F489539

General Info

Members Datasets Scaffolds Average Seq Length
1074 312 1073 188

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100029484|Ga0075428_1000294845
Length 208
Sequence VFISCNPSGSWFIFVQEFLCMHDIEPFYNWRHIYIAEEDQRSPFYGQTHSEFEFTQTVYNYYIHPQWDEFGSRTLYMKVLMADYDEKYAIIELIGEWNDAIENDIMTLKREVIDVFELQGITKFILIAENVLNFHSGDKDYYEEWYEETSDEHGWIVILNMPEATQHDFKKAKLNRWLELIDLPEWRTYKPFHLFRKIDSFEQARLAG

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
212 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
213 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
214 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
215 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
216 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
226 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
251 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
262 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
263 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
264 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
265 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
266 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
267 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
268 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
269 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
270 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
271 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
272 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
273 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
274 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
275 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
276 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
277 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
278 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
279 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
280 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
281 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
282 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
286 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
287 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
288 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
289 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
290 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
291 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
292 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
304 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
305 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
306 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
307 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
308 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
309 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
310 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
311 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
312 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 0.47
Rhizosphere 96.55
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_1772662 2162886011 Bacteria 1158
2 MBSR1b_contig_12669236 2162886012 Bacteria 1829
3 ARCol0yngRDRAFT_1009151 3300000652 Bacteria 716
4 JGI24738J21930_10036993 3300002075 Bacteria 993
5 JGI24744J21845_10043095 3300002077 Unclassified 841
6 JGI24742J22300_10014980 3300002244 Unclassified 1304
7 rootH1_10135696 3300003316 Bacteria 1472
8 rootH2_10020409 3300003320 Bacteria 10833
9 rootH2_10030789 3300003320 Bacteria 26106
10 rootH2_10042646 3300003320 Bacteria 6260
11 rootL2_10203795 3300003322 Bacteria 1385
12 rootH1_10060685 3300003323 Bacteria 2451
13 JGI25160J50197_1028187 3300003354 Bacteria 1512
14 Ga0065704_10114868 3300005289 Bacteria 1883
15 Ga0065704_10254632 3300005289 Bacteria 980
16 Ga0065712_10004322 3300005290 Bacteria 3285
17 Ga0065712_10077307 3300005290 Bacteria 3515
18 Ga0065712_10263234 3300005290 Bacteria 932
19 Ga0065715_10588591 3300005293 Bacteria 715
20 Ga0065707_10024347 3300005295 Bacteria 1325
21 Ga0065707_10105866 3300005295 Unclassified 2625
22 Ga0065707_10342174 3300005295 Bacteria 932
23 Ga0070658_10190011 3300005327 Bacteria 1731
24 Ga0070658_10240820 3300005327 Bacteria 1533
25 Ga0070658_10499951 3300005327 Bacteria 1050
26 Ga0070658_10856487 3300005327 Bacteria 790
27 Ga0070676_10000932 3300005328 Bacteria 14492
28 Ga0070676_10571573 3300005328 Bacteria 812
29 Ga0070683_100001892 3300005329 Bacteria 16354
30 Ga0070683_100007576 3300005329 Bacteria 9180
31 Ga0070683_100016743 3300005329 Bacteria 6468
32 Ga0070683_100019212 3300005329 Bacteria 6069
33 Ga0070683_100053668 3300005329 Bacteria 3735
34 Ga0070683_100264414 3300005329 Bacteria 1636
35 Ga0070690_100015166 3300005330 Bacteria 4591
36 Ga0070690_100068031 3300005330 Unclassified 2309
37 Ga0070670_100012284 3300005331 Bacteria 7329
38 Ga0070670_100035924 3300005331 Bacteria 4266
39 Ga0070670_100036566 3300005331 Bacteria 4226
40 Ga0070670_100036748 3300005331 Bacteria 4214
41 Ga0070670_100078687 3300005331 Bacteria 2833
42 Ga0070670_100089258 3300005331 Bacteria 2650
43 Ga0070670_100091035 3300005331 Bacteria 2622
44 Ga0070670_100104333 3300005331 Bacteria 2442
45 Ga0070670_100144191 3300005331 Bacteria 2060
46 Ga0070670_100160342 3300005331 Unclassified 1949
47 Ga0070670_100269117 3300005331 Bacteria 1486
48 Ga0070670_100994162 3300005331 Bacteria 763
49 Ga0070677_10077856 3300005333 Bacteria 1411
50 Ga0070677_10115573 3300005333 Bacteria 1204
51 Ga0070677_10129117 3300005333 Unclassified 1151
52 Ga0068869_100002337 3300005334 Bacteria 11406
53 Ga0068869_100016584 3300005334 Bacteria 4967
54 Ga0068869_100017315 3300005334 Bacteria 4882
55 Ga0068869_100031071 3300005334 Bacteria 3756
56 Ga0068869_100058283 3300005334 Bacteria 2823
57 Ga0068869_100076905 3300005334 Bacteria 2482
58 Ga0068869_100097426 3300005334 Bacteria 2221
59 Ga0068869_100102193 3300005334 Bacteria 2169
60 Ga0068869_100119200 3300005334 Bacteria 2016
61 Ga0068869_100571015 3300005334 Unclassified 952
62 Ga0068869_100671682 3300005334 Bacteria 881
63 Ga0070666_10000833 3300005335 Bacteria 18712
64 Ga0070666_10015420 3300005335 Bacteria 4874
65 Ga0070666_10020501 3300005335 Bacteria 4273
66 Ga0070666_10206403 3300005335 Bacteria 1383
67 Ga0070666_10311104 3300005335 Bacteria 1123
68 Ga0070666_10648648 3300005335 Bacteria 772
69 Ga0070680_100103219 3300005336 Bacteria 2369
70 Ga0070682_100025159 3300005337 Bacteria 3551
71 Ga0070682_100435585 3300005337 Bacteria 1000
72 Ga0068868_100000091 3300005338 Bacteria 55405
73 Ga0068868_100003227 3300005338 Bacteria 11342
74 Ga0068868_100005969 3300005338 Bacteria 8591
75 Ga0068868_100017172 3300005338 Bacteria 5385
76 Ga0068868_100017820 3300005338 Bacteria 5296
77 Ga0068868_100050580 3300005338 Bacteria 3264
78 Ga0068868_100437582 3300005338 Bacteria 1135
79 Ga0068868_101133717 3300005338 Bacteria 721
80 Ga0070660_100007804 3300005339 Bacteria 7464
81 Ga0070689_100075317 3300005340 Bacteria 2642
82 Ga0070689_100097914 3300005340 Bacteria 2320
83 Ga0070689_100099393 3300005340 Bacteria 2302
84 Ga0070689_100100163 3300005340 Bacteria 2292
85 Ga0070689_100126083 3300005340 Bacteria 2049
86 Ga0070689_100470179 3300005340 Bacteria 1073
87 Ga0070689_100707738 3300005340 Unclassified 880
88 Ga0070687_100049753 3300005343 Bacteria 2161
89 Ga0070687_100065980 3300005343 Bacteria 1927
90 Ga0070687_100151924 3300005343 Bacteria 1360
91 Ga0070661_100000998 3300005344 Bacteria 20086
92 Ga0070661_100055301 3300005344 Bacteria 2906
93 Ga0070668_100000043 3300005347 Bacteria 78564
94 Ga0070668_100014986 3300005347 Bacteria 5791
95 Ga0070668_100238069 3300005347 Bacteria 1507
96 Ga0070668_100326349 3300005347 Bacteria 1293
97 Ga0070668_100329169 3300005347 Unclassified 1288
98 Ga0070668_100807142 3300005347 Bacteria 834
99 Ga0070669_100010916 3300005353 Bacteria 6449
100 Ga0070669_100011863 3300005353 Bacteria 6182
101 Ga0070669_100055419 3300005353 Bacteria 2905
102 Ga0070669_100100993 3300005353 Unclassified 2176
103 Ga0070669_100197168 3300005353 Bacteria 1583
104 Ga0070669_100333602 3300005353 Bacteria 1227
105 Ga0070669_100529024 3300005353 Bacteria 981
106 Ga0070675_100016806 3300005354 Bacteria 5810
107 Ga0070675_100040377 3300005354 Bacteria 3809
108 Ga0070675_100046961 3300005354 Bacteria 3537
109 Ga0070675_100077696 3300005354 Bacteria 2763
110 Ga0070675_100140247 3300005354 Bacteria 2066
111 Ga0070675_100155730 3300005354 Bacteria 1962
112 Ga0070675_100172433 3300005354 Bacteria 1866
113 Ga0070675_100183471 3300005354 Unclassified 1810
114 Ga0070675_100379574 3300005354 Bacteria 1258
115 Ga0070675_100471186 3300005354 Unclassified 1128
116 Ga0070675_100727582 3300005354 Bacteria 905
117 Ga0070671_100013905 3300005355 Bacteria 6493
118 Ga0070671_100121885 3300005355 Bacteria 2194
119 Ga0070671_100175449 3300005355 Bacteria 1813
120 Ga0070671_100182088 3300005355 Bacteria 1779
121 Ga0070671_100258283 3300005355 Bacteria 1480
122 Ga0070671_100270702 3300005355 Bacteria 1444
123 Ga0070671_100298122 3300005355 Bacteria 1372
124 Ga0070671_100344012 3300005355 Bacteria 1272
125 Ga0070671_100432733 3300005355 Bacteria 1127
126 Ga0070674_100053820 3300005356 Bacteria 2781
127 Ga0070674_100056755 3300005356 Bacteria 2716
128 Ga0070674_100073920 3300005356 Bacteria 2417
129 Ga0070674_100182923 3300005356 Bacteria 1607
130 Ga0070674_100269074 3300005356 Bacteria 1346
131 Ga0070674_100616089 3300005356 Bacteria 919
132 Ga0070673_100012785 3300005364 Bacteria 5775
133 Ga0070673_100013846 3300005364 Bacteria 5597
134 Ga0070673_100019331 3300005364 Bacteria 4888
135 Ga0070673_100048748 3300005364 Bacteria 3304
136 Ga0070673_100069027 3300005364 Bacteria 2832
137 Ga0070673_100071700 3300005364 Bacteria 2784
138 Ga0070673_100171374 3300005364 Bacteria 1853
139 Ga0070673_100614801 3300005364 Bacteria 992
140 Ga0070673_101126804 3300005364 Bacteria 733
141 Ga0070688_100001211 3300005365 Bacteria 12840
142 Ga0070688_100054375 3300005365 Unclassified 2507
143 Ga0070688_100067445 3300005365 Bacteria 2279
144 Ga0070688_100079251 3300005365 Bacteria 2121
145 Ga0070688_100163879 3300005365 Bacteria 1529
146 Ga0070688_100274493 3300005365 Bacteria 1209
147 Ga0070659_100012950 3300005366 Bacteria 6201
148 Ga0070659_100048059 3300005366 Bacteria 3350
149 Ga0070659_100526146 3300005366 Bacteria 1010
150 Ga0070659_100793684 3300005366 Unclassified 823
151 Ga0070667_100000254 3300005367 Bacteria 60664
152 Ga0070667_100022994 3300005367 Bacteria 5169
153 Ga0070667_100049982 3300005367 Bacteria 3523
154 Ga0070667_100078410 3300005367 Bacteria 2822
155 Ga0070667_100170549 3300005367 Unclassified 1921
156 Ga0070667_100244950 3300005367 Bacteria 1601
157 Ga0070667_100431265 3300005367 Bacteria 1203
158 Ga0070667_101120913 3300005367 Viruses 736
159 Ga0070701_10060827 3300005438 Bacteria 1990
160 Ga0070701_10066706 3300005438 Bacteria 1913
161 Ga0070705_100191810 3300005440 Bacteria 1393
162 Ga0070700_100054188 3300005441 Bacteria 2505
163 Ga0070700_100157347 3300005441 Unclassified 1560
164 Ga0070678_100004350 3300005456 Bacteria 8014
165 Ga0070678_100057910 3300005456 Unclassified 2841
166 Ga0070678_100373337 3300005456 Bacteria 1232
167 Ga0070678_100428371 3300005456 Unclassified 1155
168 Ga0070662_100010688 3300005457 Bacteria 6041
169 Ga0070662_100014815 3300005457 Bacteria 5213
170 Ga0070662_100020923 3300005457 Bacteria 4462
171 Ga0070662_100027652 3300005457 Bacteria 3940
172 Ga0070662_100060059 3300005457 Bacteria 2771
173 Ga0070662_100087226 3300005457 Bacteria 2336
174 Ga0070662_100197069 3300005457 Unclassified 1596
175 Ga0070662_100504918 3300005457 Unclassified 1009
176 Ga0070662_100651932 3300005457 Bacteria 888
177 Ga0070681_10002668 3300005458 Bacteria 16383
178 Ga0068867_100003884 3300005459 Bacteria 10517
179 Ga0068867_100034619 3300005459 Bacteria 3661
180 Ga0068867_100109335 3300005459 Bacteria 2122
181 Ga0068867_100233541 3300005459 Bacteria 1488
182 Ga0068867_100319758 3300005459 Bacteria 1285
183 Ga0068867_100547920 3300005459 Bacteria 1001
184 Ga0070685_10161660 3300005466 Bacteria 1428
185 Ga0070685_10270157 3300005466 Bacteria 1134
186 Ga0070685_10496073 3300005466 Unclassified 863
187 Ga0070706_100430297 3300005467 Bacteria 1228
188 Ga0070706_100465549 3300005467 Unclassified 1176
189 Ga0070698_100001232 3300005471 Bacteria 28474
190 Ga0070698_100001401 3300005471 Bacteria 26708
191 Ga0070698_100024342 3300005471 Bacteria 6318
192 Ga0070698_100175844 3300005471 Bacteria 2080
193 Ga0070699_100073116 3300005518 Bacteria 2983
194 Ga0070679_100064164 3300005530 Bacteria 3660
195 Ga0070679_101000488 3300005530 Bacteria 780
196 Ga0070684_100000143 3300005535 Bacteria 47674
197 Ga0070684_100004638 3300005535 Bacteria 10486
198 Ga0070684_100008847 3300005535 Bacteria 7896
199 Ga0070684_100015352 3300005535 Bacteria 6235
200 Ga0070684_100060599 3300005535 Bacteria 3311
201 Ga0070684_100144420 3300005535 Bacteria 2153
202 Ga0070684_100151285 3300005535 Bacteria 2102
203 Ga0070684_101001501 3300005535 Bacteria 784
204 Ga0068853_100007245 3300005539 Bacteria 8885
205 Ga0068853_100015397 3300005539 Bacteria 6283
206 Ga0068853_100133050 3300005539 Bacteria 2227
207 Ga0068853_100202634 3300005539 Bacteria 1806
208 Ga0068853_100259546 3300005539 Bacteria 1597
209 Ga0068853_100360678 3300005539 Unclassified 1354
210 Ga0068853_100463979 3300005539 Bacteria 1192
211 Ga0068853_100600863 3300005539 Bacteria 1045
212 Ga0068853_100745638 3300005539 Unclassified 936
213 Ga0068853_101658230 3300005539 Bacteria 620
214 Ga0070672_100000160 3300005543 Bacteria 37362
215 Ga0070672_100101544 3300005543 Bacteria 2333
216 Ga0070672_100110785 3300005543 Bacteria 2237
217 Ga0070672_100163589 3300005543 Unclassified 1848
218 Ga0070672_100267583 3300005543 Bacteria 1442
219 Ga0070672_100351100 3300005543 Bacteria 1257
220 Ga0070672_100443964 3300005543 Bacteria 1117
221 Ga0070686_100027961 3300005544 Bacteria 3416
222 Ga0070686_100475410 3300005544 Bacteria 965
223 Ga0070695_100163393 3300005545 Bacteria 1565
224 Ga0070696_100505393 3300005546 Bacteria 962
225 Ga0070693_100061006 3300005547 Bacteria 2191
226 Ga0070693_100408740 3300005547 Bacteria 943
227 Ga0070693_100420411 3300005547 Bacteria 931
228 Ga0070693_100451979 3300005547 Unclassified 902
229 Ga0070665_100000350 3300005548 Bacteria 69455
230 Ga0070665_100042513 3300005548 Bacteria 4568
231 Ga0070665_100170322 3300005548 Bacteria 2179
232 Ga0070665_100311136 3300005548 Bacteria 1579
233 Ga0070665_100337427 3300005548 Unclassified 1512
234 Ga0068855_100000089 3300005563 Bacteria 110845
235 Ga0068855_100025914 3300005563 Bacteria 7014
236 Ga0068855_100074344 3300005563 Bacteria 3947
237 Ga0068855_100081339 3300005563 Bacteria 3755
238 Ga0068855_101300394 3300005563 Bacteria 753
239 Ga0070664_100008696 3300005564 Bacteria 8219
240 Ga0070664_100016033 3300005564 Bacteria 6140
241 Ga0070664_100040643 3300005564 Bacteria 3921
242 Ga0070664_100052751 3300005564 Bacteria 3445
243 Ga0070664_100058800 3300005564 Bacteria 3270
244 Ga0070664_100177020 3300005564 Bacteria 1894
245 Ga0070664_100247518 3300005564 Bacteria 1601
246 Ga0070664_100439506 3300005564 Bacteria 1196
247 Ga0068857_100010772 3300005577 Bacteria 7959
248 Ga0068857_100052934 3300005577 Bacteria 3601
249 Ga0068857_100104411 3300005577 Bacteria 2544
250 Ga0068857_100161546 3300005577 Bacteria 2033
251 Ga0068857_100258266 3300005577 Bacteria 1598
252 Ga0068857_100328796 3300005577 Bacteria 1412
253 Ga0068857_100387820 3300005577 Bacteria 1298
254 Ga0068857_100430778 3300005577 Bacteria 1231
255 Ga0068857_100770525 3300005577 Unclassified 917
256 Ga0068857_100894496 3300005577 Bacteria 851
257 Ga0068857_101030982 3300005577 Unclassified 793
258 Ga0068854_100205682 3300005578 Bacteria 1550
259 Ga0068854_100274520 3300005578 Bacteria 1355
260 Ga0068854_100387386 3300005578 Bacteria 1153
261 Ga0068856_100164527 3300005614 Bacteria 2229
262 Ga0068856_100750359 3300005614 Bacteria 996
263 Ga0070702_100087919 3300005615 Bacteria 1878
264 Ga0068852_100015848 3300005616 Bacteria 5861
265 Ga0068852_100110788 3300005616 Bacteria 2495
266 Ga0068852_100124989 3300005616 Bacteria 2360
267 Ga0068852_100134972 3300005616 Bacteria 2278
268 Ga0068852_100164795 3300005616 Bacteria 2073
269 Ga0068852_100358351 3300005616 Bacteria 1426
270 Ga0068852_100811437 3300005616 Bacteria 950
271 Ga0068852_101424504 3300005616 Bacteria 715
272 Ga0068859_100000100 3300005617 Bacteria 79844
273 Ga0068859_100006400 3300005617 Bacteria 11949
274 Ga0068859_100045503 3300005617 Bacteria 4409
275 Ga0068859_100045943 3300005617 Bacteria 4387
276 Ga0068859_100055078 3300005617 Bacteria 4002
277 Ga0068859_100071722 3300005617 Bacteria 3499
278 Ga0068859_100090854 3300005617 Bacteria 3104
279 Ga0068859_100097155 3300005617 Bacteria 2998
280 Ga0068859_100099520 3300005617 Bacteria 2963
281 Ga0068859_100177818 3300005617 Bacteria 2210
282 Ga0068859_100189897 3300005617 Bacteria 2139
283 Ga0068859_100410358 3300005617 Unclassified 1450
284 Ga0068859_100770622 3300005617 Unclassified 1050
285 Ga0068859_100971747 3300005617 Bacteria 932
286 Ga0068859_101242883 3300005617 Bacteria 820
287 Ga0068859_101418791 3300005617 Bacteria 766
288 Ga0068864_100004900 3300005618 Bacteria 10966
289 Ga0068864_100047787 3300005618 Bacteria 3677
290 Ga0068864_100052426 3300005618 Unclassified 3516
291 Ga0068864_100066952 3300005618 Bacteria 3118
292 Ga0068864_100096472 3300005618 Bacteria 2617
293 Ga0068864_100149758 3300005618 Bacteria 2113
294 Ga0068864_100194596 3300005618 Bacteria 1860
295 Ga0068864_100236660 3300005618 Unclassified 1690
296 Ga0068864_100275992 3300005618 Bacteria 1567
297 Ga0068864_100695094 3300005618 Bacteria 993
298 Ga0068864_100762170 3300005618 Bacteria 949
299 Ga0068864_101208464 3300005618 Unclassified 755
300 Ga0068866_10005085 3300005718 Bacteria 5418
301 Ga0068866_10028304 3300005718 Bacteria 2669
302 Ga0068866_10287892 3300005718 Bacteria 1021
303 Ga0068866_10594611 3300005718 Bacteria 746
304 Ga0068861_100002321 3300005719 Bacteria 12362
305 Ga0068861_100004878 3300005719 Bacteria 9029
306 Ga0068861_100018316 3300005719 Bacteria 4988
307 Ga0068861_100034867 3300005719 Bacteria 3724
308 Ga0068861_100065845 3300005719 Bacteria 2792
309 Ga0068861_100287472 3300005719 Bacteria 1418
310 Ga0068861_100289715 3300005719 Bacteria 1413
311 Ga0068861_100613395 3300005719 Bacteria 1000
312 Ga0068861_100613470 3300005719 Bacteria 1000
313 Ga0068851_10002184 3300005834 Bacteria 8604
314 Ga0068851_10088663 3300005834 Bacteria 1626
315 Ga0068851_10095771 3300005834 Unclassified 1569
316 Ga0068851_10505455 3300005834 Bacteria 725
317 Ga0068851_10551966 3300005834 Bacteria 696
318 Ga0068870_10021567 3300005840 Bacteria 3153
319 Ga0068870_10028936 3300005840 Bacteria 2787
320 Ga0068870_10244433 3300005840 Bacteria 1109
321 Ga0068863_100003656 3300005841 Bacteria 15182
322 Ga0068863_100005412 3300005841 Bacteria 12587
323 Ga0068863_100022973 3300005841 Bacteria 5961
324 Ga0068863_100048136 3300005841 Bacteria 4043
325 Ga0068863_100059429 3300005841 Bacteria 3617
326 Ga0068863_100483940 3300005841 Unclassified 1217
327 Ga0068863_100518876 3300005841 Bacteria 1175
328 Ga0068863_100544527 3300005841 Unclassified 1145
329 Ga0068863_100700176 3300005841 Bacteria 1007
330 Ga0068858_100000199 3300005842 Bacteria 64607
331 Ga0068858_100013150 3300005842 Bacteria 7804
332 Ga0068858_100109962 3300005842 Bacteria 2573
333 Ga0068858_100145754 3300005842 Unclassified 2224
334 Ga0068858_101110621 3300005842 Bacteria 776
335 Ga0068860_100003203 3300005843 Bacteria 16892
336 Ga0068860_100006347 3300005843 Bacteria 11865
337 Ga0068860_100007843 3300005843 Bacteria 10655
338 Ga0068860_100076081 3300005843 Bacteria 3192
339 Ga0068860_100134077 3300005843 Bacteria 2378
340 Ga0068860_100545787 3300005843 Bacteria 1161
341 Ga0068860_100596383 3300005843 Bacteria 1110
342 Ga0068862_100016502 3300005844 Bacteria 6147
343 Ga0068862_100057039 3300005844 Bacteria 3348
344 Ga0068862_100059367 3300005844 Unclassified 3285
345 Ga0068862_100084888 3300005844 Bacteria 2751
346 Ga0068862_100247155 3300005844 Bacteria 1624
347 Ga0081455_10455209 3300005937 Bacteria 873
348 Ga0070715_10066344 3300006163 Unclassified 1600
349 Ga0075366_10197900 3300006195 Unclassified 1222
350 Ga0075366_10267412 3300006195 Unclassified 1044
351 Ga0075366_10330696 3300006195 Bacteria 934
352 Ga0097621_100009982 3300006237 Bacteria 6920
353 Ga0097621_100034379 3300006237 Bacteria 4044
354 Ga0097621_100110422 3300006237 Bacteria 2323
355 Ga0097621_100151904 3300006237 Bacteria 1986
356 Ga0097621_100190968 3300006237 Bacteria 1774
357 Ga0097621_100358964 3300006237 Bacteria 1298
358 Ga0097621_100439600 3300006237 Bacteria 1173
359 Ga0097621_100450992 3300006237 Unclassified 1159
360 Ga0097621_100758558 3300006237 Bacteria 897
361 Ga0068871_100055412 3300006358 Bacteria 3218
362 Ga0068871_100095193 3300006358 Bacteria 2486
363 Ga0068871_100146078 3300006358 Bacteria 2014
364 Ga0068871_100149747 3300006358 Bacteria 1989
365 Ga0068871_100156633 3300006358 Unclassified 1945
366 Ga0068871_100282209 3300006358 Bacteria 1453
367 Ga0068871_100301984 3300006358 Bacteria 1405
368 Ga0068871_100350777 3300006358 Bacteria 1305
369 Ga0068871_100525682 3300006358 Bacteria 1069
370 Ga0068871_100589720 3300006358 Bacteria 1010
371 Ga0068871_101414736 3300006358 Bacteria 656
372 Ga0075428_100001125 3300006844 Bacteria 28571
373 Ga0075428_100029484 3300006844 Bacteria 6071
374 Ga0075428_100159109 3300006844 Unclassified 2452
375 Ga0075430_100037041 3300006846 Bacteria 4135
376 Ga0075431_100018153 3300006847 Bacteria 7157
377 Ga0075434_101119836 3300006871 Bacteria 800
378 Ga0075429_100000105 3300006880 Bacteria 47284
379 Ga0075429_100033094 3300006880 Bacteria 4492
380 Ga0075429_100446591 3300006880 Bacteria 1133
381 Ga0068865_100003229 3300006881 Bacteria 9768
382 Ga0068865_100019488 3300006881 Unclassified 4391
383 Ga0068865_100190045 3300006881 Bacteria 1587
384 Ga0068865_100575693 3300006881 Unclassified 949
385 Ga0068865_100605535 3300006881 Bacteria 926
386 Ga0097620_100000100 3300006931 Bacteria 79844
387 Ga0097620_100006400 3300006931 Bacteria 11949
388 Ga0097620_100045504 3300006931 Bacteria 4409
389 Ga0097620_100045944 3300006931 Bacteria 4387
390 Ga0097620_100055076 3300006931 Bacteria 4002
391 Ga0097620_100071720 3300006931 Bacteria 3499
392 Ga0097620_100090855 3300006931 Bacteria 3104
393 Ga0097620_100097165 3300006931 Bacteria 2998
394 Ga0097620_100099522 3300006931 Bacteria 2963
395 Ga0097620_100177816 3300006931 Bacteria 2210
396 Ga0097620_100189892 3300006931 Bacteria 2139
397 Ga0097620_100410361 3300006931 Unclassified 1450
398 Ga0097620_100770591 3300006931 Unclassified 1050
399 Ga0097620_100971857 3300006931 Bacteria 932
400 Ga0097620_101242842 3300006931 Bacteria 820
401 Ga0097620_101418989 3300006931 Bacteria 766
402 Ga0075435_101263635 3300007076 Bacteria 646
403 Ga0105251_10071169 3300009011 Bacteria 1618
404 Ga0105240_10000074 3300009093 Bacteria 199611
405 Ga0105240_10010569 3300009093 Bacteria 12966
406 Ga0105240_10451742 3300009093 Bacteria 1438
407 Ga0105240_10575427 3300009093 Unclassified 1243
408 Ga0111539_10124592 3300009094 Bacteria 3020
409 Ga0111539_10725210 3300009094 Bacteria 1157
410 Ga0111539_11053653 3300009094 Bacteria 945
411 Ga0105245_10021467 3300009098 Bacteria 5665
412 Ga0105245_10141816 3300009098 Bacteria 2264
413 Ga0105245_10490164 3300009098 Bacteria 1243
414 Ga0105245_11496987 3300009098 Bacteria 726
415 Ga0105247_10001666 3300009101 Bacteria 15681
416 Ga0105247_10035042 3300009101 Bacteria 3058
417 Ga0105247_10036944 3300009101 Unclassified 2979
418 Ga0105247_10091146 3300009101 Bacteria 1935
419 Ga0105247_10148451 3300009101 Bacteria 1543
420 Ga0105247_10634304 3300009101 Unclassified 796
421 Ga0114129_10017306 3300009147 Bacteria 10263
422 Ga0114129_10121641 3300009147 Bacteria 3592
423 Ga0114129_10150575 3300009147 Bacteria 3184
424 Ga0114129_12032728 3300009147 Bacteria 694
425 Ga0105243_10063213 3300009148 Bacteria 2966
426 Ga0105243_10191730 3300009148 Bacteria 1786
427 Ga0105243_10387379 3300009148 Unclassified 1295
428 Ga0105243_10492186 3300009148 Bacteria 1160
429 Ga0105243_10521583 3300009148 Bacteria 1130
430 Ga0105241_10000286 3300009174 Bacteria 37584
431 Ga0105241_10000674 3300009174 Bacteria 25718
432 Ga0105241_10050739 3300009174 Bacteria 3162
433 Ga0105241_10078204 3300009174 Bacteria 2584
434 Ga0105241_10128490 3300009174 Bacteria 2049
435 Ga0105241_10445574 3300009174 Bacteria 1144
436 Ga0105241_10612534 3300009174 Bacteria 985
437 Ga0105241_10701313 3300009174 Bacteria 924
438 Ga0105242_10007239 3300009176 Bacteria 8554
439 Ga0105242_10057786 3300009176 Bacteria 3178
440 Ga0105242_10121029 3300009176 Bacteria 2246
441 Ga0105242_10249725 3300009176 Unclassified 1598
442 Ga0105242_10551545 3300009176 Unclassified 1105
443 Ga0105242_11457885 3300009176 Bacteria 714
444 Ga0105248_10064189 3300009177 Bacteria 4122
445 Ga0105248_10276264 3300009177 Bacteria 1891
446 Ga0105248_10463890 3300009177 Bacteria 1428
447 Ga0105248_10841729 3300009177 Bacteria 1035
448 Ga0105237_10000528 3300009545 Bacteria 53756
449 Ga0105237_10009229 3300009545 Bacteria 10584
450 Ga0105237_10009236 3300009545 Bacteria 10577
451 Ga0105237_10011435 3300009545 Bacteria 9389
452 Ga0105237_10018995 3300009545 Bacteria 7103
453 Ga0105237_10030026 3300009545 Bacteria 5522
454 Ga0105237_10557879 3300009545 Unclassified 1152
455 Ga0105238_10002521 3300009551 Bacteria 18308
456 Ga0105238_10093340 3300009551 Bacteria 2998
457 Ga0105249_10000420 3300009553 Bacteria 40445
458 Ga0105249_10004650 3300009553 Bacteria 11851
459 Ga0105249_10006252 3300009553 Bacteria 10343
460 Ga0105249_10007262 3300009553 Bacteria 9664
461 Ga0105249_10008839 3300009553 Bacteria 8796
462 Ga0105249_10155341 3300009553 Bacteria 2206
463 Ga0105249_10177873 3300009553 Bacteria 2068
464 Ga0105249_10216869 3300009553 Bacteria 1881
465 Ga0105249_10285716 3300009553 Bacteria 1649
466 Ga0105249_10565320 3300009553 Unclassified 1189
467 Ga0105249_10570393 3300009553 Bacteria 1184
468 Ga0105249_10611980 3300009553 Bacteria 1145
469 Ga0105249_11959575 3300009553 Bacteria 658
470 Ga0105239_10000048 3300010375 Bacteria 177855
471 Ga0105239_10013397 3300010375 Bacteria 9110
472 Ga0105239_10014114 3300010375 Bacteria 8867
473 Ga0105239_10016535 3300010375 Bacteria 8156
474 Ga0105239_10044989 3300010375 Bacteria 4838
475 Ga0105239_10083913 3300010375 Bacteria 3509
476 Ga0105239_10117472 3300010375 Bacteria 2952
477 Ga0105239_10124064 3300010375 Bacteria 2870
478 Ga0105239_10655543 3300010375 Bacteria 1199
479 Ga0105246_10085274 3300011119 Bacteria 2262
480 Ga0105246_10253054 3300011119 Bacteria 1399
481 Ga0105246_10702653 3300011119 Bacteria 886
482 Ga0105246_10793536 3300011119 Bacteria 839
483 Ga0157373_10015305 3300013100 Bacteria 5608
484 Ga0157373_10024569 3300013100 Bacteria 4364
485 Ga0157373_10040694 3300013100 Bacteria 3325
486 Ga0157373_10135679 3300013100 Bacteria 1730
487 Ga0157373_10274084 3300013100 Bacteria 1195
488 Ga0157371_10009068 3300013102 Bacteria 7864
489 Ga0157371_10056386 3300013102 Bacteria 2787
490 Ga0157371_10166659 3300013102 Bacteria 1573
491 Ga0157371_10538645 3300013102 Bacteria 865
492 Ga0157371_10634494 3300013102 Unclassified 796
493 Ga0157370_10031158 3300013104 Bacteria 5219
494 Ga0157370_10031443 3300013104 Bacteria 5191
495 Ga0157370_10175301 3300013104 Bacteria 1993
496 Ga0157370_10221700 3300013104 Bacteria 1751
497 Ga0157369_10010499 3300013105 Bacteria 10540
498 Ga0157369_10020813 3300013105 Bacteria 7331
499 Ga0157369_10217587 3300013105 Bacteria 2000
500 Ga0157369_10406897 3300013105 Bacteria 1411
501 Ga0157369_10861412 3300013105 Bacteria 930
502 Ga0157374_10000001 3300013296 Bacteria 1077351
503 Ga0157374_10000084 3300013296 Bacteria 94138
504 Ga0157374_10010076 3300013296 Bacteria 8116
505 Ga0157374_10139672 3300013296 Bacteria 2351
506 Ga0157374_10237222 3300013296 Bacteria 1793
507 Ga0157374_10290382 3300013296 Bacteria 1616
508 Ga0157374_10314782 3300013296 Bacteria 1550
509 Ga0157374_10826950 3300013296 Bacteria 942
510 Ga0157374_10998093 3300013296 Bacteria 856
511 Ga0157378_10001872 3300013297 Bacteria 18898
512 Ga0157378_10005024 3300013297 Bacteria 11613
513 Ga0157378_10016814 3300013297 Bacteria 6411
514 Ga0157378_10061629 3300013297 Bacteria 3349
515 Ga0157378_10068743 3300013297 Bacteria 3177
516 Ga0157378_10091452 3300013297 Bacteria 2766
517 Ga0157378_10093436 3300013297 Bacteria 2738
518 Ga0157378_10172003 3300013297 Bacteria 2032
519 Ga0157378_10300108 3300013297 Bacteria 1554
520 Ga0157378_10334558 3300013297 Bacteria 1475
521 Ga0157378_11191584 3300013297 Bacteria 801
522 Ga0157378_11420805 3300013297 Bacteria 737
523 Ga0163162_10000113 3300013306 Bacteria 71491
524 Ga0163162_10004460 3300013306 Bacteria 13486
525 Ga0163162_10005078 3300013306 Bacteria 12676
526 Ga0163162_10024349 3300013306 Bacteria 5972
527 Ga0163162_10147273 3300013306 Bacteria 2471
528 Ga0163162_10310025 3300013306 Unclassified 1710
529 Ga0163162_10332847 3300013306 Bacteria 1651
530 Ga0163162_10594102 3300013306 Unclassified 1233
531 Ga0163162_10773065 3300013306 Unclassified 1079
532 Ga0163162_10798082 3300013306 Bacteria 1061
533 Ga0157372_10001128 3300013307 Bacteria 28999
534 Ga0157372_10017684 3300013307 Bacteria 7651
535 Ga0157372_10018926 3300013307 Bacteria 7410
536 Ga0157372_10028493 3300013307 Bacteria 6095
537 Ga0157372_10033034 3300013307 Bacteria 5680
538 Ga0157372_10034481 3300013307 Bacteria 5564
539 Ga0157372_10049030 3300013307 Bacteria 4695
540 Ga0157372_10078049 3300013307 Bacteria 3741
541 Ga0157372_10125220 3300013307 Bacteria 2954
542 Ga0157372_10170040 3300013307 Bacteria 2521
543 Ga0157372_10189115 3300013307 Bacteria 2384
544 Ga0157372_10315694 3300013307 Bacteria 1819
545 Ga0157372_10330167 3300013307 Bacteria 1776
546 Ga0157372_10432757 3300013307 Bacteria 1533
547 Ga0157372_10636806 3300013307 Unclassified 1242
548 Ga0157372_10698212 3300013307 Bacteria 1181
549 Ga0157372_10864749 3300013307 Bacteria 1049
550 Ga0157372_10939323 3300013307 Bacteria 1003
551 Ga0157372_10941927 3300013307 Bacteria 1001
552 Ga0157372_11301137 3300013307 Unclassified 839
553 Ga0157372_12109109 3300013307 Bacteria 648
554 Ga0157375_10000565 3300013308 Bacteria 33320
555 Ga0157375_10008080 3300013308 Bacteria 9203
556 Ga0157375_10009333 3300013308 Bacteria 8613
557 Ga0157375_10039328 3300013308 Bacteria 4552
558 Ga0157375_10360794 3300013308 Bacteria 1619
559 Ga0157375_10710708 3300013308 Unclassified 1158
560 Ga0157375_11279325 3300013308 Bacteria 862
561 Ga0157375_11848973 3300013308 Bacteria 716
562 Ga0163163_10000332 3300014325 Bacteria 45415
563 Ga0163163_10003608 3300014325 Bacteria 13149
564 Ga0163163_10178082 3300014325 Bacteria 2173
565 Ga0163163_10315331 3300014325 Unclassified 1617
566 Ga0163163_10680898 3300014325 Bacteria 1092
567 Ga0163163_10841096 3300014325 Bacteria 981
568 Ga0157380_10076849 3300014326 Bacteria 2719
569 Ga0157380_10175065 3300014326 Bacteria 1879
570 Ga0157380_10178350 3300014326 Bacteria 1864
571 Ga0157380_10618043 3300014326 Bacteria 1075
572 Ga0157377_10001951 3300014745 Bacteria 9020
573 Ga0157377_10012098 3300014745 Bacteria 4330
574 Ga0157377_10017126 3300014745 Bacteria 3743
575 Ga0157377_10024122 3300014745 Bacteria 3231
576 Ga0157377_10069632 3300014745 Bacteria 2030
577 Ga0157377_10171685 3300014745 Bacteria 1357
578 Ga0157377_10304935 3300014745 Bacteria 1052
579 Ga0157377_10406730 3300014745 Bacteria 928
580 Ga0157377_10570048 3300014745 Bacteria 803
581 Ga0157379_10000245 3300014968 Bacteria 42570
582 Ga0157379_10014342 3300014968 Bacteria 6954
583 Ga0157379_10068746 3300014968 Bacteria 3167
584 Ga0157379_10069217 3300014968 Bacteria 3156
585 Ga0157379_10147538 3300014968 Bacteria 2121
586 Ga0157379_10367538 3300014968 Bacteria 1319
587 Ga0157379_10546789 3300014968 Bacteria 1077
588 Ga0157379_10698722 3300014968 Bacteria 952
589 Ga0157376_10004247 3300014969 Bacteria 9945
590 Ga0157376_10008507 3300014969 Bacteria 7410
591 Ga0157376_10010209 3300014969 Bacteria 6857
592 Ga0157376_10062591 3300014969 Bacteria 3131
593 Ga0157376_10137812 3300014969 Bacteria 2186
594 Ga0157376_10189803 3300014969 Unclassified 1884
595 Ga0163161_10002092 3300017792 Bacteria 14468
596 Ga0163161_10019847 3300017792 Bacteria 4715
597 Ga0163161_10050884 3300017792 Bacteria 2999
598 Ga0163161_10120757 3300017792 Unclassified 1969
599 Ga0163161_10201859 3300017792 Bacteria 1533
600 Ga0163161_10628652 3300017792 Bacteria 888
601 Ga0207426_1000002 3300025302 Bacteria 1249660
602 Ga0207697_10016858 3300025315 Bacteria 3006
603 Ga0207697_10106645 3300025315 Bacteria 1197
604 Ga0207656_10001320 3300025321 Bacteria 8164
605 Ga0207656_10084856 3300025321 Bacteria 1429
606 Ga0207656_10182571 3300025321 Bacteria 1007
607 Ga0207682_10017385 3300025893 Bacteria 2808
608 Ga0207682_10030875 3300025893 Bacteria 2148
609 Ga0207682_10055276 3300025893 Bacteria 1650
610 Ga0207682_10078383 3300025893 Bacteria 1411
611 Ga0207682_10082740 3300025893 Bacteria 1379
612 Ga0207710_10001046 3300025900 Bacteria 14273
613 Ga0207688_10091986 3300025901 Bacteria 1743
614 Ga0207688_10114170 3300025901 Bacteria 1571
615 Ga0207680_10000648 3300025903 Bacteria 16407
616 Ga0207680_10249473 3300025903 Bacteria 1226
617 Ga0207680_10722125 3300025903 Bacteria 714
618 Ga0207647_10000282 3300025904 Bacteria 41535
619 Ga0207647_10026305 3300025904 Bacteria 3809
620 Ga0207647_10098198 3300025904 Unclassified 1740
621 Ga0207647_10481369 3300025904 Bacteria 693
622 Ga0207685_10266569 3300025905 Unclassified 835
623 Ga0207645_10000378 3300025907 Bacteria 36697
624 Ga0207645_10001750 3300025907 Bacteria 17617
625 Ga0207645_10064892 3300025907 Bacteria 2333
626 Ga0207645_10142954 3300025907 Bacteria 1559
627 Ga0207643_10003255 3300025908 Bacteria 8767
628 Ga0207643_10006561 3300025908 Bacteria 6237
629 Ga0207643_10096130 3300025908 Bacteria 1732
630 Ga0207643_10399306 3300025908 Bacteria 869
631 Ga0207705_10000717 3300025909 Bacteria 27323
632 Ga0207705_10310450 3300025909 Bacteria 1211
633 Ga0207705_10432917 3300025909 Bacteria 1019
634 Ga0207654_10000259 3300025911 Bacteria 32195
635 Ga0207654_10001858 3300025911 Bacteria 10926
636 Ga0207654_10236921 3300025911 Bacteria 1218
637 Ga0207654_10502640 3300025911 Bacteria 856
638 Ga0207707_10064209 3300025912 Unclassified 3196
639 Ga0207695_10000071 3300025913 Bacteria 315568
640 Ga0207695_10003138 3300025913 Bacteria 23612
641 Ga0207695_10151543 3300025913 Bacteria 2257
642 Ga0207695_10402521 3300025913 Bacteria 1253
643 Ga0207671_10001584 3300025914 Bacteria 25863
644 Ga0207671_10001605 3300025914 Bacteria 25707
645 Ga0207671_10011203 3300025914 Bacteria 7318
646 Ga0207671_10011315 3300025914 Bacteria 7272
647 Ga0207671_10011494 3300025914 Bacteria 7196
648 Ga0207671_10024824 3300025914 Bacteria 4504
649 Ga0207660_10595829 3300025917 Bacteria 900
650 Ga0207662_10031022 3300025918 Bacteria 3105
651 Ga0207662_10201020 3300025918 Bacteria 1290
652 Ga0207657_10001201 3300025919 Bacteria 27551
653 Ga0207657_10224636 3300025919 Unclassified 1503
654 Ga0207649_10001403 3300025920 Bacteria 14262
655 Ga0207649_10048281 3300025920 Bacteria 2625
656 Ga0207649_10155754 3300025920 Bacteria 1578
657 Ga0207649_10201995 3300025920 Bacteria 1405
658 Ga0207652_10125949 3300025921 Bacteria 2282
659 Ga0207652_10202896 3300025921 Bacteria 1785
660 Ga0207681_10015733 3300025923 Bacteria 4723
661 Ga0207681_10160043 3300025923 Bacteria 1696
662 Ga0207681_10196981 3300025923 Unclassified 1545
663 Ga0207681_10677541 3300025923 Bacteria 856
664 Ga0207694_10015117 3300025924 Bacteria 5820
665 Ga0207694_10126588 3300025924 Bacteria 2044
666 Ga0207650_10002349 3300025925 Bacteria 13146
667 Ga0207650_10015855 3300025925 Bacteria 5257
668 Ga0207650_10073238 3300025925 Bacteria 2579
669 Ga0207650_10203655 3300025925 Bacteria 1586
670 Ga0207650_10216168 3300025925 Bacteria 1541
671 Ga0207650_10508621 3300025925 Unclassified 1007
672 Ga0207650_10530879 3300025925 Unclassified 985
673 Ga0207650_10708065 3300025925 Bacteria 851
674 Ga0207659_10012507 3300025926 Bacteria 5402
675 Ga0207659_10016982 3300025926 Bacteria 4748
676 Ga0207659_10059936 3300025926 Bacteria 2738
677 Ga0207659_10079825 3300025926 Bacteria 2415
678 Ga0207659_10237656 3300025926 Bacteria 1472
679 Ga0207659_10296936 3300025926 Unclassified 1326
680 Ga0207659_10321875 3300025926 Bacteria 1276
681 Ga0207659_10793781 3300025926 Bacteria 813
682 Ga0207659_11044438 3300025926 Unclassified 703
683 Ga0207687_10558495 3300025927 Bacteria 961
684 Ga0207644_10193968 3300025931 Bacteria 1598
685 Ga0207644_10366810 3300025931 Bacteria 1172
686 Ga0207644_10433588 3300025931 Bacteria 1078
687 Ga0207644_10437842 3300025931 Unclassified 1073
688 Ga0207644_10691384 3300025931 Bacteria 850
689 Ga0207690_10011658 3300025932 Bacteria 5255
690 Ga0207690_10392426 3300025932 Bacteria 1105
691 Ga0207706_10014988 3300025933 Bacteria 7018
692 Ga0207706_10019835 3300025933 Bacteria 6043
693 Ga0207706_10063987 3300025933 Bacteria 3238
694 Ga0207706_10111772 3300025933 Bacteria 2403
695 Ga0207706_10530618 3300025933 Unclassified 1014
696 Ga0207706_10739502 3300025933 Bacteria 839
697 Ga0207706_10995053 3300025933 Bacteria 705
698 Ga0207686_10002728 3300025934 Bacteria 9576
699 Ga0207686_10184808 3300025934 Unclassified 1481
700 Ga0207686_10253974 3300025934 Unclassified 1286
701 Ga0207686_10977059 3300025934 Bacteria 686
702 Ga0207709_10033145 3300025935 Bacteria 3030
703 Ga0207709_10349223 3300025935 Bacteria 1116
704 Ga0207709_10882657 3300025935 Unclassified 726
705 Ga0207670_10010013 3300025936 Bacteria 5439
706 Ga0207670_10020775 3300025936 Bacteria 4040
707 Ga0207670_10077464 3300025936 Bacteria 2316
708 Ga0207670_10136811 3300025936 Bacteria 1802
709 Ga0207670_10139113 3300025936 Bacteria 1788
710 Ga0207670_10281808 3300025936 Bacteria 1295
711 Ga0207670_10483086 3300025936 Bacteria 1003
712 Ga0207670_11077491 3300025936 Unclassified 678
713 Ga0207669_10013132 3300025937 Bacteria 4102
714 Ga0207669_10476034 3300025937 Bacteria 994
715 Ga0207704_10035825 3300025938 Bacteria 2848
716 Ga0207704_10062612 3300025938 Bacteria 2314
717 Ga0207704_10085916 3300025938 Bacteria 2050
718 Ga0207704_10145587 3300025938 Bacteria 1664
719 Ga0207704_10374304 3300025938 Unclassified 1116
720 Ga0207704_10585272 3300025938 Unclassified 911
721 Ga0207704_10644324 3300025938 Bacteria 872
722 Ga0207691_10000227 3300025940 Bacteria 54652
723 Ga0207691_10018303 3300025940 Bacteria 6635
724 Ga0207691_10019517 3300025940 Bacteria 6413
725 Ga0207691_10023073 3300025940 Bacteria 5861
726 Ga0207691_10070385 3300025940 Bacteria 3159
727 Ga0207691_10154396 3300025940 Bacteria 2017
728 Ga0207691_10473036 3300025940 Bacteria 1065
729 Ga0207711_10593479 3300025941 Unclassified 1033
730 Ga0207689_10004619 3300025942 Bacteria 12455
731 Ga0207689_10005259 3300025942 Bacteria 11605
732 Ga0207689_10005402 3300025942 Bacteria 11436
733 Ga0207689_10012962 3300025942 Bacteria 7118
734 Ga0207689_10014584 3300025942 Bacteria 6681
735 Ga0207689_10052909 3300025942 Bacteria 3345
736 Ga0207689_10081387 3300025942 Bacteria 2662
737 Ga0207689_10101900 3300025942 Bacteria 2358
738 Ga0207689_10293775 3300025942 Bacteria 1346
739 Ga0207689_10395411 3300025942 Bacteria 1152
740 Ga0207689_10652924 3300025942 Unclassified 886
741 Ga0207689_10965166 3300025942 Bacteria 719
742 Ga0207661_10003913 3300025944 Bacteria 10396
743 Ga0207661_10005361 3300025944 Bacteria 9034
744 Ga0207661_10011467 3300025944 Bacteria 6423
745 Ga0207661_10052051 3300025944 Bacteria 3270
746 Ga0207661_10084855 3300025944 Bacteria 2624
747 Ga0207661_10099900 3300025944 Bacteria 2434
748 Ga0207661_10218416 3300025944 Bacteria 1684
749 Ga0207661_10220429 3300025944 Bacteria 1676
750 Ga0207679_10000866 3300025945 Bacteria 19372
751 Ga0207679_10148306 3300025945 Bacteria 1905
752 Ga0207679_10157852 3300025945 Bacteria 1854
753 Ga0207679_10294695 3300025945 Bacteria 1396
754 Ga0207679_10759619 3300025945 Bacteria 882
755 Ga0207679_10829787 3300025945 Bacteria 844
756 Ga0207667_10000177 3300025949 Bacteria 92852
757 Ga0207667_10045605 3300025949 Bacteria 4641
758 Ga0207667_10117097 3300025949 Bacteria 2746
759 Ga0207667_10178273 3300025949 Bacteria 2182
760 Ga0207667_10208610 3300025949 Bacteria 2003
761 Ga0207651_10006597 3300025960 Bacteria 6096
762 Ga0207651_10035717 3300025960 Bacteria 3236
763 Ga0207651_10075671 3300025960 Unclassified 2403
764 Ga0207651_10094555 3300025960 Bacteria 2198
765 Ga0207651_10111969 3300025960 Bacteria 2051
766 Ga0207651_10131738 3300025960 Bacteria 1915
767 Ga0207651_10210006 3300025960 Bacteria 1566
768 Ga0207651_10250091 3300025960 Unclassified 1450
769 Ga0207651_10446132 3300025960 Bacteria 1109
770 Ga0207651_10716179 3300025960 Bacteria 883
771 Ga0207651_10837462 3300025960 Unclassified 817
772 Ga0207712_10023170 3300025961 Bacteria 4095
773 Ga0207712_10053607 3300025961 Bacteria 2830
774 Ga0207712_10053644 3300025961 Bacteria 2829
775 Ga0207712_10061186 3300025961 Bacteria 2672
776 Ga0207712_10076648 3300025961 Bacteria 2421
777 Ga0207712_10111513 3300025961 Bacteria 2053
778 Ga0207712_10117017 3300025961 Bacteria 2009
779 Ga0207712_10120443 3300025961 Bacteria 1984
780 Ga0207712_10805608 3300025961 Bacteria 826
781 Ga0207712_11112258 3300025961 Unclassified 703
782 Ga0207668_10000679 3300025972 Bacteria 20879
783 Ga0207668_10301533 3300025972 Bacteria 1322
784 Ga0207668_10573302 3300025972 Bacteria 980
785 Ga0207668_10890313 3300025972 Bacteria 792
786 Ga0207640_10163792 3300025981 Bacteria 1649
787 Ga0207640_10242161 3300025981 Bacteria 1394
788 Ga0207640_10312204 3300025981 Bacteria 1248
789 Ga0207640_10337008 3300025981 Bacteria 1207
790 Ga0207640_10407162 3300025981 Unclassified 1109
791 Ga0207640_10846054 3300025981 Bacteria 796
792 Ga0207658_10000176 3300025986 Bacteria 68501
793 Ga0207658_10062740 3300025986 Bacteria 2782
794 Ga0207658_10183778 3300025986 Bacteria 1732
795 Ga0207658_10349102 3300025986 Bacteria 1288
796 Ga0207658_10977550 3300025986 Unclassified 772
797 Ga0207677_10004540 3300026023 Bacteria 7467
798 Ga0207677_10020044 3300026023 Bacteria 4052
799 Ga0207677_10087350 3300026023 Bacteria 2257
800 Ga0207677_10160935 3300026023 Bacteria 1744
801 Ga0207677_10221271 3300026023 Bacteria 1518
802 Ga0207677_10284267 3300026023 Bacteria 1359
803 Ga0207703_10006506 3300026035 Bacteria 9328
804 Ga0207703_10009195 3300026035 Bacteria 7772
805 Ga0207703_10079409 3300026035 Bacteria 2730
806 Ga0207703_10265000 3300026035 Unclassified 1554
807 Ga0207703_10361609 3300026035 Bacteria 1339
808 Ga0207703_10646556 3300026035 Bacteria 1003
809 Ga0207703_10974357 3300026035 Bacteria 813
810 Ga0207639_10003909 3300026041 Bacteria 10051
811 Ga0207639_10004963 3300026041 Bacteria 8962
812 Ga0207639_10091444 3300026041 Bacteria 2436
813 Ga0207639_10115704 3300026041 Bacteria 2194
814 Ga0207639_10137462 3300026041 Bacteria 2031
815 Ga0207639_10344487 3300026041 Bacteria 1329
816 Ga0207639_10474254 3300026041 Bacteria 1139
817 Ga0207678_10040176 3300026067 Bacteria 4058
818 Ga0207702_10168646 3300026078 Bacteria 2005
819 Ga0207702_10183994 3300026078 Bacteria 1926
820 Ga0207641_10000631 3300026088 Bacteria 38429
821 Ga0207641_10001151 3300026088 Bacteria 26569
822 Ga0207641_10002208 3300026088 Bacteria 18318
823 Ga0207641_10037605 3300026088 Bacteria 4043
824 Ga0207641_10100743 3300026088 Bacteria 2544
825 Ga0207641_10330327 3300026088 Bacteria 1448
826 Ga0207641_10356408 3300026088 Unclassified 1395
827 Ga0207648_10001692 3300026089 Bacteria 24146
828 Ga0207648_10002605 3300026089 Bacteria 19328
829 Ga0207648_10009064 3300026089 Bacteria 9571
830 Ga0207648_10076896 3300026089 Bacteria 2909
831 Ga0207648_10098855 3300026089 Bacteria 2555
832 Ga0207648_10137595 3300026089 Bacteria 2152
833 Ga0207648_10248623 3300026089 Bacteria 1585
834 Ga0207676_10005000 3300026095 Bacteria 9389
835 Ga0207676_10057114 3300026095 Unclassified 3072
836 Ga0207676_10065222 3300026095 Bacteria 2899
837 Ga0207676_10213664 3300026095 Bacteria 1713
838 Ga0207676_10215721 3300026095 Bacteria 1706
839 Ga0207676_10233315 3300026095 Unclassified 1646
840 Ga0207676_10283830 3300026095 Unclassified 1504
841 Ga0207676_10559975 3300026095 Bacteria 1093
842 Ga0207676_10561881 3300026095 Bacteria 1091
843 Ga0207676_10648211 3300026095 Bacteria 1019
844 Ga0207676_10819128 3300026095 Bacteria 909
845 Ga0207676_10866019 3300026095 Bacteria 884
846 Ga0207674_10006874 3300026116 Bacteria 13331
847 Ga0207674_10007431 3300026116 Bacteria 12770
848 Ga0207674_10053745 3300026116 Bacteria 4104
849 Ga0207674_10102570 3300026116 Unclassified 2841
850 Ga0207674_10116330 3300026116 Bacteria 2645
851 Ga0207674_10122120 3300026116 Bacteria 2571
852 Ga0207674_10127989 3300026116 Bacteria 2504
853 Ga0207674_10296970 3300026116 Unclassified 1564
854 Ga0207674_10317100 3300026116 Bacteria 1508
855 Ga0207674_10509988 3300026116 Bacteria 1162
856 Ga0207674_10575690 3300026116 Bacteria 1088
857 Ga0207674_10935994 3300026116 Bacteria 835
858 Ga0207675_100007646 3300026118 Bacteria 10204
859 Ga0207675_100019361 3300026118 Bacteria 6351
860 Ga0207675_100037348 3300026118 Bacteria 4531
861 Ga0207675_100040464 3300026118 Bacteria 4353
862 Ga0207675_100066675 3300026118 Bacteria 3365
863 Ga0207675_100077392 3300026118 Bacteria 3116
864 Ga0207675_100115439 3300026118 Bacteria 2537
865 Ga0207675_100118493 3300026118 Bacteria 2503
866 Ga0207683_10002881 3300026121 Bacteria 14998
867 Ga0207683_10036466 3300026121 Bacteria 4282
868 Ga0207698_10026276 3300026142 Bacteria 4116
869 Ga0207698_10058347 3300026142 Bacteria 2991
870 Ga0207698_10338777 3300026142 Bacteria 1416
871 Ga0207698_10555401 3300026142 Bacteria 1126
872 Ga0207698_10719298 3300026142 Unclassified 995
873 Ga0207698_10913275 3300026142 Bacteria 886
874 Ga0209995_1039129 3300027471 Bacteria 799
875 Ga0207428_10030362 3300027907 Bacteria 4468
876 Ga0207428_10750218 3300027907 Unclassified 696
877 Ga0268266_10003258 3300028379 Bacteria 16362
878 Ga0268266_10253760 3300028379 Unclassified 1628
879 Ga0268265_10004320 3300028380 Bacteria 9900
880 Ga0268265_10380226 3300028380 Bacteria 1299
881 Ga0268265_10879310 3300028380 Bacteria 879
882 Ga0268264_10002823 3300028381 Bacteria 15162
883 Ga0268264_10003175 3300028381 Bacteria 14234
884 Ga0268264_10017151 3300028381 Bacteria 5930
885 Ga0268264_10034103 3300028381 Bacteria 4185
886 Ga0268264_10447713 3300028381 Bacteria 1250
887 Ga0268264_10552878 3300028381 Bacteria 1129
888 Ga0307515_10000072 3300028794 Bacteria 237798
889 Ga0265327_10077307 3300031251 Bacteria 1652
890 Ga0307513_10277312 3300031456 Unclassified 1456
891 Ga0307509_10111956 3300031507 Bacteria 2730
892 Ga0307509_10134744 3300031507 Bacteria 2418
893 Ga0265313_10098515 3300031595 Bacteria 1301
894 Ga0307405_10039704 3300031731 Bacteria 2847
895 Ga0307413_10046411 3300031824 Bacteria 2583
896 Ga0307410_10127969 3300031852 Bacteria 1862
897 Ga0307406_11073751 3300031901 Bacteria 694
898 Ga0307407_10109982 3300031903 Bacteria 1728
899 Ga0307407_10585515 3300031903 Bacteria 829
900 Ga0307412_10629936 3300031911 Bacteria 912
901 Ga0307412_11376664 3300031911 Bacteria 638
902 Ga0307409_100142886 3300031995 Bacteria 2065
903 Ga0307416_100152767 3300032002 Bacteria 2120
904 Ga0307414_10594060 3300032004 Bacteria 992
905 Ga0307411_10064618 3300032005 Bacteria 2451
906 Ga0307415_100095007 3300032126 Bacteria 2169
907 Ga0307415_100340303 3300032126 Bacteria 1259
908 Ga0307415_100734209 3300032126 Bacteria 895
909 Ga0307510_10000091 3300033180 Bacteria 68694
910 Ga0373952_0131773 3300035092 Unclassified 687
911 Ga0373923_0035099 3300035111 Bacteria 2040
912 Ga0373947_0463711 3300035725 Bacteria 859
913 Ga0373937_0038798 3300036401 Bacteria 4340
914 Ga0373925_0973541 3300037068 Bacteria 699
915 Ga0395900_0060995 3300037418 Bacteria 3879
916 Ga0395900_0258219 3300037418 Bacteria 1741
917 Ga0395900_0543223 3300037418 Bacteria 1108
918 Ga0395905_0000003 3300037471 Bacteria 1347396
919 Ga0395905_0009263 3300037471 Bacteria 9636
920 Ga0395905_0032320 3300037471 Bacteria 4922
921 Ga0395905_0078586 3300037471 Bacteria 3092
922 Ga0395905_0267038 3300037471 Bacteria 1597
923 Ga0395905_0963051 3300037471 Bacteria 756
924 Ga0395905_1059981 3300037471 Bacteria 714
925 Ga0436365_1285215 3300039437 Bacteria 11167
926 Ga0436363_0330490 3300039450 Bacteria 1133
927 Ga0451802_1218311 3300041460 Bacteria 649
928 Ga0451853_2475148 3300041512 Bacteria 1061
929 Ga0451853_3841961 3300041512 Bacteria 1537
930 Ga0439431_0090559 3300041997 Bacteria 833
931 Ga0439441_004375 3300042001 Bacteria 2139
932 Ga0439441_024579 3300042001 Bacteria 1132
933 Ga0439443_022276 3300042003 Unclassified 1005
934 Ga0439449_0002804 3300042007 Bacteria 6773
935 Ga0439457_031175 3300042014 Bacteria 1182
936 Ga0439434_0074458 3300042435 Unclassified 1072
937 Ga0439464_0097162 3300042439 Unclassified 892
938 Ga0451577_0073865 3300042876 Bacteria 3042
939 Ga0466969_0001246 3300044656 Bacteria 13732
940 Ga0466969_0071945 3300044656 Bacteria 1662
941 Ga0466972_0000013 3300044658 Bacteria 229345
942 Ga0466972_0010547 3300044658 Bacteria 4637
943 Ga0466972_0370278 3300044658 Bacteria 671
944 Ga0466965_0198393 3300044683 Bacteria 1064
945 Ga0466966_0000045 3300044684 Bacteria 92504
946 Ga0466966_0066006 3300044684 Bacteria 2275
947 Ga0466961_0020337 3300044693 Bacteria 4270
948 Ga0453684_0090642 3300044712 Bacteria 3777
949 Ga0466971_0145642 3300044719 Bacteria 1104
950 Ga0466968_0204283 3300044735 Bacteria 926
951 Ga0466970_0001156 3300044765 Bacteria 12789
952 Ga0466957_0000070 3300044842 Bacteria 39824
953 Ga0466957_0042684 3300044842 Bacteria 2745
954 Ga0466957_0591986 3300044842 Bacteria 776
955 Ga0466959_0000023 3300045049 Bacteria 124545
956 Ga0466959_0008989 3300045049 Bacteria 7085
957 Ga0466959_0125397 3300045049 Bacteria 1823
958 Ga0451576_0904562 3300045051 Bacteria 926
959 Ga0451576_1047326 3300045051 Bacteria 854
960 Ga0466967_0123268 3300045976 Bacteria 2398
961 Ga0495606_0004249 3300046507 Bacteria 14482
962 Ga0495628_0112891 3300046516 Bacteria 2089
963 Ga0495643_0050744 3300046522 Bacteria 2234
964 Ga0495587_0051505 3300046536 Bacteria 2434
965 Ga0495611_0045973 3300046648 Bacteria 1956
966 Ga0495625_0436769 3300046660 Bacteria 811
967 Ga0495657_0278633 3300046675 Unclassified 1001
968 Ga0495613_0367838 3300046689 Bacteria 985
969 Ga0495604_0449793 3300047317 Bacteria 842
970 Ga0495674_0096356 3300047319 Bacteria 2522
971 Ga0495672_0015619 3300047320 Bacteria 5147
972 Ga0495676_0293233 3300047321 Bacteria 1099
973 Ga0495676_0578522 3300047321 Bacteria 732
974 Ga0495680_0218622 3300047322 Unclassified 1361
975 Ga0495687_000001 3300047443 Bacteria 1215582
976 Ga0495684_0226719 3300047471 Unclassified 1368
977 Ga0496105_0159201 3300048908 Bacteria 1854
978 Ga0496109_0311902 3300048912 Bacteria 1484
979 Ga0496110_0171267 3300048913 Unclassified 1970
980 Ga0496110_0180830 3300048913 Bacteria 1915
981 Ga0501298_009953 3300049521 Bacteria 1626
982 Ga0501301_016588 3300049524 Bacteria 668
983 Ga0501031_0287330 3300049568 Bacteria 1066
984 Ga0501034_0022717 3300049571 Bacteria 6389
985 Ga0501034_0558505 3300049571 Bacteria 1053
986 Ga0501036_0154076 3300049572 Bacteria 1938
987 Ga0501037_0146479 3300049573 Bacteria 1689
988 Ga0501038_0019364 3300049574 Bacteria 6136
989 Ga0501038_0370341 3300049574 Bacteria 1113
990 Ga0501043_0003765 3300049579 Bacteria 12466
991 Ga0501043_0024677 3300049579 Bacteria 4715
992 Ga0501043_0038841 3300049579 Bacteria 3743
993 Ga0501046_0081476 3300049580 Bacteria 2499
994 Ga0501046_0444175 3300049580 Bacteria 933
995 Ga0501072_0285552 3300049588 Bacteria 1312
996 Ga0501073_0024177 3300049589 Bacteria 4361
997 Ga0501198_020162 3300049649 Bacteria 1055
998 Ga0501198_034988 3300049649 Bacteria 852
999 Ga0501202_000075 3300049652 Bacteria 10572
1000 Ga0501202_001677 3300049652 Bacteria 3586
1001 Ga0501206_005016 3300049653 Bacteria 1701
1002 Ga0501207_092800 3300049654 Bacteria 596
1003 Ga0501209_040616 3300049656 Bacteria 1229
1004 Ga0501211_009429 3300049658 Bacteria 957
1005 Ga0501217_002570 3300049661 Bacteria 3588
1006 Ga0501217_004398 3300049661 Bacteria 2894
1007 Ga0501222_023448 3300049662 Bacteria 832
1008 Ga0501223_002561 3300049663 Bacteria 4019
1009 Ga0501224_000798 3300049664 Bacteria 3988
1010 Ga0501224_011073 3300049664 Bacteria 1325
1011 Ga0501240_004216 3300049673 Bacteria 1656
1012 Ga0501240_031461 3300049673 Bacteria 850
1013 Ga0501240_046749 3300049673 Bacteria 733
1014 Ga0501249_082644 3300049679 Bacteria 757
1015 Ga0501250_000849 3300049680 Bacteria 2278
1016 Ga0501252_018495 3300049682 Bacteria 893
1017 Ga0501257_000560 3300049686 Bacteria 7376
1018 Ga0501257_095560 3300049686 Bacteria 776
1019 Ga0501259_000437 3300049688 Bacteria 6586
1020 Ga0501259_001665 3300049688 Bacteria 3699
1021 Ga0501219_000027 3300049703 Bacteria 23249
1022 Ga0501221_000197 3300049704 Bacteria 8501
1023 Ga0501221_005522 3300049704 Bacteria 2115
1024 Ga0501221_015199 3300049704 Bacteria 1441
1025 Ga0501225_0012209 3300049705 Bacteria 2413
1026 Ga0501225_0037378 3300049705 Bacteria 1338
1027 Ga0501225_0037891 3300049705 Bacteria 1329
1028 Ga0501229_038859 3300049706 Bacteria 673
1029 Ga0501234_002498 3300049707 Bacteria 2891
1030 Ga0501234_007842 3300049707 Bacteria 1669
1031 Ga0501245_001664 3300049708 Bacteria 2903
1032 Ga0501245_013938 3300049708 Bacteria 1195
1033 Ga0501245_021133 3300049708 Bacteria 1020
1034 Ga0501080_0355785 3300049742 Bacteria 1321
1035 Ga0501083_0175553 3300049744 Bacteria 1400
1036 Ga0501241_019118 3300049758 Bacteria 1256
1037 Ga0501241_062282 3300049758 Bacteria 751
1038 Ga0501266_012323 3300049763 Bacteria 1102
1039 Ga0501268_001349 3300049765 Bacteria 3047
1040 Ga0501268_072047 3300049765 Bacteria 701
1041 Ga0501269_013660 3300049766 Bacteria 995
1042 Ga0501270_016880 3300049767 Bacteria 1061
1043 Ga0501272_005628 3300049769 Bacteria 1324
1044 Ga0501274_015541 3300049771 Bacteria 748
1045 Ga0501279_012603 3300049775 Bacteria 1151
1046 Ga0501035_0056798 3300049822 Bacteria 3491
1047 Ga0501035_0131122 3300049822 Bacteria 2185
1048 Ga0501044_0045447 3300049823 Bacteria 4549
1049 Ga0501044_0157184 3300049823 Bacteria 2252
1050 Ga0501284_00021 3300050005 Bacteria 89729
1051 nmdc:mga0k408_218880_c1 3300050493 Bacteria 1137
1052 nmdc:mga0k408_23568_c1 3300050493 Bacteria 3474
1053 nmdc:mga05p37_12189_c1 3300050507 Bacteria 10264
1054 nmdc:mga05p37_129725_c1 3300050507 Bacteria 3093
1055 nmdc:mga09592_152263_c1 3300050508 Bacteria 1996
1056 nmdc:mga09592_421360_c1 3300050508 Bacteria 1153
1057 nmdc:mga09592_5207_c1 3300050508 Bacteria 10567
1058 nmdc:mga0qj67_23710_c1 3300050509 Bacteria 4723
1059 nmdc:mga08y16_85815_c1 3300050511 Bacteria 3281
1060 nmdc:mga08y16_96143_c1 3300050511 Bacteria 3085
1061 nmdc:mga0n895_1093269_c1 3300050512 Bacteria 775
1062 nmdc:mga0n895_402408_c1 3300050512 Unclassified 1384
1063 nmdc:mga0rr50_1039330_c1 3300050513 Bacteria 697
1064 Ga0500644_0043430 3300053088 Bacteria 1504
1065 Ga0500651_0325374 3300053093 Bacteria 877
1066 Ga0500641_0006740 3300053096 Bacteria 4085
1067 Ga0500562_000096 3300053108 Bacteria 33894
1068 Ga0500588_0000589 3300053146 Bacteria 5959
1069 Ga0500637_0114965 3300053178 Bacteria 1561
1070 Ga0500611_000011 3300053727 Bacteria 141259
1071 Ga0500645_006772 3300053730 Bacteria 4057
1072 Ga0500661_017685 3300055283 Bacteria 1273
1073 Ga0466962_0006963 3300061719 Bacteria 5420

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_11420805 Ga0157378_114208052 168
2 3300005842 Ga0068858_101110621 Ga0068858_1011106211 171
3 3300049686 Ga0501257_095560 Ga0501257_095560_151_669 171
4 3300013102 Ga0157371_10538645 Ga0157371_105386451 173
5 3300013105 Ga0157369_10861412 Ga0157369_108614122 173
6 3300013296 Ga0157374_10998093 Ga0157374_109980931 173
7 3300013307 Ga0157372_10078049 Ga0157372_100780493 173
8 3300014326 Ga0157380_10175065 Ga0157380_101750652 173
9 3300025893 Ga0207682_10078383 Ga0207682_100783832 173
10 3300025925 Ga0207650_10216168 Ga0207650_102161682 173
11 3300025940 Ga0207691_10154396 Ga0207691_101543962 173
12 3300025972 Ga0207668_10573302 Ga0207668_105733022 173
13 3300042435 Ga0439434_0074458 Ga0439434_0074458_517_1041 173
14 3300044693 Ga0466961_0020337 Ga0466961_0020337_3552_4073 173
15 3300044712 Ga0453684_0090642 Ga0453684_0090642_2491_3015 173
16 3300044842 Ga0466957_0042684 Ga0466957_0042684_1950_2471 173
17 3300045051 Ga0451576_0904562 Ga0451576_0904562_120_644 173
18 3300049673 Ga0501240_046749 Ga0501240_046749_155_679 173
19 3300049680 Ga0501250_000849 Ga0501250_000849_314_838 173
20 3300049682 Ga0501252_018495 Ga0501252_018495_75_599 173
21 3300049704 Ga0501221_015199 Ga0501221_015199_457_981 173
22 3300049763 Ga0501266_012323 Ga0501266_012323_492_1016 173
23 3300049765 Ga0501268_072047 Ga0501268_072047_94_618 173
24 3300049769 Ga0501272_005628 Ga0501272_005628_474_998 173
25 3300003322 rootL2_10203795 rootL2_102037952 175
26 3300003354 JGI25160J50197_1028187 JGI25160J50197_10281871 175
27 3300005335 Ga0070666_10648648 Ga0070666_106486482 175
28 3300009545 Ga0105237_10009229 Ga0105237_100092298 175
29 3300009545 Ga0105237_10011435 Ga0105237_100114356 175
30 3300009551 Ga0105238_10002521 Ga0105238_100025219 175
31 3300010375 Ga0105239_10014114 Ga0105239_100141146 175
32 3300013307 Ga0157372_11301137 Ga0157372_113011372 175
33 3300025302 Ga0207426_1000002 Ga0207426_1000002163 175
34 3300044658 Ga0466972_0010547 Ga0466972_0010547_3861_4388 175
35 3300044735 Ga0466968_0204283 Ga0466968_0204283_217_744 175
36 3300053088 Ga0500644_0043430 Ga0500644_0043430_26_553 175
37 3300053108 Ga0500562_000096 Ga0500562_000096_29162_29689 175
38 3300053727 Ga0500611_000011 Ga0500611_000011_50325_50891 177
39 3300003323 rootH1_10060685 rootH1_100606853 178
40 3300005334 Ga0068869_100016584 Ga0068869_1000165844 179
41 3300005719 Ga0068861_100034867 Ga0068861_1000348673 179
42 3300005844 Ga0068862_100059367 Ga0068862_1000593672 179
43 3300025942 Ga0207689_10014584 Ga0207689_100145843 179
44 3300026118 Ga0207675_100066675 Ga0207675_1000666753 179
45 iso_pu_bacteria 2818991444 2819587455 183
46 3300049708 Ga0501245_013938 Ga0501245_013938_618_1175 184
47 3300031251 Ga0265327_10077307 Ga0265327_100773072 185
48 3300037471 Ga0395905_0000003 Ga0395905_0000003_607642_608208 185
49 3300041512 Ga0451853_2475148 Ga0451853_2475148_50_616 185
50 2162886011 MRS1b_contig_1772662 MRS1b_0619.00001620 187
51 2162886012 MBSR1b_contig_12669236 MBSR1b_0936.00002560 187
52 3300000652 ARCol0yngRDRAFT_1009151 ARCol0yngRDRAFT_10091511 187
53 3300002075 JGI24738J21930_10036993 JGI24738J21930_100369931 187
54 3300002077 JGI24744J21845_10043095 JGI24744J21845_100430952 187
55 3300002244 JGI24742J22300_10014980 JGI24742J22300_100149802 187
56 3300003316 rootH1_10135696 rootH1_101356962 187
57 3300003320 rootH2_10020409 rootH2_100204093 187
58 3300003320 rootH2_10030789 rootH2_1003078921 187
59 3300003320 rootH2_10042646 rootH2_100426466 187
60 3300005289 Ga0065704_10114868 Ga0065704_101148683 187
61 3300005289 Ga0065704_10254632 Ga0065704_102546322 187
62 3300005290 Ga0065712_10004322 Ga0065712_100043222 187
63 3300005290 Ga0065712_10077307 Ga0065712_100773073 187
64 3300005290 Ga0065712_10263234 Ga0065712_102632341 187
65 3300005293 Ga0065715_10588591 Ga0065715_105885911 187
66 3300005295 Ga0065707_10024347 Ga0065707_100243472 187
67 3300005295 Ga0065707_10105866 Ga0065707_101058661 187
68 3300005295 Ga0065707_10342174 Ga0065707_103421742 187
69 3300005327 Ga0070658_10190011 Ga0070658_101900112 187
70 3300005327 Ga0070658_10240820 Ga0070658_102408202 187
71 3300005327 Ga0070658_10499951 Ga0070658_104999511 187
72 3300005327 Ga0070658_10856487 Ga0070658_108564872 187
73 3300005328 Ga0070676_10000932 Ga0070676_100009328 187
74 3300005328 Ga0070676_10571573 Ga0070676_105715731 187
75 3300005329 Ga0070683_100001892 Ga0070683_1000018927 187
76 3300005329 Ga0070683_100007576 Ga0070683_10000757613 187
77 3300005329 Ga0070683_100016743 Ga0070683_1000167432 187
78 3300005329 Ga0070683_100019212 Ga0070683_1000192126 187
79 3300005329 Ga0070683_100053668 Ga0070683_1000536683 187
80 3300005329 Ga0070683_100264414 Ga0070683_1002644141 187
81 3300005330 Ga0070690_100015166 Ga0070690_1000151663 187
82 3300005330 Ga0070690_100068031 Ga0070690_1000680313 187
83 3300005331 Ga0070670_100012284 Ga0070670_1000122845 187
84 3300005331 Ga0070670_100035924 Ga0070670_1000359245 187
85 3300005331 Ga0070670_100036566 Ga0070670_1000365663 187
86 3300005331 Ga0070670_100036748 Ga0070670_1000367482 187
87 3300005331 Ga0070670_100078687 Ga0070670_1000786873 187
88 3300005331 Ga0070670_100089258 Ga0070670_1000892582 187
89 3300005331 Ga0070670_100091035 Ga0070670_1000910353 187
90 3300005331 Ga0070670_100104333 Ga0070670_1001043333 187
91 3300005331 Ga0070670_100144191 Ga0070670_1001441912 187
92 3300005331 Ga0070670_100160342 Ga0070670_1001603422 187
93 3300005331 Ga0070670_100269117 Ga0070670_1002691172 187
94 3300005331 Ga0070670_100994162 Ga0070670_1009941621 187
95 3300005333 Ga0070677_10077856 Ga0070677_100778562 187
96 3300005333 Ga0070677_10115573 Ga0070677_101155732 187
97 3300005333 Ga0070677_10129117 Ga0070677_101291172 187
98 3300005334 Ga0068869_100002337 Ga0068869_10000233710 187
99 3300005334 Ga0068869_100017315 Ga0068869_1000173154 187
100 3300005334 Ga0068869_100031071 Ga0068869_1000310714 187
101 3300005334 Ga0068869_100058283 Ga0068869_1000582832 187
102 3300005334 Ga0068869_100076905 Ga0068869_1000769052 187
103 3300005334 Ga0068869_100097426 Ga0068869_1000974262 187
104 3300005334 Ga0068869_100102193 Ga0068869_1001021933 187
105 3300005334 Ga0068869_100119200 Ga0068869_1001192001 187
106 3300005334 Ga0068869_100571015 Ga0068869_1005710152 187
107 3300005334 Ga0068869_100671682 Ga0068869_1006716821 187
108 3300005335 Ga0070666_10000833 Ga0070666_100008339 187
109 3300005335 Ga0070666_10015420 Ga0070666_100154201 187
110 3300005335 Ga0070666_10020501 Ga0070666_100205013 187
111 3300005335 Ga0070666_10206403 Ga0070666_102064032 187
112 3300005335 Ga0070666_10311104 Ga0070666_103111041 187
113 3300005336 Ga0070680_100103219 Ga0070680_1001032191 187
114 3300005337 Ga0070682_100025159 Ga0070682_1000251591 187
115 3300005337 Ga0070682_100435585 Ga0070682_1004355851 187
116 3300005338 Ga0068868_100000091 Ga0068868_1000000917 187
117 3300005338 Ga0068868_100003227 Ga0068868_1000032276 187
118 3300005338 Ga0068868_100005969 Ga0068868_1000059693 187
119 3300005338 Ga0068868_100017172 Ga0068868_1000171724 187
120 3300005338 Ga0068868_100017820 Ga0068868_1000178204 187
121 3300005338 Ga0068868_100050580 Ga0068868_1000505803 187
122 3300005338 Ga0068868_100437582 Ga0068868_1004375821 187
123 3300005338 Ga0068868_101133717 Ga0068868_1011337171 187
124 3300005339 Ga0070660_100007804 Ga0070660_1000078043 187
125 3300005340 Ga0070689_100075317 Ga0070689_1000753173 187
126 3300005340 Ga0070689_100097914 Ga0070689_1000979142 187
127 3300005340 Ga0070689_100099393 Ga0070689_1000993933 187
128 3300005340 Ga0070689_100100163 Ga0070689_1001001632 187
129 3300005340 Ga0070689_100126083 Ga0070689_1001260833 187
130 3300005340 Ga0070689_100470179 Ga0070689_1004701791 187
131 3300005340 Ga0070689_100707738 Ga0070689_1007077381 187
132 3300005343 Ga0070687_100049753 Ga0070687_1000497532 187
133 3300005343 Ga0070687_100065980 Ga0070687_1000659802 187
134 3300005343 Ga0070687_100151924 Ga0070687_1001519242 187
135 3300005344 Ga0070661_100000998 Ga0070661_1000009983 187
136 3300005344 Ga0070661_100055301 Ga0070661_1000553013 187
137 3300005347 Ga0070668_100000043 Ga0070668_10000004342 187
138 3300005347 Ga0070668_100014986 Ga0070668_1000149863 187
139 3300005347 Ga0070668_100238069 Ga0070668_1002380692 187
140 3300005347 Ga0070668_100326349 Ga0070668_1003263492 187
141 3300005347 Ga0070668_100329169 Ga0070668_1003291692 187
142 3300005347 Ga0070668_100807142 Ga0070668_1008071421 187
143 3300005353 Ga0070669_100010916 Ga0070669_1000109165 187
144 3300005353 Ga0070669_100011863 Ga0070669_1000118632 187
145 3300005353 Ga0070669_100055419 Ga0070669_1000554192 187
146 3300005353 Ga0070669_100100993 Ga0070669_1001009933 187
147 3300005353 Ga0070669_100197168 Ga0070669_1001971682 187
148 3300005353 Ga0070669_100333602 Ga0070669_1003336022 187
149 3300005353 Ga0070669_100529024 Ga0070669_1005290242 187
150 3300005354 Ga0070675_100016806 Ga0070675_1000168064 187
151 3300005354 Ga0070675_100040377 Ga0070675_1000403773 187
152 3300005354 Ga0070675_100046961 Ga0070675_1000469612 187
153 3300005354 Ga0070675_100077696 Ga0070675_1000776963 187
154 3300005354 Ga0070675_100140247 Ga0070675_1001402471 187
155 3300005354 Ga0070675_100155730 Ga0070675_1001557302 187
156 3300005354 Ga0070675_100172433 Ga0070675_1001724332 187
157 3300005354 Ga0070675_100183471 Ga0070675_1001834712 187
158 3300005354 Ga0070675_100379574 Ga0070675_1003795742 187
159 3300005354 Ga0070675_100471186 Ga0070675_1004711862 187
160 3300005354 Ga0070675_100727582 Ga0070675_1007275822 187
161 3300005355 Ga0070671_100013905 Ga0070671_1000139054 187
162 3300005355 Ga0070671_100121885 Ga0070671_1001218853 187
163 3300005355 Ga0070671_100175449 Ga0070671_1001754492 187
164 3300005355 Ga0070671_100182088 Ga0070671_1001820881 187
165 3300005355 Ga0070671_100258283 Ga0070671_1002582832 187
166 3300005355 Ga0070671_100270702 Ga0070671_1002707022 187
167 3300005355 Ga0070671_100298122 Ga0070671_1002981221 187
168 3300005355 Ga0070671_100344012 Ga0070671_1003440121 187
169 3300005355 Ga0070671_100432733 Ga0070671_1004327331 187
170 3300005356 Ga0070674_100053820 Ga0070674_1000538202 187
171 3300005356 Ga0070674_100056755 Ga0070674_1000567553 187
172 3300005356 Ga0070674_100073920 Ga0070674_1000739202 187
173 3300005356 Ga0070674_100182923 Ga0070674_1001829231 187
174 3300005356 Ga0070674_100269074 Ga0070674_1002690741 187
175 3300005356 Ga0070674_100616089 Ga0070674_1006160891 187
176 3300005364 Ga0070673_100012785 Ga0070673_1000127854 187
177 3300005364 Ga0070673_100013846 Ga0070673_1000138465 187
178 3300005364 Ga0070673_100019331 Ga0070673_1000193313 187
179 3300005364 Ga0070673_100048748 Ga0070673_1000487482 187
180 3300005364 Ga0070673_100069027 Ga0070673_1000690272 187
181 3300005364 Ga0070673_100071700 Ga0070673_1000717003 187
182 3300005364 Ga0070673_100171374 Ga0070673_1001713741 187
183 3300005364 Ga0070673_100614801 Ga0070673_1006148012 187
184 3300005364 Ga0070673_101126804 Ga0070673_1011268041 187
185 3300005365 Ga0070688_100001211 Ga0070688_1000012113 187
186 3300005365 Ga0070688_100054375 Ga0070688_1000543752 187
187 3300005365 Ga0070688_100067445 Ga0070688_1000674452 187
188 3300005365 Ga0070688_100079251 Ga0070688_1000792512 187
189 3300005365 Ga0070688_100163879 Ga0070688_1001638792 187
190 3300005365 Ga0070688_100274493 Ga0070688_1002744931 187
191 3300005366 Ga0070659_100012950 Ga0070659_1000129505 187
192 3300005366 Ga0070659_100048059 Ga0070659_1000480593 187
193 3300005366 Ga0070659_100526146 Ga0070659_1005261461 187
194 3300005366 Ga0070659_100793684 Ga0070659_1007936841 187
195 3300005367 Ga0070667_100000254 Ga0070667_10000025435 187
196 3300005367 Ga0070667_100022994 Ga0070667_1000229944 187
197 3300005367 Ga0070667_100049982 Ga0070667_1000499823 187
198 3300005367 Ga0070667_100078410 Ga0070667_1000784101 187
199 3300005367 Ga0070667_100170549 Ga0070667_1001705493 187
200 3300005367 Ga0070667_100244950 Ga0070667_1002449502 187
201 3300005367 Ga0070667_100431265 Ga0070667_1004312652 187
202 3300005367 Ga0070667_101120913 Ga0070667_1011209131 187
203 3300005438 Ga0070701_10060827 Ga0070701_100608271 187
204 3300005438 Ga0070701_10066706 Ga0070701_100667062 187
205 3300005440 Ga0070705_100191810 Ga0070705_1001918102 187
206 3300005441 Ga0070700_100054188 Ga0070700_1000541882 187
207 3300005441 Ga0070700_100157347 Ga0070700_1001573472 187
208 3300005456 Ga0070678_100004350 Ga0070678_1000043505 187
209 3300005456 Ga0070678_100057910 Ga0070678_1000579101 187
210 3300005456 Ga0070678_100373337 Ga0070678_1003733372 187
211 3300005456 Ga0070678_100428371 Ga0070678_1004283711 187
212 3300005457 Ga0070662_100010688 Ga0070662_1000106881 187
213 3300005457 Ga0070662_100014815 Ga0070662_1000148154 187
214 3300005457 Ga0070662_100020923 Ga0070662_1000209234 187
215 3300005457 Ga0070662_100027652 Ga0070662_1000276523 187
216 3300005457 Ga0070662_100060059 Ga0070662_1000600592 187
217 3300005457 Ga0070662_100087226 Ga0070662_1000872263 187
218 3300005457 Ga0070662_100197069 Ga0070662_1001970692 187
219 3300005457 Ga0070662_100504918 Ga0070662_1005049181 187
220 3300005457 Ga0070662_100651932 Ga0070662_1006519321 187
221 3300005458 Ga0070681_10002668 Ga0070681_100026686 187
222 3300005459 Ga0068867_100003884 Ga0068867_1000038847 187
223 3300005459 Ga0068867_100034619 Ga0068867_1000346192 187
224 3300005459 Ga0068867_100109335 Ga0068867_1001093353 187
225 3300005459 Ga0068867_100233541 Ga0068867_1002335412 187
226 3300005459 Ga0068867_100319758 Ga0068867_1003197581 187
227 3300005459 Ga0068867_100547920 Ga0068867_1005479202 187
228 3300005466 Ga0070685_10161660 Ga0070685_101616602 187
229 3300005466 Ga0070685_10270157 Ga0070685_102701572 187
230 3300005466 Ga0070685_10496073 Ga0070685_104960731 187
231 3300005467 Ga0070706_100430297 Ga0070706_1004302972 187
232 3300005467 Ga0070706_100465549 Ga0070706_1004655491 187
233 3300005471 Ga0070698_100001232 Ga0070698_10000123230 187
234 3300005471 Ga0070698_100001401 Ga0070698_10000140116 187
235 3300005471 Ga0070698_100024342 Ga0070698_1000243421 187
236 3300005471 Ga0070698_100175844 Ga0070698_1001758442 187
237 3300005518 Ga0070699_100073116 Ga0070699_1000731163 187
238 3300005530 Ga0070679_100064164 Ga0070679_1000641644 187
239 3300005530 Ga0070679_101000488 Ga0070679_1010004882 187
240 3300005535 Ga0070684_100000143 Ga0070684_10000014335 187
241 3300005535 Ga0070684_100004638 Ga0070684_1000046388 187
242 3300005535 Ga0070684_100008847 Ga0070684_1000088475 187
243 3300005535 Ga0070684_100015352 Ga0070684_1000153526 187
244 3300005535 Ga0070684_100060599 Ga0070684_1000605994 187
245 3300005535 Ga0070684_100144420 Ga0070684_1001444202 187
246 3300005535 Ga0070684_100151285 Ga0070684_1001512853 187
247 3300005535 Ga0070684_101001501 Ga0070684_1010015011 187
248 3300005539 Ga0068853_100007245 Ga0068853_1000072456 187
249 3300005539 Ga0068853_100015397 Ga0068853_1000153978 187
250 3300005539 Ga0068853_100133050 Ga0068853_1001330503 187
251 3300005539 Ga0068853_100202634 Ga0068853_1002026343 187
252 3300005539 Ga0068853_100259546 Ga0068853_1002595463 187
253 3300005539 Ga0068853_100360678 Ga0068853_1003606782 187
254 3300005539 Ga0068853_100463979 Ga0068853_1004639791 187
255 3300005539 Ga0068853_100600863 Ga0068853_1006008632 187
256 3300005539 Ga0068853_100745638 Ga0068853_1007456382 187
257 3300005539 Ga0068853_101658230 Ga0068853_1016582301 187
258 3300005543 Ga0070672_100000160 Ga0070672_1000001602 187
259 3300005543 Ga0070672_100101544 Ga0070672_1001015443 187
260 3300005543 Ga0070672_100110785 Ga0070672_1001107853 187
261 3300005543 Ga0070672_100163589 Ga0070672_1001635892 187
262 3300005543 Ga0070672_100267583 Ga0070672_1002675832 187
263 3300005543 Ga0070672_100351100 Ga0070672_1003511002 187
264 3300005543 Ga0070672_100443964 Ga0070672_1004439642 187
265 3300005544 Ga0070686_100027961 Ga0070686_1000279612 187
266 3300005544 Ga0070686_100475410 Ga0070686_1004754101 187
267 3300005545 Ga0070695_100163393 Ga0070695_1001633932 187
268 3300005546 Ga0070696_100505393 Ga0070696_1005053931 187
269 3300005547 Ga0070693_100061006 Ga0070693_1000610062 187
270 3300005547 Ga0070693_100408740 Ga0070693_1004087402 187
271 3300005547 Ga0070693_100420411 Ga0070693_1004204112 187
272 3300005547 Ga0070693_100451979 Ga0070693_1004519791 187
273 3300005548 Ga0070665_100000350 Ga0070665_10000035010 187
274 3300005548 Ga0070665_100042513 Ga0070665_1000425133 187
275 3300005548 Ga0070665_100170322 Ga0070665_1001703221 187
276 3300005548 Ga0070665_100311136 Ga0070665_1003111362 187
277 3300005548 Ga0070665_100337427 Ga0070665_1003374272 187
278 3300005563 Ga0068855_100000089 Ga0068855_10000008935 187
279 3300005563 Ga0068855_100025914 Ga0068855_1000259145 187
280 3300005563 Ga0068855_100074344 Ga0068855_1000743443 187
281 3300005563 Ga0068855_100081339 Ga0068855_1000813392 187
282 3300005563 Ga0068855_101300394 Ga0068855_1013003941 187
283 3300005564 Ga0070664_100008696 Ga0070664_1000086963 187
284 3300005564 Ga0070664_100016033 Ga0070664_1000160335 187
285 3300005564 Ga0070664_100040643 Ga0070664_1000406431 187
286 3300005564 Ga0070664_100052751 Ga0070664_1000527513 187
287 3300005564 Ga0070664_100058800 Ga0070664_1000588004 187
288 3300005564 Ga0070664_100177020 Ga0070664_1001770202 187
289 3300005564 Ga0070664_100247518 Ga0070664_1002475182 187
290 3300005564 Ga0070664_100439506 Ga0070664_1004395063 187
291 3300005577 Ga0068857_100010772 Ga0068857_1000107723 187
292 3300005577 Ga0068857_100052934 Ga0068857_1000529342 187
293 3300005577 Ga0068857_100104411 Ga0068857_1001044114 187
294 3300005577 Ga0068857_100161546 Ga0068857_1001615462 187
295 3300005577 Ga0068857_100258266 Ga0068857_1002582662 187
296 3300005577 Ga0068857_100328796 Ga0068857_1003287962 187
297 3300005577 Ga0068857_100387820 Ga0068857_1003878202 187
298 3300005577 Ga0068857_100430778 Ga0068857_1004307782 187
299 3300005577 Ga0068857_100770525 Ga0068857_1007705251 187
300 3300005577 Ga0068857_100894496 Ga0068857_1008944962 187
301 3300005577 Ga0068857_101030982 Ga0068857_1010309821 187
302 3300005578 Ga0068854_100205682 Ga0068854_1002056822 187
303 3300005578 Ga0068854_100274520 Ga0068854_1002745202 187
304 3300005578 Ga0068854_100387386 Ga0068854_1003873862 187
305 3300005614 Ga0068856_100164527 Ga0068856_1001645272 187
306 3300005614 Ga0068856_100750359 Ga0068856_1007503591 187
307 3300005615 Ga0070702_100087919 Ga0070702_1000879192 187
308 3300005616 Ga0068852_100015848 Ga0068852_1000158483 187
309 3300005616 Ga0068852_100110788 Ga0068852_1001107883 187
310 3300005616 Ga0068852_100124989 Ga0068852_1001249892 187
311 3300005616 Ga0068852_100134972 Ga0068852_1001349723 187
312 3300005616 Ga0068852_100164795 Ga0068852_1001647953 187
313 3300005616 Ga0068852_100358351 Ga0068852_1003583512 187
314 3300005616 Ga0068852_100811437 Ga0068852_1008114371 187
315 3300005616 Ga0068852_101424504 Ga0068852_1014245041 187
316 3300005617 Ga0068859_100000100 Ga0068859_10000010068 187
317 3300005617 Ga0068859_100006400 Ga0068859_1000064005 187
318 3300005617 Ga0068859_100045503 Ga0068859_1000455033 187
319 3300005617 Ga0068859_100045943 Ga0068859_1000459433 187
320 3300005617 Ga0068859_100055078 Ga0068859_1000550783 187
321 3300005617 Ga0068859_100071722 Ga0068859_1000717223 187
322 3300005617 Ga0068859_100090854 Ga0068859_1000908543 187
323 3300005617 Ga0068859_100097155 Ga0068859_1000971554 187
324 3300005617 Ga0068859_100099520 Ga0068859_1000995203 187
325 3300005617 Ga0068859_100177818 Ga0068859_1001778182 187
326 3300005617 Ga0068859_100189897 Ga0068859_1001898972 187
327 3300005617 Ga0068859_100410358 Ga0068859_1004103582 187
328 3300005617 Ga0068859_100770622 Ga0068859_1007706222 187
329 3300005617 Ga0068859_100971747 Ga0068859_1009717472 187
330 3300005617 Ga0068859_101242883 Ga0068859_1012428831 187
331 3300005617 Ga0068859_101418791 Ga0068859_1014187912 187
332 3300005618 Ga0068864_100004900 Ga0068864_1000049009 187
333 3300005618 Ga0068864_100047787 Ga0068864_1000477873 187
334 3300005618 Ga0068864_100052426 Ga0068864_1000524264 187
335 3300005618 Ga0068864_100066952 Ga0068864_1000669522 187
336 3300005618 Ga0068864_100096472 Ga0068864_1000964723 187
337 3300005618 Ga0068864_100149758 Ga0068864_1001497583 187
338 3300005618 Ga0068864_100194596 Ga0068864_1001945962 187
339 3300005618 Ga0068864_100236660 Ga0068864_1002366602 187
340 3300005618 Ga0068864_100275992 Ga0068864_1002759922 187
341 3300005618 Ga0068864_100695094 Ga0068864_1006950941 187
342 3300005618 Ga0068864_100762170 Ga0068864_1007621702 187
343 3300005618 Ga0068864_101208464 Ga0068864_1012084642 187
344 3300005718 Ga0068866_10005085 Ga0068866_100050853 187
345 3300005718 Ga0068866_10028304 Ga0068866_100283042 187
346 3300005718 Ga0068866_10287892 Ga0068866_102878922 187
347 3300005718 Ga0068866_10594611 Ga0068866_105946111 187
348 3300005719 Ga0068861_100002321 Ga0068861_1000023216 187
349 3300005719 Ga0068861_100004878 Ga0068861_1000048785 187
350 3300005719 Ga0068861_100018316 Ga0068861_1000183163 187
351 3300005719 Ga0068861_100065845 Ga0068861_1000658453 187
352 3300005719 Ga0068861_100287472 Ga0068861_1002874722 187
353 3300005719 Ga0068861_100289715 Ga0068861_1002897152 187
354 3300005719 Ga0068861_100613395 Ga0068861_1006133952 187
355 3300005719 Ga0068861_100613470 Ga0068861_1006134702 187
356 3300005834 Ga0068851_10002184 Ga0068851_100021845 187
357 3300005834 Ga0068851_10088663 Ga0068851_100886632 187
358 3300005834 Ga0068851_10095771 Ga0068851_100957711 187
359 3300005834 Ga0068851_10505455 Ga0068851_105054551 187
360 3300005834 Ga0068851_10551966 Ga0068851_105519661 187
361 3300005840 Ga0068870_10021567 Ga0068870_100215672 187
362 3300005840 Ga0068870_10028936 Ga0068870_100289363 187
363 3300005840 Ga0068870_10244433 Ga0068870_102444332 187
364 3300005841 Ga0068863_100003656 Ga0068863_1000036567 187
365 3300005841 Ga0068863_100005412 Ga0068863_1000054123 187
366 3300005841 Ga0068863_100022973 Ga0068863_1000229732 187
367 3300005841 Ga0068863_100048136 Ga0068863_1000481365 187
368 3300005841 Ga0068863_100059429 Ga0068863_1000594292 187
369 3300005841 Ga0068863_100483940 Ga0068863_1004839402 187
370 3300005841 Ga0068863_100518876 Ga0068863_1005188762 187
371 3300005841 Ga0068863_100544527 Ga0068863_1005445272 187
372 3300005841 Ga0068863_100700176 Ga0068863_1007001762 187
373 3300005842 Ga0068858_100000199 Ga0068858_10000019946 187
374 3300005842 Ga0068858_100013150 Ga0068858_1000131502 187
375 3300005842 Ga0068858_100109962 Ga0068858_1001099623 187
376 3300005842 Ga0068858_100145754 Ga0068858_1001457542 187
377 3300005843 Ga0068860_100003203 Ga0068860_1000032035 187
378 3300005843 Ga0068860_100006347 Ga0068860_1000063479 187
379 3300005843 Ga0068860_100007843 Ga0068860_1000078434 187
380 3300005843 Ga0068860_100076081 Ga0068860_1000760813 187
381 3300005843 Ga0068860_100134077 Ga0068860_1001340772 187
382 3300005843 Ga0068860_100545787 Ga0068860_1005457871 187
383 3300005843 Ga0068860_100596383 Ga0068860_1005963832 187
384 3300005844 Ga0068862_100016502 Ga0068862_1000165023 187
385 3300005844 Ga0068862_100057039 Ga0068862_1000570391 187
386 3300005844 Ga0068862_100084888 Ga0068862_1000848883 187
387 3300005844 Ga0068862_100247155 Ga0068862_1002471553 187
388 3300005937 Ga0081455_10455209 Ga0081455_104552091 187
389 3300006163 Ga0070715_10066344 Ga0070715_100663442 187
390 3300006195 Ga0075366_10197900 Ga0075366_101979002 187
391 3300006195 Ga0075366_10267412 Ga0075366_102674122 187
392 3300006195 Ga0075366_10330696 Ga0075366_103306962 187
393 3300006237 Ga0097621_100009982 Ga0097621_1000099825 187
394 3300006237 Ga0097621_100034379 Ga0097621_1000343793 187
395 3300006237 Ga0097621_100110422 Ga0097621_1001104223 187
396 3300006237 Ga0097621_100151904 Ga0097621_1001519042 187
397 3300006237 Ga0097621_100190968 Ga0097621_1001909682 187
398 3300006237 Ga0097621_100358964 Ga0097621_1003589641 187
399 3300006237 Ga0097621_100439600 Ga0097621_1004396001 187
400 3300006237 Ga0097621_100450992 Ga0097621_1004509922 187
401 3300006237 Ga0097621_100758558 Ga0097621_1007585581 187
402 3300006358 Ga0068871_100055412 Ga0068871_1000554123 187
403 3300006358 Ga0068871_100095193 Ga0068871_1000951932 187
404 3300006358 Ga0068871_100146078 Ga0068871_1001460782 187
405 3300006358 Ga0068871_100149747 Ga0068871_1001497471 187
406 3300006358 Ga0068871_100156633 Ga0068871_1001566332 187
407 3300006358 Ga0068871_100282209 Ga0068871_1002822092 187
408 3300006358 Ga0068871_100301984 Ga0068871_1003019842 187
409 3300006358 Ga0068871_100350777 Ga0068871_1003507772 187
410 3300006358 Ga0068871_100525682 Ga0068871_1005256822 187
411 3300006358 Ga0068871_100589720 Ga0068871_1005897201 187
412 3300006358 Ga0068871_101414736 Ga0068871_1014147361 187
413 3300006844 Ga0075428_100001125 Ga0075428_10000112514 187
414 3300006844 Ga0075428_100029484 Ga0075428_1000294845 187
415 3300006844 Ga0075428_100159109 Ga0075428_1001591095 187
416 3300006846 Ga0075430_100037041 Ga0075430_1000370413 187
417 3300006847 Ga0075431_100018153 Ga0075431_1000181536 187
418 3300006871 Ga0075434_101119836 Ga0075434_1011198362 187
419 3300006880 Ga0075429_100000105 Ga0075429_10000010534 187
420 3300006880 Ga0075429_100033094 Ga0075429_1000330944 187
421 3300006880 Ga0075429_100446591 Ga0075429_1004465912 187
422 3300006881 Ga0068865_100003229 Ga0068865_1000032299 187
423 3300006881 Ga0068865_100019488 Ga0068865_1000194885 187
424 3300006881 Ga0068865_100190045 Ga0068865_1001900453 187
425 3300006881 Ga0068865_100575693 Ga0068865_1005756931 187
426 3300006881 Ga0068865_100605535 Ga0068865_1006055351 187
427 3300006931 Ga0097620_100000100 Ga0097620_1000001003 187
428 3300006931 Ga0097620_100006400 Ga0097620_1000064002 187
429 3300006931 Ga0097620_100045504 Ga0097620_1000455043 187
430 3300006931 Ga0097620_100045944 Ga0097620_1000459444 187
431 3300006931 Ga0097620_100055076 Ga0097620_1000550763 187
432 3300006931 Ga0097620_100071720 Ga0097620_1000717203 187
433 3300006931 Ga0097620_100090855 Ga0097620_1000908553 187
434 3300006931 Ga0097620_100097165 Ga0097620_1000971653 187
435 3300006931 Ga0097620_100099522 Ga0097620_1000995222 187
436 3300006931 Ga0097620_100177816 Ga0097620_1001778162 187
437 3300006931 Ga0097620_100189892 Ga0097620_1001898922 187
438 3300006931 Ga0097620_100410361 Ga0097620_1004103612 187
439 3300006931 Ga0097620_100770591 Ga0097620_1007705912 187
440 3300006931 Ga0097620_100971857 Ga0097620_1009718571 187
441 3300006931 Ga0097620_101242842 Ga0097620_1012428421 187
442 3300006931 Ga0097620_101418989 Ga0097620_1014189892 187
443 3300007076 Ga0075435_101263635 Ga0075435_1012636351 187
444 3300009011 Ga0105251_10071169 Ga0105251_100711693 187
445 3300009093 Ga0105240_10000074 Ga0105240_1000007487 187
446 3300009093 Ga0105240_10010569 Ga0105240_1001056911 187
447 3300009093 Ga0105240_10451742 Ga0105240_104517422 187
448 3300009093 Ga0105240_10575427 Ga0105240_105754272 187
449 3300009094 Ga0111539_10124592 Ga0111539_101245922 187
450 3300009094 Ga0111539_10725210 Ga0111539_107252102 187
451 3300009094 Ga0111539_11053653 Ga0111539_110536532 187
452 3300009098 Ga0105245_10021467 Ga0105245_100214672 187
453 3300009098 Ga0105245_10141816 Ga0105245_101418162 187
454 3300009098 Ga0105245_10490164 Ga0105245_104901641 187
455 3300009098 Ga0105245_11496987 Ga0105245_114969871 187
456 3300009101 Ga0105247_10001666 Ga0105247_1000166611 187
457 3300009101 Ga0105247_10035042 Ga0105247_100350422 187
458 3300009101 Ga0105247_10036944 Ga0105247_100369441 187
459 3300009101 Ga0105247_10091146 Ga0105247_100911462 187
460 3300009101 Ga0105247_10148451 Ga0105247_101484512 187
461 3300009101 Ga0105247_10634304 Ga0105247_106343041 187
462 3300009147 Ga0114129_10017306 Ga0114129_100173065 187
463 3300009147 Ga0114129_10121641 Ga0114129_101216413 187
464 3300009147 Ga0114129_10150575 Ga0114129_101505753 187
465 3300009147 Ga0114129_12032728 Ga0114129_120327281 187
466 3300009148 Ga0105243_10063213 Ga0105243_100632133 187
467 3300009148 Ga0105243_10191730 Ga0105243_101917302 187
468 3300009148 Ga0105243_10387379 Ga0105243_103873791 187
469 3300009148 Ga0105243_10492186 Ga0105243_104921861 187
470 3300009148 Ga0105243_10521583 Ga0105243_105215831 187
471 3300009174 Ga0105241_10000286 Ga0105241_1000028613 187
472 3300009174 Ga0105241_10000674 Ga0105241_100006749 187
473 3300009174 Ga0105241_10050739 Ga0105241_100507392 187
474 3300009174 Ga0105241_10078204 Ga0105241_100782042 187
475 3300009174 Ga0105241_10128490 Ga0105241_101284902 187
476 3300009174 Ga0105241_10445574 Ga0105241_104455742 187
477 3300009174 Ga0105241_10612534 Ga0105241_106125341 187
478 3300009174 Ga0105241_10701313 Ga0105241_107013132 187
479 3300009176 Ga0105242_10007239 Ga0105242_100072394 187
480 3300009176 Ga0105242_10057786 Ga0105242_100577863 187
481 3300009176 Ga0105242_10121029 Ga0105242_101210292 187
482 3300009176 Ga0105242_10249725 Ga0105242_102497252 187
483 3300009176 Ga0105242_10551545 Ga0105242_105515452 187
484 3300009176 Ga0105242_11457885 Ga0105242_114578852 187
485 3300009177 Ga0105248_10064189 Ga0105248_100641894 187
486 3300009177 Ga0105248_10276264 Ga0105248_102762643 187
487 3300009177 Ga0105248_10463890 Ga0105248_104638902 187
488 3300009177 Ga0105248_10841729 Ga0105248_108417291 187
489 3300009545 Ga0105237_10000528 Ga0105237_1000052810 187
490 3300009545 Ga0105237_10009236 Ga0105237_100092364 187
491 3300009545 Ga0105237_10018995 Ga0105237_100189955 187
492 3300009545 Ga0105237_10030026 Ga0105237_100300263 187
493 3300009545 Ga0105237_10557879 Ga0105237_105578792 187
494 3300009551 Ga0105238_10093340 Ga0105238_100933403 187
495 3300009553 Ga0105249_10000420 Ga0105249_1000042028 187
496 3300009553 Ga0105249_10004650 Ga0105249_100046509 187
497 3300009553 Ga0105249_10006252 Ga0105249_100062526 187
498 3300009553 Ga0105249_10007262 Ga0105249_100072625 187
499 3300009553 Ga0105249_10008839 Ga0105249_100088393 187
500 3300009553 Ga0105249_10155341 Ga0105249_101553413 187
501 3300009553 Ga0105249_10177873 Ga0105249_101778732 187
502 3300009553 Ga0105249_10216869 Ga0105249_102168691 187
503 3300009553 Ga0105249_10285716 Ga0105249_102857162 187
504 3300009553 Ga0105249_10565320 Ga0105249_105653201 187
505 3300009553 Ga0105249_10570393 Ga0105249_105703932 187
506 3300009553 Ga0105249_10611980 Ga0105249_106119802 187
507 3300009553 Ga0105249_11959575 Ga0105249_119595751 187
508 3300010375 Ga0105239_10000048 Ga0105239_1000004843 187
509 3300010375 Ga0105239_10013397 Ga0105239_100133973 187
510 3300010375 Ga0105239_10016535 Ga0105239_100165359 187
511 3300010375 Ga0105239_10044989 Ga0105239_100449895 187
512 3300010375 Ga0105239_10083913 Ga0105239_100839131 187
513 3300010375 Ga0105239_10117472 Ga0105239_101174723 187
514 3300010375 Ga0105239_10124064 Ga0105239_101240642 187
515 3300010375 Ga0105239_10655543 Ga0105239_106555432 187
516 3300011119 Ga0105246_10085274 Ga0105246_100852742 187
517 3300011119 Ga0105246_10253054 Ga0105246_102530542 187
518 3300011119 Ga0105246_10702653 Ga0105246_107026532 187
519 3300011119 Ga0105246_10793536 Ga0105246_107935361 187
520 3300013100 Ga0157373_10015305 Ga0157373_100153052 187
521 3300013100 Ga0157373_10024569 Ga0157373_100245693 187
522 3300013100 Ga0157373_10040694 Ga0157373_100406941 187
523 3300013100 Ga0157373_10135679 Ga0157373_101356792 187
524 3300013100 Ga0157373_10274084 Ga0157373_102740842 187
525 3300013102 Ga0157371_10009068 Ga0157371_100090682 187
526 3300013102 Ga0157371_10056386 Ga0157371_100563862 187
527 3300013102 Ga0157371_10166659 Ga0157371_101666591 187
528 3300013102 Ga0157371_10634494 Ga0157371_106344941 187
529 3300013104 Ga0157370_10031158 Ga0157370_100311585 187
530 3300013104 Ga0157370_10031443 Ga0157370_100314432 187
531 3300013104 Ga0157370_10175301 Ga0157370_101753012 187
532 3300013104 Ga0157370_10221700 Ga0157370_102217002 187
533 3300013105 Ga0157369_10010499 Ga0157369_100104992 187
534 3300013105 Ga0157369_10020813 Ga0157369_100208132 187
535 3300013105 Ga0157369_10217587 Ga0157369_102175872 187
536 3300013105 Ga0157369_10406897 Ga0157369_104068972 187
537 3300013296 Ga0157374_10000001 Ga0157374_10000001256 187
538 3300013296 Ga0157374_10000084 Ga0157374_1000008410 187
539 3300013296 Ga0157374_10010076 Ga0157374_100100762 187
540 3300013296 Ga0157374_10139672 Ga0157374_101396721 187
541 3300013296 Ga0157374_10237222 Ga0157374_102372222 187
542 3300013296 Ga0157374_10290382 Ga0157374_102903822 187
543 3300013296 Ga0157374_10314782 Ga0157374_103147822 187
544 3300013296 Ga0157374_10826950 Ga0157374_108269501 187
545 3300013297 Ga0157378_10001872 Ga0157378_100018722 187
546 3300013297 Ga0157378_10005024 Ga0157378_100050246 187
547 3300013297 Ga0157378_10016814 Ga0157378_100168142 187
548 3300013297 Ga0157378_10061629 Ga0157378_100616293 187
549 3300013297 Ga0157378_10068743 Ga0157378_100687431 187
550 3300013297 Ga0157378_10091452 Ga0157378_100914522 187
551 3300013297 Ga0157378_10093436 Ga0157378_100934362 187
552 3300013297 Ga0157378_10172003 Ga0157378_101720032 187
553 3300013297 Ga0157378_10300108 Ga0157378_103001082 187
554 3300013297 Ga0157378_10334558 Ga0157378_103345581 187
555 3300013297 Ga0157378_11191584 Ga0157378_111915842 187
556 3300013306 Ga0163162_10000113 Ga0163162_1000011356 187
557 3300013306 Ga0163162_10004460 Ga0163162_100044605 187
558 3300013306 Ga0163162_10005078 Ga0163162_100050789 187
559 3300013306 Ga0163162_10024349 Ga0163162_100243492 187
560 3300013306 Ga0163162_10147273 Ga0163162_101472733 187
561 3300013306 Ga0163162_10310025 Ga0163162_103100252 187
562 3300013306 Ga0163162_10332847 Ga0163162_103328472 187
563 3300013306 Ga0163162_10594102 Ga0163162_105941022 187
564 3300013306 Ga0163162_10773065 Ga0163162_107730652 187
565 3300013306 Ga0163162_10798082 Ga0163162_107980822 187
566 3300013307 Ga0157372_10001128 Ga0157372_1000112819 187
567 3300013307 Ga0157372_10017684 Ga0157372_100176848 187
568 3300013307 Ga0157372_10018926 Ga0157372_100189268 187
569 3300013307 Ga0157372_10028493 Ga0157372_100284935 187
570 3300013307 Ga0157372_10033034 Ga0157372_100330343 187
571 3300013307 Ga0157372_10034481 Ga0157372_100344813 187
572 3300013307 Ga0157372_10049030 Ga0157372_100490302 187
573 3300013307 Ga0157372_10125220 Ga0157372_101252201 187
574 3300013307 Ga0157372_10170040 Ga0157372_101700403 187
575 3300013307 Ga0157372_10189115 Ga0157372_101891153 187
576 3300013307 Ga0157372_10315694 Ga0157372_103156942 187
577 3300013307 Ga0157372_10330167 Ga0157372_103301672 187
578 3300013307 Ga0157372_10432757 Ga0157372_104327573 187
579 3300013307 Ga0157372_10636806 Ga0157372_106368062 187
580 3300013307 Ga0157372_10698212 Ga0157372_106982121 187
581 3300013307 Ga0157372_10864749 Ga0157372_108647492 187
582 3300013307 Ga0157372_10939323 Ga0157372_109393231 187
583 3300013307 Ga0157372_10941927 Ga0157372_109419272 187
584 3300013307 Ga0157372_12109109 Ga0157372_121091091 187
585 3300013308 Ga0157375_10000565 Ga0157375_1000056523 187
586 3300013308 Ga0157375_10008080 Ga0157375_100080804 187
587 3300013308 Ga0157375_10009333 Ga0157375_100093333 187
588 3300013308 Ga0157375_10039328 Ga0157375_100393284 187
589 3300013308 Ga0157375_10360794 Ga0157375_103607942 187
590 3300013308 Ga0157375_10710708 Ga0157375_107107082 187
591 3300013308 Ga0157375_11279325 Ga0157375_112793251 187
592 3300013308 Ga0157375_11848973 Ga0157375_118489732 187
593 3300014325 Ga0163163_10000332 Ga0163163_1000033240 187
594 3300014325 Ga0163163_10003608 Ga0163163_100036088 187
595 3300014325 Ga0163163_10178082 Ga0163163_101780822 187
596 3300014325 Ga0163163_10315331 Ga0163163_103153312 187
597 3300014325 Ga0163163_10680898 Ga0163163_106808982 187
598 3300014325 Ga0163163_10841096 Ga0163163_108410962 187
599 3300014326 Ga0157380_10076849 Ga0157380_100768492 187
600 3300014326 Ga0157380_10178350 Ga0157380_101783502 187
601 3300014326 Ga0157380_10618043 Ga0157380_106180432 187
602 3300014745 Ga0157377_10001951 Ga0157377_100019512 187
603 3300014745 Ga0157377_10012098 Ga0157377_100120982 187
604 3300014745 Ga0157377_10017126 Ga0157377_100171264 187
605 3300014745 Ga0157377_10024122 Ga0157377_100241223 187
606 3300014745 Ga0157377_10069632 Ga0157377_100696322 187
607 3300014745 Ga0157377_10171685 Ga0157377_101716852 187
608 3300014745 Ga0157377_10304935 Ga0157377_103049352 187
609 3300014745 Ga0157377_10406730 Ga0157377_104067302 187
610 3300014745 Ga0157377_10570048 Ga0157377_105700481 187
611 3300014968 Ga0157379_10000245 Ga0157379_100002459 187
612 3300014968 Ga0157379_10014342 Ga0157379_100143424 187
613 3300014968 Ga0157379_10068746 Ga0157379_100687463 187
614 3300014968 Ga0157379_10069217 Ga0157379_100692172 187
615 3300014968 Ga0157379_10147538 Ga0157379_101475382 187
616 3300014968 Ga0157379_10367538 Ga0157379_103675382 187
617 3300014968 Ga0157379_10546789 Ga0157379_105467892 187
618 3300014968 Ga0157379_10698722 Ga0157379_106987221 187
619 3300014969 Ga0157376_10004247 Ga0157376_100042475 187
620 3300014969 Ga0157376_10008507 Ga0157376_100085077 187
621 3300014969 Ga0157376_10010209 Ga0157376_100102093 187
622 3300014969 Ga0157376_10062591 Ga0157376_100625912 187
623 3300014969 Ga0157376_10137812 Ga0157376_101378122 187
624 3300014969 Ga0157376_10189803 Ga0157376_101898033 187
625 3300017792 Ga0163161_10002092 Ga0163161_100020926 187
626 3300017792 Ga0163161_10019847 Ga0163161_100198472 187
627 3300017792 Ga0163161_10050884 Ga0163161_100508842 187
628 3300017792 Ga0163161_10120757 Ga0163161_101207572 187
629 3300017792 Ga0163161_10201859 Ga0163161_102018592 187
630 3300017792 Ga0163161_10628652 Ga0163161_106286521 187
631 3300025315 Ga0207697_10016858 Ga0207697_100168583 187
632 3300025315 Ga0207697_10106645 Ga0207697_101066452 187
633 3300025321 Ga0207656_10001320 Ga0207656_100013205 187
634 3300025321 Ga0207656_10084856 Ga0207656_100848563 187
635 3300025321 Ga0207656_10182571 Ga0207656_101825711 187
636 3300025893 Ga0207682_10017385 Ga0207682_100173853 187
637 3300025893 Ga0207682_10030875 Ga0207682_100308752 187
638 3300025893 Ga0207682_10055276 Ga0207682_100552761 187
639 3300025893 Ga0207682_10082740 Ga0207682_100827402 187
640 3300025900 Ga0207710_10001046 Ga0207710_100010464 187
641 3300025901 Ga0207688_10091986 Ga0207688_100919862 187
642 3300025901 Ga0207688_10114170 Ga0207688_101141701 187
643 3300025903 Ga0207680_10000648 Ga0207680_100006489 187
644 3300025903 Ga0207680_10249473 Ga0207680_102494731 187
645 3300025903 Ga0207680_10722125 Ga0207680_107221251 187
646 3300025904 Ga0207647_10000282 Ga0207647_1000028214 187
647 3300025904 Ga0207647_10026305 Ga0207647_100263052 187
648 3300025904 Ga0207647_10098198 