | Ga0070672_100841269 | Ga0070672_1008412692 | 108 |
| 271 | 3300005544 | Ga0070686_100008268 | Ga0070686_1000082684 | 108 |
| 272 | 3300005544 | Ga0070686_100131025 | Ga0070686_1001310251 | 108 |
| 273 | 3300005544 | Ga0070686_100373207 | Ga0070686_1003732072 | 108 |
| 274 | 3300005545 | Ga0070695_100141978 | Ga0070695_1001419781 | 108 |
| 275 | 3300005545 | Ga0070695_100415760 | Ga0070695_1004157602 | 108 |
| 276 | 3300005545 | Ga0070695_101221112 | Ga0070695_1012211121 | 108 |
| 277 | 3300005545 | Ga0070695_101340101 | Ga0070695_1013401011 | 108 |
| 278 | 3300005545 | Ga0070695_101404959 | Ga0070695_1014049592 | 108 |
| 279 | 3300005546 | Ga0070696_100049164 | Ga0070696_1000491643 | 108 |
| 280 | 3300005546 | Ga0070696_100284293 | Ga0070696_1002842932 | 108 |
| 281 | 3300005547 | Ga0070693_100007204 | Ga0070693_1000072043 | 108 |
| 282 | 3300005547 | Ga0070693_100025640 | Ga0070693_1000256403 | 108 |
| 283 | 3300005547 | Ga0070693_100032154 | Ga0070693_1000321541 | 108 |
| 284 | 3300005547 | Ga0070693_100247100 | Ga0070693_1002471002 | 108 |
| 285 | 3300005547 | Ga0070693_101235547 | Ga0070693_1012355471 | 108 |
| 286 | 3300005548 | Ga0070665_100209656 | Ga0070665_1002096562 | 108 |
| 287 | 3300005548 | Ga0070665_100569362 | Ga0070665_1005693622 | 108 |
| 288 | 3300005549 | Ga0070704_100001406 | Ga0070704_10000140611 | 108 |
| 289 | 3300005549 | Ga0070704_100185771 | Ga0070704_1001857712 | 108 |
| 290 | 3300005549 | Ga0070704_100755220 | Ga0070704_1007552202 | 108 |
| 291 | 3300005563 | Ga0068855_100085188 | Ga0068855_1000851884 | 108 |
| 292 | 3300005563 | Ga0068855_100404286 | Ga0068855_1004042861 | 108 |
| 293 | 3300005563 | Ga0068855_100456070 | Ga0068855_1004560702 | 108 |
| 294 | 3300005563 | Ga0068855_100770010 | Ga0068855_1007700102 | 108 |
| 295 | 3300005563 | Ga0068855_101120927 | Ga0068855_1011209272 | 108 |
| 296 | 3300005564 | Ga0070664_100004031 | Ga0070664_1000040317 | 108 |
| 297 | 3300005564 | Ga0070664_100013879 | Ga0070664_1000138792 | 108 |
| 298 | 3300005564 | Ga0070664_100058883 | Ga0070664_1000588833 | 108 |
| 299 | 3300005564 | Ga0070664_100098246 | Ga0070664_1000982462 | 108 |
| 300 | 3300005564 | Ga0070664_100098708 | Ga0070664_1000987082 | 108 |
| 301 | 3300005564 | Ga0070664_100182242 | Ga0070664_1001822422 | 108 |
| 302 | 3300005564 | Ga0070664_100365465 | Ga0070664_1003654652 | 108 |
| 303 | 3300005564 | Ga0070664_100491257 | Ga0070664_1004912572 | 108 |
| 304 | 3300005577 | Ga0068857_100046264 | Ga0068857_1000462642 | 108 |
| 305 | 3300005577 | Ga0068857_100077827 | Ga0068857_1000778272 | 108 |
| 306 | 3300005577 | Ga0068857_100102261 | Ga0068857_1001022613 | 108 |
| 307 | 3300005577 | Ga0068857_100289006 | Ga0068857_1002890062 | 108 |
| 308 | 3300005578 | Ga0068854_100018923 | Ga0068854_1000189234 | 108 |
| 309 | 3300005578 | Ga0068854_100362766 | Ga0068854_1003627661 | 108 |
| 310 | 3300005578 | Ga0068854_101712607 | Ga0068854_1017126071 | 108 |
| 311 | 3300005578 | Ga0068854_102075721 | Ga0068854_1020757211 | 108 |
| 312 | 3300005614 | Ga0068856_100149755 | Ga0068856_1001497552 | 108 |
| 313 | 3300005614 | Ga0068856_100222314 | Ga0068856_1002223142 | 108 |
| 314 | 3300005614 | Ga0068856_100274959 | Ga0068856_1002749592 | 108 |
| 315 | 3300005614 | Ga0068856_100652536 | Ga0068856_1006525362 | 108 |
| 316 | 3300005615 | Ga0070702_100056169 | Ga0070702_1000561692 | 108 |
| 317 | 3300005615 | Ga0070702_101017779 | Ga0070702_1010177792 | 108 |
| 318 | 3300005615 | Ga0070702_101729340 | Ga0070702_1017293401 | 108 |
| 319 | 3300005616 | Ga0068852_100010321 | Ga0068852_1000103215 | 108 |
| 320 | 3300005616 | Ga0068852_100233500 | Ga0068852_1002335001 | 108 |
| 321 | 3300005616 | Ga0068852_100336698 | Ga0068852_1003366981 | 108 |
| 322 | 3300005616 | Ga0068852_100578659 | Ga0068852_1005786592 | 108 |
| 323 | 3300005616 | Ga0068852_100868465 | Ga0068852_1008684652 | 108 |
| 324 | 3300005617 | Ga0068859_100017750 | Ga0068859_1000177502 | 108 |
| 325 | 3300005617 | Ga0068859_101085031 | Ga0068859_1010850312 | 108 |
| 326 | 3300005618 | Ga0068864_100027372 | Ga0068864_1000273723 | 108 |
| 327 | 3300005618 | Ga0068864_100786077 | Ga0068864_1007860771 | 108 |
| 328 | 3300005718 | Ga0068866_10013098 | Ga0068866_100130983 | 108 |
| 329 | 3300005718 | Ga0068866_10044511 | Ga0068866_100445112 | 108 |
| 330 | 3300005718 | Ga0068866_10141985 | Ga0068866_101419852 | 108 |
| 331 | 3300005718 | Ga0068866_10250188 | Ga0068866_102501881 | 108 |
| 332 | 3300005719 | Ga0068861_100079007 | Ga0068861_1000790073 | 108 |
| 333 | 3300005719 | Ga0068861_101367312 | Ga0068861_1013673121 | 108 |
| 334 | 3300005834 | Ga0068851_10050614 | Ga0068851_100506142 | 108 |
| 335 | 3300005834 | Ga0068851_10312120 | Ga0068851_103121202 | 108 |
| 336 | 3300005840 | Ga0068870_10345028 | Ga0068870_103450282 | 108 |
| 337 | 3300005840 | Ga0068870_10471574 | Ga0068870_104715742 | 108 |
| 338 | 3300005841 | Ga0068863_100406915 | Ga0068863_1004069152 | 108 |
| 339 | 3300005841 | Ga0068863_100547734 | Ga0068863_1005477342 | 108 |
| 340 | 3300005842 | Ga0068858_100319274 | Ga0068858_1003192743 | 108 |
| 341 | 3300005842 | Ga0068858_100946854 | Ga0068858_1009468541 | 108 |
| 342 | 3300005842 | Ga0068858_100971426 | Ga0068858_1009714262 | 108 |
| 343 | 3300005843 | Ga0068860_100186028 | Ga0068860_1001860282 | 108 |
| 344 | 3300005843 | Ga0068860_100599681 | Ga0068860_1005996812 | 108 |
| 345 | 3300005843 | Ga0068860_100869795 | Ga0068860_1008697952 | 108 |
| 346 | 3300005844 | Ga0068862_100192108 | Ga0068862_1001921082 | 108 |
| 347 | 3300005844 | Ga0068862_101881280 | Ga0068862_1018812801 | 108 |
| 348 | 3300005937 | Ga0081455_10035968 | Ga0081455_100359683 | 108 |
| 349 | 3300006028 | Ga0070717_10007462 | Ga0070717_100074625 | 108 |
| 350 | 3300006028 | Ga0070717_10737134 | Ga0070717_107371342 | 108 |
| 351 | 3300006163 | Ga0070715_10107478 | Ga0070715_101074782 | 108 |
| 352 | 3300006163 | Ga0070715_10541740 | Ga0070715_105417402 | 108 |
| 353 | 3300006173 | Ga0070716_100006672 | Ga0070716_1000066724 | 108 |
| 354 | 3300006173 | Ga0070716_100094821 | Ga0070716_1000948212 | 108 |
| 355 | 3300006175 | Ga0070712_100005777 | Ga0070712_1000057775 | 108 |
| 356 | 3300006175 | Ga0070712_100023743 | Ga0070712_1000237432 | 108 |
| 357 | 3300006175 | Ga0070712_101192378 | Ga0070712_1011923781 | 108 |
| 358 | 3300006237 | Ga0097621_100267379 | Ga0097621_1002673792 | 108 |
| 359 | 3300006237 | Ga0097621_100534619 | Ga0097621_1005346192 | 108 |
| 360 | 3300006358 | Ga0068871_100301114 | Ga0068871_1003011142 | 108 |
| 361 | 3300006844 | Ga0075428_101175445 | Ga0075428_1011754452 | 108 |
| 362 | 3300006846 | Ga0075430_100021501 | Ga0075430_1000215012 | 108 |
| 363 | 3300006847 | Ga0075431_100016490 | Ga0075431_1000164902 | 108 |
| 364 | 3300006852 | Ga0075433_10010271 | Ga0075433_100102713 | 108 |
| 365 | 3300006871 | Ga0075434_100039783 | Ga0075434_1000397833 | 108 |
| 366 | 3300006871 | Ga0075434_101133376 | Ga0075434_1011333762 | 108 |
| 367 | 3300006880 | Ga0075429_100072380 | Ga0075429_1000723802 | 108 |
| 368 | 3300006880 | Ga0075429_100250269 | Ga0075429_1002502692 | 108 |
| 369 | 3300006880 | Ga0075429_101482720 | Ga0075429_1014827201 | 108 |
| 370 | 3300006881 | Ga0068865_100005690 | Ga0068865_1000056902 | 108 |
| 371 | 3300006881 | Ga0068865_100010439 | Ga0068865_1000104395 | 108 |
| 372 | 3300006881 | Ga0068865_100204855 | Ga0068865_1002048552 | 108 |
| 373 | 3300006881 | Ga0068865_100281149 | Ga0068865_1002811492 | 108 |
| 374 | 3300006914 | Ga0075436_100002007 | Ga0075436_1000020076 | 108 |
| 375 | 3300006914 | Ga0075436_100167953 | Ga0075436_1001679532 | 108 |
| 376 | 3300006914 | Ga0075436_100273491 | Ga0075436_1002734912 | 108 |
| 377 | 3300006931 | Ga0097620_100017750 | Ga0097620_1000177506 | 108 |
| 378 | 3300006931 | Ga0097620_101085015 | Ga0097620_1010850152 | 108 |
| 379 | 3300007076 | Ga0075435_100033886 | Ga0075435_1000338863 | 108 |
| 380 | 3300007265 | Ga0099794_10523512 | Ga0099794_105235121 | 108 |
| 381 | 3300007788 | Ga0099795_10524561 | Ga0099795_105245611 | 108 |
| 382 | 3300009011 | Ga0105251_10327025 | Ga0105251_103270251 | 108 |
| 383 | 3300009093 | Ga0105240_10151296 | Ga0105240_101512962 | 108 |
| 384 | 3300009093 | Ga0105240_10321288 | Ga0105240_103212882 | 108 |
| 385 | 3300009093 | Ga0105240_10456639 | Ga0105240_104566392 | 108 |
| 386 | 3300009093 | Ga0105240_11276642 | Ga0105240_112766422 | 108 |
| 387 | 3300009093 | Ga0105240_11635700 | Ga0105240_116357002 | 108 |
| 388 | 3300009094 | Ga0111539_10012567 | Ga0111539_1001256711 | 108 |
| 389 | 3300009094 | Ga0111539_10335657 | Ga0111539_103356571 | 108 |
| 390 | 3300009094 | Ga0111539_10629649 | Ga0111539_106296492 | 108 |
| 391 | 3300009098 | Ga0105245_10096938 | Ga0105245_100969382 | 108 |
| 392 | 3300009098 | Ga0105245_10146892 | Ga0105245_101468922 | 108 |
| 393 | 3300009098 | Ga0105245_10561164 | Ga0105245_105611642 | 108 |
| 394 | 3300009098 | Ga0105245_10626921 | Ga0105245_106269213 | 108 |
| 395 | 3300009098 | Ga0105245_10701329 | Ga0105245_107013292 | 108 |
| 396 | 3300009098 | Ga0105245_10742536 | Ga0105245_107425361 | 108 |
| 397 | 3300009098 | Ga0105245_11357541 | Ga0105245_113575412 | 108 |
| 398 | 3300009098 | Ga0105245_11632751 | Ga0105245_116327512 | 108 |
| 399 | 3300009098 | Ga0105245_11762046 | Ga0105245_117620462 | 108 |
| 400 | 3300009101 | Ga0105247_10919875 | Ga0105247_109198752 | 108 |
| 401 | 3300009101 | Ga0105247_10950365 | Ga0105247_109503652 | 108 |
| 402 | 3300009147 | Ga0114129_10019668 | Ga0114129_100196685 | 108 |
| 403 | 3300009147 | Ga0114129_10020805 | Ga0114129_100208052 | 108 |
| 404 | 3300009147 | Ga0114129_12553388 | Ga0114129_125533881 | 108 |
| 405 | 3300009148 | Ga0105243_10015680 | Ga0105243_100156801 | 108 |
| 406 | 3300009148 | Ga0105243_10393149 | Ga0105243_103931492 | 108 |
| 407 | 3300009148 | Ga0105243_10753810 | Ga0105243_107538102 | 108 |
| 408 | 3300009148 | Ga0105243_11217649 | Ga0105243_112176492 | 108 |
| 409 | 3300009148 | Ga0105243_12263281 | Ga0105243_122632811 | 108 |
| 410 | 3300009174 | Ga0105241_10513915 | Ga0105241_105139152 | 108 |
| 411 | 3300009174 | Ga0105241_10635622 | Ga0105241_106356222 | 108 |
| 412 | 3300009174 | Ga0105241_11194093 | Ga0105241_111940932 | 108 |
| 413 | 3300009176 | Ga0105242_10010910 | Ga0105242_100109102 | 108 |
| 414 | 3300009176 | Ga0105242_10192810 | Ga0105242_101928101 | 108 |
| 415 | 3300009176 | Ga0105242_10290095 | Ga0105242_102900952 | 108 |
| 416 | 3300009176 | Ga0105242_10646645 | Ga0105242_106466451 | 108 |
| 417 | 3300009176 | Ga0105242_10841769 | Ga0105242_108417692 | 108 |
| 418 | 3300009176 | Ga0105242_12469659 | Ga0105242_124696591 | 108 |
| 419 | 3300009177 | Ga0105248_10044271 | Ga0105248_100442712 | 108 |
| 420 | 3300009177 | Ga0105248_10324548 | Ga0105248_103245482 | 108 |
| 421 | 3300009177 | Ga0105248_11506402 | Ga0105248_115064021 | 108 |
| 422 | 3300009545 | Ga0105237_10208875 | Ga0105237_102088752 | 108 |
| 423 | 3300009545 | Ga0105237_10250893 | Ga0105237_102508932 | 108 |
| 424 | 3300009551 | Ga0105238_10049306 | Ga0105238_100493062 | 108 |
| 425 | 3300009551 | Ga0105238_10056335 | Ga0105238_100563353 | 108 |
| 426 | 3300009551 | Ga0105238_10182881 | Ga0105238_101828812 | 108 |
| 427 | 3300009551 | Ga0105238_10311252 | Ga0105238_103112522 | 108 |
| 428 | 3300009551 | Ga0105238_10910240 | Ga0105238_109102402 | 108 |
| 429 | 3300009551 | Ga0105238_12923427 | Ga0105238_129234271 | 108 |
| 430 | 3300009553 | Ga0105249_10000089 | Ga0105249_1000008998 | 108 |
| 431 | 3300009553 | Ga0105249_10149829 | Ga0105249_101498293 | 108 |
| 432 | 3300009553 | Ga0105249_10981614 | Ga0105249_109816142 | 108 |
| 433 | 3300009553 | Ga0105249_11554969 | Ga0105249_115549692 | 108 |
| 434 | 3300010375 | Ga0105239_10284303 | Ga0105239_102843033 | 108 |
| 435 | 3300010375 | Ga0105239_10977810 | Ga0105239_109778101 | 108 |
| 436 | 3300010375 | Ga0105239_11165921 | Ga0105239_111659212 | 108 |
| 437 | 3300011119 | Ga0105246_10495140 | Ga0105246_104951402 | 108 |
| 438 | 3300013100 | Ga0157373_10016738 | Ga0157373_100167382 | 108 |
| 439 | 3300013100 | Ga0157373_10112150 | Ga0157373_101121502 | 108 |
| 440 | 3300013100 | Ga0157373_10143744 | Ga0157373_101437442 | 108 |
| 441 | 3300013100 | Ga0157373_10162332 | Ga0157373_101623322 | 108 |
| 442 | 3300013100 | Ga0157373_10591317 | Ga0157373_105913172 | 108 |
| 443 | 3300013102 | Ga0157371_10771775 | Ga0157371_107717751 | 108 |
| 444 | 3300013104 | Ga0157370_10010939 | Ga0157370_100109397 | 108 |
| 445 | 3300013104 | Ga0157370_10047858 | Ga0157370_100478582 | 108 |
| 446 | 3300013104 | Ga0157370_10172146 | Ga0157370_101721462 | 108 |
| 447 | 3300013104 | Ga0157370_10238470 | Ga0157370_102384701 | 108 |
| 448 | 3300013104 | Ga0157370_10524279 | Ga0157370_105242792 | 108 |
| 449 | 3300013104 | Ga0157370_11147803 | Ga0157370_111478032 | 108 |
| 450 | 3300013105 | Ga0157369_10010715 | Ga0157369_100107158 | 108 |
| 451 | 3300013105 | Ga0157369_10086060 | Ga0157369_100860602 | 108 |
| 452 | 3300013105 | Ga0157369_10162045 | Ga0157369_101620452 | 108 |
| 453 | 3300013105 | Ga0157369_10231779 | Ga0157369_102317792 | 108 |
| 454 | 3300013105 | Ga0157369_10373059 | Ga0157369_103730592 | 108 |
| 455 | 3300013105 | Ga0157369_11100773 | Ga0157369_111007732 | 108 |
| 456 | 3300013105 | Ga0157369_11309560 | Ga0157369_113095602 | 108 |
| 457 | 3300013105 | Ga0157369_11393176 | Ga0157369_113931761 | 108 |
| 458 | 3300013296 | Ga0157374_10349551 | Ga0157374_103495512 | 108 |
| 459 | 3300013296 | Ga0157374_10460290 | Ga0157374_104602902 | 108 |
| 460 | 3300013296 | Ga0157374_10511377 | Ga0157374_105113771 | 108 |
| 461 | 3300013296 | Ga0157374_12239762 | Ga0157374_122397621 | 108 |
| 462 | 3300013296 | Ga0157374_12459476 | Ga0157374_124594761 | 108 |
| 463 | 3300013297 | Ga0157378_10008553 | Ga0157378_100085533 | 108 |
| 464 | 3300013297 | Ga0157378_10034272 | Ga0157378_100342723 | 108 |
| 465 | 3300013297 | Ga0157378_10080140 | Ga0157378_100801402 | 108 |
| 466 | 3300013297 | Ga0157378_10089406 | Ga0157378_100894062 | 108 |
| 467 | 3300013297 | Ga0157378_10774533 | Ga0157378_107745332 | 108 |
| 468 | 3300013297 | Ga0157378_10801761 | Ga0157378_108017612 | 108 |
| 469 | 3300013297 | Ga0157378_11165718 | Ga0157378_111657182 | 108 |
| 470 | 3300013297 | Ga0157378_11334252 | Ga0157378_113342522 | 108 |
| 471 | 3300013306 | Ga0163162_10045637 | Ga0163162_100456373 | 108 |
| 472 | 3300013306 | Ga0163162_10154799 | Ga0163162_101547992 | 108 |
| 473 | 3300013306 | Ga0163162_10216391 | Ga0163162_102163912 | 108 |
| 474 | 3300013306 | Ga0163162_10513608 | Ga0163162_105136082 | 108 |
| 475 | 3300013306 | Ga0163162_11307988 | Ga0163162_113079882 | 108 |
| 476 | 3300013307 | Ga0157372_10017516 | Ga0157372_100175162 | 108 |
| 477 | 3300013307 | Ga0157372_10123198 | Ga0157372_101231982 | 108 |
| 478 | 3300013307 | Ga0157372_10147826 | Ga0157372_101478262 | 108 |
| 479 | 3300013307 | Ga0157372_10163721 | Ga0157372_101637212 | 108 |
| 480 | 3300013307 | Ga0157372_10204408 | Ga0157372_102044082 | 108 |
| 481 | 3300013307 | Ga0157372_10228842 | Ga0157372_102288422 | 108 |
| 482 | 3300013307 | Ga0157372_10342416 | Ga0157372_103424161 | 108 |
| 483 | 3300013307 | Ga0157372_10519682 | Ga0157372_105196821 | 108 |
| 484 | 3300013307 | Ga0157372_10574289 | Ga0157372_105742892 | 108 |
| 485 | 3300013307 | Ga0157372_10840159 | Ga0157372_108401592 | 108 |
| 486 | 3300013307 | Ga0157372_12413639 | Ga0157372_124136391 | 108 |
| 487 | 3300013308 | Ga0157375_10078765 | Ga0157375_100787653 | 108 |
| 488 | 3300013308 | Ga0157375_10175123 | Ga0157375_101751232 | 108 |
| 489 | 3300013308 | Ga0157375_10275307 | Ga0157375_102753072 | 108 |
| 490 | 3300013308 | Ga0157375_10931717 | Ga0157375_109317172 | 108 |
| 491 | 3300013308 | Ga0157375_10931739 | Ga0157375_109317392 | 108 |
| 492 | 3300013308 | Ga0157375_11036773 | Ga0157375_110367731 | 108 |
| 493 | 3300013308 | Ga0157375_13616190 | Ga0157375_136161901 | 108 |
| 494 | 3300014325 | Ga0163163_10263428 | Ga0163163_102634282 | 108 |
| 495 | 3300014325 | Ga0163163_10372999 | Ga0163163_103729992 | 108 |
| 496 | 3300014325 | Ga0163163_12382349 | Ga0163163_123823491 | 108 |
| 497 | 3300014326 | Ga0157380_10415774 | Ga0157380_104157741 | 108 |
| 498 | 3300014326 | Ga0157380_11419676 | Ga0157380_114196762 | 108 |
| 499 | 3300014497 | Ga0182008_10011727 | Ga0182008_100117272 | 108 |
| 500 | 3300014745 | Ga0157377_10075373 | Ga0157377_100753731 | 108 |
| 501 | 3300014745 | Ga0157377_10155798 | Ga0157377_101557982 | 108 |
| 502 | 3300014745 | Ga0157377_11580836 | Ga0157377_115808361 | 108 |
| 503 | 3300014968 | Ga0157379_10375431 | Ga0157379_103754312 | 108 |
| 504 | 3300014968 | Ga0157379_10493113 | Ga0157379_104931132 | 108 |
| 505 | 3300014969 | Ga0157376_10430077 | Ga0157376_104300772 | 108 |
| 506 | 3300014969 | Ga0157376_10562482 | Ga0157376_105624822 | 108 |
| 507 | 3300014969 | Ga0157376_11447054 | Ga0157376_114470541 | 108 |
| 508 | 3300015262 | Ga0182007_10088522 | Ga0182007_100885222 | 108 |
| 509 | 3300015262 | Ga0182007_10294957 | Ga0182007_102949572 | 108 |
| 510 | 3300015265 | Ga0182005_1206177 | Ga0182005_12061772 | 108 |
| 511 | 3300017792 | Ga0163161_10155292 | Ga0163161_101552922 | 108 |
| 512 | 3300017792 | Ga0163161_10242091 | Ga0163161_102420911 | 108 |
| 513 | 3300017792 | Ga0163161_10987467 | Ga0163161_109874672 | 108 |
| 514 | 3300020069 | Ga0197907_10955397 | Ga0197907_109553972 | 108 |
| 515 | 3300020070 | Ga0206356_11089032 | Ga0206356_110890321 | 108 |
| 516 | 3300020070 | Ga0206356_11492485 | Ga0206356_114924851 | 108 |
| 517 | 3300020070 | Ga0206356_11542969 | Ga0206356_115429691 | 108 |
| 518 | 3300020070 | Ga0206356_11623018 | Ga0206356_116230182 | 108 |
| 519 | 3300020070 | Ga0206356_11860846 | Ga0206356_118608461 | 108 |
| 520 | 3300020075 | Ga0206349_1530089 | Ga0206349_15300891 | 108 |
| 521 | 3300020076 | Ga0206355_1078973 | Ga0206355_10789732 | 108 |
| 522 | 3300020076 | Ga0206355_1723175 | Ga0206355_17231751 | 108 |
| 523 | 3300020077 | Ga0206351_10189109 | Ga0206351_101891091 | 108 |
| 524 | 3300020077 | Ga0206351_10372331 | Ga0206351_103723311 | 108 |
| 525 | 3300020078 | Ga0206352_11216042 | Ga0206352_112160422 | 108 |
| 526 | 3300020080 | Ga0206350_10333601 | Ga0206350_103336011 | 108 |
| 527 | 3300020080 | Ga0206350_11441145 | Ga0206350_114411452 | 108 |
| 528 | 3300020081 | Ga0206354_10426956 | Ga0206354_104269562 | 108 |
| 529 | 3300020082 | Ga0206353_10538341 | Ga0206353_105383411 | 108 |
| 530 | 3300020082 | Ga0206353_11659228 | Ga0206353_116592281 | 108 |
| 531 | 3300022467 | Ga0224712_10194356 | Ga0224712_101943562 | 108 |
| 532 | 3300022467 | Ga0224712_10225657 | Ga0224712_102256571 | 108 |
| 533 | 3300025315 | Ga0207697_10020771 | Ga0207697_100207713 | 108 |
| 534 | 3300025315 | Ga0207697_10036882 | Ga0207697_100368821 | 108 |
| 535 | 3300025321 | Ga0207656_10129576 | Ga0207656_101295762 | 108 |
| 536 | 3300025885 | Ga0207653_10020217 | Ga0207653_100202172 | 108 |
| 537 | 3300025893 | Ga0207682_10014329 | Ga0207682_100143292 | 108 |
| 538 | 3300025893 | Ga0207682_10481367 | Ga0207682_104813671 | 108 |
| 539 | 3300025898 | Ga0207692_10057750 | Ga0207692_100577502 | 108 |
| 540 | 3300025898 | Ga0207692_10448935 | Ga0207692_104489351 | 108 |
| 541 | 3300025899 | Ga0207642_10032962 | Ga0207642_100329622 | 108 |
| 542 | 3300025899 | Ga0207642_10738894 | Ga0207642_107388942 | 108 |
| 543 | 3300025901 | Ga0207688_10113594 | Ga0207688_101135942 | 108 |
| 544 | 3300025901 | Ga0207688_11069656 | Ga0207688_110696561 | 108 |
| 545 | 3300025903 | Ga0207680_10243756 | Ga0207680_102437562 | 108 |
| 546 | 3300025903 | Ga0207680_10327665 | Ga0207680_103276652 | 108 |
| 547 | 3300025906 | Ga0207699_10054995 | Ga0207699_100549952 | 108 |
| 548 | 3300025906 | Ga0207699_10172457 | Ga0207699_101724572 | 108 |
| 549 | 3300025906 | Ga0207699_10624334 | Ga0207699_106243341 | 108 |
| 550 | 3300025906 | Ga0207699_11020881 | Ga0207699_110208811 | 108 |
| 551 | 3300025907 | Ga0207645_10016651 | Ga0207645_100166515 | 108 |
| 552 | 3300025907 | Ga0207645_10029906 | Ga0207645_100299062 | 108 |
| 553 | 3300025907 | Ga0207645_10095771 | Ga0207645_100957712 | 108 |
| 554 | 3300025907 | Ga0207645_10232199 | Ga0207645_102321992 | 108 |
| 555 | 3300025907 | Ga0207645_10323857 | Ga0207645_103238572 | 108 |
| 556 | 3300025907 | Ga0207645_11185611 | Ga0207645_111856111 | 108 |
| 557 | 3300025908 | Ga0207643_10012554 | Ga0207643_100125542 | 108 |
| 558 | 3300025908 | Ga0207643_10317851 | Ga0207643_103178511 | 108 |
| 559 | 3300025909 | Ga0207705_10603160 | Ga0207705_106031601 | 108 |
| 560 | 3300025910 | Ga0207684_10031189 | Ga0207684_100311892 | 108 |
| 561 | 3300025910 | Ga0207684_10103621 | Ga0207684_101036212 | 108 |
| 562 | 3300025911 | Ga0207654_10572295 | Ga0207654_105722952 | 108 |
| 563 | 3300025911 | Ga0207654_10982222 | Ga0207654_109822221 | 108 |
| 564 | 3300025912 | Ga0207707_10014574 | Ga0207707_100145745 | 108 |
| 565 | 3300025912 | Ga0207707_10015856 | Ga0207707_100158563 | 108 |
| 566 | 3300025912 | Ga0207707_10059039 | Ga0207707_100590392 | 108 |
| 567 | 3300025912 | Ga0207707_10065914 | Ga0207707_100659143 | 108 |
| 568 | 3300025912 | Ga0207707_10146842 | Ga0207707_101468422 | 108 |
| 569 | 3300025912 | Ga0207707_10166288 | Ga0207707_101662882 | 108 |
| 570 | 3300025912 | Ga0207707_10396764 | Ga0207707_103967642 | 108 |
| 571 | 3300025912 | Ga0207707_10425247 | Ga0207707_104252472 | 108 |
| 572 | 3300025912 | Ga0207707_10436192 | Ga0207707_104361922 | 108 |
| 573 | 3300025912 | Ga0207707_10714939 | Ga0207707_107149391 | 108 |
| 574 | 3300025912 | Ga0207707_11646177 | Ga0207707_116461771 | 108 |
| 575 | 3300025913 | Ga0207695_10006890 | Ga0207695_1000689013 | 108 |
| 576 | 3300025913 | Ga0207695_10028752 | Ga0207695_100287525 | 108 |
| 577 | 3300025913 | Ga0207695_10123495 | Ga0207695_101234952 | 108 |
| 578 | 3300025913 | Ga0207695_10235955 | Ga0207695_102359552 | 108 |
| 579 | 3300025914 | Ga0207671_10344576 | Ga0207671_103445762 | 108 |
| 580 | 3300025915 | Ga0207693_10008333 | Ga0207693_100083335 | 108 |
| 581 | 3300025915 | Ga0207693_10613632 | Ga0207693_106136322 | 108 |
| 582 | 3300025915 | Ga0207693_11287376 | Ga0207693_112873761 | 108 |
| 583 | 3300025916 | Ga0207663_10266806 | Ga0207663_102668062 | 108 |
| 584 | 3300025916 | Ga0207663_11719895 | Ga0207663_117198951 | 108 |
| 585 | 3300025917 | Ga0207660_10000818 | Ga0207660_1000081816 | 108 |
| 586 | 3300025917 | Ga0207660_10033905 | Ga0207660_100339052 | 108 |
| 587 | 3300025917 | Ga0207660_10059970 | Ga0207660_100599702 | 108 |
| 588 | 3300025917 | Ga0207660_10092736 | Ga0207660_100927362 | 108 |
| 589 | 3300025917 | Ga0207660_10211015 | Ga0207660_102110153 | 108 |
| 590 | 3300025917 | Ga0207660_10218929 | Ga0207660_102189291 | 108 |
| 591 | 3300025917 | Ga0207660_10278600 | Ga0207660_102786002 | 108 |
| 592 | 3300025917 | Ga0207660_11170159 | Ga0207660_111701592 | 108 |
| 593 | 3300025918 | Ga0207662_10003539 | Ga0207662_100035395 | 108 |
| 594 | 3300025918 | Ga0207662_10004466 | Ga0207662_100044666 | 108 |
| 595 | 3300025919 | Ga0207657_10038882 | Ga0207657_100388823 | 108 |
| 596 | 3300025919 | Ga0207657_10111500 | Ga0207657_101115002 | 108 |
| 597 | 3300025919 | Ga0207657_10148321 | Ga0207657_101483212 | 108 |
| 598 | 3300025920 | Ga0207649_10355685 | Ga0207649_103556851 | 108 |
| 599 | 3300025920 | Ga0207649_10398525 | Ga0207649_103985252 | 108 |
| 600 | 3300025920 | Ga0207649_10711865 | Ga0207649_107118652 | 108 |
| 601 | 3300025920 | Ga0207649_11045494 | Ga0207649_110454942 | 108 |
| 602 | 3300025921 | Ga0207652_10021476 | Ga0207652_100214764 | 108 |
| 603 | 3300025921 | Ga0207652_10086905 | Ga0207652_100869053 | 108 |
| 604 | 3300025921 | Ga0207652_10103796 | Ga0207652_101037962 | 108 |
| 605 | 3300025921 | Ga0207652_10197638 | Ga0207652_101976382 | 108 |
| 606 | 3300025921 | Ga0207652_10314431 | Ga0207652_103144311 | 108 |
| 607 | 3300025921 | Ga0207652_10325978 | Ga0207652_103259782 | 108 |
| 608 | 3300025921 | Ga0207652_10335387 | Ga0207652_103353872 | 108 |
| 609 | 3300025921 | Ga0207652_10375658 | Ga0207652_103756582 | 108 |
| 610 | 3300025921 | Ga0207652_10454275 | Ga0207652_104542751 | 108 |
| 611 | 3300025922 | Ga0207646_10004321 | Ga0207646_1000432113 | 108 |
| 612 | 3300025922 | Ga0207646_10013479 | Ga0207646_100134793 | 108 |
| 613 | 3300025923 | Ga0207681_10002415 | Ga0207681_1000241512 | 108 |
| 614 | 3300025923 | Ga0207681_10013977 | Ga0207681_100139774 | 108 |
| 615 | 3300025923 | Ga0207681_10440455 | Ga0207681_104404551 | 108 |
| 616 | 3300025924 | Ga0207694_10017770 | Ga0207694_100177703 | 108 |
| 617 | 3300025924 | Ga0207694_10017815 | Ga0207694_100178151 | 108 |
| 618 | 3300025924 | Ga0207694_10041334 | Ga0207694_100413343 | 108 |
| 619 | 3300025924 | Ga0207694_10137989 | Ga0207694_101379892 | 108 |
| 620 | 3300025924 | Ga0207694_10971835 | Ga0207694_109718351 | 108 |
| 621 | 3300025925 | Ga0207650_10173797 | Ga0207650_101737971 | 108 |
| 622 | 3300025925 | Ga0207650_10210181 | Ga0207650_102101812 | 108 |
| 623 | 3300025925 | Ga0207650_10954928 | Ga0207650_109549281 | 108 |
| 624 | 3300025926 | Ga0207659_10007815 | Ga0207659_100078155 | 108 |
| 625 | 3300025926 | Ga0207659_10106456 | Ga0207659_101064562 | 108 |
| 626 | 3300025926 | Ga0207659_10440069 | Ga0207659_104400692 | 108 |
| 627 | 3300025926 | Ga0207659_10460170 | Ga0207659_104601702 | 108 |
| 628 | 3300025926 | Ga0207659_10492158 | Ga0207659_104921582 | 108 |
| 629 | 3300025927 | Ga0207687_10086323 | Ga0207687_100863232 | 108 |
| 630 | 3300025927 | Ga0207687_10099200 | Ga0207687_100992002 | 108 |
| 631 | 3300025927 | Ga0207687_10163444 | Ga0207687_101634442 | 108 |
| 632 | 3300025927 | Ga0207687_10494852 | Ga0207687_104948521 | 108 |
| 633 | 3300025927 | Ga0207687_10889106 | Ga0207687_108891061 | 108 |
| 634 | 3300025928 | Ga0207700_10000773 | Ga0207700_100007733 | 108 |
| 635 | 3300025928 | Ga0207700_10799452 | Ga0207700_107994522 | 108 |
| 636 | 3300025929 | Ga0207664_10014780 | Ga0207664_100147802 | 108 |
| 637 | 3300025929 | Ga0207664_10083531 | Ga0207664_100835312 | 108 |
| 638 | 3300025929 | Ga0207664_10174502 | Ga0207664_101745022 | 108 |
| 639 | 3300025929 | Ga0207664_10242750 | Ga0207664_102427502 | 108 |
| 640 | 3300025929 | Ga0207664_10673104 | Ga0207664_106731041 | 108 |
| 641 | 3300025931 | Ga0207644_10074312 | Ga0207644_100743121 | 108 |
| 642 | 3300025931 | Ga0207644_10139062 | Ga0207644_101390622 | 108 |
| 643 | 3300025931 | Ga0207644_10237320 | Ga0207644_102373202 | 108 |
| 644 | 3300025931 | Ga0207644_11294695 | Ga0207644_112946951 | 108 |
| 645 | 3300025931 | Ga0207644_11539021 | Ga0207644_115390212 | 108 |
| 646 | 3300025931 | Ga0207644_11616957 | Ga0207644_116169572 | 108 |
| 647 | 3300025931 | Ga0207644_11708123 | Ga0207644_117081231 | 108 |
| 648 | 3300025932 | Ga0207690_10155854 | Ga0207690_101558542 | 108 |
| 649 | 3300025932 | Ga0207690_10263098 | Ga0207690_102630982 | 108 |
| 650 | 3300025932 | Ga0207690_10725305 | Ga0207690_107253051 | 108 |
| 651 | 3300025932 | Ga0207690_11348961 | Ga0207690_113489611 | 108 |
| 652 | 3300025933 | Ga0207706_10008341 | Ga0207706_100083416 | 108 |
| 653 | 3300025933 | Ga0207706_10198599 | Ga0207706_101985992 | 108 |
| 654 | 3300025933 | Ga0207706_10328157 | Ga0207706_103281571 | 108 |
| 655 | 3300025933 | Ga0207706_10451175 | Ga0207706_104511751 | 108 |
| 656 | 3300025934 | Ga0207686_10130616 | Ga0207686_101306162 | 108 |
| 657 | 3300025935 | Ga0207709_10238216 | Ga0207709_102382162 | 108 |
| 658 | 3300025935 | Ga0207709_10617346 | Ga0207709_106173461 | 108 |
| 659 | 3300025935 | Ga0207709_10747699 | Ga0207709_107476992 | 108 |
| 660 | 3300025936 | Ga0207670_10023378 | Ga0207670_100233783 | 108 |
| 661 | 3300025936 | Ga0207670_10547655 | Ga0207670_105476552 | 108 |
| 662 | 3300025936 | Ga0207670_11297989 | Ga0207670_112979891 | 108 |
| 663 | 3300025937 | Ga0207669_10098019 | Ga0207669_100980192 | 108 |
| 664 | 3300025937 | Ga0207669_10187364 | Ga0207669_101873642 | 108 |
| 665 | 3300025938 | Ga0207704_10002383 | Ga0207704_100023832 | 108 |
| 666 | 3300025938 | Ga0207704_10243064 | Ga0207704_102430642 | 108 |
| 667 | 3300025938 | Ga0207704_10972910 | Ga0207704_109729102 | 108 |
| 668 | 3300025939 | Ga0207665_10000466 | Ga0207665_100004666 | 108 |
| 669 | 3300025939 | Ga0207665_10195005 | Ga0207665_101950051 | 108 |
| 670 | 3300025939 | Ga0207665_10446952 | Ga0207665_104469522 | 108 |
| 671 | 3300025939 | Ga0207665_10990476 | Ga0207665_109904761 | 108 |
| 672 | 3300025940 | Ga0207691_10027348 | Ga0207691_100273485 | 108 |
| 673 | 3300025940 | Ga0207691_10041030 | Ga0207691_100410305 | 108 |
| 674 | 3300025940 | Ga0207691_10164568 | Ga0207691_101645682 | 108 |
| 675 | 3300025940 | Ga0207691_10326229 | Ga0207691_103262292 | 108 |
| 676 | 3300025940 | Ga0207691_10638468 | Ga0207691_106384682 | 108 |
| 677 | 3300025940 | Ga0207691_11637636 | Ga0207691_116376361 | 108 |
| 678 | 3300025941 | Ga0207711_10047601 | Ga0207711_100476012 | 108 |
| 679 | 3300025941 | Ga0207711_10213627 | Ga0207711_102136271 | 108 |
| 680 | 3300025944 | Ga0207661_10033051 | Ga0207661_100330512 | 108 |
| 681 | 3300025944 | Ga0207661_10079709 | Ga0207661_100797092 | 108 |
| 682 | 3300025944 | Ga0207661_10152230 | Ga0207661_101522302 | 108 |
| 683 | 3300025944 | Ga0207661_10258574 | Ga0207661_102585742 | 108 |
| 684 | 3300025944 | Ga0207661_10306176 | Ga0207661_103061762 | 108 |
| 685 | 3300025944 | Ga0207661_10402411 | Ga0207661_104024112 | 108 |
| 686 | 3300025944 | Ga0207661_10436894 | Ga0207661_104368942 | 108 |
| 687 | 3300025944 | Ga0207661_10453001 | Ga0207661_104530012 | 108 |
| 688 | 3300025944 | Ga0207661_10498764 | Ga0207661_104987641 | 108 |
| 689 | 3300025944 | Ga0207661_10894206 | Ga0207661_108942062 | 108 |
| 690 | 3300025944 | Ga0207661_10943943 | Ga0207661_109439432 | 108 |
| 691 | 3300025944 | Ga0207661_10992203 | Ga0207661_109922031 | 108 |
| 692 | 3300025944 | Ga0207661_11019028 | Ga0207661_110190282 | 108 |
| 693 | 3300025944 | Ga0207661_11786700 | Ga0207661_117867002 | 108 |
| 694 | 3300025944 | Ga0207661_11909820 | Ga0207661_119098201 | 108 |
| 695 | 3300025945 | Ga0207679_10172202 | Ga0207679_101722022 | 108 |
| 696 | 3300025945 | Ga0207679_10269921 | Ga0207679_102699212 | 108 |
| 697 | 3300025945 | Ga0207679_10470072 | Ga0207679_104700722 | 108 |
| 698 | 3300025945 | Ga0207679_10767680 | Ga0207679_107676802 | 108 |
| 699 | 3300025945 | Ga0207679_10802003 | Ga0207679_108020032 | 108 |
| 700 | 3300025945 | Ga0207679_11181746 | Ga0207679_111817461 | 108 |
| 701 | 3300025949 | Ga0207667_10173101 | Ga0207667_101731012 | 108 |
| 702 | 3300025949 | Ga0207667_10406468 | Ga0207667_104064683 | 108 |
| 703 | 3300025949 | Ga0207667_11058113 | Ga0207667_110581131 | 108 |
| 704 | 3300025960 | Ga0207651_10017001 | Ga0207651_100170013 | 108 |
| 705 | 3300025960 | Ga0207651_10883538 | Ga0207651_108835381 | 108 |
| 706 | 3300025960 | Ga0207651_11242957 | Ga0207651_112429572 | 108 |
| 707 | 3300025960 | Ga0207651_11875001 | Ga0207651_118750011 | 108 |
| 708 | 3300025961 | Ga0207712_10000403 | Ga0207712_1000040332 | 108 |
| 709 | 3300025961 | Ga0207712_10550917 | Ga0207712_105509172 | 108 |
| 710 | 3300025961 | Ga0207712_11225899 | Ga0207712_112258991 | 108 |
| 711 | 3300025972 | Ga0207668_10009579 | Ga0207668_100095796 | 108 |
| 712 | 3300025972 | Ga0207668_10159003 | Ga0207668_101590032 | 108 |
| 713 | 3300025981 | Ga0207640_10076568 | Ga0207640_100765682 | 108 |
| 714 | 3300025981 | Ga0207640_10127247 | Ga0207640_101272472 | 108 |
| 715 | 3300025981 | Ga0207640_10836713 | Ga0207640_108367132 | 108 |
| 716 | 3300025981 | Ga0207640_10837834 | Ga0207640_108378341 | 108 |
| 717 | 3300025981 | Ga0207640_11570828 | Ga0207640_115708282 | 108 |
| 718 | 3300025986 | Ga0207658_10161741 | Ga0207658_101617411 | 108 |
| 719 | 3300025986 | Ga0207658_10298313 | Ga0207658_102983131 | 108 |
| 720 | 3300025986 | Ga0207658_10545267 | Ga0207658_105452671 | 108 |
| 721 | 3300026023 | Ga0207677_10004927 | Ga0207677_100049274 | 108 |
| 722 | 3300026023 | Ga0207677_10323075 | Ga0207677_103230752 | 108 |
| 723 | 3300026023 | Ga0207677_10686557 | Ga0207677_106865572 | 108 |
| 724 | 3300026023 | Ga0207677_11115775 | Ga0207677_111157751 | 108 |
| 725 | 3300026035 | Ga0207703_10261828 | Ga0207703_102618281 | 108 |
| 726 | 3300026035 | Ga0207703_10324696 | Ga0207703_103246961 | 108 |
| 727 | 3300026041 | Ga0207639_10006980 | Ga0207639_100069805 | 108 |
| 728 | 3300026041 | Ga0207639_10092619 | Ga0207639_100926192 | 108 |
| 729 | 3300026041 | Ga0207639_10472752 | Ga0207639_104727522 | 108 |
| 730 | 3300026041 | Ga0207639_10652957 | Ga0207639_106529572 | 108 |
| 731 | 3300026067 | Ga0207678_10076175 | Ga0207678_100761752 | 108 |
| 732 | 3300026067 | Ga0207678_10183539 | Ga0207678_101835392 | 108 |
| 733 | 3300026067 | Ga0207678_10573108 | Ga0207678_105731082 | 108 |
| 734 | 3300026067 | Ga0207678_10918209 | Ga0207678_109182092 | 108 |
| 735 | 3300026075 | Ga0207708_10006225 | Ga0207708_100062256 | 108 |
| 736 | 3300026075 | Ga0207708_10019142 | Ga0207708_100191424 | 108 |
| 737 | 3300026075 | Ga0207708_10670505 | Ga0207708_106705052 | 108 |
| 738 | 3300026075 | Ga0207708_10936986 | Ga0207708_109369862 | 108 |
| 739 | 3300026078 | Ga0207702_10089912 | Ga0207702_100899122 | 108 |
| 740 | 3300026078 | Ga0207702_10406375 | Ga0207702_104063752 | 108 |
| 741 | 3300026078 | Ga0207702_10704189 | Ga0207702_107041892 | 108 |
| 742 | 3300026078 | Ga0207702_11896634 | Ga0207702_118966342 | 108 |
| 743 | 3300026088 | Ga0207641_10524299 | Ga0207641_105242992 | 108 |
| 744 | 3300026089 | Ga0207648_10017109 | Ga0207648_100171093 | 108 |
| 745 | 3300026089 | Ga0207648_10034209 | Ga0207648_100342093 | 108 |
| 746 | 3300026089 | Ga0207648_10076480 | Ga0207648_100764803 | 108 |
| 747 | 3300026089 | Ga0207648_10125655 | Ga0207648_101256552 | 108 |
| 748 | 3300026089 | Ga0207648_10145068 | Ga0207648_101450682 | 108 |
| 749 | 3300026089 | Ga0207648_10341086 | Ga0207648_103410862 | 108 |
| 750 | 3300026089 | Ga0207648_10455817 | Ga0207648_104558172 | 108 |
| 751 | 3300026095 | Ga0207676_10036095 | Ga0207676_100360952 | 108 |
| 752 | 3300026095 | Ga0207676_10223408 | Ga0207676_102234082 | 108 |
| 753 | 3300026116 | Ga0207674_10005615 | Ga0207674_100056159 | 108 |
| 754 | 3300026116 | Ga0207674_10014941 | Ga0207674_100149412 | 108 |
| 755 | 3300026116 | Ga0207674_10209381 | Ga0207674_102093812 | 108 |
| 756 | 3300026116 | Ga0207674_10306503 | Ga0207674_103065032 | 108 |
| 757 | 3300026116 | Ga0207674_10505316 | Ga0207674_105053162 | 108 |
| 758 | 3300026118 | Ga0207675_100366981 | Ga0207675_1003669812 | 108 |
| 759 | 3300026121 | Ga0207683_10012414 | Ga0207683_100124143 | 108 |
| 760 | 3300026121 | Ga0207683_10395115 | Ga0207683_103951152 | 108 |
| 761 | 3300026121 | Ga0207683_10405432 | Ga0207683_104054322 | 108 |
| 762 | 3300026121 | Ga0207683_11628457 | Ga0207683_116284571 | 108 |
| 763 | 3300026142 | Ga0207698_10027735 | Ga0207698_100277353 | 108 |
| 764 | 3300026142 | Ga0207698_10094497 | Ga0207698_100944971 | 108 |
| 765 | 3300026142 | Ga0207698_10153048 | Ga0207698_101530482 | 108 |
| 766 | 3300026142 | Ga0207698_10269601 | Ga0207698_102696012 | 108 |
| 767 | 3300026142 | Ga0207698_10284098 | Ga0207698_102840982 | 108 |
| 768 | 3300026142 | Ga0207698_10725673 | Ga0207698_107256732 | 108 |
| 769 | 3300026142 | Ga0207698_11145611 | Ga0207698_111456111 | 108 |
| 770 | 3300026142 | Ga0207698_11411028 | Ga0207698_114110282 | 108 |
| 771 | 3300027378 | Ga0209981_1013967 | Ga0209981_10139672 | 108 |
| 772 | 3300027462 | Ga0210000_1002573 | Ga0210000_10025732 | 108 |
| 773 | 3300027543 | Ga0209999_1002764 | Ga0209999_10027642 | 108 |
| 774 | 3300027695 | Ga0209966_1009819 | Ga0209966_10098192 | 108 |
| 775 | 3300028379 | Ga0268266_11214417 | Ga0268266_112144172 | 108 |
| 776 | 3300028380 | Ga0268265_10137082 | Ga0268265_101370822 | 108 |
| 777 | 3300028381 | Ga0268264_10406727 | Ga0268264_104067271 | 108 |
| 778 | 3300030736 | Ga0316180_1134937 | Ga0316180_11349371 | 108 |
| 779 | 3300030745 | Ga0316182_1362494 | Ga0316182_13624941 | 108 |
| 780 | 3300031548 | Ga0307408_100209033 | Ga0307408_1002090332 | 108 |
| 781 | 3300031548 | Ga0307408_101045005 | Ga0307408_1010450052 | 108 |
| 782 | 3300031548 | Ga0307408_102347908 | Ga0307408_1023479081 | 108 |
| 783 | 3300031548 | Ga0307408_102458346 | Ga0307408_1024583461 | 108 |
| 784 | 3300031728 | Ga0316578_10657619 | Ga0316578_106576191 | 108 |
| 785 | 3300031731 | Ga0307405_10015090 | Ga0307405_100150903 | 108 |
| 786 | 3300031731 | Ga0307405_10448704 | Ga0307405_104487042 | 108 |
| 787 | 3300031731 | Ga0307405_10801686 | Ga0307405_108016861 | 108 |
| 788 | 3300031824 | Ga0307413_10099233 | Ga0307413_100992332 | 108 |
| 789 | 3300031824 | Ga0307413_10412579 | Ga0307413_104125792 | 108 |
| 790 | 3300031852 | Ga0307410_10077786 | Ga0307410_100777862 | 108 |
| 791 | 3300031852 | Ga0307410_10140438 | Ga0307410_101404382 | 108 |
| 792 | 3300031852 | Ga0307410_10202544 | Ga0307410_102025441 | 108 |
| 793 | 3300031852 | Ga0307410_10339023 | Ga0307410_103390232 | 108 |
| 794 | 3300031901 | Ga0307406_10041009 | Ga0307406_100410092 | 108 |
| 795 | 3300031901 | Ga0307406_10050359 | Ga0307406_100503592 | 108 |
| 796 | 3300031901 | Ga0307406_11301176 | Ga0307406_113011761 | 108 |
| 797 | 3300031901 | Ga0307406_11639798 | Ga0307406_116397982 | 108 |
| 798 | 3300031903 | Ga0307407_10129073 | Ga0307407_101290732 | 108 |
| 799 | 3300031903 | Ga0307407_10342139 | Ga0307407_103421392 | 108 |
| 800 | 3300031903 | Ga0307407_10573274 | Ga0307407_105732742 | 108 |
| 801 | 3300031911 | Ga0307412_10157309 | Ga0307412_101573092 | 108 |
| 802 | 3300031995 | Ga0307409_100052967 | Ga0307409_1000529672 | 108 |
| 803 | 3300031995 | Ga0307409_100256825 | Ga0307409_1002568252 | 108 |
| 804 | 3300031995 | Ga0307409_100737466 | Ga0307409_1007374661 | 108 |
| 805 | 3300031995 | Ga0307409_101015184 | Ga0307409_1010151842 | 108 |
| 806 | 3300032002 | Ga0307416_100102135 | Ga0307416_1001021352 | 108 |
| 807 | 3300032002 | Ga0307416_100331187 | Ga0307416_1003311871 | 108 |
| 808 | 3300032002 | Ga0307416_100699242 | Ga0307416_1006992422 | 108 |
| 809 | 3300032002 | Ga0307416_101367355 | Ga0307416_1013673551 | 108 |
| 810 | 3300032004 | Ga0307414_10154256 | Ga0307414_101542561 | 108 |
| 811 | 3300032004 | Ga0307414_10588620 | Ga0307414_105886202 | 108 |
| 812 | 3300032004 | Ga0307414_11835712 | Ga0307414_118357121 | 108 |
| 813 | 3300032005 | Ga0307411_10044355 | Ga0307411_100443552 | 108 |
| 814 | 3300032005 | Ga0307411_10297372 | Ga0307411_102973722 | 108 |
| 815 | 3300032005 | Ga0307411_10420843 | Ga0307411_104208432 | 108 |
| 816 | 3300032005 | Ga0307411_10903345 | Ga0307411_109033451 | 108 |
| 817 | 3300032126 | Ga0307415_100086437 | Ga0307415_1000864372 | 108 |
| 818 | 3300032126 | Ga0307415_101057629 | Ga0307415_1010576292 | 108 |
| 819 | 3300034817 | Ga0373948_0008842 | Ga0373948_0008842_545_901 | 108 |
| 820 | 3300035083 | Ga0373926_0084345 | Ga0373926_0084345_105_452 | 108 |
| 821 | 3300035086 | Ga0373934_0000463 | Ga0373934_0000463_3753_4100 | 108 |
| 822 | 3300035089 | Ga0373944_0036358 | Ga0373944_0036358_519_866 | 108 |
| 823 | 3300035090 | Ga0373949_0023357 | Ga0373949_0023357_1010_1336 | 108 |
| 824 | 3300035091 | Ga0373951_0110682 | Ga0373951_0110682_15_371 | 108 |
| 825 | 3300035111 | Ga0373923_0001722 | Ga0373923_0001722_428_775 | 108 |
| 826 | 3300035113 | Ga0373936_0054724 | Ga0373936_0054724_459_806 | 108 |
| 827 | 3300035115 | Ga0373941_0011511 | Ga0373941_0011511_1387_1743 | 108 |
| 828 | 3300035116 | Ga0373945_0005281 | Ga0373945_0005281_2134_2481 | 108 |
| 829 | 3300035117 | Ga0373953_0022490 | Ga0373953_0022490_1228_1575 | 108 |
| 830 | 3300035118 | Ga0373954_0065865 | Ga0373954_0065865_903_1250 | 108 |
| 831 | 3300035119 | Ga0373956_0000644 | Ga0373956_0000644_11890_12237 | 108 |
| 832 | 3300035120 | Ga0373957_0025840 | Ga0373957_0025840_974_1321 | 108 |
| 833 | 3300035120 | Ga0373957_0238908 | Ga0373957_0238908_242_643 | 108 |
| 834 | 3300035121 | Ga0373960_0321557 | Ga0373960_0321557_103_459 | 108 |
| 835 | 3300035170 | Ga0373943_0000618 | Ga0373943_0000618_3515_3862 | 108 |
| 836 | 3300035171 | Ga0373946_0035605 | Ga0373946_0035605_512_859 | 108 |
| 837 | 3300035172 | Ga0373955_0009773 | Ga0373955_0009773_1674_2021 | 108 |
| 838 | 3300035172 | Ga0373955_0331780 | Ga0373955_0331780_334_690 | 108 |
| 839 | 3300035241 | Ga0373961_0368125 | Ga0373961_0368125_95_451 | 108 |
| 840 | 3300035691 | Ga0373931_0110974 | Ga0373931_0110974_857_1213 | 108 |
| 841 | 3300035691 | Ga0373931_0858534 | Ga0373931_0858534_110_457 | 108 |
| 842 | 3300035691 | Ga0373931_1220283 | Ga0373931_1220283_65_466 | 108 |
| 843 | 3300035692 | Ga0373935_0001230 | Ga0373935_0001230_3189_3536 | 108 |
| 844 | 3300035695 | Ga0373927_0010997 | Ga0373927_0010997_1739_2086 | 108 |
| 845 | 3300035695 | Ga0373927_0113627 | Ga0373927_0113627_877_1224 | 108 |
| 846 | 3300035724 | Ga0373933_0004688 | Ga0373933_0004688_3752_4099 | 108 |
| 847 | 3300035725 | Ga0373947_0000019 | Ga0373947_0000019_55996_56343 | 108 |
| 848 | 3300036401 | Ga0373937_0000142 | Ga0373937_0000142_56555_56902 | 108 |
| 849 | 3300036401 | Ga0373937_1416903 | Ga0373937_1416903_119_475 | 108 |
| 850 | 3300036647 | Ga0316582_0172303 | Ga0316582_0172303_196_558 | 108 |
| 851 | 3300037068 | Ga0373925_0000303 | Ga0373925_0000303_31363_31710 | 108 |
| 852 | 3300037418 | Ga0395900_0547098 | Ga0395900_0547098_590_916 | 108 |
| 853 | 3300037471 | Ga0395905_0054759 | Ga0395905_0054759_1179_1535 | 108 |
| 854 | 3300037471 | Ga0395905_0602041 | Ga0395905_0602041_411_812 | 108 |
| 855 | 3300038443 | Ga0395901_1036988 | Ga0395901_1036988_243_590 | 108 |
| 856 | 3300038996 | Ga0242420_023461 | Ga0242420_023461_699_1055 | 108 |
| 857 | 3300039437 | Ga0436365_0141229 | Ga0436365_0141229_1734_2090 | 108 |
| 858 | 3300039437 | Ga0436365_1138491 | Ga0436365_1138491_442_798 | 108 |
| 859 | 3300041496 | Ga0451839_0967978 | Ga0451839_0967978_183_539 | 108 |
| 860 | 3300041512 | Ga0451853_1892066 | Ga0451853_1892066_111_467 | 108 |
| 861 | 3300041512 | Ga0451853_3935002 | Ga0451853_3935002_674_1030 | 108 |
| 862 | 3300044684 | Ga0466966_0192934 | Ga0466966_0192934_816_1163 | 108 |
| 863 | 3300044694 | Ga0466963_0289789 | Ga0466963_0289789_742_1098 | 108 |
| 864 | 3300044694 | Ga0466963_0749985 | Ga0466963_0749985_31_378 | 108 |
| 865 | 3300044694 | Ga0466963_0777870 | Ga0466963_0777870_279_635 | 108 |
| 866 | 3300044706 | Ga0466964_0470530 | Ga0466964_0470530_151_507 | 108 |
| 867 | 3300045049 | Ga0466959_0145435 | Ga0466959_0145435_993_1340 | 108 |
| 868 | 3300045836 | Ga0466958_0083501 | Ga0466958_0083501_356_712 | 108 |
| 869 | 3300045836 | Ga0466958_0088156 | Ga0466958_0088156_1413_1760 | 108 |
| 870 | 3300045836 | Ga0466958_0201449 | Ga0466958_0201449_20_367 | 108 |
| 871 | 3300045976 | Ga0466967_0269257 | Ga0466967_0269257_774_1121 | 108 |
| 872 | 3300045976 | Ga0466967_0799220 | Ga0466967_0799220_334_690 | 108 |
| 873 | 3300045976 | Ga0466967_1200499 | Ga0466967_1200499_360_716 | 108 |
| 874 | 3300045976 | Ga0466967_1347879 | Ga0466967_1347879_269_616 | 108 |
| 875 | 3300046454 | Ga0495592_0026016 | Ga0495592_0026016_3353_3700 | 108 |
| 876 | 3300046454 | Ga0495592_0602698 | Ga0495592_0602698_233_589 | 108 |
| 877 | 3300046462 | Ga0495651_0000723 | Ga0495651_0000723_5117_5464 | 108 |
| 878 | 3300046462 | Ga0495651_0580264 | Ga0495651_0580264_189_545 | 108 |
| 879 | 3300046462 | Ga0495651_0795701 | Ga0495651_0795701_201_557 | 108 |
| 880 | 3300046462 | Ga0495651_0885881 | Ga0495651_0885881_138_494 | 108 |
| 881 | 3300046463 | Ga0495653_0003352 | Ga0495653_0003352_2241_2588 | 108 |
| 882 | 3300046472 | Ga0495580_0000426 | Ga0495580_0000426_27662_28009 | 108 |
| 883 | 3300046473 | Ga0495582_0000045 | Ga0495582_0000045_42541_42888 | 108 |
| 884 | 3300046475 | Ga0495639_0000403 | Ga0495639_0000403_11939_12286 | 108 |
| 885 | 3300046475 | Ga0495639_0286260 | Ga0495639_0286260_261_617 | 108 |
| 886 | 3300046476 | Ga0495662_0392431 | Ga0495662_0392431_187_543 | 108 |
| 887 | 3300046477 | Ga0495664_0569994 | Ga0495664_0569994_37_393 | 108 |
| 888 | 3300046499 | Ga0495594_0075984 | Ga0495594_0075984_622_969 | 108 |
| 889 | 3300046499 | Ga0495594_0477202 | Ga0495594_0477202_119_445 | 108 |
| 890 | 3300046511 | Ga0495608_0002935 | Ga0495608_0002935_6169_6516 | 108 |
| 891 | 3300046511 | Ga0495608_0032534 | Ga0495608_0032534_3016_3372 | 108 |
| 892 | 3300046511 | Ga0495608_0184800 | Ga0495608_0184800_157_513 | 108 |
| 893 | 3300046514 | Ga0495618_0333188 | Ga0495618_0333188_455_811 | 108 |
| 894 | 3300046516 | Ga0495628_0000674 | Ga0495628_0000674_7856_8203 | 108 |
| 895 | 3300046517 | Ga0495630_0003749 | Ga0495630_0003749_9885_10232 | 108 |
| 896 | 3300046517 | Ga0495630_0012293 | Ga0495630_0012293_5162_5509 | 108 |
| 897 | 3300046517 | Ga0495630_0077935 | Ga0495630_0077935_1907_2263 | 108 |
| 898 | 3300046517 | Ga0495630_0217970 | Ga0495630_0217970_233_589 | 108 |
| 899 | 3300046522 | Ga0495643_0064527 | Ga0495643_0064527_1024_1380 | 108 |
| 900 | 3300046525 | Ga0495663_0118759 | Ga0495663_0118759_491_847 | 108 |
| 901 | 3300046525 | Ga0495663_0174665 | Ga0495663_0174665_223_624 | 108 |
| 902 | 3300046526 | Ga0495666_0500949 | Ga0495666_0500949_30_356 | 108 |
| 903 | 3300046529 | Ga0495652_0017042 | Ga0495652_0017042_1624_1971 | 108 |
| 904 | 3300046529 | Ga0495652_0353847 | Ga0495652_0353847_543_899 | 108 |
| 905 | 3300046529 | Ga0495652_0856079 | Ga0495652_0856079_173_529 | 108 |
| 906 | 3300046531 | Ga0495665_0000014 | Ga0495665_0000014_29257_29604 | 108 |
| 907 | 3300046531 | Ga0495665_0012549 | Ga0495665_0012549_4182_4529 | 108 |
| 908 | 3300046531 | Ga0495665_0608461 | Ga0495665_0608461_71_397 | 108 |
| 909 | 3300046533 | Ga0495640_0103343 | Ga0495640_0103343_425_781 | 108 |
| 910 | 3300046535 | Ga0495586_0247767 | Ga0495586_0247767_59_415 | 108 |
| 911 | 3300046536 | Ga0495587_0000899 | Ga0495587_0000899_12015_12362 | 108 |
| 912 | 3300046536 | Ga0495587_0033174 | Ga0495587_0033174_526_882 | 108 |
| 913 | 3300046537 | Ga0495598_0060196 | Ga0495598_0060196_729_1073 | 108 |
| 914 | 3300046539 | Ga0495621_0132701 | Ga0495621_0132701_302_703 | 108 |
| 915 | 3300046543 | Ga0495645_0000642 | Ga0495645_0000642_20516_20863 | 108 |
| 916 | 3300046543 | Ga0495645_0197509 | Ga0495645_0197509_852_1208 | 108 |
| 917 | 3300046543 | Ga0495645_0399672 | Ga0495645_0399672_429_785 | 108 |
| 918 | 3300046543 | Ga0495645_0947848 | Ga0495645_0947848_35_391 | 108 |
| 919 | 3300046557 | Ga0495622_0296356 | Ga0495622_0296356_83_430 | 108 |
| 920 | 3300046559 | Ga0495667_0000783 | Ga0495667_0000783_10506_10853 | 108 |
| 921 | 3300046559 | Ga0495667_0500999 | Ga0495667_0500999_297_653 | 108 |
| 922 | 3300046559 | Ga0495667_0829180 | Ga0495667_0829180_131_532 | 108 |
| 923 | 3300046615 | Ga0495656_0421325 | Ga0495656_0421325_344_688 | 108 |
| 924 | 3300046642 | Ga0495634_0167420 | Ga0495634_0167420_149_505 | 108 |
| 925 | 3300046642 | Ga0495634_0231004 | Ga0495634_0231004_638_994 | 108 |
| 926 | 3300046663 | Ga0495635_0000476 | Ga0495635_0000476_17774_18121 | 108 |
| 927 | 3300046663 | Ga0495635_0049264 | Ga0495635_0049264_435_791 | 108 |
| 928 | 3300046663 | Ga0495635_0125122 | Ga0495635_0125122_392_739 | 108 |
| 929 | 3300046663 | Ga0495635_0237297 | Ga0495635_0237297_560_961 | 108 |
| 930 | 3300046664 | Ga0495659_0047114 | Ga0495659_0047114_973_1317 | 108 |
| 931 | 3300046674 | Ga0495588_0000923 | Ga0495588_0000923_1943_2290 | 108 |
| 932 | 3300046675 | Ga0495657_0429893 | Ga0495657_0429893_221_577 | 108 |
| 933 | 3300046675 | Ga0495657_0904031 | Ga0495657_0904031_59_460 | 108 |
| 934 | 3300046678 | Ga0495599_0000524 | Ga0495599_0000524_19444_19791 | 108 |
| 935 | 3300046679 | Ga0495623_0000581 | Ga0495623_0000581_2381_2728 | 108 |
| 936 | 3300046680 | Ga0495646_0005155 | Ga0495646_0005155_5456_5803 | 108 |
| 937 | 3300046680 | Ga0495646_0443223 | Ga0495646_0443223_140_496 | 108 |
| 938 | 3300046683 | Ga0495658_0000038 | Ga0495658_0000038_42842_43189 | 108 |
| 939 | 3300046684 | Ga0495669_0058544 | Ga0495669_0058544_407_763 | 108 |
| 940 | 3300046684 | Ga0495669_0080218 | Ga0495669_0080218_281_607 | 108 |
| 941 | 3300046684 | Ga0495669_0179647 | Ga0495669_0179647_475_876 | 108 |
| 942 | 3300046689 | Ga0495613_0012452 | Ga0495613_0012452_79_426 | 108 |
| 943 | 3300046689 | Ga0495613_0411479 | Ga0495613_0411479_554_901 | 108 |
| 944 | 3300046689 | Ga0495613_0429823 | Ga0495613_0429823_46_402 | 108 |
| 945 | 3300046689 | Ga0495613_1062370 | Ga0495613_1062370_39_395 | 108 |
| 946 | 3300046690 | Ga0495624_0475835 | Ga0495624_0475835_137_484 | 108 |
| 947 | 3300046691 | Ga0495670_0129844 | Ga0495670_0129844_17_361 | 108 |
| 948 | 3300046809 | Ga0495600_0000452 | Ga0495600_0000452_13297_13644 | 108 |
| 949 | 3300047315 | Ga0495581_0000112 | Ga0495581_0000112_31236_31583 | 108 |
| 950 | 3300047317 | Ga0495604_0000592 | Ga0495604_0000592_10574_10921 | 108 |
| 951 | 3300047317 | Ga0495604_0091315 | Ga0495604_0091315_138_494 | 108 |
| 952 | 3300047317 | Ga0495604_0369920 | Ga0495604_0369920_428_829 | 108 |
| 953 | 3300047317 | Ga0495604_0983035 | Ga0495604_0983035_99_455 | 108 |
| 954 | 3300047319 | Ga0495674_0004595 | Ga0495674_0004595_5017_5364 | 108 |
| 955 | 3300047319 | Ga0495674_0683776 | Ga0495674_0683776_428_784 | 108 |
| 956 | 3300047322 | Ga0495680_0006077 | Ga0495680_0006077_7560_7907 | 108 |
| 957 | 3300047322 | Ga0495680_0177063 | Ga0495680_0177063_175_531 | 108 |
| 958 | 3300047322 | Ga0495680_0373402 | Ga0495680_0373402_243_644 | 108 |
| 959 | 3300047444 | Ga0495675_0001981 | Ga0495675_0001981_3318_3665 | 108 |
| 960 | 3300047444 | Ga0495675_0381818 | Ga0495675_0381818_32_388 | 108 |
| 961 | 3300047444 | Ga0495675_0413452 | Ga0495675_0413452_56_412 | 108 |
| 962 | 3300047444 | Ga0495675_0742824 | Ga0495675_0742824_126_482 | 108 |
| 963 | 3300047447 | Ga0495685_149135 | Ga0495685_149135_296_697 | 108 |
| 964 | 3300047471 | Ga0495684_0001660 | Ga0495684_0001660_10809_11156 | 108 |
| 965 | 3300047471 | Ga0495684_0256043 | Ga0495684_0256043_506_862 | 108 |
| 966 | 3300047471 | Ga0495684_1043863 | Ga0495684_1043863_85_441 | 108 |
| 967 | 3300047673 | Ga0495593_0000188 | Ga0495593_0000188_20235_20582 | 108 |
| 968 | 3300047673 | Ga0495593_0724597 | Ga0495593_0724597_33_389 | 108 |
| 969 | 3300048088 | Ga0495602_0003690 | Ga0495602_0003690_11860_12207 | 108 |
| 970 | 3300048088 | Ga0495602_0642928 | Ga0495602_0642928_221_577 | 108 |
| 971 | 3300048088 | Ga0495602_0678813 | Ga0495602_0678813_255_611 | 108 |
| 972 | 3300048088 | Ga0495602_0679160 | Ga0495602_0679160_109_510 | 108 |
| 973 | 3300048089 | Ga0495614_0000013 | Ga0495614_0000013_26568_26915 | 108 |
| 974 | 3300048903 | Ga0496100_0415240 | Ga0496100_0415240_427_753 | 108 |
| 975 | 3300048904 | Ga0496101_0602988 | Ga0496101_0602988_434_835 | 108 |
| 976 | 3300048904 | Ga0496101_1237614 | Ga0496101_1237614_38_364 | 108 |
| 977 | 3300048907 | Ga0496104_0090136 | Ga0496104_0090136_1331_1657 | 108 |
| 978 | 3300048908 | Ga0496105_0168845 | Ga0496105_0168845_1328_1654 | 108 |
| 979 | 3300048909 | Ga0496106_0424884 | Ga0496106_0424884_596_922 | 108 |
| 980 | 3300048910 | Ga0496107_1322151 | Ga0496107_1322151_82_438 | 108 |
| 981 | 3300048911 | Ga0496108_0087841 | Ga0496108_0087841_448_849 | 108 |
| 982 | 3300048912 | Ga0496109_0252506 | Ga0496109_0252506_1171_1497 | 108 |
| 983 | 3300048915 | Ga0496112_0038661 | Ga0496112_0038661_3913_4269 | 108 |
| 984 | 3300048915 | Ga0496112_0062878 | Ga0496112_0062878_2024_2425 | 108 |
| 985 | 3300048915 | Ga0496112_0533269 | Ga0496112_0533269_32_388 | 108 |
| 986 | 3300048915 | Ga0496112_1048747 | Ga0496112_1048747_152_478 | 108 |
| 987 | 3300048916 | Ga0496113_0037466 | Ga0496113_0037466_427_828 | 108 |
| 988 | 3300048917 | Ga0496114_0911149 | Ga0496114_0911149_309_665 | 108 |
| 989 | 3300048918 | Ga0496115_0136899 | Ga0496115_0136899_82_438 | 108 |
| 990 | 3300049532 | Ga0501316_058577 | Ga0501316_058577_150_533 | 108 |
| 991 | 3300049532 | Ga0501316_076459 | Ga0501316_076459_59_460 | 108 |
| 992 | 3300049533 | Ga0501317_096461 | Ga0501317_096461_59_460 | 108 |
| 993 | 3300049568 | Ga0501031_0128102 | Ga0501031_0128102_1077_1433 | 108 |
| 994 | 3300049570 | Ga0501033_0028071 | Ga0501033_0028071_1420_1767 | 108 |
| 995 | 3300049571 | Ga0501034_0082214 | Ga0501034_0082214_1684_2031 | 108 |
| 996 | 3300049572 | Ga0501036_0015341 | Ga0501036_0015341_4791_5138 | 108 |
| 997 | 3300049572 | Ga0501036_0166847 | Ga0501036_0166847_843_1199 | 108 |
| 998 | 3300049574 | Ga0501038_0042595 | Ga0501038_0042595_969_1316 | 108 |
| 999 | 3300049575 | Ga0501039_0217063 | Ga0501039_0217063_431_787 | 108 |
| 1000 | 3300049576 | Ga0501040_0213517 | Ga0501040_0213517_105_461 | 108 |
| 1001 | 3300049577 | Ga0501041_0313543 | Ga0501041_0313543_394_750 | 108 |
| 1002 | 3300049578 | Ga0501042_0172110 | Ga0501042_0172110_952_1308 | 108 |
| 1003 | 3300049578 | Ga0501042_0623750 | Ga0501042_0623750_220_576 | 108 |
| 1004 | 3300049580 | Ga0501046_0036969 | Ga0501046_0036969_1925_2281 | 108 |
| 1005 | 3300049581 | Ga0501047_0245214 | Ga0501047_0245214_1117_1464 | 108 |
| 1006 | 3300049586 | Ga0501070_0046113 | Ga0501070_0046113_2958_3314 | 108 |
| 1007 | 3300049588 | Ga0501072_0324535 | Ga0501072_0324535_636_992 | 108 |
| 1008 | 3300049590 | Ga0501074_0126135 | Ga0501074_0126135_1138_1494 | 108 |
| 1009 | 3300049590 | Ga0501074_0443002 | Ga0501074_0443002_250_606 | 108 |
| 1010 | 3300049651 | Ga0501201_028729 | Ga0501201_028729_66_449 | 108 |
| 1011 | 3300049669 | Ga0501235_098770 | Ga0501235_098770_102_458 | 108 |
| 1012 | 3300049679 | Ga0501249_135073 | Ga0501249_135073_200_583 | 108 |
| 1013 | 3300049686 | Ga0501257_146105 | Ga0501257_146105_175_558 | 108 |
| 1014 | 3300049706 | Ga0501229_054342 | Ga0501229_054342_80_481 | 108 |
| 1015 | 3300049741 | Ga0501079_0160259 | Ga0501079_0160259_142_498 | 108 |
| 1016 | 3300049742 | Ga0501080_0554634 | Ga0501080_0554634_25_381 | 108 |
| 1017 | 3300049742 | Ga0501080_1796127 | Ga0501080_1796127_129_485 | 108 |
| 1018 | 3300049743 | Ga0501081_0057133 | Ga0501081_0057133_1023_1379 | 108 |
| 1019 | 3300049743 | Ga0501081_0177973 | Ga0501081_0177973_164_520 | 108 |
| 1020 | 3300049761 | Ga0501264_044742 | Ga0501264_044742_80_481 | 108 |
| 1021 | 3300049770 | Ga0501273_020123 | Ga0501273_020123_476_832 | 108 |
| 1022 | 3300049822 | Ga0501035_0077656 | Ga0501035_0077656_1294_1641 | 108 |
| 1023 | 3300049823 | Ga0501044_0050994 | Ga0501044_0050994_65_412 | 108 |
| 1024 | 3300049824 | Ga0501045_0072581 | Ga0501045_0072581_710_1066 | 108 |
| 1025 | 3300050507 | nmdc:mga05p37_1294589_c1 | nmdc:mga05p37_1294589_c1_59_388 | 108 |
| 1026 | 3300050507 | nmdc:mga05p37_236139_c1 | nmdc:mga05p37_236139_c1_1592_1948 | 108 |
| 1027 | 3300050508 | nmdc:mga09592_217138_c1 | nmdc:mga09592_217138_c1_949_1305 | 108 |
| 1028 | 3300050508 | nmdc:mga09592_69437_c1 | nmdc:mga09592_69437_c1_2530_2859 | 108 |
| 1029 | 3300050509 | nmdc:mga0qj67_5557_c1 | nmdc:mga0qj67_5557_c1_2531_2887 | 108 |
| 1030 | 3300050510 | nmdc:mga06r32_1430251_c1 | nmdc:mga06r32_1430251_c1_197_526 | 108 |
| 1031 | 3300050510 | nmdc:mga06r32_178005_c1 | nmdc:mga06r32_178005_c1_298_654 | 108 |
| 1032 | 3300050510 | nmdc:mga06r32_185170_c1 | nmdc:mga06r32_185170_c1_290_619 | 108 |
| 1033 | 3300050511 | nmdc:mga08y16_56756_c1 | nmdc:mga08y16_56756_c1_176_532 | 108 |
| 1034 | 3300050511 | nmdc:mga08y16_742576_c1 | nmdc:mga08y16_742576_c1_414_740 | 108 |
| 1035 | 3300050512 | nmdc:mga0n895_184069_c1 | nmdc:mga0n895_184069_c1_1745_2092 | 108 |
| 1036 | 3300050512 | nmdc:mga0n895_975465_c1 | nmdc:mga0n895_975465_c1_398_745 | 108 |
| 1037 | 3300050513 | nmdc:mga0rr50_124612_c1 | nmdc:mga0rr50_124612_c1_1157_1513 | 108 |
| 1038 | 3300050514 | nmdc:mga08x19_150445_c1 | nmdc:mga08x19_150445_c1_1098_1454 | 108 |
| 1039 | 3300050514 | nmdc:mga08x19_196401_c1 | nmdc:mga08x19_196401_c1_436_792 | 108 |
| 1040 | 3300050514 | nmdc:mga08x19_3616_c1 | nmdc:mga08x19_3616_c1_4449_4805 | 108 |
| 1041 | 3300050514 | nmdc:mga08x19_5563_c1 | nmdc:mga08x19_5563_c1_4623_4979 | 108 |
| 1042 | 3300050515 | nmdc:mga0a205_892667_c1 | nmdc:mga0a205_892667_c1_246_647 | 108 |
| 1043 | 3300053077 | Ga0495601_0005901 | Ga0495601_0005901_2359_2706 | 108 |
| 1044 | 3300053078 | Ga0495612_0018548 | Ga0495612_0018548_2247_2594 | 108 |
| 1045 | 3300053085 | Ga0495619_0003300 | Ga0495619_0003300_3719_4066 | 108 |
| 1046 | 3300053085 | Ga0495619_0540789 | Ga0495619_0540789_341_697 | 108 |
| 1047 | 3300054114 | Ga0501084_0192633 | Ga0501084_0192633_1160_1516 | 108 |
| 1048 | 3300054114 | Ga0501084_0714380 | Ga0501084_0714380_355_711 | 108 |
| 1049 | 3300059424 | Ga0590075_141592 | Ga0590075_141592_159_515 | 108 |
| 1050 | 3300059490 | Ga0587066_187366 | Ga0587066_187366_124_480 | 108 |
| 1051 | 3300059490 | Ga0587066_197312 | Ga0587066_197312_155_511 | 108 |
| 1052 | 3300059503 | Ga0587080_180016 | Ga0587080_180016_22_378 | 108 |
| 1053 | 3300059504 | Ga0587082_140745 | Ga0587082_140745_60_416 | 108 |
| 1054 | 3300059508 | Ga0587088_042385 | Ga0587088_042385_235_591 | 108 |
| 1055 | 3300059508 | Ga0587088_107474 | Ga0587088_107474_59_415 | 108 |
| 1056 | 3300059508 | Ga0587088_175248 | Ga0587088_175248_22_378 | 108 |
| 1057 | 3300059511 | Ga0587091_029655 | Ga0587091_029655_393_749 | 108 |
| 1058 | 3300059511 | Ga0587091_167816 | Ga0587091_167816_122_523 | 108 |
| 1059 | 3300059513 | Ga0587094_022552 | Ga0587094_022552_176_532 | 108 |
| 1060 | 3300059623 | Ga0587101_085480 | Ga0587101_085480_173_574 | 108 |
| 1061 | 3300059626 | Ga0587115_036883 | Ga0587115_036883_10_366 | 108 |
| 1062 | 3300059626 | Ga0587115_122384 | Ga0587115_122384_72_428 | 108 |
| 1063 | 3300059630 | Ga0587128_028052 | Ga0587128_028052_392_748 | 108 |
| 1064 | 3300059640 | Ga0587067_135511 | Ga0587067_135511_14_370 | 108 |
| 1065 | 3300059640 | Ga0587067_188716 | Ga0587067_188716_12_368 | 108 |
| 1066 | 3300059642 | Ga0587069_125180 | Ga0587069_125180_93_449 | 108 |
| 1067 | 3300059644 | Ga0587075_024895 | Ga0587075_024895_167_523 | 108 |
| 1068 | 3300059644 | Ga0587075_144129 | Ga0587075_144129_38_439 | 108 |
| 1069 | 3300059647 | Ga0587079_034151 | Ga0587079_034151_471_827 | 108 |
| 1070 | 3300059652 | Ga0587107_088081 | Ga0587107_088081_169_570 | 108 |
| 1071 | 3300059655 | Ga0587114_006593 | Ga0587114_006593_600_956 | 108 |
| 1072 | 3300059658 | Ga0587119_034582 | Ga0587119_034582_218_574 | 108 |
| 1073 | 3300060353 | Ga0501082_0295535 | Ga0501082_0295535_960_1316 | 108 |
| 1074 | 3300060353 | Ga0501082_0487679 | Ga0501082_0487679_65_421 | 108 |
| 1075 | 3300060353 | Ga0501082_1179277 | Ga0501082_1179277_94_450 | 108 |
| 1076 | 3300061734 | Ga0530510_0170125 | Ga0530510_0170125_936_1292 | 108 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.8877 | 2 | 95 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.8638 | 2 | 95 |
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.8575 | 2 | 96 |
| 1x0g-assembly1.cif.gz_A | crystal structure of isca with the [2fe-2s] cluster | 0.8358 | 3 | 106 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.829 | 2 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s98A00 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8638 | 2 | 95 | 2.60.300.12 |
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8575 | 2 | 96 | 2.60.300.12 |
| af_A0A0R0F1L8_21_105_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.851 | 2 | 83 | 2.60.300.12 |
| af_Q2FZV8_4_111_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8466 | 1 | 106 | 2.60.300.12 |
| af_B6SR68_68_176_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8441 | 2 | 106 | 2.60.300.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X5WH35-F1-model_v4 | deleted | 0.9631 | 2 | 100 |
|
| AF-A0A531KMU7-F1-model_v4 | Iron-sulfur cluster assembly accessory protein | 0.9332 | 2 | 96 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A7X5WH35-F1-model_v4 | deleted | 0.9264 | 2 | 100 |
|
| AF-A0A7Y5PBL3-F1-model_v4 | Iron-sulfur cluster assembly accessory protein | 0.9256 | 1 | 108 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A7X9HXH7-F1-model_v4 | Iron-sulfur cluster assembly accessory protein | 0.9224 | 2 | 94 |
GO:0005506
GO:0016020 GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar