F489539
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1074 | 312 | 1073 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100029484|Ga0075428_1000294845 |
| Length | 208 |
| Sequence | VFISCNPSGSWFIFVQEFLCMHDIEPFYNWRHIYIAEEDQRSPFYGQTHSEFEFTQTVYNYYIHPQWDEFGSRTLYMKVLMADYDEKYAIIELIGEWNDAIENDIMTLKREVIDVFELQGITKFILIAENVLNFHSGDKDYYEEWYEETSDEHGWIVILNMPEATQHDFKKAKLNRWLELIDLPEWRTYKPFHLFRKIDSFEQARLAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 187 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 211 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 212 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 213 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 214 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 215 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 216 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 217 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 220 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 221 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 222 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 223 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 224 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 225 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 226 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 227 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 251 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 252 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 262 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 263 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 264 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 265 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 266 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 267 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 268 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 269 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 271 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 272 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 273 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 274 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 275 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 276 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 277 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 278 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 279 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 281 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 286 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 287 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 288 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 289 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 290 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 291 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 292 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 293 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 296 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 305 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 306 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 307 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 308 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 309 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 310 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 311 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 312 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.49 |
| Nodule | 0 |
| Rhizoplane | 0.47 |
| Rhizosphere | 96.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_1772662 | 2162886011 | Bacteria | 1158 |
| 2 | MBSR1b_contig_12669236 | 2162886012 | Bacteria | 1829 |
| 3 | ARCol0yngRDRAFT_1009151 | 3300000652 | Bacteria | 716 |
| 4 | JGI24738J21930_10036993 | 3300002075 | Bacteria | 993 |
| 5 | JGI24744J21845_10043095 | 3300002077 | Unclassified | 841 |
| 6 | JGI24742J22300_10014980 | 3300002244 | Unclassified | 1304 |
| 7 | rootH1_10135696 | 3300003316 | Bacteria | 1472 |
| 8 | rootH2_10020409 | 3300003320 | Bacteria | 10833 |
| 9 | rootH2_10030789 | 3300003320 | Bacteria | 26106 |
| 10 | rootH2_10042646 | 3300003320 | Bacteria | 6260 |
| 11 | rootL2_10203795 | 3300003322 | Bacteria | 1385 |
| 12 | rootH1_10060685 | 3300003323 | Bacteria | 2451 |
| 13 | JGI25160J50197_1028187 | 3300003354 | Bacteria | 1512 |
| 14 | Ga0065704_10114868 | 3300005289 | Bacteria | 1883 |
| 15 | Ga0065704_10254632 | 3300005289 | Bacteria | 980 |
| 16 | Ga0065712_10004322 | 3300005290 | Bacteria | 3285 |
| 17 | Ga0065712_10077307 | 3300005290 | Bacteria | 3515 |
| 18 | Ga0065712_10263234 | 3300005290 | Bacteria | 932 |
| 19 | Ga0065715_10588591 | 3300005293 | Bacteria | 715 |
| 20 | Ga0065707_10024347 | 3300005295 | Bacteria | 1325 |
| 21 | Ga0065707_10105866 | 3300005295 | Unclassified | 2625 |
| 22 | Ga0065707_10342174 | 3300005295 | Bacteria | 932 |
| 23 | Ga0070658_10190011 | 3300005327 | Bacteria | 1731 |
| 24 | Ga0070658_10240820 | 3300005327 | Bacteria | 1533 |
| 25 | Ga0070658_10499951 | 3300005327 | Bacteria | 1050 |
| 26 | Ga0070658_10856487 | 3300005327 | Bacteria | 790 |
| 27 | Ga0070676_10000932 | 3300005328 | Bacteria | 14492 |
| 28 | Ga0070676_10571573 | 3300005328 | Bacteria | 812 |
| 29 | Ga0070683_100001892 | 3300005329 | Bacteria | 16354 |
| 30 | Ga0070683_100007576 | 3300005329 | Bacteria | 9180 |
| 31 | Ga0070683_100016743 | 3300005329 | Bacteria | 6468 |
| 32 | Ga0070683_100019212 | 3300005329 | Bacteria | 6069 |
| 33 | Ga0070683_100053668 | 3300005329 | Bacteria | 3735 |
| 34 | Ga0070683_100264414 | 3300005329 | Bacteria | 1636 |
| 35 | Ga0070690_100015166 | 3300005330 | Bacteria | 4591 |
| 36 | Ga0070690_100068031 | 3300005330 | Unclassified | 2309 |
| 37 | Ga0070670_100012284 | 3300005331 | Bacteria | 7329 |
| 38 | Ga0070670_100035924 | 3300005331 | Bacteria | 4266 |
| 39 | Ga0070670_100036566 | 3300005331 | Bacteria | 4226 |
| 40 | Ga0070670_100036748 | 3300005331 | Bacteria | 4214 |
| 41 | Ga0070670_100078687 | 3300005331 | Bacteria | 2833 |
| 42 | Ga0070670_100089258 | 3300005331 | Bacteria | 2650 |
| 43 | Ga0070670_100091035 | 3300005331 | Bacteria | 2622 |
| 44 | Ga0070670_100104333 | 3300005331 | Bacteria | 2442 |
| 45 | Ga0070670_100144191 | 3300005331 | Bacteria | 2060 |
| 46 | Ga0070670_100160342 | 3300005331 | Unclassified | 1949 |
| 47 | Ga0070670_100269117 | 3300005331 | Bacteria | 1486 |
| 48 | Ga0070670_100994162 | 3300005331 | Bacteria | 763 |
| 49 | Ga0070677_10077856 | 3300005333 | Bacteria | 1411 |
| 50 | Ga0070677_10115573 | 3300005333 | Bacteria | 1204 |
| 51 | Ga0070677_10129117 | 3300005333 | Unclassified | 1151 |
| 52 | Ga0068869_100002337 | 3300005334 | Bacteria | 11406 |
| 53 | Ga0068869_100016584 | 3300005334 | Bacteria | 4967 |
| 54 | Ga0068869_100017315 | 3300005334 | Bacteria | 4882 |
| 55 | Ga0068869_100031071 | 3300005334 | Bacteria | 3756 |
| 56 | Ga0068869_100058283 | 3300005334 | Bacteria | 2823 |
| 57 | Ga0068869_100076905 | 3300005334 | Bacteria | 2482 |
| 58 | Ga0068869_100097426 | 3300005334 | Bacteria | 2221 |
| 59 | Ga0068869_100102193 | 3300005334 | Bacteria | 2169 |
| 60 | Ga0068869_100119200 | 3300005334 | Bacteria | 2016 |
| 61 | Ga0068869_100571015 | 3300005334 | Unclassified | 952 |
| 62 | Ga0068869_100671682 | 3300005334 | Bacteria | 881 |
| 63 | Ga0070666_10000833 | 3300005335 | Bacteria | 18712 |
| 64 | Ga0070666_10015420 | 3300005335 | Bacteria | 4874 |
| 65 | Ga0070666_10020501 | 3300005335 | Bacteria | 4273 |
| 66 | Ga0070666_10206403 | 3300005335 | Bacteria | 1383 |
| 67 | Ga0070666_10311104 | 3300005335 | Bacteria | 1123 |
| 68 | Ga0070666_10648648 | 3300005335 | Bacteria | 772 |
| 69 | Ga0070680_100103219 | 3300005336 | Bacteria | 2369 |
| 70 | Ga0070682_100025159 | 3300005337 | Bacteria | 3551 |
| 71 | Ga0070682_100435585 | 3300005337 | Bacteria | 1000 |
| 72 | Ga0068868_100000091 | 3300005338 | Bacteria | 55405 |
| 73 | Ga0068868_100003227 | 3300005338 | Bacteria | 11342 |
| 74 | Ga0068868_100005969 | 3300005338 | Bacteria | 8591 |
| 75 | Ga0068868_100017172 | 3300005338 | Bacteria | 5385 |
| 76 | Ga0068868_100017820 | 3300005338 | Bacteria | 5296 |
| 77 | Ga0068868_100050580 | 3300005338 | Bacteria | 3264 |
| 78 | Ga0068868_100437582 | 3300005338 | Bacteria | 1135 |
| 79 | Ga0068868_101133717 | 3300005338 | Bacteria | 721 |
| 80 | Ga0070660_100007804 | 3300005339 | Bacteria | 7464 |
| 81 | Ga0070689_100075317 | 3300005340 | Bacteria | 2642 |
| 82 | Ga0070689_100097914 | 3300005340 | Bacteria | 2320 |
| 83 | Ga0070689_100099393 | 3300005340 | Bacteria | 2302 |
| 84 | Ga0070689_100100163 | 3300005340 | Bacteria | 2292 |
| 85 | Ga0070689_100126083 | 3300005340 | Bacteria | 2049 |
| 86 | Ga0070689_100470179 | 3300005340 | Bacteria | 1073 |
| 87 | Ga0070689_100707738 | 3300005340 | Unclassified | 880 |
| 88 | Ga0070687_100049753 | 3300005343 | Bacteria | 2161 |
| 89 | Ga0070687_100065980 | 3300005343 | Bacteria | 1927 |
| 90 | Ga0070687_100151924 | 3300005343 | Bacteria | 1360 |
| 91 | Ga0070661_100000998 | 3300005344 | Bacteria | 20086 |
| 92 | Ga0070661_100055301 | 3300005344 | Bacteria | 2906 |
| 93 | Ga0070668_100000043 | 3300005347 | Bacteria | 78564 |
| 94 | Ga0070668_100014986 | 3300005347 | Bacteria | 5791 |
| 95 | Ga0070668_100238069 | 3300005347 | Bacteria | 1507 |
| 96 | Ga0070668_100326349 | 3300005347 | Bacteria | 1293 |
| 97 | Ga0070668_100329169 | 3300005347 | Unclassified | 1288 |
| 98 | Ga0070668_100807142 | 3300005347 | Bacteria | 834 |
| 99 | Ga0070669_100010916 | 3300005353 | Bacteria | 6449 |
| 100 | Ga0070669_100011863 | 3300005353 | Bacteria | 6182 |
| 101 | Ga0070669_100055419 | 3300005353 | Bacteria | 2905 |
| 102 | Ga0070669_100100993 | 3300005353 | Unclassified | 2176 |
| 103 | Ga0070669_100197168 | 3300005353 | Bacteria | 1583 |
| 104 | Ga0070669_100333602 | 3300005353 | Bacteria | 1227 |
| 105 | Ga0070669_100529024 | 3300005353 | Bacteria | 981 |
| 106 | Ga0070675_100016806 | 3300005354 | Bacteria | 5810 |
| 107 | Ga0070675_100040377 | 3300005354 | Bacteria | 3809 |
| 108 | Ga0070675_100046961 | 3300005354 | Bacteria | 3537 |
| 109 | Ga0070675_100077696 | 3300005354 | Bacteria | 2763 |
| 110 | Ga0070675_100140247 | 3300005354 | Bacteria | 2066 |
| 111 | Ga0070675_100155730 | 3300005354 | Bacteria | 1962 |
| 112 | Ga0070675_100172433 | 3300005354 | Bacteria | 1866 |
| 113 | Ga0070675_100183471 | 3300005354 | Unclassified | 1810 |
| 114 | Ga0070675_100379574 | 3300005354 | Bacteria | 1258 |
| 115 | Ga0070675_100471186 | 3300005354 | Unclassified | 1128 |
| 116 | Ga0070675_100727582 | 3300005354 | Bacteria | 905 |
| 117 | Ga0070671_100013905 | 3300005355 | Bacteria | 6493 |
| 118 | Ga0070671_100121885 | 3300005355 | Bacteria | 2194 |
| 119 | Ga0070671_100175449 | 3300005355 | Bacteria | 1813 |
| 120 | Ga0070671_100182088 | 3300005355 | Bacteria | 1779 |
| 121 | Ga0070671_100258283 | 3300005355 | Bacteria | 1480 |
| 122 | Ga0070671_100270702 | 3300005355 | Bacteria | 1444 |
| 123 | Ga0070671_100298122 | 3300005355 | Bacteria | 1372 |
| 124 | Ga0070671_100344012 | 3300005355 | Bacteria | 1272 |
| 125 | Ga0070671_100432733 | 3300005355 | Bacteria | 1127 |
| 126 | Ga0070674_100053820 | 3300005356 | Bacteria | 2781 |
| 127 | Ga0070674_100056755 | 3300005356 | Bacteria | 2716 |
| 128 | Ga0070674_100073920 | 3300005356 | Bacteria | 2417 |
| 129 | Ga0070674_100182923 | 3300005356 | Bacteria | 1607 |
| 130 | Ga0070674_100269074 | 3300005356 | Bacteria | 1346 |
| 131 | Ga0070674_100616089 | 3300005356 | Bacteria | 919 |
| 132 | Ga0070673_100012785 | 3300005364 | Bacteria | 5775 |
| 133 | Ga0070673_100013846 | 3300005364 | Bacteria | 5597 |
| 134 | Ga0070673_100019331 | 3300005364 | Bacteria | 4888 |
| 135 | Ga0070673_100048748 | 3300005364 | Bacteria | 3304 |
| 136 | Ga0070673_100069027 | 3300005364 | Bacteria | 2832 |
| 137 | Ga0070673_100071700 | 3300005364 | Bacteria | 2784 |
| 138 | Ga0070673_100171374 | 3300005364 | Bacteria | 1853 |
| 139 | Ga0070673_100614801 | 3300005364 | Bacteria | 992 |
| 140 | Ga0070673_101126804 | 3300005364 | Bacteria | 733 |
| 141 | Ga0070688_100001211 | 3300005365 | Bacteria | 12840 |
| 142 | Ga0070688_100054375 | 3300005365 | Unclassified | 2507 |
| 143 | Ga0070688_100067445 | 3300005365 | Bacteria | 2279 |
| 144 | Ga0070688_100079251 | 3300005365 | Bacteria | 2121 |
| 145 | Ga0070688_100163879 | 3300005365 | Bacteria | 1529 |
| 146 | Ga0070688_100274493 | 3300005365 | Bacteria | 1209 |
| 147 | Ga0070659_100012950 | 3300005366 | Bacteria | 6201 |
| 148 | Ga0070659_100048059 | 3300005366 | Bacteria | 3350 |
| 149 | Ga0070659_100526146 | 3300005366 | Bacteria | 1010 |
| 150 | Ga0070659_100793684 | 3300005366 | Unclassified | 823 |
| 151 | Ga0070667_100000254 | 3300005367 | Bacteria | 60664 |
| 152 | Ga0070667_100022994 | 3300005367 | Bacteria | 5169 |
| 153 | Ga0070667_100049982 | 3300005367 | Bacteria | 3523 |
| 154 | Ga0070667_100078410 | 3300005367 | Bacteria | 2822 |
| 155 | Ga0070667_100170549 | 3300005367 | Unclassified | 1921 |
| 156 | Ga0070667_100244950 | 3300005367 | Bacteria | 1601 |
| 157 | Ga0070667_100431265 | 3300005367 | Bacteria | 1203 |
| 158 | Ga0070667_101120913 | 3300005367 | Viruses | 736 |
| 159 | Ga0070701_10060827 | 3300005438 | Bacteria | 1990 |
| 160 | Ga0070701_10066706 | 3300005438 | Bacteria | 1913 |
| 161 | Ga0070705_100191810 | 3300005440 | Bacteria | 1393 |
| 162 | Ga0070700_100054188 | 3300005441 | Bacteria | 2505 |
| 163 | Ga0070700_100157347 | 3300005441 | Unclassified | 1560 |
| 164 | Ga0070678_100004350 | 3300005456 | Bacteria | 8014 |
| 165 | Ga0070678_100057910 | 3300005456 | Unclassified | 2841 |
| 166 | Ga0070678_100373337 | 3300005456 | Bacteria | 1232 |
| 167 | Ga0070678_100428371 | 3300005456 | Unclassified | 1155 |
| 168 | Ga0070662_100010688 | 3300005457 | Bacteria | 6041 |
| 169 | Ga0070662_100014815 | 3300005457 | Bacteria | 5213 |
| 170 | Ga0070662_100020923 | 3300005457 | Bacteria | 4462 |
| 171 | Ga0070662_100027652 | 3300005457 | Bacteria | 3940 |
| 172 | Ga0070662_100060059 | 3300005457 | Bacteria | 2771 |
| 173 | Ga0070662_100087226 | 3300005457 | Bacteria | 2336 |
| 174 | Ga0070662_100197069 | 3300005457 | Unclassified | 1596 |
| 175 | Ga0070662_100504918 | 3300005457 | Unclassified | 1009 |
| 176 | Ga0070662_100651932 | 3300005457 | Bacteria | 888 |
| 177 | Ga0070681_10002668 | 3300005458 | Bacteria | 16383 |
| 178 | Ga0068867_100003884 | 3300005459 | Bacteria | 10517 |
| 179 | Ga0068867_100034619 | 3300005459 | Bacteria | 3661 |
| 180 | Ga0068867_100109335 | 3300005459 | Bacteria | 2122 |
| 181 | Ga0068867_100233541 | 3300005459 | Bacteria | 1488 |
| 182 | Ga0068867_100319758 | 3300005459 | Bacteria | 1285 |
| 183 | Ga0068867_100547920 | 3300005459 | Bacteria | 1001 |
| 184 | Ga0070685_10161660 | 3300005466 | Bacteria | 1428 |
| 185 | Ga0070685_10270157 | 3300005466 | Bacteria | 1134 |
| 186 | Ga0070685_10496073 | 3300005466 | Unclassified | 863 |
| 187 | Ga0070706_100430297 | 3300005467 | Bacteria | 1228 |
| 188 | Ga0070706_100465549 | 3300005467 | Unclassified | 1176 |
| 189 | Ga0070698_100001232 | 3300005471 | Bacteria | 28474 |
| 190 | Ga0070698_100001401 | 3300005471 | Bacteria | 26708 |
| 191 | Ga0070698_100024342 | 3300005471 | Bacteria | 6318 |
| 192 | Ga0070698_100175844 | 3300005471 | Bacteria | 2080 |
| 193 | Ga0070699_100073116 | 3300005518 | Bacteria | 2983 |
| 194 | Ga0070679_100064164 | 3300005530 | Bacteria | 3660 |
| 195 | Ga0070679_101000488 | 3300005530 | Bacteria | 780 |
| 196 | Ga0070684_100000143 | 3300005535 | Bacteria | 47674 |
| 197 | Ga0070684_100004638 | 3300005535 | Bacteria | 10486 |
| 198 | Ga0070684_100008847 | 3300005535 | Bacteria | 7896 |
| 199 | Ga0070684_100015352 | 3300005535 | Bacteria | 6235 |
| 200 | Ga0070684_100060599 | 3300005535 | Bacteria | 3311 |
| 201 | Ga0070684_100144420 | 3300005535 | Bacteria | 2153 |
| 202 | Ga0070684_100151285 | 3300005535 | Bacteria | 2102 |
| 203 | Ga0070684_101001501 | 3300005535 | Bacteria | 784 |
| 204 | Ga0068853_100007245 | 3300005539 | Bacteria | 8885 |
| 205 | Ga0068853_100015397 | 3300005539 | Bacteria | 6283 |
| 206 | Ga0068853_100133050 | 3300005539 | Bacteria | 2227 |
| 207 | Ga0068853_100202634 | 3300005539 | Bacteria | 1806 |
| 208 | Ga0068853_100259546 | 3300005539 | Bacteria | 1597 |
| 209 | Ga0068853_100360678 | 3300005539 | Unclassified | 1354 |
| 210 | Ga0068853_100463979 | 3300005539 | Bacteria | 1192 |
| 211 | Ga0068853_100600863 | 3300005539 | Bacteria | 1045 |
| 212 | Ga0068853_100745638 | 3300005539 | Unclassified | 936 |
| 213 | Ga0068853_101658230 | 3300005539 | Bacteria | 620 |
| 214 | Ga0070672_100000160 | 3300005543 | Bacteria | 37362 |
| 215 | Ga0070672_100101544 | 3300005543 | Bacteria | 2333 |
| 216 | Ga0070672_100110785 | 3300005543 | Bacteria | 2237 |
| 217 | Ga0070672_100163589 | 3300005543 | Unclassified | 1848 |
| 218 | Ga0070672_100267583 | 3300005543 | Bacteria | 1442 |
| 219 | Ga0070672_100351100 | 3300005543 | Bacteria | 1257 |
| 220 | Ga0070672_100443964 | 3300005543 | Bacteria | 1117 |
| 221 | Ga0070686_100027961 | 3300005544 | Bacteria | 3416 |
| 222 | Ga0070686_100475410 | 3300005544 | Bacteria | 965 |
| 223 | Ga0070695_100163393 | 3300005545 | Bacteria | 1565 |
| 224 | Ga0070696_100505393 | 3300005546 | Bacteria | 962 |
| 225 | Ga0070693_100061006 | 3300005547 | Bacteria | 2191 |
| 226 | Ga0070693_100408740 | 3300005547 | Bacteria | 943 |
| 227 | Ga0070693_100420411 | 3300005547 | Bacteria | 931 |
| 228 | Ga0070693_100451979 | 3300005547 | Unclassified | 902 |
| 229 | Ga0070665_100000350 | 3300005548 | Bacteria | 69455 |
| 230 | Ga0070665_100042513 | 3300005548 | Bacteria | 4568 |
| 231 | Ga0070665_100170322 | 3300005548 | Bacteria | 2179 |
| 232 | Ga0070665_100311136 | 3300005548 | Bacteria | 1579 |
| 233 | Ga0070665_100337427 | 3300005548 | Unclassified | 1512 |
| 234 | Ga0068855_100000089 | 3300005563 | Bacteria | 110845 |
| 235 | Ga0068855_100025914 | 3300005563 | Bacteria | 7014 |
| 236 | Ga0068855_100074344 | 3300005563 | Bacteria | 3947 |
| 237 | Ga0068855_100081339 | 3300005563 | Bacteria | 3755 |
| 238 | Ga0068855_101300394 | 3300005563 | Bacteria | 753 |
| 239 | Ga0070664_100008696 | 3300005564 | Bacteria | 8219 |
| 240 | Ga0070664_100016033 | 3300005564 | Bacteria | 6140 |
| 241 | Ga0070664_100040643 | 3300005564 | Bacteria | 3921 |
| 242 | Ga0070664_100052751 | 3300005564 | Bacteria | 3445 |
| 243 | Ga0070664_100058800 | 3300005564 | Bacteria | 3270 |
| 244 | Ga0070664_100177020 | 3300005564 | Bacteria | 1894 |
| 245 | Ga0070664_100247518 | 3300005564 | Bacteria | 1601 |
| 246 | Ga0070664_100439506 | 3300005564 | Bacteria | 1196 |
| 247 | Ga0068857_100010772 | 3300005577 | Bacteria | 7959 |
| 248 | Ga0068857_100052934 | 3300005577 | Bacteria | 3601 |
| 249 | Ga0068857_100104411 | 3300005577 | Bacteria | 2544 |
| 250 | Ga0068857_100161546 | 3300005577 | Bacteria | 2033 |
| 251 | Ga0068857_100258266 | 3300005577 | Bacteria | 1598 |
| 252 | Ga0068857_100328796 | 3300005577 | Bacteria | 1412 |
| 253 | Ga0068857_100387820 | 3300005577 | Bacteria | 1298 |
| 254 | Ga0068857_100430778 | 3300005577 | Bacteria | 1231 |
| 255 | Ga0068857_100770525 | 3300005577 | Unclassified | 917 |
| 256 | Ga0068857_100894496 | 3300005577 | Bacteria | 851 |
| 257 | Ga0068857_101030982 | 3300005577 | Unclassified | 793 |
| 258 | Ga0068854_100205682 | 3300005578 | Bacteria | 1550 |
| 259 | Ga0068854_100274520 | 3300005578 | Bacteria | 1355 |
| 260 | Ga0068854_100387386 | 3300005578 | Bacteria | 1153 |
| 261 | Ga0068856_100164527 | 3300005614 | Bacteria | 2229 |
| 262 | Ga0068856_100750359 | 3300005614 | Bacteria | 996 |
| 263 | Ga0070702_100087919 | 3300005615 | Bacteria | 1878 |
| 264 | Ga0068852_100015848 | 3300005616 | Bacteria | 5861 |
| 265 | Ga0068852_100110788 | 3300005616 | Bacteria | 2495 |
| 266 | Ga0068852_100124989 | 3300005616 | Bacteria | 2360 |
| 267 | Ga0068852_100134972 | 3300005616 | Bacteria | 2278 |
| 268 | Ga0068852_100164795 | 3300005616 | Bacteria | 2073 |
| 269 | Ga0068852_100358351 | 3300005616 | Bacteria | 1426 |
| 270 | Ga0068852_100811437 | 3300005616 | Bacteria | 950 |
| 271 | Ga0068852_101424504 | 3300005616 | Bacteria | 715 |
| 272 | Ga0068859_100000100 | 3300005617 | Bacteria | 79844 |
| 273 | Ga0068859_100006400 | 3300005617 | Bacteria | 11949 |
| 274 | Ga0068859_100045503 | 3300005617 | Bacteria | 4409 |
| 275 | Ga0068859_100045943 | 3300005617 | Bacteria | 4387 |
| 276 | Ga0068859_100055078 | 3300005617 | Bacteria | 4002 |
| 277 | Ga0068859_100071722 | 3300005617 | Bacteria | 3499 |
| 278 | Ga0068859_100090854 | 3300005617 | Bacteria | 3104 |
| 279 | Ga0068859_100097155 | 3300005617 | Bacteria | 2998 |
| 280 | Ga0068859_100099520 | 3300005617 | Bacteria | 2963 |
| 281 | Ga0068859_100177818 | 3300005617 | Bacteria | 2210 |
| 282 | Ga0068859_100189897 | 3300005617 | Bacteria | 2139 |
| 283 | Ga0068859_100410358 | 3300005617 | Unclassified | 1450 |
| 284 | Ga0068859_100770622 | 3300005617 | Unclassified | 1050 |
| 285 | Ga0068859_100971747 | 3300005617 | Bacteria | 932 |
| 286 | Ga0068859_101242883 | 3300005617 | Bacteria | 820 |
| 287 | Ga0068859_101418791 | 3300005617 | Bacteria | 766 |
| 288 | Ga0068864_100004900 | 3300005618 | Bacteria | 10966 |
| 289 | Ga0068864_100047787 | 3300005618 | Bacteria | 3677 |
| 290 | Ga0068864_100052426 | 3300005618 | Unclassified | 3516 |
| 291 | Ga0068864_100066952 | 3300005618 | Bacteria | 3118 |
| 292 | Ga0068864_100096472 | 3300005618 | Bacteria | 2617 |
| 293 | Ga0068864_100149758 | 3300005618 | Bacteria | 2113 |
| 294 | Ga0068864_100194596 | 3300005618 | Bacteria | 1860 |
| 295 | Ga0068864_100236660 | 3300005618 | Unclassified | 1690 |
| 296 | Ga0068864_100275992 | 3300005618 | Bacteria | 1567 |
| 297 | Ga0068864_100695094 | 3300005618 | Bacteria | 993 |
| 298 | Ga0068864_100762170 | 3300005618 | Bacteria | 949 |
| 299 | Ga0068864_101208464 | 3300005618 | Unclassified | 755 |
| 300 | Ga0068866_10005085 | 3300005718 | Bacteria | 5418 |
| 301 | Ga0068866_10028304 | 3300005718 | Bacteria | 2669 |
| 302 | Ga0068866_10287892 | 3300005718 | Bacteria | 1021 |
| 303 | Ga0068866_10594611 | 3300005718 | Bacteria | 746 |
| 304 | Ga0068861_100002321 | 3300005719 | Bacteria | 12362 |
| 305 | Ga0068861_100004878 | 3300005719 | Bacteria | 9029 |
| 306 | Ga0068861_100018316 | 3300005719 | Bacteria | 4988 |
| 307 | Ga0068861_100034867 | 3300005719 | Bacteria | 3724 |
| 308 | Ga0068861_100065845 | 3300005719 | Bacteria | 2792 |
| 309 | Ga0068861_100287472 | 3300005719 | Bacteria | 1418 |
| 310 | Ga0068861_100289715 | 3300005719 | Bacteria | 1413 |
| 311 | Ga0068861_100613395 | 3300005719 | Bacteria | 1000 |
| 312 | Ga0068861_100613470 | 3300005719 | Bacteria | 1000 |
| 313 | Ga0068851_10002184 | 3300005834 | Bacteria | 8604 |
| 314 | Ga0068851_10088663 | 3300005834 | Bacteria | 1626 |
| 315 | Ga0068851_10095771 | 3300005834 | Unclassified | 1569 |
| 316 | Ga0068851_10505455 | 3300005834 | Bacteria | 725 |
| 317 | Ga0068851_10551966 | 3300005834 | Bacteria | 696 |
| 318 | Ga0068870_10021567 | 3300005840 | Bacteria | 3153 |
| 319 | Ga0068870_10028936 | 3300005840 | Bacteria | 2787 |
| 320 | Ga0068870_10244433 | 3300005840 | Bacteria | 1109 |
| 321 | Ga0068863_100003656 | 3300005841 | Bacteria | 15182 |
| 322 | Ga0068863_100005412 | 3300005841 | Bacteria | 12587 |
| 323 | Ga0068863_100022973 | 3300005841 | Bacteria | 5961 |
| 324 | Ga0068863_100048136 | 3300005841 | Bacteria | 4043 |
| 325 | Ga0068863_100059429 | 3300005841 | Bacteria | 3617 |
| 326 | Ga0068863_100483940 | 3300005841 | Unclassified | 1217 |
| 327 | Ga0068863_100518876 | 3300005841 | Bacteria | 1175 |
| 328 | Ga0068863_100544527 | 3300005841 | Unclassified | 1145 |
| 329 | Ga0068863_100700176 | 3300005841 | Bacteria | 1007 |
| 330 | Ga0068858_100000199 | 3300005842 | Bacteria | 64607 |
| 331 | Ga0068858_100013150 | 3300005842 | Bacteria | 7804 |
| 332 | Ga0068858_100109962 | 3300005842 | Bacteria | 2573 |
| 333 | Ga0068858_100145754 | 3300005842 | Unclassified | 2224 |
| 334 | Ga0068858_101110621 | 3300005842 | Bacteria | 776 |
| 335 | Ga0068860_100003203 | 3300005843 | Bacteria | 16892 |
| 336 | Ga0068860_100006347 | 3300005843 | Bacteria | 11865 |
| 337 | Ga0068860_100007843 | 3300005843 | Bacteria | 10655 |
| 338 | Ga0068860_100076081 | 3300005843 | Bacteria | 3192 |
| 339 | Ga0068860_100134077 | 3300005843 | Bacteria | 2378 |
| 340 | Ga0068860_100545787 | 3300005843 | Bacteria | 1161 |
| 341 | Ga0068860_100596383 | 3300005843 | Bacteria | 1110 |
| 342 | Ga0068862_100016502 | 3300005844 | Bacteria | 6147 |
| 343 | Ga0068862_100057039 | 3300005844 | Bacteria | 3348 |
| 344 | Ga0068862_100059367 | 3300005844 | Unclassified | 3285 |
| 345 | Ga0068862_100084888 | 3300005844 | Bacteria | 2751 |
| 346 | Ga0068862_100247155 | 3300005844 | Bacteria | 1624 |
| 347 | Ga0081455_10455209 | 3300005937 | Bacteria | 873 |
| 348 | Ga0070715_10066344 | 3300006163 | Unclassified | 1600 |
| 349 | Ga0075366_10197900 | 3300006195 | Unclassified | 1222 |
| 350 | Ga0075366_10267412 | 3300006195 | Unclassified | 1044 |
| 351 | Ga0075366_10330696 | 3300006195 | Bacteria | 934 |
| 352 | Ga0097621_100009982 | 3300006237 | Bacteria | 6920 |
| 353 | Ga0097621_100034379 | 3300006237 | Bacteria | 4044 |
| 354 | Ga0097621_100110422 | 3300006237 | Bacteria | 2323 |
| 355 | Ga0097621_100151904 | 3300006237 | Bacteria | 1986 |
| 356 | Ga0097621_100190968 | 3300006237 | Bacteria | 1774 |
| 357 | Ga0097621_100358964 | 3300006237 | Bacteria | 1298 |
| 358 | Ga0097621_100439600 | 3300006237 | Bacteria | 1173 |
| 359 | Ga0097621_100450992 | 3300006237 | Unclassified | 1159 |
| 360 | Ga0097621_100758558 | 3300006237 | Bacteria | 897 |
| 361 | Ga0068871_100055412 | 3300006358 | Bacteria | 3218 |
| 362 | Ga0068871_100095193 | 3300006358 | Bacteria | 2486 |
| 363 | Ga0068871_100146078 | 3300006358 | Bacteria | 2014 |
| 364 | Ga0068871_100149747 | 3300006358 | Bacteria | 1989 |
| 365 | Ga0068871_100156633 | 3300006358 | Unclassified | 1945 |
| 366 | Ga0068871_100282209 | 3300006358 | Bacteria | 1453 |
| 367 | Ga0068871_100301984 | 3300006358 | Bacteria | 1405 |
| 368 | Ga0068871_100350777 | 3300006358 | Bacteria | 1305 |
| 369 | Ga0068871_100525682 | 3300006358 | Bacteria | 1069 |
| 370 | Ga0068871_100589720 | 3300006358 | Bacteria | 1010 |
| 371 | Ga0068871_101414736 | 3300006358 | Bacteria | 656 |
| 372 | Ga0075428_100001125 | 3300006844 | Bacteria | 28571 |
| 373 | Ga0075428_100029484 | 3300006844 | Bacteria | 6071 |
| 374 | Ga0075428_100159109 | 3300006844 | Unclassified | 2452 |
| 375 | Ga0075430_100037041 | 3300006846 | Bacteria | 4135 |
| 376 | Ga0075431_100018153 | 3300006847 | Bacteria | 7157 |
| 377 | Ga0075434_101119836 | 3300006871 | Bacteria | 800 |
| 378 | Ga0075429_100000105 | 3300006880 | Bacteria | 47284 |
| 379 | Ga0075429_100033094 | 3300006880 | Bacteria | 4492 |
| 380 | Ga0075429_100446591 | 3300006880 | Bacteria | 1133 |
| 381 | Ga0068865_100003229 | 3300006881 | Bacteria | 9768 |
| 382 | Ga0068865_100019488 | 3300006881 | Unclassified | 4391 |
| 383 | Ga0068865_100190045 | 3300006881 | Bacteria | 1587 |
| 384 | Ga0068865_100575693 | 3300006881 | Unclassified | 949 |
| 385 | Ga0068865_100605535 | 3300006881 | Bacteria | 926 |
| 386 | Ga0097620_100000100 | 3300006931 | Bacteria | 79844 |
| 387 | Ga0097620_100006400 | 3300006931 | Bacteria | 11949 |
| 388 | Ga0097620_100045504 | 3300006931 | Bacteria | 4409 |
| 389 | Ga0097620_100045944 | 3300006931 | Bacteria | 4387 |
| 390 | Ga0097620_100055076 | 3300006931 | Bacteria | 4002 |
| 391 | Ga0097620_100071720 | 3300006931 | Bacteria | 3499 |
| 392 | Ga0097620_100090855 | 3300006931 | Bacteria | 3104 |
| 393 | Ga0097620_100097165 | 3300006931 | Bacteria | 2998 |
| 394 | Ga0097620_100099522 | 3300006931 | Bacteria | 2963 |
| 395 | Ga0097620_100177816 | 3300006931 | Bacteria | 2210 |
| 396 | Ga0097620_100189892 | 3300006931 | Bacteria | 2139 |
| 397 | Ga0097620_100410361 | 3300006931 | Unclassified | 1450 |
| 398 | Ga0097620_100770591 | 3300006931 | Unclassified | 1050 |
| 399 | Ga0097620_100971857 | 3300006931 | Bacteria | 932 |
| 400 | Ga0097620_101242842 | 3300006931 | Bacteria | 820 |
| 401 | Ga0097620_101418989 | 3300006931 | Bacteria | 766 |
| 402 | Ga0075435_101263635 | 3300007076 | Bacteria | 646 |
| 403 | Ga0105251_10071169 | 3300009011 | Bacteria | 1618 |
| 404 | Ga0105240_10000074 | 3300009093 | Bacteria | 199611 |
| 405 | Ga0105240_10010569 | 3300009093 | Bacteria | 12966 |
| 406 | Ga0105240_10451742 | 3300009093 | Bacteria | 1438 |
| 407 | Ga0105240_10575427 | 3300009093 | Unclassified | 1243 |
| 408 | Ga0111539_10124592 | 3300009094 | Bacteria | 3020 |
| 409 | Ga0111539_10725210 | 3300009094 | Bacteria | 1157 |
| 410 | Ga0111539_11053653 | 3300009094 | Bacteria | 945 |
| 411 | Ga0105245_10021467 | 3300009098 | Bacteria | 5665 |
| 412 | Ga0105245_10141816 | 3300009098 | Bacteria | 2264 |
| 413 | Ga0105245_10490164 | 3300009098 | Bacteria | 1243 |
| 414 | Ga0105245_11496987 | 3300009098 | Bacteria | 726 |
| 415 | Ga0105247_10001666 | 3300009101 | Bacteria | 15681 |
| 416 | Ga0105247_10035042 | 3300009101 | Bacteria | 3058 |
| 417 | Ga0105247_10036944 | 3300009101 | Unclassified | 2979 |
| 418 | Ga0105247_10091146 | 3300009101 | Bacteria | 1935 |
| 419 | Ga0105247_10148451 | 3300009101 | Bacteria | 1543 |
| 420 | Ga0105247_10634304 | 3300009101 | Unclassified | 796 |
| 421 | Ga0114129_10017306 | 3300009147 | Bacteria | 10263 |
| 422 | Ga0114129_10121641 | 3300009147 | Bacteria | 3592 |
| 423 | Ga0114129_10150575 | 3300009147 | Bacteria | 3184 |
| 424 | Ga0114129_12032728 | 3300009147 | Bacteria | 694 |
| 425 | Ga0105243_10063213 | 3300009148 | Bacteria | 2966 |
| 426 | Ga0105243_10191730 | 3300009148 | Bacteria | 1786 |
| 427 | Ga0105243_10387379 | 3300009148 | Unclassified | 1295 |
| 428 | Ga0105243_10492186 | 3300009148 | Bacteria | 1160 |
| 429 | Ga0105243_10521583 | 3300009148 | Bacteria | 1130 |
| 430 | Ga0105241_10000286 | 3300009174 | Bacteria | 37584 |
| 431 | Ga0105241_10000674 | 3300009174 | Bacteria | 25718 |
| 432 | Ga0105241_10050739 | 3300009174 | Bacteria | 3162 |
| 433 | Ga0105241_10078204 | 3300009174 | Bacteria | 2584 |
| 434 | Ga0105241_10128490 | 3300009174 | Bacteria | 2049 |
| 435 | Ga0105241_10445574 | 3300009174 | Bacteria | 1144 |
| 436 | Ga0105241_10612534 | 3300009174 | Bacteria | 985 |
| 437 | Ga0105241_10701313 | 3300009174 | Bacteria | 924 |
| 438 | Ga0105242_10007239 | 3300009176 | Bacteria | 8554 |
| 439 | Ga0105242_10057786 | 3300009176 | Bacteria | 3178 |
| 440 | Ga0105242_10121029 | 3300009176 | Bacteria | 2246 |
| 441 | Ga0105242_10249725 | 3300009176 | Unclassified | 1598 |
| 442 | Ga0105242_10551545 | 3300009176 | Unclassified | 1105 |
| 443 | Ga0105242_11457885 | 3300009176 | Bacteria | 714 |
| 444 | Ga0105248_10064189 | 3300009177 | Bacteria | 4122 |
| 445 | Ga0105248_10276264 | 3300009177 | Bacteria | 1891 |
| 446 | Ga0105248_10463890 | 3300009177 | Bacteria | 1428 |
| 447 | Ga0105248_10841729 | 3300009177 | Bacteria | 1035 |
| 448 | Ga0105237_10000528 | 3300009545 | Bacteria | 53756 |
| 449 | Ga0105237_10009229 | 3300009545 | Bacteria | 10584 |
| 450 | Ga0105237_10009236 | 3300009545 | Bacteria | 10577 |
| 451 | Ga0105237_10011435 | 3300009545 | Bacteria | 9389 |
| 452 | Ga0105237_10018995 | 3300009545 | Bacteria | 7103 |
| 453 | Ga0105237_10030026 | 3300009545 | Bacteria | 5522 |
| 454 | Ga0105237_10557879 | 3300009545 | Unclassified | 1152 |
| 455 | Ga0105238_10002521 | 3300009551 | Bacteria | 18308 |
| 456 | Ga0105238_10093340 | 3300009551 | Bacteria | 2998 |
| 457 | Ga0105249_10000420 | 3300009553 | Bacteria | 40445 |
| 458 | Ga0105249_10004650 | 3300009553 | Bacteria | 11851 |
| 459 | Ga0105249_10006252 | 3300009553 | Bacteria | 10343 |
| 460 | Ga0105249_10007262 | 3300009553 | Bacteria | 9664 |
| 461 | Ga0105249_10008839 | 3300009553 | Bacteria | 8796 |
| 462 | Ga0105249_10155341 | 3300009553 | Bacteria | 2206 |
| 463 | Ga0105249_10177873 | 3300009553 | Bacteria | 2068 |
| 464 | Ga0105249_10216869 | 3300009553 | Bacteria | 1881 |
| 465 | Ga0105249_10285716 | 3300009553 | Bacteria | 1649 |
| 466 | Ga0105249_10565320 | 3300009553 | Unclassified | 1189 |
| 467 | Ga0105249_10570393 | 3300009553 | Bacteria | 1184 |
| 468 | Ga0105249_10611980 | 3300009553 | Bacteria | 1145 |
| 469 | Ga0105249_11959575 | 3300009553 | Bacteria | 658 |
| 470 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 471 | Ga0105239_10013397 | 3300010375 | Bacteria | 9110 |
| 472 | Ga0105239_10014114 | 3300010375 | Bacteria | 8867 |
| 473 | Ga0105239_10016535 | 3300010375 | Bacteria | 8156 |
| 474 | Ga0105239_10044989 | 3300010375 | Bacteria | 4838 |
| 475 | Ga0105239_10083913 | 3300010375 | Bacteria | 3509 |
| 476 | Ga0105239_10117472 | 3300010375 | Bacteria | 2952 |
| 477 | Ga0105239_10124064 | 3300010375 | Bacteria | 2870 |
| 478 | Ga0105239_10655543 | 3300010375 | Bacteria | 1199 |
| 479 | Ga0105246_10085274 | 3300011119 | Bacteria | 2262 |
| 480 | Ga0105246_10253054 | 3300011119 | Bacteria | 1399 |
| 481 | Ga0105246_10702653 | 3300011119 | Bacteria | 886 |
| 482 | Ga0105246_10793536 | 3300011119 | Bacteria | 839 |
| 483 | Ga0157373_10015305 | 3300013100 | Bacteria | 5608 |
| 484 | Ga0157373_10024569 | 3300013100 | Bacteria | 4364 |
| 485 | Ga0157373_10040694 | 3300013100 | Bacteria | 3325 |
| 486 | Ga0157373_10135679 | 3300013100 | Bacteria | 1730 |
| 487 | Ga0157373_10274084 | 3300013100 | Bacteria | 1195 |
| 488 | Ga0157371_10009068 | 3300013102 | Bacteria | 7864 |
| 489 | Ga0157371_10056386 | 3300013102 | Bacteria | 2787 |
| 490 | Ga0157371_10166659 | 3300013102 | Bacteria | 1573 |
| 491 | Ga0157371_10538645 | 3300013102 | Bacteria | 865 |
| 492 | Ga0157371_10634494 | 3300013102 | Unclassified | 796 |
| 493 | Ga0157370_10031158 | 3300013104 | Bacteria | 5219 |
| 494 | Ga0157370_10031443 | 3300013104 | Bacteria | 5191 |
| 495 | Ga0157370_10175301 | 3300013104 | Bacteria | 1993 |
| 496 | Ga0157370_10221700 | 3300013104 | Bacteria | 1751 |
| 497 | Ga0157369_10010499 | 3300013105 | Bacteria | 10540 |
| 498 | Ga0157369_10020813 | 3300013105 | Bacteria | 7331 |
| 499 | Ga0157369_10217587 | 3300013105 | Bacteria | 2000 |
| 500 | Ga0157369_10406897 | 3300013105 | Bacteria | 1411 |
| 501 | Ga0157369_10861412 | 3300013105 | Bacteria | 930 |
| 502 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 503 | Ga0157374_10000084 | 3300013296 | Bacteria | 94138 |
| 504 | Ga0157374_10010076 | 3300013296 | Bacteria | 8116 |
| 505 | Ga0157374_10139672 | 3300013296 | Bacteria | 2351 |
| 506 | Ga0157374_10237222 | 3300013296 | Bacteria | 1793 |
| 507 | Ga0157374_10290382 | 3300013296 | Bacteria | 1616 |
| 508 | Ga0157374_10314782 | 3300013296 | Bacteria | 1550 |
| 509 | Ga0157374_10826950 | 3300013296 | Bacteria | 942 |
| 510 | Ga0157374_10998093 | 3300013296 | Bacteria | 856 |
| 511 | Ga0157378_10001872 | 3300013297 | Bacteria | 18898 |
| 512 | Ga0157378_10005024 | 3300013297 | Bacteria | 11613 |
| 513 | Ga0157378_10016814 | 3300013297 | Bacteria | 6411 |
| 514 | Ga0157378_10061629 | 3300013297 | Bacteria | 3349 |
| 515 | Ga0157378_10068743 | 3300013297 | Bacteria | 3177 |
| 516 | Ga0157378_10091452 | 3300013297 | Bacteria | 2766 |
| 517 | Ga0157378_10093436 | 3300013297 | Bacteria | 2738 |
| 518 | Ga0157378_10172003 | 3300013297 | Bacteria | 2032 |
| 519 | Ga0157378_10300108 | 3300013297 | Bacteria | 1554 |
| 520 | Ga0157378_10334558 | 3300013297 | Bacteria | 1475 |
| 521 | Ga0157378_11191584 | 3300013297 | Bacteria | 801 |
| 522 | Ga0157378_11420805 | 3300013297 | Bacteria | 737 |
| 523 | Ga0163162_10000113 | 3300013306 | Bacteria | 71491 |
| 524 | Ga0163162_10004460 | 3300013306 | Bacteria | 13486 |
| 525 | Ga0163162_10005078 | 3300013306 | Bacteria | 12676 |
| 526 | Ga0163162_10024349 | 3300013306 | Bacteria | 5972 |
| 527 | Ga0163162_10147273 | 3300013306 | Bacteria | 2471 |
| 528 | Ga0163162_10310025 | 3300013306 | Unclassified | 1710 |
| 529 | Ga0163162_10332847 | 3300013306 | Bacteria | 1651 |
| 530 | Ga0163162_10594102 | 3300013306 | Unclassified | 1233 |
| 531 | Ga0163162_10773065 | 3300013306 | Unclassified | 1079 |
| 532 | Ga0163162_10798082 | 3300013306 | Bacteria | 1061 |
| 533 | Ga0157372_10001128 | 3300013307 | Bacteria | 28999 |
| 534 | Ga0157372_10017684 | 3300013307 | Bacteria | 7651 |
| 535 | Ga0157372_10018926 | 3300013307 | Bacteria | 7410 |
| 536 | Ga0157372_10028493 | 3300013307 | Bacteria | 6095 |
| 537 | Ga0157372_10033034 | 3300013307 | Bacteria | 5680 |
| 538 | Ga0157372_10034481 | 3300013307 | Bacteria | 5564 |
| 539 | Ga0157372_10049030 | 3300013307 | Bacteria | 4695 |
| 540 | Ga0157372_10078049 | 3300013307 | Bacteria | 3741 |
| 541 | Ga0157372_10125220 | 3300013307 | Bacteria | 2954 |
| 542 | Ga0157372_10170040 | 3300013307 | Bacteria | 2521 |
| 543 | Ga0157372_10189115 | 3300013307 | Bacteria | 2384 |
| 544 | Ga0157372_10315694 | 3300013307 | Bacteria | 1819 |
| 545 | Ga0157372_10330167 | 3300013307 | Bacteria | 1776 |
| 546 | Ga0157372_10432757 | 3300013307 | Bacteria | 1533 |
| 547 | Ga0157372_10636806 | 3300013307 | Unclassified | 1242 |
| 548 | Ga0157372_10698212 | 3300013307 | Bacteria | 1181 |
| 549 | Ga0157372_10864749 | 3300013307 | Bacteria | 1049 |
| 550 | Ga0157372_10939323 | 3300013307 | Bacteria | 1003 |
| 551 | Ga0157372_10941927 | 3300013307 | Bacteria | 1001 |
| 552 | Ga0157372_11301137 | 3300013307 | Unclassified | 839 |
| 553 | Ga0157372_12109109 | 3300013307 | Bacteria | 648 |
| 554 | Ga0157375_10000565 | 3300013308 | Bacteria | 33320 |
| 555 | Ga0157375_10008080 | 3300013308 | Bacteria | 9203 |
| 556 | Ga0157375_10009333 | 3300013308 | Bacteria | 8613 |
| 557 | Ga0157375_10039328 | 3300013308 | Bacteria | 4552 |
| 558 | Ga0157375_10360794 | 3300013308 | Bacteria | 1619 |
| 559 | Ga0157375_10710708 | 3300013308 | Unclassified | 1158 |
| 560 | Ga0157375_11279325 | 3300013308 | Bacteria | 862 |
| 561 | Ga0157375_11848973 | 3300013308 | Bacteria | 716 |
| 562 | Ga0163163_10000332 | 3300014325 | Bacteria | 45415 |
| 563 | Ga0163163_10003608 | 3300014325 | Bacteria | 13149 |
| 564 | Ga0163163_10178082 | 3300014325 | Bacteria | 2173 |
| 565 | Ga0163163_10315331 | 3300014325 | Unclassified | 1617 |
| 566 | Ga0163163_10680898 | 3300014325 | Bacteria | 1092 |
| 567 | Ga0163163_10841096 | 3300014325 | Bacteria | 981 |
| 568 | Ga0157380_10076849 | 3300014326 | Bacteria | 2719 |
| 569 | Ga0157380_10175065 | 3300014326 | Bacteria | 1879 |
| 570 | Ga0157380_10178350 | 3300014326 | Bacteria | 1864 |
| 571 | Ga0157380_10618043 | 3300014326 | Bacteria | 1075 |
| 572 | Ga0157377_10001951 | 3300014745 | Bacteria | 9020 |
| 573 | Ga0157377_10012098 | 3300014745 | Bacteria | 4330 |
| 574 | Ga0157377_10017126 | 3300014745 | Bacteria | 3743 |
| 575 | Ga0157377_10024122 | 3300014745 | Bacteria | 3231 |
| 576 | Ga0157377_10069632 | 3300014745 | Bacteria | 2030 |
| 577 | Ga0157377_10171685 | 3300014745 | Bacteria | 1357 |
| 578 | Ga0157377_10304935 | 3300014745 | Bacteria | 1052 |
| 579 | Ga0157377_10406730 | 3300014745 | Bacteria | 928 |
| 580 | Ga0157377_10570048 | 3300014745 | Bacteria | 803 |
| 581 | Ga0157379_10000245 | 3300014968 | Bacteria | 42570 |
| 582 | Ga0157379_10014342 | 3300014968 | Bacteria | 6954 |
| 583 | Ga0157379_10068746 | 3300014968 | Bacteria | 3167 |
| 584 | Ga0157379_10069217 | 3300014968 | Bacteria | 3156 |
| 585 | Ga0157379_10147538 | 3300014968 | Bacteria | 2121 |
| 586 | Ga0157379_10367538 | 3300014968 | Bacteria | 1319 |
| 587 | Ga0157379_10546789 | 3300014968 | Bacteria | 1077 |
| 588 | Ga0157379_10698722 | 3300014968 | Bacteria | 952 |
| 589 | Ga0157376_10004247 | 3300014969 | Bacteria | 9945 |
| 590 | Ga0157376_10008507 | 3300014969 | Bacteria | 7410 |
| 591 | Ga0157376_10010209 | 3300014969 | Bacteria | 6857 |
| 592 | Ga0157376_10062591 | 3300014969 | Bacteria | 3131 |
| 593 | Ga0157376_10137812 | 3300014969 | Bacteria | 2186 |
| 594 | Ga0157376_10189803 | 3300014969 | Unclassified | 1884 |
| 595 | Ga0163161_10002092 | 3300017792 | Bacteria | 14468 |
| 596 | Ga0163161_10019847 | 3300017792 | Bacteria | 4715 |
| 597 | Ga0163161_10050884 | 3300017792 | Bacteria | 2999 |
| 598 | Ga0163161_10120757 | 3300017792 | Unclassified | 1969 |
| 599 | Ga0163161_10201859 | 3300017792 | Bacteria | 1533 |
| 600 | Ga0163161_10628652 | 3300017792 | Bacteria | 888 |
| 601 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 602 | Ga0207697_10016858 | 3300025315 | Bacteria | 3006 |
| 603 | Ga0207697_10106645 | 3300025315 | Bacteria | 1197 |
| 604 | Ga0207656_10001320 | 3300025321 | Bacteria | 8164 |
| 605 | Ga0207656_10084856 | 3300025321 | Bacteria | 1429 |
| 606 | Ga0207656_10182571 | 3300025321 | Bacteria | 1007 |
| 607 | Ga0207682_10017385 | 3300025893 | Bacteria | 2808 |
| 608 | Ga0207682_10030875 | 3300025893 | Bacteria | 2148 |
| 609 | Ga0207682_10055276 | 3300025893 | Bacteria | 1650 |
| 610 | Ga0207682_10078383 | 3300025893 | Bacteria | 1411 |
| 611 | Ga0207682_10082740 | 3300025893 | Bacteria | 1379 |
| 612 | Ga0207710_10001046 | 3300025900 | Bacteria | 14273 |
| 613 | Ga0207688_10091986 | 3300025901 | Bacteria | 1743 |
| 614 | Ga0207688_10114170 | 3300025901 | Bacteria | 1571 |
| 615 | Ga0207680_10000648 | 3300025903 | Bacteria | 16407 |
| 616 | Ga0207680_10249473 | 3300025903 | Bacteria | 1226 |
| 617 | Ga0207680_10722125 | 3300025903 | Bacteria | 714 |
| 618 | Ga0207647_10000282 | 3300025904 | Bacteria | 41535 |
| 619 | Ga0207647_10026305 | 3300025904 | Bacteria | 3809 |
| 620 | Ga0207647_10098198 | 3300025904 | Unclassified | 1740 |
| 621 | Ga0207647_10481369 | 3300025904 | Bacteria | 693 |
| 622 | Ga0207685_10266569 | 3300025905 | Unclassified | 835 |
| 623 | Ga0207645_10000378 | 3300025907 | Bacteria | 36697 |
| 624 | Ga0207645_10001750 | 3300025907 | Bacteria | 17617 |
| 625 | Ga0207645_10064892 | 3300025907 | Bacteria | 2333 |
| 626 | Ga0207645_10142954 | 3300025907 | Bacteria | 1559 |
| 627 | Ga0207643_10003255 | 3300025908 | Bacteria | 8767 |
| 628 | Ga0207643_10006561 | 3300025908 | Bacteria | 6237 |
| 629 | Ga0207643_10096130 | 3300025908 | Bacteria | 1732 |
| 630 | Ga0207643_10399306 | 3300025908 | Bacteria | 869 |
| 631 | Ga0207705_10000717 | 3300025909 | Bacteria | 27323 |
| 632 | Ga0207705_10310450 | 3300025909 | Bacteria | 1211 |
| 633 | Ga0207705_10432917 | 3300025909 | Bacteria | 1019 |
| 634 | Ga0207654_10000259 | 3300025911 | Bacteria | 32195 |
| 635 | Ga0207654_10001858 | 3300025911 | Bacteria | 10926 |
| 636 | Ga0207654_10236921 | 3300025911 | Bacteria | 1218 |
| 637 | Ga0207654_10502640 | 3300025911 | Bacteria | 856 |
| 638 | Ga0207707_10064209 | 3300025912 | Unclassified | 3196 |
| 639 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 640 | Ga0207695_10003138 | 3300025913 | Bacteria | 23612 |
| 641 | Ga0207695_10151543 | 3300025913 | Bacteria | 2257 |
| 642 | Ga0207695_10402521 | 3300025913 | Bacteria | 1253 |
| 643 | Ga0207671_10001584 | 3300025914 | Bacteria | 25863 |
| 644 | Ga0207671_10001605 | 3300025914 | Bacteria | 25707 |
| 645 | Ga0207671_10011203 | 3300025914 | Bacteria | 7318 |
| 646 | Ga0207671_10011315 | 3300025914 | Bacteria | 7272 |
| 647 | Ga0207671_10011494 | 3300025914 | Bacteria | 7196 |
| 648 | Ga0207671_10024824 | 3300025914 | Bacteria | 4504 |
| 649 | Ga0207660_10595829 | 3300025917 | Bacteria | 900 |
| 650 | Ga0207662_10031022 | 3300025918 | Bacteria | 3105 |
| 651 | Ga0207662_10201020 | 3300025918 | Bacteria | 1290 |
| 652 | Ga0207657_10001201 | 3300025919 | Bacteria | 27551 |
| 653 | Ga0207657_10224636 | 3300025919 | Unclassified | 1503 |
| 654 | Ga0207649_10001403 | 3300025920 | Bacteria | 14262 |
| 655 | Ga0207649_10048281 | 3300025920 | Bacteria | 2625 |
| 656 | Ga0207649_10155754 | 3300025920 | Bacteria | 1578 |
| 657 | Ga0207649_10201995 | 3300025920 | Bacteria | 1405 |
| 658 | Ga0207652_10125949 | 3300025921 | Bacteria | 2282 |
| 659 | Ga0207652_10202896 | 3300025921 | Bacteria | 1785 |
| 660 | Ga0207681_10015733 | 3300025923 | Bacteria | 4723 |
| 661 | Ga0207681_10160043 | 3300025923 | Bacteria | 1696 |
| 662 | Ga0207681_10196981 | 3300025923 | Unclassified | 1545 |
| 663 | Ga0207681_10677541 | 3300025923 | Bacteria | 856 |
| 664 | Ga0207694_10015117 | 3300025924 | Bacteria | 5820 |
| 665 | Ga0207694_10126588 | 3300025924 | Bacteria | 2044 |
| 666 | Ga0207650_10002349 | 3300025925 | Bacteria | 13146 |
| 667 | Ga0207650_10015855 | 3300025925 | Bacteria | 5257 |
| 668 | Ga0207650_10073238 | 3300025925 | Bacteria | 2579 |
| 669 | Ga0207650_10203655 | 3300025925 | Bacteria | 1586 |
| 670 | Ga0207650_10216168 | 3300025925 | Bacteria | 1541 |
| 671 | Ga0207650_10508621 | 3300025925 | Unclassified | 1007 |
| 672 | Ga0207650_10530879 | 3300025925 | Unclassified | 985 |
| 673 | Ga0207650_10708065 | 3300025925 | Bacteria | 851 |
| 674 | Ga0207659_10012507 | 3300025926 | Bacteria | 5402 |
| 675 | Ga0207659_10016982 | 3300025926 | Bacteria | 4748 |
| 676 | Ga0207659_10059936 | 3300025926 | Bacteria | 2738 |
| 677 | Ga0207659_10079825 | 3300025926 | Bacteria | 2415 |
| 678 | Ga0207659_10237656 | 3300025926 | Bacteria | 1472 |
| 679 | Ga0207659_10296936 | 3300025926 | Unclassified | 1326 |
| 680 | Ga0207659_10321875 | 3300025926 | Bacteria | 1276 |
| 681 | Ga0207659_10793781 | 3300025926 | Bacteria | 813 |
| 682 | Ga0207659_11044438 | 3300025926 | Unclassified | 703 |
| 683 | Ga0207687_10558495 | 3300025927 | Bacteria | 961 |
| 684 | Ga0207644_10193968 | 3300025931 | Bacteria | 1598 |
| 685 | Ga0207644_10366810 | 3300025931 | Bacteria | 1172 |
| 686 | Ga0207644_10433588 | 3300025931 | Bacteria | 1078 |
| 687 | Ga0207644_10437842 | 3300025931 | Unclassified | 1073 |
| 688 | Ga0207644_10691384 | 3300025931 | Bacteria | 850 |
| 689 | Ga0207690_10011658 | 3300025932 | Bacteria | 5255 |
| 690 | Ga0207690_10392426 | 3300025932 | Bacteria | 1105 |
| 691 | Ga0207706_10014988 | 3300025933 | Bacteria | 7018 |
| 692 | Ga0207706_10019835 | 3300025933 | Bacteria | 6043 |
| 693 | Ga0207706_10063987 | 3300025933 | Bacteria | 3238 |
| 694 | Ga0207706_10111772 | 3300025933 | Bacteria | 2403 |
| 695 | Ga0207706_10530618 | 3300025933 | Unclassified | 1014 |
| 696 | Ga0207706_10739502 | 3300025933 | Bacteria | 839 |
| 697 | Ga0207706_10995053 | 3300025933 | Bacteria | 705 |
| 698 | Ga0207686_10002728 | 3300025934 | Bacteria | 9576 |
| 699 | Ga0207686_10184808 | 3300025934 | Unclassified | 1481 |
| 700 | Ga0207686_10253974 | 3300025934 | Unclassified | 1286 |
| 701 | Ga0207686_10977059 | 3300025934 | Bacteria | 686 |
| 702 | Ga0207709_10033145 | 3300025935 | Bacteria | 3030 |
| 703 | Ga0207709_10349223 | 3300025935 | Bacteria | 1116 |
| 704 | Ga0207709_10882657 | 3300025935 | Unclassified | 726 |
| 705 | Ga0207670_10010013 | 3300025936 | Bacteria | 5439 |
| 706 | Ga0207670_10020775 | 3300025936 | Bacteria | 4040 |
| 707 | Ga0207670_10077464 | 3300025936 | Bacteria | 2316 |
| 708 | Ga0207670_10136811 | 3300025936 | Bacteria | 1802 |
| 709 | Ga0207670_10139113 | 3300025936 | Bacteria | 1788 |
| 710 | Ga0207670_10281808 | 3300025936 | Bacteria | 1295 |
| 711 | Ga0207670_10483086 | 3300025936 | Bacteria | 1003 |
| 712 | Ga0207670_11077491 | 3300025936 | Unclassified | 678 |
| 713 | Ga0207669_10013132 | 3300025937 | Bacteria | 4102 |
| 714 | Ga0207669_10476034 | 3300025937 | Bacteria | 994 |
| 715 | Ga0207704_10035825 | 3300025938 | Bacteria | 2848 |
| 716 | Ga0207704_10062612 | 3300025938 | Bacteria | 2314 |
| 717 | Ga0207704_10085916 | 3300025938 | Bacteria | 2050 |
| 718 | Ga0207704_10145587 | 3300025938 | Bacteria | 1664 |
| 719 | Ga0207704_10374304 | 3300025938 | Unclassified | 1116 |
| 720 | Ga0207704_10585272 | 3300025938 | Unclassified | 911 |
| 721 | Ga0207704_10644324 | 3300025938 | Bacteria | 872 |
| 722 | Ga0207691_10000227 | 3300025940 | Bacteria | 54652 |
| 723 | Ga0207691_10018303 | 3300025940 | Bacteria | 6635 |
| 724 | Ga0207691_10019517 | 3300025940 | Bacteria | 6413 |
| 725 | Ga0207691_10023073 | 3300025940 | Bacteria | 5861 |
| 726 | Ga0207691_10070385 | 3300025940 | Bacteria | 3159 |
| 727 | Ga0207691_10154396 | 3300025940 | Bacteria | 2017 |
| 728 | Ga0207691_10473036 | 3300025940 | Bacteria | 1065 |
| 729 | Ga0207711_10593479 | 3300025941 | Unclassified | 1033 |
| 730 | Ga0207689_10004619 | 3300025942 | Bacteria | 12455 |
| 731 | Ga0207689_10005259 | 3300025942 | Bacteria | 11605 |
| 732 | Ga0207689_10005402 | 3300025942 | Bacteria | 11436 |
| 733 | Ga0207689_10012962 | 3300025942 | Bacteria | 7118 |
| 734 | Ga0207689_10014584 | 3300025942 | Bacteria | 6681 |
| 735 | Ga0207689_10052909 | 3300025942 | Bacteria | 3345 |
| 736 | Ga0207689_10081387 | 3300025942 | Bacteria | 2662 |
| 737 | Ga0207689_10101900 | 3300025942 | Bacteria | 2358 |
| 738 | Ga0207689_10293775 | 3300025942 | Bacteria | 1346 |
| 739 | Ga0207689_10395411 | 3300025942 | Bacteria | 1152 |
| 740 | Ga0207689_10652924 | 3300025942 | Unclassified | 886 |
| 741 | Ga0207689_10965166 | 3300025942 | Bacteria | 719 |
| 742 | Ga0207661_10003913 | 3300025944 | Bacteria | 10396 |
| 743 | Ga0207661_10005361 | 3300025944 | Bacteria | 9034 |
| 744 | Ga0207661_10011467 | 3300025944 | Bacteria | 6423 |
| 745 | Ga0207661_10052051 | 3300025944 | Bacteria | 3270 |
| 746 | Ga0207661_10084855 | 3300025944 | Bacteria | 2624 |
| 747 | Ga0207661_10099900 | 3300025944 | Bacteria | 2434 |
| 748 | Ga0207661_10218416 | 3300025944 | Bacteria | 1684 |
| 749 | Ga0207661_10220429 | 3300025944 | Bacteria | 1676 |
| 750 | Ga0207679_10000866 | 3300025945 | Bacteria | 19372 |
| 751 | Ga0207679_10148306 | 3300025945 | Bacteria | 1905 |
| 752 | Ga0207679_10157852 | 3300025945 | Bacteria | 1854 |
| 753 | Ga0207679_10294695 | 3300025945 | Bacteria | 1396 |
| 754 | Ga0207679_10759619 | 3300025945 | Bacteria | 882 |
| 755 | Ga0207679_10829787 | 3300025945 | Bacteria | 844 |
| 756 | Ga0207667_10000177 | 3300025949 | Bacteria | 92852 |
| 757 | Ga0207667_10045605 | 3300025949 | Bacteria | 4641 |
| 758 | Ga0207667_10117097 | 3300025949 | Bacteria | 2746 |
| 759 | Ga0207667_10178273 | 3300025949 | Bacteria | 2182 |
| 760 | Ga0207667_10208610 | 3300025949 | Bacteria | 2003 |
| 761 | Ga0207651_10006597 | 3300025960 | Bacteria | 6096 |
| 762 | Ga0207651_10035717 | 3300025960 | Bacteria | 3236 |
| 763 | Ga0207651_10075671 | 3300025960 | Unclassified | 2403 |
| 764 | Ga0207651_10094555 | 3300025960 | Bacteria | 2198 |
| 765 | Ga0207651_10111969 | 3300025960 | Bacteria | 2051 |
| 766 | Ga0207651_10131738 | 3300025960 | Bacteria | 1915 |
| 767 | Ga0207651_10210006 | 3300025960 | Bacteria | 1566 |
| 768 | Ga0207651_10250091 | 3300025960 | Unclassified | 1450 |
| 769 | Ga0207651_10446132 | 3300025960 | Bacteria | 1109 |
| 770 | Ga0207651_10716179 | 3300025960 | Bacteria | 883 |
| 771 | Ga0207651_10837462 | 3300025960 | Unclassified | 817 |
| 772 | Ga0207712_10023170 | 3300025961 | Bacteria | 4095 |
| 773 | Ga0207712_10053607 | 3300025961 | Bacteria | 2830 |
| 774 | Ga0207712_10053644 | 3300025961 | Bacteria | 2829 |
| 775 | Ga0207712_10061186 | 3300025961 | Bacteria | 2672 |
| 776 | Ga0207712_10076648 | 3300025961 | Bacteria | 2421 |
| 777 | Ga0207712_10111513 | 3300025961 | Bacteria | 2053 |
| 778 | Ga0207712_10117017 | 3300025961 | Bacteria | 2009 |
| 779 | Ga0207712_10120443 | 3300025961 | Bacteria | 1984 |
| 780 | Ga0207712_10805608 | 3300025961 | Bacteria | 826 |
| 781 | Ga0207712_11112258 | 3300025961 | Unclassified | 703 |
| 782 | Ga0207668_10000679 | 3300025972 | Bacteria | 20879 |
| 783 | Ga0207668_10301533 | 3300025972 | Bacteria | 1322 |
| 784 | Ga0207668_10573302 | 3300025972 | Bacteria | 980 |
| 785 | Ga0207668_10890313 | 3300025972 | Bacteria | 792 |
| 786 | Ga0207640_10163792 | 3300025981 | Bacteria | 1649 |
| 787 | Ga0207640_10242161 | 3300025981 | Bacteria | 1394 |
| 788 | Ga0207640_10312204 | 3300025981 | Bacteria | 1248 |
| 789 | Ga0207640_10337008 | 3300025981 | Bacteria | 1207 |
| 790 | Ga0207640_10407162 | 3300025981 | Unclassified | 1109 |
| 791 | Ga0207640_10846054 | 3300025981 | Bacteria | 796 |
| 792 | Ga0207658_10000176 | 3300025986 | Bacteria | 68501 |
| 793 | Ga0207658_10062740 | 3300025986 | Bacteria | 2782 |
| 794 | Ga0207658_10183778 | 3300025986 | Bacteria | 1732 |
| 795 | Ga0207658_10349102 | 3300025986 | Bacteria | 1288 |
| 796 | Ga0207658_10977550 | 3300025986 | Unclassified | 772 |
| 797 | Ga0207677_10004540 | 3300026023 | Bacteria | 7467 |
| 798 | Ga0207677_10020044 | 3300026023 | Bacteria | 4052 |
| 799 | Ga0207677_10087350 | 3300026023 | Bacteria | 2257 |
| 800 | Ga0207677_10160935 | 3300026023 | Bacteria | 1744 |
| 801 | Ga0207677_10221271 | 3300026023 | Bacteria | 1518 |
| 802 | Ga0207677_10284267 | 3300026023 | Bacteria | 1359 |
| 803 | Ga0207703_10006506 | 3300026035 | Bacteria | 9328 |
| 804 | Ga0207703_10009195 | 3300026035 | Bacteria | 7772 |
| 805 | Ga0207703_10079409 | 3300026035 | Bacteria | 2730 |
| 806 | Ga0207703_10265000 | 3300026035 | Unclassified | 1554 |
| 807 | Ga0207703_10361609 | 3300026035 | Bacteria | 1339 |
| 808 | Ga0207703_10646556 | 3300026035 | Bacteria | 1003 |
| 809 | Ga0207703_10974357 | 3300026035 | Bacteria | 813 |
| 810 | Ga0207639_10003909 | 3300026041 | Bacteria | 10051 |
| 811 | Ga0207639_10004963 | 3300026041 | Bacteria | 8962 |
| 812 | Ga0207639_10091444 | 3300026041 | Bacteria | 2436 |
| 813 | Ga0207639_10115704 | 3300026041 | Bacteria | 2194 |
| 814 | Ga0207639_10137462 | 3300026041 | Bacteria | 2031 |
| 815 | Ga0207639_10344487 | 3300026041 | Bacteria | 1329 |
| 816 | Ga0207639_10474254 | 3300026041 | Bacteria | 1139 |
| 817 | Ga0207678_10040176 | 3300026067 | Bacteria | 4058 |
| 818 | Ga0207702_10168646 | 3300026078 | Bacteria | 2005 |
| 819 | Ga0207702_10183994 | 3300026078 | Bacteria | 1926 |
| 820 | Ga0207641_10000631 | 3300026088 | Bacteria | 38429 |
| 821 | Ga0207641_10001151 | 3300026088 | Bacteria | 26569 |
| 822 | Ga0207641_10002208 | 3300026088 | Bacteria | 18318 |
| 823 | Ga0207641_10037605 | 3300026088 | Bacteria | 4043 |
| 824 | Ga0207641_10100743 | 3300026088 | Bacteria | 2544 |
| 825 | Ga0207641_10330327 | 3300026088 | Bacteria | 1448 |
| 826 | Ga0207641_10356408 | 3300026088 | Unclassified | 1395 |
| 827 | Ga0207648_10001692 | 3300026089 | Bacteria | 24146 |
| 828 | Ga0207648_10002605 | 3300026089 | Bacteria | 19328 |
| 829 | Ga0207648_10009064 | 3300026089 | Bacteria | 9571 |
| 830 | Ga0207648_10076896 | 3300026089 | Bacteria | 2909 |
| 831 | Ga0207648_10098855 | 3300026089 | Bacteria | 2555 |
| 832 | Ga0207648_10137595 | 3300026089 | Bacteria | 2152 |
| 833 | Ga0207648_10248623 | 3300026089 | Bacteria | 1585 |
| 834 | Ga0207676_10005000 | 3300026095 | Bacteria | 9389 |
| 835 | Ga0207676_10057114 | 3300026095 | Unclassified | 3072 |
| 836 | Ga0207676_10065222 | 3300026095 | Bacteria | 2899 |
| 837 | Ga0207676_10213664 | 3300026095 | Bacteria | 1713 |
| 838 | Ga0207676_10215721 | 3300026095 | Bacteria | 1706 |
| 839 | Ga0207676_10233315 | 3300026095 | Unclassified | 1646 |
| 840 | Ga0207676_10283830 | 3300026095 | Unclassified | 1504 |
| 841 | Ga0207676_10559975 | 3300026095 | Bacteria | 1093 |
| 842 | Ga0207676_10561881 | 3300026095 | Bacteria | 1091 |
| 843 | Ga0207676_10648211 | 3300026095 | Bacteria | 1019 |
| 844 | Ga0207676_10819128 | 3300026095 | Bacteria | 909 |
| 845 | Ga0207676_10866019 | 3300026095 | Bacteria | 884 |
| 846 | Ga0207674_10006874 | 3300026116 | Bacteria | 13331 |
| 847 | Ga0207674_10007431 | 3300026116 | Bacteria | 12770 |
| 848 | Ga0207674_10053745 | 3300026116 | Bacteria | 4104 |
| 849 | Ga0207674_10102570 | 3300026116 | Unclassified | 2841 |
| 850 | Ga0207674_10116330 | 3300026116 | Bacteria | 2645 |
| 851 | Ga0207674_10122120 | 3300026116 | Bacteria | 2571 |
| 852 | Ga0207674_10127989 | 3300026116 | Bacteria | 2504 |
| 853 | Ga0207674_10296970 | 3300026116 | Unclassified | 1564 |
| 854 | Ga0207674_10317100 | 3300026116 | Bacteria | 1508 |
| 855 | Ga0207674_10509988 | 3300026116 | Bacteria | 1162 |
| 856 | Ga0207674_10575690 | 3300026116 | Bacteria | 1088 |
| 857 | Ga0207674_10935994 | 3300026116 | Bacteria | 835 |
| 858 | Ga0207675_100007646 | 3300026118 | Bacteria | 10204 |
| 859 | Ga0207675_100019361 | 3300026118 | Bacteria | 6351 |
| 860 | Ga0207675_100037348 | 3300026118 | Bacteria | 4531 |
| 861 | Ga0207675_100040464 | 3300026118 | Bacteria | 4353 |
| 862 | Ga0207675_100066675 | 3300026118 | Bacteria | 3365 |
| 863 | Ga0207675_100077392 | 3300026118 | Bacteria | 3116 |
| 864 | Ga0207675_100115439 | 3300026118 | Bacteria | 2537 |
| 865 | Ga0207675_100118493 | 3300026118 | Bacteria | 2503 |
| 866 | Ga0207683_10002881 | 3300026121 | Bacteria | 14998 |
| 867 | Ga0207683_10036466 | 3300026121 | Bacteria | 4282 |
| 868 | Ga0207698_10026276 | 3300026142 | Bacteria | 4116 |
| 869 | Ga0207698_10058347 | 3300026142 | Bacteria | 2991 |
| 870 | Ga0207698_10338777 | 3300026142 | Bacteria | 1416 |
| 871 | Ga0207698_10555401 | 3300026142 | Bacteria | 1126 |
| 872 | Ga0207698_10719298 | 3300026142 | Unclassified | 995 |
| 873 | Ga0207698_10913275 | 3300026142 | Bacteria | 886 |
| 874 | Ga0209995_1039129 | 3300027471 | Bacteria | 799 |
| 875 | Ga0207428_10030362 | 3300027907 | Bacteria | 4468 |
| 876 | Ga0207428_10750218 | 3300027907 | Unclassified | 696 |
| 877 | Ga0268266_10003258 | 3300028379 | Bacteria | 16362 |
| 878 | Ga0268266_10253760 | 3300028379 | Unclassified | 1628 |
| 879 | Ga0268265_10004320 | 3300028380 | Bacteria | 9900 |
| 880 | Ga0268265_10380226 | 3300028380 | Bacteria | 1299 |
| 881 | Ga0268265_10879310 | 3300028380 | Bacteria | 879 |
| 882 | Ga0268264_10002823 | 3300028381 | Bacteria | 15162 |
| 883 | Ga0268264_10003175 | 3300028381 | Bacteria | 14234 |
| 884 | Ga0268264_10017151 | 3300028381 | Bacteria | 5930 |
| 885 | Ga0268264_10034103 | 3300028381 | Bacteria | 4185 |
| 886 | Ga0268264_10447713 | 3300028381 | Bacteria | 1250 |
| 887 | Ga0268264_10552878 | 3300028381 | Bacteria | 1129 |
| 888 | Ga0307515_10000072 | 3300028794 | Bacteria | 237798 |
| 889 | Ga0265327_10077307 | 3300031251 | Bacteria | 1652 |
| 890 | Ga0307513_10277312 | 3300031456 | Unclassified | 1456 |
| 891 | Ga0307509_10111956 | 3300031507 | Bacteria | 2730 |
| 892 | Ga0307509_10134744 | 3300031507 | Bacteria | 2418 |
| 893 | Ga0265313_10098515 | 3300031595 | Bacteria | 1301 |
| 894 | Ga0307405_10039704 | 3300031731 | Bacteria | 2847 |
| 895 | Ga0307413_10046411 | 3300031824 | Bacteria | 2583 |
| 896 | Ga0307410_10127969 | 3300031852 | Bacteria | 1862 |
| 897 | Ga0307406_11073751 | 3300031901 | Bacteria | 694 |
| 898 | Ga0307407_10109982 | 3300031903 | Bacteria | 1728 |
| 899 | Ga0307407_10585515 | 3300031903 | Bacteria | 829 |
| 900 | Ga0307412_10629936 | 3300031911 | Bacteria | 912 |
| 901 | Ga0307412_11376664 | 3300031911 | Bacteria | 638 |
| 902 | Ga0307409_100142886 | 3300031995 | Bacteria | 2065 |
| 903 | Ga0307416_100152767 | 3300032002 | Bacteria | 2120 |
| 904 | Ga0307414_10594060 | 3300032004 | Bacteria | 992 |
| 905 | Ga0307411_10064618 | 3300032005 | Bacteria | 2451 |
| 906 | Ga0307415_100095007 | 3300032126 | Bacteria | 2169 |
| 907 | Ga0307415_100340303 | 3300032126 | Bacteria | 1259 |
| 908 | Ga0307415_100734209 | 3300032126 | Bacteria | 895 |
| 909 | Ga0307510_10000091 | 3300033180 | Bacteria | 68694 |
| 910 | Ga0373952_0131773 | 3300035092 | Unclassified | 687 |
| 911 | Ga0373923_0035099 | 3300035111 | Bacteria | 2040 |
| 912 | Ga0373947_0463711 | 3300035725 | Bacteria | 859 |
| 913 | Ga0373937_0038798 | 3300036401 | Bacteria | 4340 |
| 914 | Ga0373925_0973541 | 3300037068 | Bacteria | 699 |
| 915 | Ga0395900_0060995 | 3300037418 | Bacteria | 3879 |
| 916 | Ga0395900_0258219 | 3300037418 | Bacteria | 1741 |
| 917 | Ga0395900_0543223 | 3300037418 | Bacteria | 1108 |
| 918 | Ga0395905_0000003 | 3300037471 | Bacteria | 1347396 |
| 919 | Ga0395905_0009263 | 3300037471 | Bacteria | 9636 |
| 920 | Ga0395905_0032320 | 3300037471 | Bacteria | 4922 |
| 921 | Ga0395905_0078586 | 3300037471 | Bacteria | 3092 |
| 922 | Ga0395905_0267038 | 3300037471 | Bacteria | 1597 |
| 923 | Ga0395905_0963051 | 3300037471 | Bacteria | 756 |
| 924 | Ga0395905_1059981 | 3300037471 | Bacteria | 714 |
| 925 | Ga0436365_1285215 | 3300039437 | Bacteria | 11167 |
| 926 | Ga0436363_0330490 | 3300039450 | Bacteria | 1133 |
| 927 | Ga0451802_1218311 | 3300041460 | Bacteria | 649 |
| 928 | Ga0451853_2475148 | 3300041512 | Bacteria | 1061 |
| 929 | Ga0451853_3841961 | 3300041512 | Bacteria | 1537 |
| 930 | Ga0439431_0090559 | 3300041997 | Bacteria | 833 |
| 931 | Ga0439441_004375 | 3300042001 | Bacteria | 2139 |
| 932 | Ga0439441_024579 | 3300042001 | Bacteria | 1132 |
| 933 | Ga0439443_022276 | 3300042003 | Unclassified | 1005 |
| 934 | Ga0439449_0002804 | 3300042007 | Bacteria | 6773 |
| 935 | Ga0439457_031175 | 3300042014 | Bacteria | 1182 |
| 936 | Ga0439434_0074458 | 3300042435 | Unclassified | 1072 |
| 937 | Ga0439464_0097162 | 3300042439 | Unclassified | 892 |
| 938 | Ga0451577_0073865 | 3300042876 | Bacteria | 3042 |
| 939 | Ga0466969_0001246 | 3300044656 | Bacteria | 13732 |
| 940 | Ga0466969_0071945 | 3300044656 | Bacteria | 1662 |
| 941 | Ga0466972_0000013 | 3300044658 | Bacteria | 229345 |
| 942 | Ga0466972_0010547 | 3300044658 | Bacteria | 4637 |
| 943 | Ga0466972_0370278 | 3300044658 | Bacteria | 671 |
| 944 | Ga0466965_0198393 | 3300044683 | Bacteria | 1064 |
| 945 | Ga0466966_0000045 | 3300044684 | Bacteria | 92504 |
| 946 | Ga0466966_0066006 | 3300044684 | Bacteria | 2275 |
| 947 | Ga0466961_0020337 | 3300044693 | Bacteria | 4270 |
| 948 | Ga0453684_0090642 | 3300044712 | Bacteria | 3777 |
| 949 | Ga0466971_0145642 | 3300044719 | Bacteria | 1104 |
| 950 | Ga0466968_0204283 | 3300044735 | Bacteria | 926 |
| 951 | Ga0466970_0001156 | 3300044765 | Bacteria | 12789 |
| 952 | Ga0466957_0000070 | 3300044842 | Bacteria | 39824 |
| 953 | Ga0466957_0042684 | 3300044842 | Bacteria | 2745 |
| 954 | Ga0466957_0591986 | 3300044842 | Bacteria | 776 |
| 955 | Ga0466959_0000023 | 3300045049 | Bacteria | 124545 |
| 956 | Ga0466959_0008989 | 3300045049 | Bacteria | 7085 |
| 957 | Ga0466959_0125397 | 3300045049 | Bacteria | 1823 |
| 958 | Ga0451576_0904562 | 3300045051 | Bacteria | 926 |
| 959 | Ga0451576_1047326 | 3300045051 | Bacteria | 854 |
| 960 | Ga0466967_0123268 | 3300045976 | Bacteria | 2398 |
| 961 | Ga0495606_0004249 | 3300046507 | Bacteria | 14482 |
| 962 | Ga0495628_0112891 | 3300046516 | Bacteria | 2089 |
| 963 | Ga0495643_0050744 | 3300046522 | Bacteria | 2234 |
| 964 | Ga0495587_0051505 | 3300046536 | Bacteria | 2434 |
| 965 | Ga0495611_0045973 | 3300046648 | Bacteria | 1956 |
| 966 | Ga0495625_0436769 | 3300046660 | Bacteria | 811 |
| 967 | Ga0495657_0278633 | 3300046675 | Unclassified | 1001 |
| 968 | Ga0495613_0367838 | 3300046689 | Bacteria | 985 |
| 969 | Ga0495604_0449793 | 3300047317 | Bacteria | 842 |
| 970 | Ga0495674_0096356 | 3300047319 | Bacteria | 2522 |
| 971 | Ga0495672_0015619 | 3300047320 | Bacteria | 5147 |
| 972 | Ga0495676_0293233 | 3300047321 | Bacteria | 1099 |
| 973 | Ga0495676_0578522 | 3300047321 | Bacteria | 732 |
| 974 | Ga0495680_0218622 | 3300047322 | Unclassified | 1361 |
| 975 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 976 | Ga0495684_0226719 | 3300047471 | Unclassified | 1368 |
| 977 | Ga0496105_0159201 | 3300048908 | Bacteria | 1854 |
| 978 | Ga0496109_0311902 | 3300048912 | Bacteria | 1484 |
| 979 | Ga0496110_0171267 | 3300048913 | Unclassified | 1970 |
| 980 | Ga0496110_0180830 | 3300048913 | Bacteria | 1915 |
| 981 | Ga0501298_009953 | 3300049521 | Bacteria | 1626 |
| 982 | Ga0501301_016588 | 3300049524 | Bacteria | 668 |
| 983 | Ga0501031_0287330 | 3300049568 | Bacteria | 1066 |
| 984 | Ga0501034_0022717 | 3300049571 | Bacteria | 6389 |
| 985 | Ga0501034_0558505 | 3300049571 | Bacteria | 1053 |
| 986 | Ga0501036_0154076 | 3300049572 | Bacteria | 1938 |
| 987 | Ga0501037_0146479 | 3300049573 | Bacteria | 1689 |
| 988 | Ga0501038_0019364 | 3300049574 | Bacteria | 6136 |
| 989 | Ga0501038_0370341 | 3300049574 | Bacteria | 1113 |
| 990 | Ga0501043_0003765 | 3300049579 | Bacteria | 12466 |
| 991 | Ga0501043_0024677 | 3300049579 | Bacteria | 4715 |
| 992 | Ga0501043_0038841 | 3300049579 | Bacteria | 3743 |
| 993 | Ga0501046_0081476 | 3300049580 | Bacteria | 2499 |
| 994 | Ga0501046_0444175 | 3300049580 | Bacteria | 933 |
| 995 | Ga0501072_0285552 | 3300049588 | Bacteria | 1312 |
| 996 | Ga0501073_0024177 | 3300049589 | Bacteria | 4361 |
| 997 | Ga0501198_020162 | 3300049649 | Bacteria | 1055 |
| 998 | Ga0501198_034988 | 3300049649 | Bacteria | 852 |
| 999 | Ga0501202_000075 | 3300049652 | Bacteria | 10572 |
| 1000 | Ga0501202_001677 | 3300049652 | Bacteria | 3586 |
| 1001 | Ga0501206_005016 | 3300049653 | Bacteria | 1701 |
| 1002 | Ga0501207_092800 | 3300049654 | Bacteria | 596 |
| 1003 | Ga0501209_040616 | 3300049656 | Bacteria | 1229 |
| 1004 | Ga0501211_009429 | 3300049658 | Bacteria | 957 |
| 1005 | Ga0501217_002570 | 3300049661 | Bacteria | 3588 |
| 1006 | Ga0501217_004398 | 3300049661 | Bacteria | 2894 |
| 1007 | Ga0501222_023448 | 3300049662 | Bacteria | 832 |
| 1008 | Ga0501223_002561 | 3300049663 | Bacteria | 4019 |
| 1009 | Ga0501224_000798 | 3300049664 | Bacteria | 3988 |
| 1010 | Ga0501224_011073 | 3300049664 | Bacteria | 1325 |
| 1011 | Ga0501240_004216 | 3300049673 | Bacteria | 1656 |
| 1012 | Ga0501240_031461 | 3300049673 | Bacteria | 850 |
| 1013 | Ga0501240_046749 | 3300049673 | Bacteria | 733 |
| 1014 | Ga0501249_082644 | 3300049679 | Bacteria | 757 |
| 1015 | Ga0501250_000849 | 3300049680 | Bacteria | 2278 |
| 1016 | Ga0501252_018495 | 3300049682 | Bacteria | 893 |
| 1017 | Ga0501257_000560 | 3300049686 | Bacteria | 7376 |
| 1018 | Ga0501257_095560 | 3300049686 | Bacteria | 776 |
| 1019 | Ga0501259_000437 | 3300049688 | Bacteria | 6586 |
| 1020 | Ga0501259_001665 | 3300049688 | Bacteria | 3699 |
| 1021 | Ga0501219_000027 | 3300049703 | Bacteria | 23249 |
| 1022 | Ga0501221_000197 | 3300049704 | Bacteria | 8501 |
| 1023 | Ga0501221_005522 | 3300049704 | Bacteria | 2115 |
| 1024 | Ga0501221_015199 | 3300049704 | Bacteria | 1441 |
| 1025 | Ga0501225_0012209 | 3300049705 | Bacteria | 2413 |
| 1026 | Ga0501225_0037378 | 3300049705 | Bacteria | 1338 |
| 1027 | Ga0501225_0037891 | 3300049705 | Bacteria | 1329 |
| 1028 | Ga0501229_038859 | 3300049706 | Bacteria | 673 |
| 1029 | Ga0501234_002498 | 3300049707 | Bacteria | 2891 |
| 1030 | Ga0501234_007842 | 3300049707 | Bacteria | 1669 |
| 1031 | Ga0501245_001664 | 3300049708 | Bacteria | 2903 |
| 1032 | Ga0501245_013938 | 3300049708 | Bacteria | 1195 |
| 1033 | Ga0501245_021133 | 3300049708 | Bacteria | 1020 |
| 1034 | Ga0501080_0355785 | 3300049742 | Bacteria | 1321 |
| 1035 | Ga0501083_0175553 | 3300049744 | Bacteria | 1400 |
| 1036 | Ga0501241_019118 | 3300049758 | Bacteria | 1256 |
| 1037 | Ga0501241_062282 | 3300049758 | Bacteria | 751 |
| 1038 | Ga0501266_012323 | 3300049763 | Bacteria | 1102 |
| 1039 | Ga0501268_001349 | 3300049765 | Bacteria | 3047 |
| 1040 | Ga0501268_072047 | 3300049765 | Bacteria | 701 |
| 1041 | Ga0501269_013660 | 3300049766 | Bacteria | 995 |
| 1042 | Ga0501270_016880 | 3300049767 | Bacteria | 1061 |
| 1043 | Ga0501272_005628 | 3300049769 | Bacteria | 1324 |
| 1044 | Ga0501274_015541 | 3300049771 | Bacteria | 748 |
| 1045 | Ga0501279_012603 | 3300049775 | Bacteria | 1151 |
| 1046 | Ga0501035_0056798 | 3300049822 | Bacteria | 3491 |
| 1047 | Ga0501035_0131122 | 3300049822 | Bacteria | 2185 |
| 1048 | Ga0501044_0045447 | 3300049823 | Bacteria | 4549 |
| 1049 | Ga0501044_0157184 | 3300049823 | Bacteria | 2252 |
| 1050 | Ga0501284_00021 | 3300050005 | Bacteria | 89729 |
| 1051 | nmdc:mga0k408_218880_c1 | 3300050493 | Bacteria | 1137 |
| 1052 | nmdc:mga0k408_23568_c1 | 3300050493 | Bacteria | 3474 |
| 1053 | nmdc:mga05p37_12189_c1 | 3300050507 | Bacteria | 10264 |
| 1054 | nmdc:mga05p37_129725_c1 | 3300050507 | Bacteria | 3093 |
| 1055 | nmdc:mga09592_152263_c1 | 3300050508 | Bacteria | 1996 |
| 1056 | nmdc:mga09592_421360_c1 | 3300050508 | Bacteria | 1153 |
| 1057 | nmdc:mga09592_5207_c1 | 3300050508 | Bacteria | 10567 |
| 1058 | nmdc:mga0qj67_23710_c1 | 3300050509 | Bacteria | 4723 |
| 1059 | nmdc:mga08y16_85815_c1 | 3300050511 | Bacteria | 3281 |
| 1060 | nmdc:mga08y16_96143_c1 | 3300050511 | Bacteria | 3085 |
| 1061 | nmdc:mga0n895_1093269_c1 | 3300050512 | Bacteria | 775 |
| 1062 | nmdc:mga0n895_402408_c1 | 3300050512 | Unclassified | 1384 |
| 1063 | nmdc:mga0rr50_1039330_c1 | 3300050513 | Bacteria | 697 |
| 1064 | Ga0500644_0043430 | 3300053088 | Bacteria | 1504 |
| 1065 | Ga0500651_0325374 | 3300053093 | Bacteria | 877 |
| 1066 | Ga0500641_0006740 | 3300053096 | Bacteria | 4085 |
| 1067 | Ga0500562_000096 | 3300053108 | Bacteria | 33894 |
| 1068 | Ga0500588_0000589 | 3300053146 | Bacteria | 5959 |
| 1069 | Ga0500637_0114965 | 3300053178 | Bacteria | 1561 |
| 1070 | Ga0500611_000011 | 3300053727 | Bacteria | 141259 |
| 1071 | Ga0500645_006772 | 3300053730 | Bacteria | 4057 |
| 1072 | Ga0500661_017685 | 3300055283 | Bacteria | 1273 |
| 1073 | Ga0466962_0006963 | 3300061719 | Bacteria | 5420 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_11420805 | Ga0157378_114208052 | 168 |
| 2 | 3300005842 | Ga0068858_101110621 | Ga0068858_1011106211 | 171 |
| 3 | 3300049686 | Ga0501257_095560 | Ga0501257_095560_151_669 | 171 |
| 4 | 3300013102 | Ga0157371_10538645 | Ga0157371_105386451 | 173 |
| 5 | 3300013105 | Ga0157369_10861412 | Ga0157369_108614122 | 173 |
| 6 | 3300013296 | Ga0157374_10998093 | Ga0157374_109980931 | 173 |
| 7 | 3300013307 | Ga0157372_10078049 | Ga0157372_100780493 | 173 |
| 8 | 3300014326 | Ga0157380_10175065 | Ga0157380_101750652 | 173 |
| 9 | 3300025893 | Ga0207682_10078383 | Ga0207682_100783832 | 173 |
| 10 | 3300025925 | Ga0207650_10216168 | Ga0207650_102161682 | 173 |
| 11 | 3300025940 | Ga0207691_10154396 | Ga0207691_101543962 | 173 |
| 12 | 3300025972 | Ga0207668_10573302 | Ga0207668_105733022 | 173 |
| 13 | 3300042435 | Ga0439434_0074458 | Ga0439434_0074458_517_1041 | 173 |
| 14 | 3300044693 | Ga0466961_0020337 | Ga0466961_0020337_3552_4073 | 173 |
| 15 | 3300044712 | Ga0453684_0090642 | Ga0453684_0090642_2491_3015 | 173 |
| 16 | 3300044842 | Ga0466957_0042684 | Ga0466957_0042684_1950_2471 | 173 |
| 17 | 3300045051 | Ga0451576_0904562 | Ga0451576_0904562_120_644 | 173 |
| 18 | 3300049673 | Ga0501240_046749 | Ga0501240_046749_155_679 | 173 |
| 19 | 3300049680 | Ga0501250_000849 | Ga0501250_000849_314_838 | 173 |
| 20 | 3300049682 | Ga0501252_018495 | Ga0501252_018495_75_599 | 173 |
| 21 | 3300049704 | Ga0501221_015199 | Ga0501221_015199_457_981 | 173 |
| 22 | 3300049763 | Ga0501266_012323 | Ga0501266_012323_492_1016 | 173 |
| 23 | 3300049765 | Ga0501268_072047 | Ga0501268_072047_94_618 | 173 |
| 24 | 3300049769 | Ga0501272_005628 | Ga0501272_005628_474_998 | 173 |
| 25 | 3300003322 | rootL2_10203795 | rootL2_102037952 | 175 |
| 26 | 3300003354 | JGI25160J50197_1028187 | JGI25160J50197_10281871 | 175 |
| 27 | 3300005335 | Ga0070666_10648648 | Ga0070666_106486482 | 175 |
| 28 | 3300009545 | Ga0105237_10009229 | Ga0105237_100092298 | 175 |
| 29 | 3300009545 | Ga0105237_10011435 | Ga0105237_100114356 | 175 |
| 30 | 3300009551 | Ga0105238_10002521 | Ga0105238_100025219 | 175 |
| 31 | 3300010375 | Ga0105239_10014114 | Ga0105239_100141146 | 175 |
| 32 | 3300013307 | Ga0157372_11301137 | Ga0157372_113011372 | 175 |
| 33 | 3300025302 | Ga0207426_1000002 | Ga0207426_1000002163 | 175 |
| 34 | 3300044658 | Ga0466972_0010547 | Ga0466972_0010547_3861_4388 | 175 |
| 35 | 3300044735 | Ga0466968_0204283 | Ga0466968_0204283_217_744 | 175 |
| 36 | 3300053088 | Ga0500644_0043430 | Ga0500644_0043430_26_553 | 175 |
| 37 | 3300053108 | Ga0500562_000096 | Ga0500562_000096_29162_29689 | 175 |
| 38 | 3300053727 | Ga0500611_000011 | Ga0500611_000011_50325_50891 | 177 |
| 39 | 3300003323 | rootH1_10060685 | rootH1_100606853 | 178 |
| 40 | 3300005334 | Ga0068869_100016584 | Ga0068869_1000165844 | 179 |
| 41 | 3300005719 | Ga0068861_100034867 | Ga0068861_1000348673 | 179 |
| 42 | 3300005844 | Ga0068862_100059367 | Ga0068862_1000593672 | 179 |
| 43 | 3300025942 | Ga0207689_10014584 | Ga0207689_100145843 | 179 |
| 44 | 3300026118 | Ga0207675_100066675 | Ga0207675_1000666753 | 179 |
| 45 | iso_pu_bacteria | 2818991444 | 2819587455 | 183 |
| 46 | 3300049708 | Ga0501245_013938 | Ga0501245_013938_618_1175 | 184 |
| 47 | 3300031251 | Ga0265327_10077307 | Ga0265327_100773072 | 185 |
| 48 | 3300037471 | Ga0395905_0000003 | Ga0395905_0000003_607642_608208 | 185 |
| 49 | 3300041512 | Ga0451853_2475148 | Ga0451853_2475148_50_616 | 185 |
| 50 | 2162886011 | MRS1b_contig_1772662 | MRS1b_0619.00001620 | 187 |
| 51 | 2162886012 | MBSR1b_contig_12669236 | MBSR1b_0936.00002560 | 187 |
| 52 | 3300000652 | ARCol0yngRDRAFT_1009151 | ARCol0yngRDRAFT_10091511 | 187 |
| 53 | 3300002075 | JGI24738J21930_10036993 | JGI24738J21930_100369931 | 187 |
| 54 | 3300002077 | JGI24744J21845_10043095 | JGI24744J21845_100430952 | 187 |
| 55 | 3300002244 | JGI24742J22300_10014980 | JGI24742J22300_100149802 | 187 |
| 56 | 3300003316 | rootH1_10135696 | rootH1_101356962 | 187 |
| 57 | 3300003320 | rootH2_10020409 | rootH2_100204093 | 187 |
| 58 | 3300003320 | rootH2_10030789 | rootH2_1003078921 | 187 |
| 59 | 3300003320 | rootH2_10042646 | rootH2_100426466 | 187 |
| 60 | 3300005289 | Ga0065704_10114868 | Ga0065704_101148683 | 187 |
| 61 | 3300005289 | Ga0065704_10254632 | Ga0065704_102546322 | 187 |
| 62 | 3300005290 | Ga0065712_10004322 | Ga0065712_100043222 | 187 |
| 63 | 3300005290 | Ga0065712_10077307 | Ga0065712_100773073 | 187 |
| 64 | 3300005290 | Ga0065712_10263234 | Ga0065712_102632341 | 187 |
| 65 | 3300005293 | Ga0065715_10588591 | Ga0065715_105885911 | 187 |
| 66 | 3300005295 | Ga0065707_10024347 | Ga0065707_100243472 | 187 |
| 67 | 3300005295 | Ga0065707_10105866 | Ga0065707_101058661 | 187 |
| 68 | 3300005295 | Ga0065707_10342174 | Ga0065707_103421742 | 187 |
| 69 | 3300005327 | Ga0070658_10190011 | Ga0070658_101900112 | 187 |
| 70 | 3300005327 | Ga0070658_10240820 | Ga0070658_102408202 | 187 |
| 71 | 3300005327 | Ga0070658_10499951 | Ga0070658_104999511 | 187 |
| 72 | 3300005327 | Ga0070658_10856487 | Ga0070658_108564872 | 187 |
| 73 | 3300005328 | Ga0070676_10000932 | Ga0070676_100009328 | 187 |
| 74 | 3300005328 | Ga0070676_10571573 | Ga0070676_105715731 | 187 |
| 75 | 3300005329 | Ga0070683_100001892 | Ga0070683_1000018927 | 187 |
| 76 | 3300005329 | Ga0070683_100007576 | Ga0070683_10000757613 | 187 |
| 77 | 3300005329 | Ga0070683_100016743 | Ga0070683_1000167432 | 187 |
| 78 | 3300005329 | Ga0070683_100019212 | Ga0070683_1000192126 | 187 |
| 79 | 3300005329 | Ga0070683_100053668 | Ga0070683_1000536683 | 187 |
| 80 | 3300005329 | Ga0070683_100264414 | Ga0070683_1002644141 | 187 |
| 81 | 3300005330 | Ga0070690_100015166 | Ga0070690_1000151663 | 187 |
| 82 | 3300005330 | Ga0070690_100068031 | Ga0070690_1000680313 | 187 |
| 83 | 3300005331 | Ga0070670_100012284 | Ga0070670_1000122845 | 187 |
| 84 | 3300005331 | Ga0070670_100035924 | Ga0070670_1000359245 | 187 |
| 85 | 3300005331 | Ga0070670_100036566 | Ga0070670_1000365663 | 187 |
| 86 | 3300005331 | Ga0070670_100036748 | Ga0070670_1000367482 | 187 |
| 87 | 3300005331 | Ga0070670_100078687 | Ga0070670_1000786873 | 187 |
| 88 | 3300005331 | Ga0070670_100089258 | Ga0070670_1000892582 | 187 |
| 89 | 3300005331 | Ga0070670_100091035 | Ga0070670_1000910353 | 187 |
| 90 | 3300005331 | Ga0070670_100104333 | Ga0070670_1001043333 | 187 |
| 91 | 3300005331 | Ga0070670_100144191 | Ga0070670_1001441912 | 187 |
| 92 | 3300005331 | Ga0070670_100160342 | Ga0070670_1001603422 | 187 |
| 93 | 3300005331 | Ga0070670_100269117 | Ga0070670_1002691172 | 187 |
| 94 | 3300005331 | Ga0070670_100994162 | Ga0070670_1009941621 | 187 |
| 95 | 3300005333 | Ga0070677_10077856 | Ga0070677_100778562 | 187 |
| 96 | 3300005333 | Ga0070677_10115573 | Ga0070677_101155732 | 187 |
| 97 | 3300005333 | Ga0070677_10129117 | Ga0070677_101291172 | 187 |
| 98 | 3300005334 | Ga0068869_100002337 | Ga0068869_10000233710 | 187 |
| 99 | 3300005334 | Ga0068869_100017315 | Ga0068869_1000173154 | 187 |
| 100 | 3300005334 | Ga0068869_100031071 | Ga0068869_1000310714 | 187 |
| 101 | 3300005334 | Ga0068869_100058283 | Ga0068869_1000582832 | 187 |
| 102 | 3300005334 | Ga0068869_100076905 | Ga0068869_1000769052 | 187 |
| 103 | 3300005334 | Ga0068869_100097426 | Ga0068869_1000974262 | 187 |
| 104 | 3300005334 | Ga0068869_100102193 | Ga0068869_1001021933 | 187 |
| 105 | 3300005334 | Ga0068869_100119200 | Ga0068869_1001192001 | 187 |
| 106 | 3300005334 | Ga0068869_100571015 | Ga0068869_1005710152 | 187 |
| 107 | 3300005334 | Ga0068869_100671682 | Ga0068869_1006716821 | 187 |
| 108 | 3300005335 | Ga0070666_10000833 | Ga0070666_100008339 | 187 |
| 109 | 3300005335 | Ga0070666_10015420 | Ga0070666_100154201 | 187 |
| 110 | 3300005335 | Ga0070666_10020501 | Ga0070666_100205013 | 187 |
| 111 | 3300005335 | Ga0070666_10206403 | Ga0070666_102064032 | 187 |
| 112 | 3300005335 | Ga0070666_10311104 | Ga0070666_103111041 | 187 |
| 113 | 3300005336 | Ga0070680_100103219 | Ga0070680_1001032191 | 187 |
| 114 | 3300005337 | Ga0070682_100025159 | Ga0070682_1000251591 | 187 |
| 115 | 3300005337 | Ga0070682_100435585 | Ga0070682_1004355851 | 187 |
| 116 | 3300005338 | Ga0068868_100000091 | Ga0068868_1000000917 | 187 |
| 117 | 3300005338 | Ga0068868_100003227 | Ga0068868_1000032276 | 187 |
| 118 | 3300005338 | Ga0068868_100005969 | Ga0068868_1000059693 | 187 |
| 119 | 3300005338 | Ga0068868_100017172 | Ga0068868_1000171724 | 187 |
| 120 | 3300005338 | Ga0068868_100017820 | Ga0068868_1000178204 | 187 |
| 121 | 3300005338 | Ga0068868_100050580 | Ga0068868_1000505803 | 187 |
| 122 | 3300005338 | Ga0068868_100437582 | Ga0068868_1004375821 | 187 |
| 123 | 3300005338 | Ga0068868_101133717 | Ga0068868_1011337171 | 187 |
| 124 | 3300005339 | Ga0070660_100007804 | Ga0070660_1000078043 | 187 |
| 125 | 3300005340 | Ga0070689_100075317 | Ga0070689_1000753173 | 187 |
| 126 | 3300005340 | Ga0070689_100097914 | Ga0070689_1000979142 | 187 |
| 127 | 3300005340 | Ga0070689_100099393 | Ga0070689_1000993933 | 187 |
| 128 | 3300005340 | Ga0070689_100100163 | Ga0070689_1001001632 | 187 |
| 129 | 3300005340 | Ga0070689_100126083 | Ga0070689_1001260833 | 187 |
| 130 | 3300005340 | Ga0070689_100470179 | Ga0070689_1004701791 | 187 |
| 131 | 3300005340 | Ga0070689_100707738 | Ga0070689_1007077381 | 187 |
| 132 | 3300005343 | Ga0070687_100049753 | Ga0070687_1000497532 | 187 |
| 133 | 3300005343 | Ga0070687_100065980 | Ga0070687_1000659802 | 187 |
| 134 | 3300005343 | Ga0070687_100151924 | Ga0070687_1001519242 | 187 |
| 135 | 3300005344 | Ga0070661_100000998 | Ga0070661_1000009983 | 187 |
| 136 | 3300005344 | Ga0070661_100055301 | Ga0070661_1000553013 | 187 |
| 137 | 3300005347 | Ga0070668_100000043 | Ga0070668_10000004342 | 187 |
| 138 | 3300005347 | Ga0070668_100014986 | Ga0070668_1000149863 | 187 |
| 139 | 3300005347 | Ga0070668_100238069 | Ga0070668_1002380692 | 187 |
| 140 | 3300005347 | Ga0070668_100326349 | Ga0070668_1003263492 | 187 |
| 141 | 3300005347 | Ga0070668_100329169 | Ga0070668_1003291692 | 187 |
| 142 | 3300005347 | Ga0070668_100807142 | Ga0070668_1008071421 | 187 |
| 143 | 3300005353 | Ga0070669_100010916 | Ga0070669_1000109165 | 187 |
| 144 | 3300005353 | Ga0070669_100011863 | Ga0070669_1000118632 | 187 |
| 145 | 3300005353 | Ga0070669_100055419 | Ga0070669_1000554192 | 187 |
| 146 | 3300005353 | Ga0070669_100100993 | Ga0070669_1001009933 | 187 |
| 147 | 3300005353 | Ga0070669_100197168 | Ga0070669_1001971682 | 187 |
| 148 | 3300005353 | Ga0070669_100333602 | Ga0070669_1003336022 | 187 |
| 149 | 3300005353 | Ga0070669_100529024 | Ga0070669_1005290242 | 187 |
| 150 | 3300005354 | Ga0070675_100016806 | Ga0070675_1000168064 | 187 |
| 151 | 3300005354 | Ga0070675_100040377 | Ga0070675_1000403773 | 187 |
| 152 | 3300005354 | Ga0070675_100046961 | Ga0070675_1000469612 | 187 |
| 153 | 3300005354 | Ga0070675_100077696 | Ga0070675_1000776963 | 187 |
| 154 | 3300005354 | Ga0070675_100140247 | Ga0070675_1001402471 | 187 |
| 155 | 3300005354 | Ga0070675_100155730 | Ga0070675_1001557302 | 187 |
| 156 | 3300005354 | Ga0070675_100172433 | Ga0070675_1001724332 | 187 |
| 157 | 3300005354 | Ga0070675_100183471 | Ga0070675_1001834712 | 187 |
| 158 | 3300005354 | Ga0070675_100379574 | Ga0070675_1003795742 | 187 |
| 159 | 3300005354 | Ga0070675_100471186 | Ga0070675_1004711862 | 187 |
| 160 | 3300005354 | Ga0070675_100727582 | Ga0070675_1007275822 | 187 |
| 161 | 3300005355 | Ga0070671_100013905 | Ga0070671_1000139054 | 187 |
| 162 | 3300005355 | Ga0070671_100121885 | Ga0070671_1001218853 | 187 |
| 163 | 3300005355 | Ga0070671_100175449 | Ga0070671_1001754492 | 187 |
| 164 | 3300005355 | Ga0070671_100182088 | Ga0070671_1001820881 | 187 |
| 165 | 3300005355 | Ga0070671_100258283 | Ga0070671_1002582832 | 187 |
| 166 | 3300005355 | Ga0070671_100270702 | Ga0070671_1002707022 | 187 |
| 167 | 3300005355 | Ga0070671_100298122 | Ga0070671_1002981221 | 187 |
| 168 | 3300005355 | Ga0070671_100344012 | Ga0070671_1003440121 | 187 |
| 169 | 3300005355 | Ga0070671_100432733 | Ga0070671_1004327331 | 187 |
| 170 | 3300005356 | Ga0070674_100053820 | Ga0070674_1000538202 | 187 |
| 171 | 3300005356 | Ga0070674_100056755 | Ga0070674_1000567553 | 187 |
| 172 | 3300005356 | Ga0070674_100073920 | Ga0070674_1000739202 | 187 |
| 173 | 3300005356 | Ga0070674_100182923 | Ga0070674_1001829231 | 187 |
| 174 | 3300005356 | Ga0070674_100269074 | Ga0070674_1002690741 | 187 |
| 175 | 3300005356 | Ga0070674_100616089 | Ga0070674_1006160891 | 187 |
| 176 | 3300005364 | Ga0070673_100012785 | Ga0070673_1000127854 | 187 |
| 177 | 3300005364 | Ga0070673_100013846 | Ga0070673_1000138465 | 187 |
| 178 | 3300005364 | Ga0070673_100019331 | Ga0070673_1000193313 | 187 |
| 179 | 3300005364 | Ga0070673_100048748 | Ga0070673_1000487482 | 187 |
| 180 | 3300005364 | Ga0070673_100069027 | Ga0070673_1000690272 | 187 |
| 181 | 3300005364 | Ga0070673_100071700 | Ga0070673_1000717003 | 187 |
| 182 | 3300005364 | Ga0070673_100171374 | Ga0070673_1001713741 | 187 |
| 183 | 3300005364 | Ga0070673_100614801 | Ga0070673_1006148012 | 187 |
| 184 | 3300005364 | Ga0070673_101126804 | Ga0070673_1011268041 | 187 |
| 185 | 3300005365 | Ga0070688_100001211 | Ga0070688_1000012113 | 187 |
| 186 | 3300005365 | Ga0070688_100054375 | Ga0070688_1000543752 | 187 |
| 187 | 3300005365 | Ga0070688_100067445 | Ga0070688_1000674452 | 187 |
| 188 | 3300005365 | Ga0070688_100079251 | Ga0070688_1000792512 | 187 |
| 189 | 3300005365 | Ga0070688_100163879 | Ga0070688_1001638792 | 187 |
| 190 | 3300005365 | Ga0070688_100274493 | Ga0070688_1002744931 | 187 |
| 191 | 3300005366 | Ga0070659_100012950 | Ga0070659_1000129505 | 187 |
| 192 | 3300005366 | Ga0070659_100048059 | Ga0070659_1000480593 | 187 |
| 193 | 3300005366 | Ga0070659_100526146 | Ga0070659_1005261461 | 187 |
| 194 | 3300005366 | Ga0070659_100793684 | Ga0070659_1007936841 | 187 |
| 195 | 3300005367 | Ga0070667_100000254 | Ga0070667_10000025435 | 187 |
| 196 | 3300005367 | Ga0070667_100022994 | Ga0070667_1000229944 | 187 |
| 197 | 3300005367 | Ga0070667_100049982 | Ga0070667_1000499823 | 187 |
| 198 | 3300005367 | Ga0070667_100078410 | Ga0070667_1000784101 | 187 |
| 199 | 3300005367 | Ga0070667_100170549 | Ga0070667_1001705493 | 187 |
| 200 | 3300005367 | Ga0070667_100244950 | Ga0070667_1002449502 | 187 |
| 201 | 3300005367 | Ga0070667_100431265 | Ga0070667_1004312652 | 187 |
| 202 | 3300005367 | Ga0070667_101120913 | Ga0070667_1011209131 | 187 |
| 203 | 3300005438 | Ga0070701_10060827 | Ga0070701_100608271 | 187 |
| 204 | 3300005438 | Ga0070701_10066706 | Ga0070701_100667062 | 187 |
| 205 | 3300005440 | Ga0070705_100191810 | Ga0070705_1001918102 | 187 |
| 206 | 3300005441 | Ga0070700_100054188 | Ga0070700_1000541882 | 187 |
| 207 | 3300005441 | Ga0070700_100157347 | Ga0070700_1001573472 | 187 |
| 208 | 3300005456 | Ga0070678_100004350 | Ga0070678_1000043505 | 187 |
| 209 | 3300005456 | Ga0070678_100057910 | Ga0070678_1000579101 | 187 |
| 210 | 3300005456 | Ga0070678_100373337 | Ga0070678_1003733372 | 187 |
| 211 | 3300005456 | Ga0070678_100428371 | Ga0070678_1004283711 | 187 |
| 212 | 3300005457 | Ga0070662_100010688 | Ga0070662_1000106881 | 187 |
| 213 | 3300005457 | Ga0070662_100014815 | Ga0070662_1000148154 | 187 |
| 214 | 3300005457 | Ga0070662_100020923 | Ga0070662_1000209234 | 187 |
| 215 | 3300005457 | Ga0070662_100027652 | Ga0070662_1000276523 | 187 |
| 216 | 3300005457 | Ga0070662_100060059 | Ga0070662_1000600592 | 187 |
| 217 | 3300005457 | Ga0070662_100087226 | Ga0070662_1000872263 | 187 |
| 218 | 3300005457 | Ga0070662_100197069 | Ga0070662_1001970692 | 187 |
| 219 | 3300005457 | Ga0070662_100504918 | Ga0070662_1005049181 | 187 |
| 220 | 3300005457 | Ga0070662_100651932 | Ga0070662_1006519321 | 187 |
| 221 | 3300005458 | Ga0070681_10002668 | Ga0070681_100026686 | 187 |
| 222 | 3300005459 | Ga0068867_100003884 | Ga0068867_1000038847 | 187 |
| 223 | 3300005459 | Ga0068867_100034619 | Ga0068867_1000346192 | 187 |
| 224 | 3300005459 | Ga0068867_100109335 | Ga0068867_1001093353 | 187 |
| 225 | 3300005459 | Ga0068867_100233541 | Ga0068867_1002335412 | 187 |
| 226 | 3300005459 | Ga0068867_100319758 | Ga0068867_1003197581 | 187 |
| 227 | 3300005459 | Ga0068867_100547920 | Ga0068867_1005479202 | 187 |
| 228 | 3300005466 | Ga0070685_10161660 | Ga0070685_101616602 | 187 |
| 229 | 3300005466 | Ga0070685_10270157 | Ga0070685_102701572 | 187 |
| 230 | 3300005466 | Ga0070685_10496073 | Ga0070685_104960731 | 187 |
| 231 | 3300005467 | Ga0070706_100430297 | Ga0070706_1004302972 | 187 |
| 232 | 3300005467 | Ga0070706_100465549 | Ga0070706_1004655491 | 187 |
| 233 | 3300005471 | Ga0070698_100001232 | Ga0070698_10000123230 | 187 |
| 234 | 3300005471 | Ga0070698_100001401 | Ga0070698_10000140116 | 187 |
| 235 | 3300005471 | Ga0070698_100024342 | Ga0070698_1000243421 | 187 |
| 236 | 3300005471 | Ga0070698_100175844 | Ga0070698_1001758442 | 187 |
| 237 | 3300005518 | Ga0070699_100073116 | Ga0070699_1000731163 | 187 |
| 238 | 3300005530 | Ga0070679_100064164 | Ga0070679_1000641644 | 187 |
| 239 | 3300005530 | Ga0070679_101000488 | Ga0070679_1010004882 | 187 |
| 240 | 3300005535 | Ga0070684_100000143 | Ga0070684_10000014335 | 187 |
| 241 | 3300005535 | Ga0070684_100004638 | Ga0070684_1000046388 | 187 |
| 242 | 3300005535 | Ga0070684_100008847 | Ga0070684_1000088475 | 187 |
| 243 | 3300005535 | Ga0070684_100015352 | Ga0070684_1000153526 | 187 |
| 244 | 3300005535 | Ga0070684_100060599 | Ga0070684_1000605994 | 187 |
| 245 | 3300005535 | Ga0070684_100144420 | Ga0070684_1001444202 | 187 |
| 246 | 3300005535 | Ga0070684_100151285 | Ga0070684_1001512853 | 187 |
| 247 | 3300005535 | Ga0070684_101001501 | Ga0070684_1010015011 | 187 |
| 248 | 3300005539 | Ga0068853_100007245 | Ga0068853_1000072456 | 187 |
| 249 | 3300005539 | Ga0068853_100015397 | Ga0068853_1000153978 | 187 |
| 250 | 3300005539 | Ga0068853_100133050 | Ga0068853_1001330503 | 187 |
| 251 | 3300005539 | Ga0068853_100202634 | Ga0068853_1002026343 | 187 |
| 252 | 3300005539 | Ga0068853_100259546 | Ga0068853_1002595463 | 187 |
| 253 | 3300005539 | Ga0068853_100360678 | Ga0068853_1003606782 | 187 |
| 254 | 3300005539 | Ga0068853_100463979 | Ga0068853_1004639791 | 187 |
| 255 | 3300005539 | Ga0068853_100600863 | Ga0068853_1006008632 | 187 |
| 256 | 3300005539 | Ga0068853_100745638 | Ga0068853_1007456382 | 187 |
| 257 | 3300005539 | Ga0068853_101658230 | Ga0068853_1016582301 | 187 |
| 258 | 3300005543 | Ga0070672_100000160 | Ga0070672_1000001602 | 187 |
| 259 | 3300005543 | Ga0070672_100101544 | Ga0070672_1001015443 | 187 |
| 260 | 3300005543 | Ga0070672_100110785 | Ga0070672_1001107853 | 187 |
| 261 | 3300005543 | Ga0070672_100163589 | Ga0070672_1001635892 | 187 |
| 262 | 3300005543 | Ga0070672_100267583 | Ga0070672_1002675832 | 187 |
| 263 | 3300005543 | Ga0070672_100351100 | Ga0070672_1003511002 | 187 |
| 264 | 3300005543 | Ga0070672_100443964 | Ga0070672_1004439642 | 187 |
| 265 | 3300005544 | Ga0070686_100027961 | Ga0070686_1000279612 | 187 |
| 266 | 3300005544 | Ga0070686_100475410 | Ga0070686_1004754101 | 187 |
| 267 | 3300005545 | Ga0070695_100163393 | Ga0070695_1001633932 | 187 |
| 268 | 3300005546 | Ga0070696_100505393 | Ga0070696_1005053931 | 187 |
| 269 | 3300005547 | Ga0070693_100061006 | Ga0070693_1000610062 | 187 |
| 270 | 3300005547 | Ga0070693_100408740 | Ga0070693_1004087402 | 187 |
| 271 | 3300005547 | Ga0070693_100420411 | Ga0070693_1004204112 | 187 |
| 272 | 3300005547 | Ga0070693_100451979 | Ga0070693_1004519791 | 187 |
| 273 | 3300005548 | Ga0070665_100000350 | Ga0070665_10000035010 | 187 |
| 274 | 3300005548 | Ga0070665_100042513 | Ga0070665_1000425133 | 187 |
| 275 | 3300005548 | Ga0070665_100170322 | Ga0070665_1001703221 | 187 |
| 276 | 3300005548 | Ga0070665_100311136 | Ga0070665_1003111362 | 187 |
| 277 | 3300005548 | Ga0070665_100337427 | Ga0070665_1003374272 | 187 |
| 278 | 3300005563 | Ga0068855_100000089 | Ga0068855_10000008935 | 187 |
| 279 | 3300005563 | Ga0068855_100025914 | Ga0068855_1000259145 | 187 |
| 280 | 3300005563 | Ga0068855_100074344 | Ga0068855_1000743443 | 187 |
| 281 | 3300005563 | Ga0068855_100081339 | Ga0068855_1000813392 | 187 |
| 282 | 3300005563 | Ga0068855_101300394 | Ga0068855_1013003941 | 187 |
| 283 | 3300005564 | Ga0070664_100008696 | Ga0070664_1000086963 | 187 |
| 284 | 3300005564 | Ga0070664_100016033 | Ga0070664_1000160335 | 187 |
| 285 | 3300005564 | Ga0070664_100040643 | Ga0070664_1000406431 | 187 |
| 286 | 3300005564 | Ga0070664_100052751 | Ga0070664_1000527513 | 187 |
| 287 | 3300005564 | Ga0070664_100058800 | Ga0070664_1000588004 | 187 |
| 288 | 3300005564 | Ga0070664_100177020 | Ga0070664_1001770202 | 187 |
| 289 | 3300005564 | Ga0070664_100247518 | Ga0070664_1002475182 | 187 |
| 290 | 3300005564 | Ga0070664_100439506 | Ga0070664_1004395063 | 187 |
| 291 | 3300005577 | Ga0068857_100010772 | Ga0068857_1000107723 | 187 |
| 292 | 3300005577 | Ga0068857_100052934 | Ga0068857_1000529342 | 187 |
| 293 | 3300005577 | Ga0068857_100104411 | Ga0068857_1001044114 | 187 |
| 294 | 3300005577 | Ga0068857_100161546 | Ga0068857_1001615462 | 187 |
| 295 | 3300005577 | Ga0068857_100258266 | Ga0068857_1002582662 | 187 |
| 296 | 3300005577 | Ga0068857_100328796 | Ga0068857_1003287962 | 187 |
| 297 | 3300005577 | Ga0068857_100387820 | Ga0068857_1003878202 | 187 |
| 298 | 3300005577 | Ga0068857_100430778 | Ga0068857_1004307782 | 187 |
| 299 | 3300005577 | Ga0068857_100770525 | Ga0068857_1007705251 | 187 |
| 300 | 3300005577 | Ga0068857_100894496 | Ga0068857_1008944962 | 187 |
| 301 | 3300005577 | Ga0068857_101030982 | Ga0068857_1010309821 | 187 |
| 302 | 3300005578 | Ga0068854_100205682 | Ga0068854_1002056822 | 187 |
| 303 | 3300005578 | Ga0068854_100274520 | Ga0068854_1002745202 | 187 |
| 304 | 3300005578 | Ga0068854_100387386 | Ga0068854_1003873862 | 187 |
| 305 | 3300005614 | Ga0068856_100164527 | Ga0068856_1001645272 | 187 |
| 306 | 3300005614 | Ga0068856_100750359 | Ga0068856_1007503591 | 187 |
| 307 | 3300005615 | Ga0070702_100087919 | Ga0070702_1000879192 | 187 |
| 308 | 3300005616 | Ga0068852_100015848 | Ga0068852_1000158483 | 187 |
| 309 | 3300005616 | Ga0068852_100110788 | Ga0068852_1001107883 | 187 |
| 310 | 3300005616 | Ga0068852_100124989 | Ga0068852_1001249892 | 187 |
| 311 | 3300005616 | Ga0068852_100134972 | Ga0068852_1001349723 | 187 |
| 312 | 3300005616 | Ga0068852_100164795 | Ga0068852_1001647953 | 187 |
| 313 | 3300005616 | Ga0068852_100358351 | Ga0068852_1003583512 | 187 |
| 314 | 3300005616 | Ga0068852_100811437 | Ga0068852_1008114371 | 187 |
| 315 | 3300005616 | Ga0068852_101424504 | Ga0068852_1014245041 | 187 |
| 316 | 3300005617 | Ga0068859_100000100 | Ga0068859_10000010068 | 187 |
| 317 | 3300005617 | Ga0068859_100006400 | Ga0068859_1000064005 | 187 |
| 318 | 3300005617 | Ga0068859_100045503 | Ga0068859_1000455033 | 187 |
| 319 | 3300005617 | Ga0068859_100045943 | Ga0068859_1000459433 | 187 |
| 320 | 3300005617 | Ga0068859_100055078 | Ga0068859_1000550783 | 187 |
| 321 | 3300005617 | Ga0068859_100071722 | Ga0068859_1000717223 | 187 |
| 322 | 3300005617 | Ga0068859_100090854 | Ga0068859_1000908543 | 187 |
| 323 | 3300005617 | Ga0068859_100097155 | Ga0068859_1000971554 | 187 |
| 324 | 3300005617 | Ga0068859_100099520 | Ga0068859_1000995203 | 187 |
| 325 | 3300005617 | Ga0068859_100177818 | Ga0068859_1001778182 | 187 |
| 326 | 3300005617 | Ga0068859_100189897 | Ga0068859_1001898972 | 187 |
| 327 | 3300005617 | Ga0068859_100410358 | Ga0068859_1004103582 | 187 |
| 328 | 3300005617 | Ga0068859_100770622 | Ga0068859_1007706222 | 187 |
| 329 | 3300005617 | Ga0068859_100971747 | Ga0068859_1009717472 | 187 |
| 330 | 3300005617 | Ga0068859_101242883 | Ga0068859_1012428831 | 187 |
| 331 | 3300005617 | Ga0068859_101418791 | Ga0068859_1014187912 | 187 |
| 332 | 3300005618 | Ga0068864_100004900 | Ga0068864_1000049009 | 187 |
| 333 | 3300005618 | Ga0068864_100047787 | Ga0068864_1000477873 | 187 |
| 334 | 3300005618 | Ga0068864_100052426 | Ga0068864_1000524264 | 187 |
| 335 | 3300005618 | Ga0068864_100066952 | Ga0068864_1000669522 | 187 |
| 336 | 3300005618 | Ga0068864_100096472 | Ga0068864_1000964723 | 187 |
| 337 | 3300005618 | Ga0068864_100149758 | Ga0068864_1001497583 | 187 |
| 338 | 3300005618 | Ga0068864_100194596 | Ga0068864_1001945962 | 187 |
| 339 | 3300005618 | Ga0068864_100236660 | Ga0068864_1002366602 | 187 |
| 340 | 3300005618 | Ga0068864_100275992 | Ga0068864_1002759922 | 187 |
| 341 | 3300005618 | Ga0068864_100695094 | Ga0068864_1006950941 | 187 |
| 342 | 3300005618 | Ga0068864_100762170 | Ga0068864_1007621702 | 187 |
| 343 | 3300005618 | Ga0068864_101208464 | Ga0068864_1012084642 | 187 |
| 344 | 3300005718 | Ga0068866_10005085 | Ga0068866_100050853 | 187 |
| 345 | 3300005718 | Ga0068866_10028304 | Ga0068866_100283042 | 187 |
| 346 | 3300005718 | Ga0068866_10287892 | Ga0068866_102878922 | 187 |
| 347 | 3300005718 | Ga0068866_10594611 | Ga0068866_105946111 | 187 |
| 348 | 3300005719 | Ga0068861_100002321 | Ga0068861_1000023216 | 187 |
| 349 | 3300005719 | Ga0068861_100004878 | Ga0068861_1000048785 | 187 |
| 350 | 3300005719 | Ga0068861_100018316 | Ga0068861_1000183163 | 187 |
| 351 | 3300005719 | Ga0068861_100065845 | Ga0068861_1000658453 | 187 |
| 352 | 3300005719 | Ga0068861_100287472 | Ga0068861_1002874722 | 187 |
| 353 | 3300005719 | Ga0068861_100289715 | Ga0068861_1002897152 | 187 |
| 354 | 3300005719 | Ga0068861_100613395 | Ga0068861_1006133952 | 187 |
| 355 | 3300005719 | Ga0068861_100613470 | Ga0068861_1006134702 | 187 |
| 356 | 3300005834 | Ga0068851_10002184 | Ga0068851_100021845 | 187 |
| 357 | 3300005834 | Ga0068851_10088663 | Ga0068851_100886632 | 187 |
| 358 | 3300005834 | Ga0068851_10095771 | Ga0068851_100957711 | 187 |
| 359 | 3300005834 | Ga0068851_10505455 | Ga0068851_105054551 | 187 |
| 360 | 3300005834 | Ga0068851_10551966 | Ga0068851_105519661 | 187 |
| 361 | 3300005840 | Ga0068870_10021567 | Ga0068870_100215672 | 187 |
| 362 | 3300005840 | Ga0068870_10028936 | Ga0068870_100289363 | 187 |
| 363 | 3300005840 | Ga0068870_10244433 | Ga0068870_102444332 | 187 |
| 364 | 3300005841 | Ga0068863_100003656 | Ga0068863_1000036567 | 187 |
| 365 | 3300005841 | Ga0068863_100005412 | Ga0068863_1000054123 | 187 |
| 366 | 3300005841 | Ga0068863_100022973 | Ga0068863_1000229732 | 187 |
| 367 | 3300005841 | Ga0068863_100048136 | Ga0068863_1000481365 | 187 |
| 368 | 3300005841 | Ga0068863_100059429 | Ga0068863_1000594292 | 187 |
| 369 | 3300005841 | Ga0068863_100483940 | Ga0068863_1004839402 | 187 |
| 370 | 3300005841 | Ga0068863_100518876 | Ga0068863_1005188762 | 187 |
| 371 | 3300005841 | Ga0068863_100544527 | Ga0068863_1005445272 | 187 |
| 372 | 3300005841 | Ga0068863_100700176 | Ga0068863_1007001762 | 187 |
| 373 | 3300005842 | Ga0068858_100000199 | Ga0068858_10000019946 | 187 |
| 374 | 3300005842 | Ga0068858_100013150 | Ga0068858_1000131502 | 187 |
| 375 | 3300005842 | Ga0068858_100109962 | Ga0068858_1001099623 | 187 |
| 376 | 3300005842 | Ga0068858_100145754 | Ga0068858_1001457542 | 187 |
| 377 | 3300005843 | Ga0068860_100003203 | Ga0068860_1000032035 | 187 |
| 378 | 3300005843 | Ga0068860_100006347 | Ga0068860_1000063479 | 187 |
| 379 | 3300005843 | Ga0068860_100007843 | Ga0068860_1000078434 | 187 |
| 380 | 3300005843 | Ga0068860_100076081 | Ga0068860_1000760813 | 187 |
| 381 | 3300005843 | Ga0068860_100134077 | Ga0068860_1001340772 | 187 |
| 382 | 3300005843 | Ga0068860_100545787 | Ga0068860_1005457871 | 187 |
| 383 | 3300005843 | Ga0068860_100596383 | Ga0068860_1005963832 | 187 |
| 384 | 3300005844 | Ga0068862_100016502 | Ga0068862_1000165023 | 187 |
| 385 | 3300005844 | Ga0068862_100057039 | Ga0068862_1000570391 | 187 |
| 386 | 3300005844 | Ga0068862_100084888 | Ga0068862_1000848883 | 187 |
| 387 | 3300005844 | Ga0068862_100247155 | Ga0068862_1002471553 | 187 |
| 388 | 3300005937 | Ga0081455_10455209 | Ga0081455_104552091 | 187 |
| 389 | 3300006163 | Ga0070715_10066344 | Ga0070715_100663442 | 187 |
| 390 | 3300006195 | Ga0075366_10197900 | Ga0075366_101979002 | 187 |
| 391 | 3300006195 | Ga0075366_10267412 | Ga0075366_102674122 | 187 |
| 392 | 3300006195 | Ga0075366_10330696 | Ga0075366_103306962 | 187 |
| 393 | 3300006237 | Ga0097621_100009982 | Ga0097621_1000099825 | 187 |
| 394 | 3300006237 | Ga0097621_100034379 | Ga0097621_1000343793 | 187 |
| 395 | 3300006237 | Ga0097621_100110422 | Ga0097621_1001104223 | 187 |
| 396 | 3300006237 | Ga0097621_100151904 | Ga0097621_1001519042 | 187 |
| 397 | 3300006237 | Ga0097621_100190968 | Ga0097621_1001909682 | 187 |
| 398 | 3300006237 | Ga0097621_100358964 | Ga0097621_1003589641 | 187 |
| 399 | 3300006237 | Ga0097621_100439600 | Ga0097621_1004396001 | 187 |
| 400 | 3300006237 | Ga0097621_100450992 | Ga0097621_1004509922 | 187 |
| 401 | 3300006237 | Ga0097621_100758558 | Ga0097621_1007585581 | 187 |
| 402 | 3300006358 | Ga0068871_100055412 | Ga0068871_1000554123 | 187 |
| 403 | 3300006358 | Ga0068871_100095193 | Ga0068871_1000951932 | 187 |
| 404 | 3300006358 | Ga0068871_100146078 | Ga0068871_1001460782 | 187 |
| 405 | 3300006358 | Ga0068871_100149747 | Ga0068871_1001497471 | 187 |
| 406 | 3300006358 | Ga0068871_100156633 | Ga0068871_1001566332 | 187 |
| 407 | 3300006358 | Ga0068871_100282209 | Ga0068871_1002822092 | 187 |
| 408 | 3300006358 | Ga0068871_100301984 | Ga0068871_1003019842 | 187 |
| 409 | 3300006358 | Ga0068871_100350777 | Ga0068871_1003507772 | 187 |
| 410 | 3300006358 | Ga0068871_100525682 | Ga0068871_1005256822 | 187 |
| 411 | 3300006358 | Ga0068871_100589720 | Ga0068871_1005897201 | 187 |
| 412 | 3300006358 | Ga0068871_101414736 | Ga0068871_1014147361 | 187 |
| 413 | 3300006844 | Ga0075428_100001125 | Ga0075428_10000112514 | 187 |
| 414 | 3300006844 | Ga0075428_100029484 | Ga0075428_1000294845 | 187 |
| 415 | 3300006844 | Ga0075428_100159109 | Ga0075428_1001591095 | 187 |
| 416 | 3300006846 | Ga0075430_100037041 | Ga0075430_1000370413 | 187 |
| 417 | 3300006847 | Ga0075431_100018153 | Ga0075431_1000181536 | 187 |
| 418 | 3300006871 | Ga0075434_101119836 | Ga0075434_1011198362 | 187 |
| 419 | 3300006880 | Ga0075429_100000105 | Ga0075429_10000010534 | 187 |
| 420 | 3300006880 | Ga0075429_100033094 | Ga0075429_1000330944 | 187 |
| 421 | 3300006880 | Ga0075429_100446591 | Ga0075429_1004465912 | 187 |
| 422 | 3300006881 | Ga0068865_100003229 | Ga0068865_1000032299 | 187 |
| 423 | 3300006881 | Ga0068865_100019488 | Ga0068865_1000194885 | 187 |
| 424 | 3300006881 | Ga0068865_100190045 | Ga0068865_1001900453 | 187 |
| 425 | 3300006881 | Ga0068865_100575693 | Ga0068865_1005756931 | 187 |
| 426 | 3300006881 | Ga0068865_100605535 | Ga0068865_1006055351 | 187 |
| 427 | 3300006931 | Ga0097620_100000100 | Ga0097620_1000001003 | 187 |
| 428 | 3300006931 | Ga0097620_100006400 | Ga0097620_1000064002 | 187 |
| 429 | 3300006931 | Ga0097620_100045504 | Ga0097620_1000455043 | 187 |
| 430 | 3300006931 | Ga0097620_100045944 | Ga0097620_1000459444 | 187 |
| 431 | 3300006931 | Ga0097620_100055076 | Ga0097620_1000550763 | 187 |
| 432 | 3300006931 | Ga0097620_100071720 | Ga0097620_1000717203 | 187 |
| 433 | 3300006931 | Ga0097620_100090855 | Ga0097620_1000908553 | 187 |
| 434 | 3300006931 | Ga0097620_100097165 | Ga0097620_1000971653 | 187 |
| 435 | 3300006931 | Ga0097620_100099522 | Ga0097620_1000995222 | 187 |
| 436 | 3300006931 | Ga0097620_100177816 | Ga0097620_1001778162 | 187 |
| 437 | 3300006931 | Ga0097620_100189892 | Ga0097620_1001898922 | 187 |
| 438 | 3300006931 | Ga0097620_100410361 | Ga0097620_1004103612 | 187 |
| 439 | 3300006931 | Ga0097620_100770591 | Ga0097620_1007705912 | 187 |
| 440 | 3300006931 | Ga0097620_100971857 | Ga0097620_1009718571 | 187 |
| 441 | 3300006931 | Ga0097620_101242842 | Ga0097620_1012428421 | 187 |
| 442 | 3300006931 | Ga0097620_101418989 | Ga0097620_1014189892 | 187 |
| 443 | 3300007076 | Ga0075435_101263635 | Ga0075435_1012636351 | 187 |
| 444 | 3300009011 | Ga0105251_10071169 | Ga0105251_100711693 | 187 |
| 445 | 3300009093 | Ga0105240_10000074 | Ga0105240_1000007487 | 187 |
| 446 | 3300009093 | Ga0105240_10010569 | Ga0105240_1001056911 | 187 |
| 447 | 3300009093 | Ga0105240_10451742 | Ga0105240_104517422 | 187 |
| 448 | 3300009093 | Ga0105240_10575427 | Ga0105240_105754272 | 187 |
| 449 | 3300009094 | Ga0111539_10124592 | Ga0111539_101245922 | 187 |
| 450 | 3300009094 | Ga0111539_10725210 | Ga0111539_107252102 | 187 |
| 451 | 3300009094 | Ga0111539_11053653 | Ga0111539_110536532 | 187 |
| 452 | 3300009098 | Ga0105245_10021467 | Ga0105245_100214672 | 187 |
| 453 | 3300009098 | Ga0105245_10141816 | Ga0105245_101418162 | 187 |
| 454 | 3300009098 | Ga0105245_10490164 | Ga0105245_104901641 | 187 |
| 455 | 3300009098 | Ga0105245_11496987 | Ga0105245_114969871 | 187 |
| 456 | 3300009101 | Ga0105247_10001666 | Ga0105247_1000166611 | 187 |
| 457 | 3300009101 | Ga0105247_10035042 | Ga0105247_100350422 | 187 |
| 458 | 3300009101 | Ga0105247_10036944 | Ga0105247_100369441 | 187 |
| 459 | 3300009101 | Ga0105247_10091146 | Ga0105247_100911462 | 187 |
| 460 | 3300009101 | Ga0105247_10148451 | Ga0105247_101484512 | 187 |
| 461 | 3300009101 | Ga0105247_10634304 | Ga0105247_106343041 | 187 |
| 462 | 3300009147 | Ga0114129_10017306 | Ga0114129_100173065 | 187 |
| 463 | 3300009147 | Ga0114129_10121641 | Ga0114129_101216413 | 187 |
| 464 | 3300009147 | Ga0114129_10150575 | Ga0114129_101505753 | 187 |
| 465 | 3300009147 | Ga0114129_12032728 | Ga0114129_120327281 | 187 |
| 466 | 3300009148 | Ga0105243_10063213 | Ga0105243_100632133 | 187 |
| 467 | 3300009148 | Ga0105243_10191730 | Ga0105243_101917302 | 187 |
| 468 | 3300009148 | Ga0105243_10387379 | Ga0105243_103873791 | 187 |
| 469 | 3300009148 | Ga0105243_10492186 | Ga0105243_104921861 | 187 |
| 470 | 3300009148 | Ga0105243_10521583 | Ga0105243_105215831 | 187 |
| 471 | 3300009174 | Ga0105241_10000286 | Ga0105241_1000028613 | 187 |
| 472 | 3300009174 | Ga0105241_10000674 | Ga0105241_100006749 | 187 |
| 473 | 3300009174 | Ga0105241_10050739 | Ga0105241_100507392 | 187 |
| 474 | 3300009174 | Ga0105241_10078204 | Ga0105241_100782042 | 187 |
| 475 | 3300009174 | Ga0105241_10128490 | Ga0105241_101284902 | 187 |
| 476 | 3300009174 | Ga0105241_10445574 | Ga0105241_104455742 | 187 |
| 477 | 3300009174 | Ga0105241_10612534 | Ga0105241_106125341 | 187 |
| 478 | 3300009174 | Ga0105241_10701313 | Ga0105241_107013132 | 187 |
| 479 | 3300009176 | Ga0105242_10007239 | Ga0105242_100072394 | 187 |
| 480 | 3300009176 | Ga0105242_10057786 | Ga0105242_100577863 | 187 |
| 481 | 3300009176 | Ga0105242_10121029 | Ga0105242_101210292 | 187 |
| 482 | 3300009176 | Ga0105242_10249725 | Ga0105242_102497252 | 187 |
| 483 | 3300009176 | Ga0105242_10551545 | Ga0105242_105515452 | 187 |
| 484 | 3300009176 | Ga0105242_11457885 | Ga0105242_114578852 | 187 |
| 485 | 3300009177 | Ga0105248_10064189 | Ga0105248_100641894 | 187 |
| 486 | 3300009177 | Ga0105248_10276264 | Ga0105248_102762643 | 187 |
| 487 | 3300009177 | Ga0105248_10463890 | Ga0105248_104638902 | 187 |
| 488 | 3300009177 | Ga0105248_10841729 | Ga0105248_108417291 | 187 |
| 489 | 3300009545 | Ga0105237_10000528 | Ga0105237_1000052810 | 187 |
| 490 | 3300009545 | Ga0105237_10009236 | Ga0105237_100092364 | 187 |
| 491 | 3300009545 | Ga0105237_10018995 | Ga0105237_100189955 | 187 |
| 492 | 3300009545 | Ga0105237_10030026 | Ga0105237_100300263 | 187 |
| 493 | 3300009545 | Ga0105237_10557879 | Ga0105237_105578792 | 187 |
| 494 | 3300009551 | Ga0105238_10093340 | Ga0105238_100933403 | 187 |
| 495 | 3300009553 | Ga0105249_10000420 | Ga0105249_1000042028 | 187 |
| 496 | 3300009553 | Ga0105249_10004650 | Ga0105249_100046509 | 187 |
| 497 | 3300009553 | Ga0105249_10006252 | Ga0105249_100062526 | 187 |
| 498 | 3300009553 | Ga0105249_10007262 | Ga0105249_100072625 | 187 |
| 499 | 3300009553 | Ga0105249_10008839 | Ga0105249_100088393 | 187 |
| 500 | 3300009553 | Ga0105249_10155341 | Ga0105249_101553413 | 187 |
| 501 | 3300009553 | Ga0105249_10177873 | Ga0105249_101778732 | 187 |
| 502 | 3300009553 | Ga0105249_10216869 | Ga0105249_102168691 | 187 |
| 503 | 3300009553 | Ga0105249_10285716 | Ga0105249_102857162 | 187 |
| 504 | 3300009553 | Ga0105249_10565320 | Ga0105249_105653201 | 187 |
| 505 | 3300009553 | Ga0105249_10570393 | Ga0105249_105703932 | 187 |
| 506 | 3300009553 | Ga0105249_10611980 | Ga0105249_106119802 | 187 |
| 507 | 3300009553 | Ga0105249_11959575 | Ga0105249_119595751 | 187 |
| 508 | 3300010375 | Ga0105239_10000048 | Ga0105239_1000004843 | 187 |
| 509 | 3300010375 | Ga0105239_10013397 | Ga0105239_100133973 | 187 |
| 510 | 3300010375 | Ga0105239_10016535 | Ga0105239_100165359 | 187 |
| 511 | 3300010375 | Ga0105239_10044989 | Ga0105239_100449895 | 187 |
| 512 | 3300010375 | Ga0105239_10083913 | Ga0105239_100839131 | 187 |
| 513 | 3300010375 | Ga0105239_10117472 | Ga0105239_101174723 | 187 |
| 514 | 3300010375 | Ga0105239_10124064 | Ga0105239_101240642 | 187 |
| 515 | 3300010375 | Ga0105239_10655543 | Ga0105239_106555432 | 187 |
| 516 | 3300011119 | Ga0105246_10085274 | Ga0105246_100852742 | 187 |
| 517 | 3300011119 | Ga0105246_10253054 | Ga0105246_102530542 | 187 |
| 518 | 3300011119 | Ga0105246_10702653 | Ga0105246_107026532 | 187 |
| 519 | 3300011119 | Ga0105246_10793536 | Ga0105246_107935361 | 187 |
| 520 | 3300013100 | Ga0157373_10015305 | Ga0157373_100153052 | 187 |
| 521 | 3300013100 | Ga0157373_10024569 | Ga0157373_100245693 | 187 |
| 522 | 3300013100 | Ga0157373_10040694 | Ga0157373_100406941 | 187 |
| 523 | 3300013100 | Ga0157373_10135679 | Ga0157373_101356792 | 187 |
| 524 | 3300013100 | Ga0157373_10274084 | Ga0157373_102740842 | 187 |
| 525 | 3300013102 | Ga0157371_10009068 | Ga0157371_100090682 | 187 |
| 526 | 3300013102 | Ga0157371_10056386 | Ga0157371_100563862 | 187 |
| 527 | 3300013102 | Ga0157371_10166659 | Ga0157371_101666591 | 187 |
| 528 | 3300013102 | Ga0157371_10634494 | Ga0157371_106344941 | 187 |
| 529 | 3300013104 | Ga0157370_10031158 | Ga0157370_100311585 | 187 |
| 530 | 3300013104 | Ga0157370_10031443 | Ga0157370_100314432 | 187 |
| 531 | 3300013104 | Ga0157370_10175301 | Ga0157370_101753012 | 187 |
| 532 | 3300013104 | Ga0157370_10221700 | Ga0157370_102217002 | 187 |
| 533 | 3300013105 | Ga0157369_10010499 | Ga0157369_100104992 | 187 |
| 534 | 3300013105 | Ga0157369_10020813 | Ga0157369_100208132 | 187 |
| 535 | 3300013105 | Ga0157369_10217587 | Ga0157369_102175872 | 187 |
| 536 | 3300013105 | Ga0157369_10406897 | Ga0157369_104068972 | 187 |
| 537 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001256 | 187 |
| 538 | 3300013296 | Ga0157374_10000084 | Ga0157374_1000008410 | 187 |
| 539 | 3300013296 | Ga0157374_10010076 | Ga0157374_100100762 | 187 |
| 540 | 3300013296 | Ga0157374_10139672 | Ga0157374_101396721 | 187 |
| 541 | 3300013296 | Ga0157374_10237222 | Ga0157374_102372222 | 187 |
| 542 | 3300013296 | Ga0157374_10290382 | Ga0157374_102903822 | 187 |
| 543 | 3300013296 | Ga0157374_10314782 | Ga0157374_103147822 | 187 |
| 544 | 3300013296 | Ga0157374_10826950 | Ga0157374_108269501 | 187 |
| 545 | 3300013297 | Ga0157378_10001872 | Ga0157378_100018722 | 187 |
| 546 | 3300013297 | Ga0157378_10005024 | Ga0157378_100050246 | 187 |
| 547 | 3300013297 | Ga0157378_10016814 | Ga0157378_100168142 | 187 |
| 548 | 3300013297 | Ga0157378_10061629 | Ga0157378_100616293 | 187 |
| 549 | 3300013297 | Ga0157378_10068743 | Ga0157378_100687431 | 187 |
| 550 | 3300013297 | Ga0157378_10091452 | Ga0157378_100914522 | 187 |
| 551 | 3300013297 | Ga0157378_10093436 | Ga0157378_100934362 | 187 |
| 552 | 3300013297 | Ga0157378_10172003 | Ga0157378_101720032 | 187 |
| 553 | 3300013297 | Ga0157378_10300108 | Ga0157378_103001082 | 187 |
| 554 | 3300013297 | Ga0157378_10334558 | Ga0157378_103345581 | 187 |
| 555 | 3300013297 | Ga0157378_11191584 | Ga0157378_111915842 | 187 |
| 556 | 3300013306 | Ga0163162_10000113 | Ga0163162_1000011356 | 187 |
| 557 | 3300013306 | Ga0163162_10004460 | Ga0163162_100044605 | 187 |
| 558 | 3300013306 | Ga0163162_10005078 | Ga0163162_100050789 | 187 |
| 559 | 3300013306 | Ga0163162_10024349 | Ga0163162_100243492 | 187 |
| 560 | 3300013306 | Ga0163162_10147273 | Ga0163162_101472733 | 187 |
| 561 | 3300013306 | Ga0163162_10310025 | Ga0163162_103100252 | 187 |
| 562 | 3300013306 | Ga0163162_10332847 | Ga0163162_103328472 | 187 |
| 563 | 3300013306 | Ga0163162_10594102 | Ga0163162_105941022 | 187 |
| 564 | 3300013306 | Ga0163162_10773065 | Ga0163162_107730652 | 187 |
| 565 | 3300013306 | Ga0163162_10798082 | Ga0163162_107980822 | 187 |
| 566 | 3300013307 | Ga0157372_10001128 | Ga0157372_1000112819 | 187 |
| 567 | 3300013307 | Ga0157372_10017684 | Ga0157372_100176848 | 187 |
| 568 | 3300013307 | Ga0157372_10018926 | Ga0157372_100189268 | 187 |
| 569 | 3300013307 | Ga0157372_10028493 | Ga0157372_100284935 | 187 |
| 570 | 3300013307 | Ga0157372_10033034 | Ga0157372_100330343 | 187 |
| 571 | 3300013307 | Ga0157372_10034481 | Ga0157372_100344813 | 187 |
| 572 | 3300013307 | Ga0157372_10049030 | Ga0157372_100490302 | 187 |
| 573 | 3300013307 | Ga0157372_10125220 | Ga0157372_101252201 | 187 |
| 574 | 3300013307 | Ga0157372_10170040 | Ga0157372_101700403 | 187 |
| 575 | 3300013307 | Ga0157372_10189115 | Ga0157372_101891153 | 187 |
| 576 | 3300013307 | Ga0157372_10315694 | Ga0157372_103156942 | 187 |
| 577 | 3300013307 | Ga0157372_10330167 | Ga0157372_103301672 | 187 |
| 578 | 3300013307 | Ga0157372_10432757 | Ga0157372_104327573 | 187 |
| 579 | 3300013307 | Ga0157372_10636806 | Ga0157372_106368062 | 187 |
| 580 | 3300013307 | Ga0157372_10698212 | Ga0157372_106982121 | 187 |
| 581 | 3300013307 | Ga0157372_10864749 | Ga0157372_108647492 | 187 |
| 582 | 3300013307 | Ga0157372_10939323 | Ga0157372_109393231 | 187 |
| 583 | 3300013307 | Ga0157372_10941927 | Ga0157372_109419272 | 187 |
| 584 | 3300013307 | Ga0157372_12109109 | Ga0157372_121091091 | 187 |
| 585 | 3300013308 | Ga0157375_10000565 | Ga0157375_1000056523 | 187 |
| 586 | 3300013308 | Ga0157375_10008080 | Ga0157375_100080804 | 187 |
| 587 | 3300013308 | Ga0157375_10009333 | Ga0157375_100093333 | 187 |
| 588 | 3300013308 | Ga0157375_10039328 | Ga0157375_100393284 | 187 |
| 589 | 3300013308 | Ga0157375_10360794 | Ga0157375_103607942 | 187 |
| 590 | 3300013308 | Ga0157375_10710708 | Ga0157375_107107082 | 187 |
| 591 | 3300013308 | Ga0157375_11279325 | Ga0157375_112793251 | 187 |
| 592 | 3300013308 | Ga0157375_11848973 | Ga0157375_118489732 | 187 |
| 593 | 3300014325 | Ga0163163_10000332 | Ga0163163_1000033240 | 187 |
| 594 | 3300014325 | Ga0163163_10003608 | Ga0163163_100036088 | 187 |
| 595 | 3300014325 | Ga0163163_10178082 | Ga0163163_101780822 | 187 |
| 596 | 3300014325 | Ga0163163_10315331 | Ga0163163_103153312 | 187 |
| 597 | 3300014325 | Ga0163163_10680898 | Ga0163163_106808982 | 187 |
| 598 | 3300014325 | Ga0163163_10841096 | Ga0163163_108410962 | 187 |
| 599 | 3300014326 | Ga0157380_10076849 | Ga0157380_100768492 | 187 |
| 600 | 3300014326 | Ga0157380_10178350 | Ga0157380_101783502 | 187 |
| 601 | 3300014326 | Ga0157380_10618043 | Ga0157380_106180432 | 187 |
| 602 | 3300014745 | Ga0157377_10001951 | Ga0157377_100019512 | 187 |
| 603 | 3300014745 | Ga0157377_10012098 | Ga0157377_100120982 | 187 |
| 604 | 3300014745 | Ga0157377_10017126 | Ga0157377_100171264 | 187 |
| 605 | 3300014745 | Ga0157377_10024122 | Ga0157377_100241223 | 187 |
| 606 | 3300014745 | Ga0157377_10069632 | Ga0157377_100696322 | 187 |
| 607 | 3300014745 | Ga0157377_10171685 | Ga0157377_101716852 | 187 |
| 608 | 3300014745 | Ga0157377_10304935 | Ga0157377_103049352 | 187 |
| 609 | 3300014745 | Ga0157377_10406730 | Ga0157377_104067302 | 187 |
| 610 | 3300014745 | Ga0157377_10570048 | Ga0157377_105700481 | 187 |
| 611 | 3300014968 | Ga0157379_10000245 | Ga0157379_100002459 | 187 |
| 612 | 3300014968 | Ga0157379_10014342 | Ga0157379_100143424 | 187 |
| 613 | 3300014968 | Ga0157379_10068746 | Ga0157379_100687463 | 187 |
| 614 | 3300014968 | Ga0157379_10069217 | Ga0157379_100692172 | 187 |
| 615 | 3300014968 | Ga0157379_10147538 | Ga0157379_101475382 | 187 |
| 616 | 3300014968 | Ga0157379_10367538 | Ga0157379_103675382 | 187 |
| 617 | 3300014968 | Ga0157379_10546789 | Ga0157379_105467892 | 187 |
| 618 | 3300014968 | Ga0157379_10698722 | Ga0157379_106987221 | 187 |
| 619 | 3300014969 | Ga0157376_10004247 | Ga0157376_100042475 | 187 |
| 620 | 3300014969 | Ga0157376_10008507 | Ga0157376_100085077 | 187 |
| 621 | 3300014969 | Ga0157376_10010209 | Ga0157376_100102093 | 187 |
| 622 | 3300014969 | Ga0157376_10062591 | Ga0157376_100625912 | 187 |
| 623 | 3300014969 | Ga0157376_10137812 | Ga0157376_101378122 | 187 |
| 624 | 3300014969 | Ga0157376_10189803 | Ga0157376_101898033 | 187 |
| 625 | 3300017792 | Ga0163161_10002092 | Ga0163161_100020926 | 187 |
| 626 | 3300017792 | Ga0163161_10019847 | Ga0163161_100198472 | 187 |
| 627 | 3300017792 | Ga0163161_10050884 | Ga0163161_100508842 | 187 |
| 628 | 3300017792 | Ga0163161_10120757 | Ga0163161_101207572 | 187 |
| 629 | 3300017792 | Ga0163161_10201859 | Ga0163161_102018592 | 187 |
| 630 | 3300017792 | Ga0163161_10628652 | Ga0163161_106286521 | 187 |
| 631 | 3300025315 | Ga0207697_10016858 | Ga0207697_100168583 | 187 |
| 632 | 3300025315 | Ga0207697_10106645 | Ga0207697_101066452 | 187 |
| 633 | 3300025321 | Ga0207656_10001320 | Ga0207656_100013205 | 187 |
| 634 | 3300025321 | Ga0207656_10084856 | Ga0207656_100848563 | 187 |
| 635 | 3300025321 | Ga0207656_10182571 | Ga0207656_101825711 | 187 |
| 636 | 3300025893 | Ga0207682_10017385 | Ga0207682_100173853 | 187 |
| 637 | 3300025893 | Ga0207682_10030875 | Ga0207682_100308752 | 187 |
| 638 | 3300025893 | Ga0207682_10055276 | Ga0207682_100552761 | 187 |
| 639 | 3300025893 | Ga0207682_10082740 | Ga0207682_100827402 | 187 |
| 640 | 3300025900 | Ga0207710_10001046 | Ga0207710_100010464 | 187 |
| 641 | 3300025901 | Ga0207688_10091986 | Ga0207688_100919862 | 187 |
| 642 | 3300025901 | Ga0207688_10114170 | Ga0207688_101141701 | 187 |
| 643 | 3300025903 | Ga0207680_10000648 | Ga0207680_100006489 | 187 |
| 644 | 3300025903 | Ga0207680_10249473 | Ga0207680_102494731 | 187 |
| 645 | 3300025903 | Ga0207680_10722125 | Ga0207680_107221251 | 187 |
| 646 | 3300025904 | Ga0207647_10000282 | Ga0207647_1000028214 | 187 |
| 647 | 3300025904 | Ga0207647_10026305 | Ga0207647_100263052 | 187 |
| 648 | 3300025904 | Ga0207647_10098198 | Ga0207647_100981982 | 187 |
| 649 | 3300025904 | Ga0207647_10481369 | Ga0207647_104813691 | 187 |
| 650 | 3300025905 | Ga0207685_10266569 | Ga0207685_102665691 | 187 |
| 651 | 3300025907 | Ga0207645_10000378 | Ga0207645_1000037818 | 187 |
| 652 | 3300025907 | Ga0207645_10001750 | Ga0207645_1000175015 | 187 |
| 653 | 3300025907 | Ga0207645_10064892 | Ga0207645_100648922 | 187 |
| 654 | 3300025907 | Ga0207645_10142954 | Ga0207645_101429542 | 187 |
| 655 | 3300025908 | Ga0207643_10003255 | Ga0207643_100032559 | 187 |
| 656 | 3300025908 | Ga0207643_10006561 | Ga0207643_100065611 | 187 |
| 657 | 3300025908 | Ga0207643_10096130 | Ga0207643_100961302 | 187 |
| 658 | 3300025908 | Ga0207643_10399306 | Ga0207643_103993062 | 187 |
| 659 | 3300025909 | Ga0207705_10000717 | Ga0207705_100007178 | 187 |
| 660 | 3300025909 | Ga0207705_10310450 | Ga0207705_103104501 | 187 |
| 661 | 3300025909 | Ga0207705_10432917 | Ga0207705_104329172 | 187 |
| 662 | 3300025911 | Ga0207654_10000259 | Ga0207654_100002599 | 187 |
| 663 | 3300025911 | Ga0207654_10001858 | Ga0207654_100018588 | 187 |
| 664 | 3300025911 | Ga0207654_10236921 | Ga0207654_102369212 | 187 |
| 665 | 3300025911 | Ga0207654_10502640 | Ga0207654_105026401 | 187 |
| 666 | 3300025912 | Ga0207707_10064209 | Ga0207707_100642095 | 187 |
| 667 | 3300025913 | Ga0207695_10000071 | Ga0207695_10000071203 | 187 |
| 668 | 3300025913 | Ga0207695_10003138 | Ga0207695_1000313812 | 187 |
| 669 | 3300025913 | Ga0207695_10151543 | Ga0207695_101515432 | 187 |
| 670 | 3300025913 | Ga0207695_10402521 | Ga0207695_104025212 | 187 |
| 671 | 3300025914 | Ga0207671_10001584 | Ga0207671_1000158417 | 187 |
| 672 | 3300025914 | Ga0207671_10001605 | Ga0207671_1000160519 | 187 |
| 673 | 3300025914 | Ga0207671_10011203 | Ga0207671_100112034 | 187 |
| 674 | 3300025914 | Ga0207671_10011315 | Ga0207671_100113154 | 187 |
| 675 | 3300025914 | Ga0207671_10011494 | Ga0207671_100114943 | 187 |
| 676 | 3300025914 | Ga0207671_10024824 | Ga0207671_100248243 | 187 |
| 677 | 3300025917 | Ga0207660_10595829 | Ga0207660_105958291 | 187 |
| 678 | 3300025918 | Ga0207662_10031022 | Ga0207662_100310222 | 187 |
| 679 | 3300025918 | Ga0207662_10201020 | Ga0207662_102010202 | 187 |
| 680 | 3300025919 | Ga0207657_10001201 | Ga0207657_1000120120 | 187 |
| 681 | 3300025919 | Ga0207657_10224636 | Ga0207657_102246361 | 187 |
| 682 | 3300025920 | Ga0207649_10001403 | Ga0207649_1000140312 | 187 |
| 683 | 3300025920 | Ga0207649_10048281 | Ga0207649_100482812 | 187 |
| 684 | 3300025920 | Ga0207649_10155754 | Ga0207649_101557542 | 187 |
| 685 | 3300025920 | Ga0207649_10201995 | Ga0207649_102019952 | 187 |
| 686 | 3300025921 | Ga0207652_10125949 | Ga0207652_101259493 | 187 |
| 687 | 3300025921 | Ga0207652_10202896 | Ga0207652_102028961 | 187 |
| 688 | 3300025923 | Ga0207681_10015733 | Ga0207681_100157333 | 187 |
| 689 | 3300025923 | Ga0207681_10160043 | Ga0207681_101600431 | 187 |
| 690 | 3300025923 | Ga0207681_10196981 | Ga0207681_101969812 | 187 |
| 691 | 3300025923 | Ga0207681_10677541 | Ga0207681_106775411 | 187 |
| 692 | 3300025924 | Ga0207694_10015117 | Ga0207694_100151173 | 187 |
| 693 | 3300025924 | Ga0207694_10126588 | Ga0207694_101265882 | 187 |
| 694 | 3300025925 | Ga0207650_10002349 | Ga0207650_100023498 | 187 |
| 695 | 3300025925 | Ga0207650_10015855 | Ga0207650_100158552 | 187 |
| 696 | 3300025925 | Ga0207650_10073238 | Ga0207650_100732384 | 187 |
| 697 | 3300025925 | Ga0207650_10203655 | Ga0207650_102036552 | 187 |
| 698 | 3300025925 | Ga0207650_10508621 | Ga0207650_105086212 | 187 |
| 699 | 3300025925 | Ga0207650_10530879 | Ga0207650_105308791 | 187 |
| 700 | 3300025925 | Ga0207650_10708065 | Ga0207650_107080651 | 187 |
| 701 | 3300025926 | Ga0207659_10012507 | Ga0207659_100125074 | 187 |
| 702 | 3300025926 | Ga0207659_10016982 | Ga0207659_100169824 | 187 |
| 703 | 3300025926 | Ga0207659_10059936 | Ga0207659_100599361 | 187 |
| 704 | 3300025926 | Ga0207659_10079825 | Ga0207659_100798252 | 187 |
| 705 | 3300025926 | Ga0207659_10237656 | Ga0207659_102376562 | 187 |
| 706 | 3300025926 | Ga0207659_10296936 | Ga0207659_102969361 | 187 |
| 707 | 3300025926 | Ga0207659_10321875 | Ga0207659_103218752 | 187 |
| 708 | 3300025926 | Ga0207659_10793781 | Ga0207659_107937812 | 187 |
| 709 | 3300025926 | Ga0207659_11044438 | Ga0207659_110444381 | 187 |
| 710 | 3300025927 | Ga0207687_10558495 | Ga0207687_105584952 | 187 |
| 711 | 3300025931 | Ga0207644_10193968 | Ga0207644_101939681 | 187 |
| 712 | 3300025931 | Ga0207644_10366810 | Ga0207644_103668101 | 187 |
| 713 | 3300025931 | Ga0207644_10433588 | Ga0207644_104335882 | 187 |
| 714 | 3300025931 | Ga0207644_10437842 | Ga0207644_104378422 | 187 |
| 715 | 3300025931 | Ga0207644_10691384 | Ga0207644_106913841 | 187 |
| 716 | 3300025932 | Ga0207690_10011658 | Ga0207690_100116583 | 187 |
| 717 | 3300025932 | Ga0207690_10392426 | Ga0207690_103924261 | 187 |
| 718 | 3300025933 | Ga0207706_10014988 | Ga0207706_100149887 | 187 |
| 719 | 3300025933 | Ga0207706_10019835 | Ga0207706_100198358 | 187 |
| 720 | 3300025933 | Ga0207706_10063987 | Ga0207706_100639873 | 187 |
| 721 | 3300025933 | Ga0207706_10111772 | Ga0207706_101117722 | 187 |
| 722 | 3300025933 | Ga0207706_10530618 | Ga0207706_105306182 | 187 |
| 723 | 3300025933 | Ga0207706_10739502 | Ga0207706_107395021 | 187 |
| 724 | 3300025933 | Ga0207706_10995053 | Ga0207706_109950531 | 187 |
| 725 | 3300025934 | Ga0207686_10002728 | Ga0207686_100027286 | 187 |
| 726 | 3300025934 | Ga0207686_10184808 | Ga0207686_101848082 | 187 |
| 727 | 3300025934 | Ga0207686_10253974 | Ga0207686_102539741 | 187 |
| 728 | 3300025934 | Ga0207686_10977059 | Ga0207686_109770591 | 187 |
| 729 | 3300025935 | Ga0207709_10033145 | Ga0207709_100331452 | 187 |
| 730 | 3300025935 | Ga0207709_10349223 | Ga0207709_103492232 | 187 |
| 731 | 3300025935 | Ga0207709_10882657 | Ga0207709_108826571 | 187 |
| 732 | 3300025936 | Ga0207670_10010013 | Ga0207670_100100132 | 187 |
| 733 | 3300025936 | Ga0207670_10020775 | Ga0207670_100207753 | 187 |
| 734 | 3300025936 | Ga0207670_10077464 | Ga0207670_100774643 | 187 |
| 735 | 3300025936 | Ga0207670_10136811 | Ga0207670_101368112 | 187 |
| 736 | 3300025936 | Ga0207670_10139113 | Ga0207670_101391132 | 187 |
| 737 | 3300025936 | Ga0207670_10281808 | Ga0207670_102818082 | 187 |
| 738 | 3300025936 | Ga0207670_10483086 | Ga0207670_104830861 | 187 |
| 739 | 3300025936 | Ga0207670_11077491 | Ga0207670_110774911 | 187 |
| 740 | 3300025937 | Ga0207669_10013132 | Ga0207669_100131324 | 187 |
| 741 | 3300025937 | Ga0207669_10476034 | Ga0207669_104760341 | 187 |
| 742 | 3300025938 | Ga0207704_10035825 | Ga0207704_100358254 | 187 |
| 743 | 3300025938 | Ga0207704_10062612 | Ga0207704_100626123 | 187 |
| 744 | 3300025938 | Ga0207704_10085916 | Ga0207704_100859162 | 187 |
| 745 | 3300025938 | Ga0207704_10145587 | Ga0207704_101455872 | 187 |
| 746 | 3300025938 | Ga0207704_10374304 | Ga0207704_103743042 | 187 |
| 747 | 3300025938 | Ga0207704_10585272 | Ga0207704_105852722 | 187 |
| 748 | 3300025938 | Ga0207704_10644324 | Ga0207704_106443241 | 187 |
| 749 | 3300025940 | Ga0207691_10000227 | Ga0207691_1000022735 | 187 |
| 750 | 3300025940 | Ga0207691_10018303 | Ga0207691_100183038 | 187 |
| 751 | 3300025940 | Ga0207691_10019517 | Ga0207691_100195176 | 187 |
| 752 | 3300025940 | Ga0207691_10023073 | Ga0207691_100230732 | 187 |
| 753 | 3300025940 | Ga0207691_10070385 | Ga0207691_100703852 | 187 |
| 754 | 3300025940 | Ga0207691_10473036 | Ga0207691_104730362 | 187 |
| 755 | 3300025941 | Ga0207711_10593479 | Ga0207711_105934791 | 187 |
| 756 | 3300025942 | Ga0207689_10004619 | Ga0207689_100046193 | 187 |
| 757 | 3300025942 | Ga0207689_10005259 | Ga0207689_100052597 | 187 |
| 758 | 3300025942 | Ga0207689_10005402 | Ga0207689_100054026 | 187 |
| 759 | 3300025942 | Ga0207689_10012962 | Ga0207689_100129624 | 187 |
| 760 | 3300025942 | Ga0207689_10052909 | Ga0207689_100529092 | 187 |
| 761 | 3300025942 | Ga0207689_10081387 | Ga0207689_100813873 | 187 |
| 762 | 3300025942 | Ga0207689_10101900 | Ga0207689_101019003 | 187 |
| 763 | 3300025942 | Ga0207689_10293775 | Ga0207689_102937752 | 187 |
| 764 | 3300025942 | Ga0207689_10395411 | Ga0207689_103954112 | 187 |
| 765 | 3300025942 | Ga0207689_10652924 | Ga0207689_106529241 | 187 |
| 766 | 3300025942 | Ga0207689_10965166 | Ga0207689_109651661 | 187 |
| 767 | 3300025944 | Ga0207661_10003913 | Ga0207661_100039133 | 187 |
| 768 | 3300025944 | Ga0207661_10005361 | Ga0207661_100053615 | 187 |
| 769 | 3300025944 | Ga0207661_10011467 | Ga0207661_100114674 | 187 |
| 770 | 3300025944 | Ga0207661_10052051 | Ga0207661_100520514 | 187 |
| 771 | 3300025944 | Ga0207661_10084855 | Ga0207661_100848553 | 187 |
| 772 | 3300025944 | Ga0207661_10099900 | Ga0207661_100999001 | 187 |
| 773 | 3300025944 | Ga0207661_10218416 | Ga0207661_102184162 | 187 |
| 774 | 3300025944 | Ga0207661_10220429 | Ga0207661_102204292 | 187 |
| 775 | 3300025945 | Ga0207679_10000866 | Ga0207679_1000086613 | 187 |
| 776 | 3300025945 | Ga0207679_10148306 | Ga0207679_101483062 | 187 |
| 777 | 3300025945 | Ga0207679_10157852 | Ga0207679_101578523 | 187 |
| 778 | 3300025945 | Ga0207679_10294695 | Ga0207679_102946952 | 187 |
| 779 | 3300025945 | Ga0207679_10759619 | Ga0207679_107596191 | 187 |
| 780 | 3300025945 | Ga0207679_10829787 | Ga0207679_108297871 | 187 |
| 781 | 3300025949 | Ga0207667_10000177 | Ga0207667_1000017750 | 187 |
| 782 | 3300025949 | Ga0207667_10045605 | Ga0207667_100456054 | 187 |
| 783 | 3300025949 | Ga0207667_10117097 | Ga0207667_101170971 | 187 |
| 784 | 3300025949 | Ga0207667_10178273 | Ga0207667_101782733 | 187 |
| 785 | 3300025949 | Ga0207667_10208610 | Ga0207667_102086102 | 187 |
| 786 | 3300025960 | Ga0207651_10006597 | Ga0207651_100065974 | 187 |
| 787 | 3300025960 | Ga0207651_10035717 | Ga0207651_100357171 | 187 |
| 788 | 3300025960 | Ga0207651_10075671 | Ga0207651_100756711 | 187 |
| 789 | 3300025960 | Ga0207651_10094555 | Ga0207651_100945552 | 187 |
| 790 | 3300025960 | Ga0207651_10111969 | Ga0207651_101119692 | 187 |
| 791 | 3300025960 | Ga0207651_10131738 | Ga0207651_101317383 | 187 |
| 792 | 3300025960 | Ga0207651_10210006 | Ga0207651_102100061 | 187 |
| 793 | 3300025960 | Ga0207651_10250091 | Ga0207651_102500912 | 187 |
| 794 | 3300025960 | Ga0207651_10446132 | Ga0207651_104461322 | 187 |
| 795 | 3300025960 | Ga0207651_10716179 | Ga0207651_107161792 | 187 |
| 796 | 3300025960 | Ga0207651_10837462 | Ga0207651_108374621 | 187 |
| 797 | 3300025961 | Ga0207712_10023170 | Ga0207712_100231705 | 187 |
| 798 | 3300025961 | Ga0207712_10053607 | Ga0207712_100536071 | 187 |
| 799 | 3300025961 | Ga0207712_10053644 | Ga0207712_100536443 | 187 |
| 800 | 3300025961 | Ga0207712_10061186 | Ga0207712_100611863 | 187 |
| 801 | 3300025961 | Ga0207712_10076648 | Ga0207712_100766482 | 187 |
| 802 | 3300025961 | Ga0207712_10111513 | Ga0207712_101115132 | 187 |
| 803 | 3300025961 | Ga0207712_10117017 | Ga0207712_101170173 | 187 |
| 804 | 3300025961 | Ga0207712_10120443 | Ga0207712_101204433 | 187 |
| 805 | 3300025961 | Ga0207712_10805608 | Ga0207712_108056081 | 187 |
| 806 | 3300025961 | Ga0207712_11112258 | Ga0207712_111122581 | 187 |
| 807 | 3300025972 | Ga0207668_10000679 | Ga0207668_100006792 | 187 |
| 808 | 3300025972 | Ga0207668_10301533 | Ga0207668_103015332 | 187 |
| 809 | 3300025972 | Ga0207668_10890313 | Ga0207668_108903131 | 187 |
| 810 | 3300025981 | Ga0207640_10163792 | Ga0207640_101637922 | 187 |
| 811 | 3300025981 | Ga0207640_10242161 | Ga0207640_102421612 | 187 |
| 812 | 3300025981 | Ga0207640_10312204 | Ga0207640_103122042 | 187 |
| 813 | 3300025981 | Ga0207640_10337008 | Ga0207640_103370081 | 187 |
| 814 | 3300025981 | Ga0207640_10407162 | Ga0207640_104071622 | 187 |
| 815 | 3300025981 | Ga0207640_10846054 | Ga0207640_108460542 | 187 |
| 816 | 3300025986 | Ga0207658_10000176 | Ga0207658_1000017642 | 187 |
| 817 | 3300025986 | Ga0207658_10062740 | Ga0207658_100627403 | 187 |
| 818 | 3300025986 | Ga0207658_10183778 | Ga0207658_101837782 | 187 |
| 819 | 3300025986 | Ga0207658_10349102 | Ga0207658_103491022 | 187 |
| 820 | 3300025986 | Ga0207658_10977550 | Ga0207658_109775501 | 187 |
| 821 | 3300026023 | Ga0207677_10004540 | Ga0207677_100045408 | 187 |
| 822 | 3300026023 | Ga0207677_10020044 | Ga0207677_100200444 | 187 |
| 823 | 3300026023 | Ga0207677_10087350 | Ga0207677_100873502 | 187 |
| 824 | 3300026023 | Ga0207677_10160935 | Ga0207677_101609351 | 187 |
| 825 | 3300026023 | Ga0207677_10221271 | Ga0207677_102212712 | 187 |
| 826 | 3300026023 | Ga0207677_10284267 | Ga0207677_102842671 | 187 |
| 827 | 3300026035 | Ga0207703_10006506 | Ga0207703_100065065 | 187 |
| 828 | 3300026035 | Ga0207703_10009195 | Ga0207703_100091952 | 187 |
| 829 | 3300026035 | Ga0207703_10079409 | Ga0207703_100794093 | 187 |
| 830 | 3300026035 | Ga0207703_10265000 | Ga0207703_102650002 | 187 |
| 831 | 3300026035 | Ga0207703_10361609 | Ga0207703_103616091 | 187 |
| 832 | 3300026035 | Ga0207703_10646556 | Ga0207703_106465561 | 187 |
| 833 | 3300026035 | Ga0207703_10974357 | Ga0207703_109743571 | 187 |
| 834 | 3300026041 | Ga0207639_10003909 | Ga0207639_100039093 | 187 |
| 835 | 3300026041 | Ga0207639_10004963 | Ga0207639_100049639 | 187 |
| 836 | 3300026041 | Ga0207639_10091444 | Ga0207639_100914442 | 187 |
| 837 | 3300026041 | Ga0207639_10115704 | Ga0207639_101157043 | 187 |
| 838 | 3300026041 | Ga0207639_10137462 | Ga0207639_101374621 | 187 |
| 839 | 3300026041 | Ga0207639_10344487 | Ga0207639_103444872 | 187 |
| 840 | 3300026041 | Ga0207639_10474254 | Ga0207639_104742541 | 187 |
| 841 | 3300026067 | Ga0207678_10040176 | Ga0207678_100401763 | 187 |
| 842 | 3300026078 | Ga0207702_10168646 | Ga0207702_101686461 | 187 |
| 843 | 3300026078 | Ga0207702_10183994 | Ga0207702_101839942 | 187 |
| 844 | 3300026088 | Ga0207641_10000631 | Ga0207641_100006316 | 187 |
| 845 | 3300026088 | Ga0207641_10001151 | Ga0207641_1000115117 | 187 |
| 846 | 3300026088 | Ga0207641_10002208 | Ga0207641_100022089 | 187 |
| 847 | 3300026088 | Ga0207641_10037605 | Ga0207641_100376055 | 187 |
| 848 | 3300026088 | Ga0207641_10100743 | Ga0207641_101007432 | 187 |
| 849 | 3300026088 | Ga0207641_10330327 | Ga0207641_103303272 | 187 |
| 850 | 3300026088 | Ga0207641_10356408 | Ga0207641_103564082 | 187 |
| 851 | 3300026089 | Ga0207648_10001692 | Ga0207648_1000169214 | 187 |
| 852 | 3300026089 | Ga0207648_10002605 | Ga0207648_1000260511 | 187 |
| 853 | 3300026089 | Ga0207648_10009064 | Ga0207648_100090644 | 187 |
| 854 | 3300026089 | Ga0207648_10076896 | Ga0207648_100768963 | 187 |
| 855 | 3300026089 | Ga0207648_10098855 | Ga0207648_100988553 | 187 |
| 856 | 3300026089 | Ga0207648_10137595 | Ga0207648_101375952 | 187 |
| 857 | 3300026089 | Ga0207648_10248623 | Ga0207648_102486233 | 187 |
| 858 | 3300026095 | Ga0207676_10005000 | Ga0207676_100050003 | 187 |
| 859 | 3300026095 | Ga0207676_10057114 | Ga0207676_100571144 | 187 |
| 860 | 3300026095 | Ga0207676_10065222 | Ga0207676_100652223 | 187 |
| 861 | 3300026095 | Ga0207676_10213664 | Ga0207676_102136642 | 187 |
| 862 | 3300026095 | Ga0207676_10215721 | Ga0207676_102157212 | 187 |
| 863 | 3300026095 | Ga0207676_10233315 | Ga0207676_102333152 | 187 |
| 864 | 3300026095 | Ga0207676_10283830 | Ga0207676_102838302 | 187 |
| 865 | 3300026095 | Ga0207676_10559975 | Ga0207676_105599751 | 187 |
| 866 | 3300026095 | Ga0207676_10561881 | Ga0207676_105618812 | 187 |
| 867 | 3300026095 | Ga0207676_10648211 | Ga0207676_106482112 | 187 |
| 868 | 3300026095 | Ga0207676_10819128 | Ga0207676_108191281 | 187 |
| 869 | 3300026095 | Ga0207676_10866019 | Ga0207676_108660191 | 187 |
| 870 | 3300026116 | Ga0207674_10006874 | Ga0207674_1000687412 | 187 |
| 871 | 3300026116 | Ga0207674_10007431 | Ga0207674_100074319 | 187 |
| 872 | 3300026116 | Ga0207674_10053745 | Ga0207674_100537454 | 187 |
| 873 | 3300026116 | Ga0207674_10102570 | Ga0207674_101025703 | 187 |
| 874 | 3300026116 | Ga0207674_10116330 | Ga0207674_101163302 | 187 |
| 875 | 3300026116 | Ga0207674_10122120 | Ga0207674_101221202 | 187 |
| 876 | 3300026116 | Ga0207674_10127989 | Ga0207674_101279892 | 187 |
| 877 | 3300026116 | Ga0207674_10296970 | Ga0207674_102969702 | 187 |
| 878 | 3300026116 | Ga0207674_10317100 | Ga0207674_103171002 | 187 |
| 879 | 3300026116 | Ga0207674_10509988 | Ga0207674_105099882 | 187 |
| 880 | 3300026116 | Ga0207674_10575690 | Ga0207674_105756901 | 187 |
| 881 | 3300026116 | Ga0207674_10935994 | Ga0207674_109359942 | 187 |
| 882 | 3300026118 | Ga0207675_100007646 | Ga0207675_1000076467 | 187 |
| 883 | 3300026118 | Ga0207675_100019361 | Ga0207675_1000193613 | 187 |
| 884 | 3300026118 | Ga0207675_100037348 | Ga0207675_1000373482 | 187 |
| 885 | 3300026118 | Ga0207675_100040464 | Ga0207675_1000404643 | 187 |
| 886 | 3300026118 | Ga0207675_100077392 | Ga0207675_1000773923 | 187 |
| 887 | 3300026118 | Ga0207675_100115439 | Ga0207675_1001154393 | 187 |
| 888 | 3300026118 | Ga0207675_100118493 | Ga0207675_1001184933 | 187 |
| 889 | 3300026121 | Ga0207683_10002881 | Ga0207683_100028817 | 187 |
| 890 | 3300026121 | Ga0207683_10036466 | Ga0207683_100364663 | 187 |
| 891 | 3300026142 | Ga0207698_10026276 | Ga0207698_100262763 | 187 |
| 892 | 3300026142 | Ga0207698_10058347 | Ga0207698_100583475 | 187 |
| 893 | 3300026142 | Ga0207698_10338777 | Ga0207698_103387772 | 187 |
| 894 | 3300026142 | Ga0207698_10555401 | Ga0207698_105554012 | 187 |
| 895 | 3300026142 | Ga0207698_10719298 | Ga0207698_107192982 | 187 |
| 896 | 3300026142 | Ga0207698_10913275 | Ga0207698_109132751 | 187 |
| 897 | 3300027471 | Ga0209995_1039129 | Ga0209995_10391292 | 187 |
| 898 | 3300027907 | Ga0207428_10030362 | Ga0207428_100303623 | 187 |
| 899 | 3300027907 | Ga0207428_10750218 | Ga0207428_107502181 | 187 |
| 900 | 3300028379 | Ga0268266_10003258 | Ga0268266_100032588 | 187 |
| 901 | 3300028379 | Ga0268266_10253760 | Ga0268266_102537602 | 187 |
| 902 | 3300028380 | Ga0268265_10004320 | Ga0268265_100043202 | 187 |
| 903 | 3300028380 | Ga0268265_10380226 | Ga0268265_103802262 | 187 |
| 904 | 3300028380 | Ga0268265_10879310 | Ga0268265_108793101 | 187 |
| 905 | 3300028381 | Ga0268264_10002823 | Ga0268264_100028238 | 187 |
| 906 | 3300028381 | Ga0268264_10003175 | Ga0268264_100031753 | 187 |
| 907 | 3300028381 | Ga0268264_10017151 | Ga0268264_100171514 | 187 |
| 908 | 3300028381 | Ga0268264_10034103 | Ga0268264_100341032 | 187 |
| 909 | 3300028381 | Ga0268264_10447713 | Ga0268264_104477132 | 187 |
| 910 | 3300028381 | Ga0268264_10552878 | Ga0268264_105528782 | 187 |
| 911 | 3300028794 | Ga0307515_10000072 | Ga0307515_1000007284 | 187 |
| 912 | 3300031456 | Ga0307513_10277312 | Ga0307513_102773121 | 187 |
| 913 | 3300031507 | Ga0307509_10111956 | Ga0307509_101119562 | 187 |
| 914 | 3300031507 | Ga0307509_10134744 | Ga0307509_101347443 | 187 |
| 915 | 3300031595 | Ga0265313_10098515 | Ga0265313_100985153 | 187 |
| 916 | 3300031731 | Ga0307405_10039704 | Ga0307405_100397043 | 187 |
| 917 | 3300031824 | Ga0307413_10046411 | Ga0307413_100464112 | 187 |
| 918 | 3300031852 | Ga0307410_10127969 | Ga0307410_101279692 | 187 |
| 919 | 3300031901 | Ga0307406_11073751 | Ga0307406_110737511 | 187 |
| 920 | 3300031903 | Ga0307407_10109982 | Ga0307407_101099822 | 187 |
| 921 | 3300031903 | Ga0307407_10585515 | Ga0307407_105855151 | 187 |
| 922 | 3300031911 | Ga0307412_10629936 | Ga0307412_106299362 | 187 |
| 923 | 3300031911 | Ga0307412_11376664 | Ga0307412_113766641 | 187 |
| 924 | 3300031995 | Ga0307409_100142886 | Ga0307409_1001428863 | 187 |
| 925 | 3300032002 | Ga0307416_100152767 | Ga0307416_1001527672 | 187 |
| 926 | 3300032004 | Ga0307414_10594060 | Ga0307414_105940601 | 187 |
| 927 | 3300032005 | Ga0307411_10064618 | Ga0307411_100646183 | 187 |
| 928 | 3300032126 | Ga0307415_100095007 | Ga0307415_1000950073 | 187 |
| 929 | 3300032126 | Ga0307415_100340303 | Ga0307415_1003403032 | 187 |
| 930 | 3300032126 | Ga0307415_100734209 | Ga0307415_1007342092 | 187 |
| 931 | 3300033180 | Ga0307510_10000091 | Ga0307510_1000009164 | 187 |
| 932 | 3300035092 | Ga0373952_0131773 | Ga0373952_0131773_61_627 | 187 |
| 933 | 3300035111 | Ga0373923_0035099 | Ga0373923_0035099_425_991 | 187 |
| 934 | 3300035725 | Ga0373947_0463711 | Ga0373947_0463711_106_672 | 187 |
| 935 | 3300036401 | Ga0373937_0038798 | Ga0373937_0038798_3161_3727 | 187 |
| 936 | 3300037068 | Ga0373925_0973541 | Ga0373925_0973541_121_687 | 187 |
| 937 | 3300037418 | Ga0395900_0060995 | Ga0395900_0060995_170_736 | 187 |
| 938 | 3300037418 | Ga0395900_0258219 | Ga0395900_0258219_609_1175 | 187 |
| 939 | 3300037418 | Ga0395900_0543223 | Ga0395900_0543223_535_1098 | 187 |
| 940 | 3300037471 | Ga0395905_0009263 | Ga0395905_0009263_5512_6078 | 187 |
| 941 | 3300037471 | Ga0395905_0032320 | Ga0395905_0032320_391_957 | 187 |
| 942 | 3300037471 | Ga0395905_0078586 | Ga0395905_0078586_2443_3009 | 187 |
| 943 | 3300037471 | Ga0395905_0267038 | Ga0395905_0267038_858_1424 | 187 |
| 944 | 3300037471 | Ga0395905_0963051 | Ga0395905_0963051_33_599 | 187 |
| 945 | 3300037471 | Ga0395905_1059981 | Ga0395905_1059981_124_690 | 187 |
| 946 | 3300039437 | Ga0436365_1285215 | Ga0436365_1285215_10262_10825 | 187 |
| 947 | 3300039450 | Ga0436363_0330490 | Ga0436363_0330490_484_1050 | 187 |
| 948 | 3300041460 | Ga0451802_1218311 | Ga0451802_1218311_75_638 | 187 |
| 949 | 3300041512 | Ga0451853_3841961 | Ga0451853_3841961_810_1376 | 187 |
| 950 | 3300041997 | Ga0439431_0090559 | Ga0439431_0090559_75_638 | 187 |
| 951 | 3300042001 | Ga0439441_004375 | Ga0439441_004375_1096_1662 | 187 |
| 952 | 3300042001 | Ga0439441_024579 | Ga0439441_024579_139_705 | 187 |
| 953 | 3300042003 | Ga0439443_022276 | Ga0439443_022276_93_659 | 187 |
| 954 | 3300042007 | Ga0439449_0002804 | Ga0439449_0002804_490_1056 | 187 |
| 955 | 3300042014 | Ga0439457_031175 | Ga0439457_031175_169_735 | 187 |
| 956 | 3300042439 | Ga0439464_0097162 | Ga0439464_0097162_216_782 | 187 |
| 957 | 3300042876 | Ga0451577_0073865 | Ga0451577_0073865_1991_2554 | 187 |
| 958 | 3300044656 | Ga0466969_0001246 | Ga0466969_0001246_8836_9399 | 187 |
| 959 | 3300044656 | Ga0466969_0071945 | Ga0466969_0071945_299_862 | 187 |
| 960 | 3300044658 | Ga0466972_0000013 | Ga0466972_0000013_89646_90209 | 187 |
| 961 | 3300044658 | Ga0466972_0370278 | Ga0466972_0370278_71_637 | 187 |
| 962 | 3300044683 | Ga0466965_0198393 | Ga0466965_0198393_10_573 | 187 |
| 963 | 3300044684 | Ga0466966_0000045 | Ga0466966_0000045_70115_70678 | 187 |
| 964 | 3300044684 | Ga0466966_0066006 | Ga0466966_0066006_628_1191 | 187 |
| 965 | 3300044719 | Ga0466971_0145642 | Ga0466971_0145642_371_934 | 187 |
| 966 | 3300044765 | Ga0466970_0001156 | Ga0466970_0001156_4506_5069 | 187 |
| 967 | 3300044842 | Ga0466957_0000070 | Ga0466957_0000070_38888_39451 | 187 |
| 968 | 3300044842 | Ga0466957_0591986 | Ga0466957_0591986_38_604 | 187 |
| 969 | 3300045049 | Ga0466959_0000023 | Ga0466959_0000023_76298_76861 | 187 |
| 970 | 3300045049 | Ga0466959_0008989 | Ga0466959_0008989_5515_6078 | 187 |
| 971 | 3300045049 | Ga0466959_0125397 | Ga0466959_0125397_72_638 | 187 |
| 972 | 3300045051 | Ga0451576_1047326 | Ga0451576_1047326_99_665 | 187 |
| 973 | 3300045976 | Ga0466967_0123268 | Ga0466967_0123268_116_682 | 187 |
| 974 | 3300046507 | Ga0495606_0004249 | Ga0495606_0004249_9716_10279 | 187 |
| 975 | 3300046516 | Ga0495628_0112891 | Ga0495628_0112891_50_616 | 187 |
| 976 | 3300046522 | Ga0495643_0050744 | Ga0495643_0050744_251_814 | 187 |
| 977 | 3300046536 | Ga0495587_0051505 | Ga0495587_0051505_144_710 | 187 |
| 978 | 3300046648 | Ga0495611_0045973 | Ga0495611_0045973_50_616 | 187 |
| 979 | 3300046660 | Ga0495625_0436769 | Ga0495625_0436769_19_582 | 187 |
| 980 | 3300046675 | Ga0495657_0278633 | Ga0495657_0278633_376_942 | 187 |
| 981 | 3300046689 | Ga0495613_0367838 | Ga0495613_0367838_376_942 | 187 |
| 982 | 3300047317 | Ga0495604_0449793 | Ga0495604_0449793_117_683 | 187 |
| 983 | 3300047319 | Ga0495674_0096356 | Ga0495674_0096356_1215_1784 | 187 |
| 984 | 3300047320 | Ga0495672_0015619 | Ga0495672_0015619_4004_4570 | 187 |
| 985 | 3300047321 | Ga0495676_0293233 | Ga0495676_0293233_259_825 | 187 |
| 986 | 3300047321 | Ga0495676_0578522 | Ga0495676_0578522_23_589 | 187 |
| 987 | 3300047322 | Ga0495680_0218622 | Ga0495680_0218622_672_1238 | 187 |
| 988 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_396074_396637 | 187 |
| 989 | 3300047471 | Ga0495684_0226719 | Ga0495684_0226719_146_712 | 187 |
| 990 | 3300048908 | Ga0496105_0159201 | Ga0496105_0159201_830_1399 | 187 |
| 991 | 3300048912 | Ga0496109_0311902 | Ga0496109_0311902_769_1362 | 187 |
| 992 | 3300048913 | Ga0496110_0171267 | Ga0496110_0171267_1165_1731 | 187 |
| 993 | 3300048913 | Ga0496110_0180830 | Ga0496110_0180830_895_1461 | 187 |
| 994 | 3300049521 | Ga0501298_009953 | Ga0501298_009953_596_1162 | 187 |
| 995 | 3300049524 | Ga0501301_016588 | Ga0501301_016588_71_637 | 187 |
| 996 | 3300049568 | Ga0501031_0287330 | Ga0501031_0287330_401_967 | 187 |
| 997 | 3300049571 | Ga0501034_0022717 | Ga0501034_0022717_4503_5069 | 187 |
| 998 | 3300049571 | Ga0501034_0558505 | Ga0501034_0558505_306_872 | 187 |
| 999 | 3300049572 | Ga0501036_0154076 | Ga0501036_0154076_345_911 | 187 |
| 1000 | 3300049573 | Ga0501037_0146479 | Ga0501037_0146479_1020_1589 | 187 |
| 1001 | 3300049574 | Ga0501038_0019364 | Ga0501038_0019364_5020_5586 | 187 |
| 1002 | 3300049574 | Ga0501038_0370341 | Ga0501038_0370341_238_804 | 187 |
| 1003 | 3300049579 | Ga0501043_0003765 | Ga0501043_0003765_238_804 | 187 |
| 1004 | 3300049579 | Ga0501043_0024677 | Ga0501043_0024677_2669_3235 | 187 |
| 1005 | 3300049579 | Ga0501043_0038841 | Ga0501043_0038841_2945_3511 | 187 |
| 1006 | 3300049580 | Ga0501046_0081476 | Ga0501046_0081476_1709_2275 | 187 |
| 1007 | 3300049580 | Ga0501046_0444175 | Ga0501046_0444175_169_735 | 187 |
| 1008 | 3300049588 | Ga0501072_0285552 | Ga0501072_0285552_720_1286 | 187 |
| 1009 | 3300049589 | Ga0501073_0024177 | Ga0501073_0024177_513_1079 | 187 |
| 1010 | 3300049649 | Ga0501198_020162 | Ga0501198_020162_456_1022 | 187 |
| 1011 | 3300049649 | Ga0501198_034988 | Ga0501198_034988_184_750 | 187 |
| 1012 | 3300049652 | Ga0501202_000075 | Ga0501202_000075_9483_10049 | 187 |
| 1013 | 3300049652 | Ga0501202_001677 | Ga0501202_001677_2115_2681 | 187 |
| 1014 | 3300049653 | Ga0501206_005016 | Ga0501206_005016_161_727 | 187 |
| 1015 | 3300049654 | Ga0501207_092800 | Ga0501207_092800_13_579 | 187 |
| 1016 | 3300049656 | Ga0501209_040616 | Ga0501209_040616_571_1137 | 187 |
| 1017 | 3300049658 | Ga0501211_009429 | Ga0501211_009429_339_905 | 187 |
| 1018 | 3300049661 | Ga0501217_002570 | Ga0501217_002570_1819_2385 | 187 |
| 1019 | 3300049661 | Ga0501217_004398 | Ga0501217_004398_394_960 | 187 |
| 1020 | 3300049662 | Ga0501222_023448 | Ga0501222_023448_18_584 | 187 |
| 1021 | 3300049663 | Ga0501223_002561 | Ga0501223_002561_501_1115 | 187 |
| 1022 | 3300049664 | Ga0501224_000798 | Ga0501224_000798_2658_3224 | 187 |
| 1023 | 3300049664 | Ga0501224_011073 | Ga0501224_011073_440_1006 | 187 |
| 1024 | 3300049673 | Ga0501240_004216 | Ga0501240_004216_32_598 | 187 |
| 1025 | 3300049673 | Ga0501240_031461 | Ga0501240_031461_210_776 | 187 |
| 1026 | 3300049679 | Ga0501249_082644 | Ga0501249_082644_62_628 | 187 |
| 1027 | 3300049686 | Ga0501257_000560 | Ga0501257_000560_3344_3910 | 187 |
| 1028 | 3300049688 | Ga0501259_000437 | Ga0501259_000437_446_1012 | 187 |
| 1029 | 3300049688 | Ga0501259_001665 | Ga0501259_001665_1465_2031 | 187 |
| 1030 | 3300049703 | Ga0501219_000027 | Ga0501219_000027_20214_20777 | 187 |
| 1031 | 3300049704 | Ga0501221_000197 | Ga0501221_000197_7296_7862 | 187 |
| 1032 | 3300049704 | Ga0501221_005522 | Ga0501221_005522_201_767 | 187 |
| 1033 | 3300049705 | Ga0501225_0012209 | Ga0501225_0012209_806_1372 | 187 |
| 1034 | 3300049705 | Ga0501225_0037378 | Ga0501225_0037378_679_1245 | 187 |
| 1035 | 3300049705 | Ga0501225_0037891 | Ga0501225_0037891_35_601 | 187 |
| 1036 | 3300049706 | Ga0501229_038859 | Ga0501229_038859_47_613 | 187 |
| 1037 | 3300049707 | Ga0501234_002498 | Ga0501234_002498_2068_2634 | 187 |
| 1038 | 3300049707 | Ga0501234_007842 | Ga0501234_007842_80_646 | 187 |
| 1039 | 3300049708 | Ga0501245_001664 | Ga0501245_001664_1899_2465 | 187 |
| 1040 | 3300049708 | Ga0501245_021133 | Ga0501245_021133_431_997 | 187 |
| 1041 | 3300049742 | Ga0501080_0355785 | Ga0501080_0355785_593_1159 | 187 |
| 1042 | 3300049744 | Ga0501083_0175553 | Ga0501083_0175553_17_583 | 187 |
| 1043 | 3300049758 | Ga0501241_019118 | Ga0501241_019118_119_682 | 187 |
| 1044 | 3300049758 | Ga0501241_062282 | Ga0501241_062282_79_645 | 187 |
| 1045 | 3300049765 | Ga0501268_001349 | Ga0501268_001349_1394_1960 | 187 |
| 1046 | 3300049766 | Ga0501269_013660 | Ga0501269_013660_172_738 | 187 |
| 1047 | 3300049767 | Ga0501270_016880 | Ga0501270_016880_408_974 | 187 |
| 1048 | 3300049771 | Ga0501274_015541 | Ga0501274_015541_50_616 | 187 |
| 1049 | 3300049775 | Ga0501279_012603 | Ga0501279_012603_41_607 | 187 |
| 1050 | 3300049822 | Ga0501035_0056798 | Ga0501035_0056798_2424_2990 | 187 |
| 1051 | 3300049822 | Ga0501035_0131122 | Ga0501035_0131122_483_1049 | 187 |
| 1052 | 3300049823 | Ga0501044_0045447 | Ga0501044_0045447_411_977 | 187 |
| 1053 | 3300049823 | Ga0501044_0157184 | Ga0501044_0157184_525_1091 | 187 |
| 1054 | 3300050005 | Ga0501284_00021 | Ga0501284_00021_59958_60521 | 187 |
| 1055 | 3300050493 | nmdc:mga0k408_218880_c1 | nmdc:mga0k408_218880_c1_214_777 | 187 |
| 1056 | 3300050493 | nmdc:mga0k408_23568_c1 | nmdc:mga0k408_23568_c1_2307_2870 | 187 |
| 1057 | 3300050507 | nmdc:mga05p37_12189_c1 | nmdc:mga05p37_12189_c1_4394_4957 | 187 |
| 1058 | 3300050507 | nmdc:mga05p37_129725_c1 | nmdc:mga05p37_129725_c1_700_1266 | 187 |
| 1059 | 3300050508 | nmdc:mga09592_152263_c1 | nmdc:mga09592_152263_c1_875_1441 | 187 |
| 1060 | 3300050508 | nmdc:mga09592_421360_c1 | nmdc:mga09592_421360_c1_397_960 | 187 |
| 1061 | 3300050508 | nmdc:mga09592_5207_c1 | nmdc:mga09592_5207_c1_2160_2726 | 187 |
| 1062 | 3300050509 | nmdc:mga0qj67_23710_c1 | nmdc:mga0qj67_23710_c1_2085_2651 | 187 |
| 1063 | 3300050511 | nmdc:mga08y16_85815_c1 | nmdc:mga08y16_85815_c1_1873_2439 | 187 |
| 1064 | 3300050511 | nmdc:mga08y16_96143_c1 | nmdc:mga08y16_96143_c1_1700_2263 | 187 |
| 1065 | 3300050512 | nmdc:mga0n895_1093269_c1 | nmdc:mga0n895_1093269_c1_168_734 | 187 |
| 1066 | 3300050512 | nmdc:mga0n895_402408_c1 | nmdc:mga0n895_402408_c1_804_1370 | 187 |
| 1067 | 3300050513 | nmdc:mga0rr50_1039330_c1 | nmdc:mga0rr50_1039330_c1_39_605 | 187 |
| 1068 | 3300053093 | Ga0500651_0325374 | Ga0500651_0325374_126_689 | 187 |
| 1069 | 3300053096 | Ga0500641_0006740 | Ga0500641_0006740_267_830 | 187 |
| 1070 | 3300053146 | Ga0500588_0000589 | Ga0500588_0000589_2217_2780 | 187 |
| 1071 | 3300053178 | Ga0500637_0114965 | Ga0500637_0114965_546_1109 | 187 |
| 1072 | 3300053730 | Ga0500645_006772 | Ga0500645_006772_203_766 | 187 |
| 1073 | 3300055283 | Ga0500661_017685 | Ga0500661_017685_172_735 | 187 |
| 1074 | 3300061719 | Ga0466962_0006963 | Ga0466962_0006963_4312_4875 | 187 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vc1-assembly1.cif.gz_B | crystal structure of the tm1442 protein from thermotoga maritima, a homolog of the bacillus subtilis general stress response anti-anti-sigma factor rsbv | 0.7791 | 54 | 164 |
| 2ka5-assembly1.cif.gz_A | nmr structure of the protein tm1081 | 0.7758 | 59 | 162 |
| 1h4y-assembly2.cif.gz_B | structure of the anti-sigma factor antagonist spoiiaa in its unphosphorylated form | 0.7735 | 57 | 180 |
| 1til-assembly1.cif.gz_B | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii | 0.771 | 54 | 167 |
| 1sbo-assembly1.cif.gz_A | solution structure of putative anti sigma factor antagonist from thermotoga maritima (tm1442) | 0.7701 | 54 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B0V3V8_450_565_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.7803 | 57 | 165 | 3.30.750.24 |
| af_P60070_1_106_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.7695 | 54 | 165 | 3.30.750.24 |
| af_P60070_1_106_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.7575 | 54 | 165 | 3.30.750.24 |
| 3f43A01 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.757 | 62 | 165 | 3.30.750.24 |
| af_A0A1D6ELD4_35_180_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.7488 | 67 | 161 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4UAG5-F1-model_v4 | Uncharacterized protein | 0.9792 | 104 | 186 |
|
| AF-A0A4Q3EJ08-F1-model_v4 | Uncharacterized protein | 0.9438 | 58 | 187 |
|
| AF-A0A7C4UAG5-F1-model_v4 | Uncharacterized protein | 0.9349 | 104 | 186 |
|
| AF-A0A4Q3EJ08-F1-model_v4 | Uncharacterized protein | 0.9232 | 58 | 187 |
|
| AF-A0A4Q5QRB9-F1-model_v4 | DUF695 domain-containing protein | 0.8868 | 37 | 187 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar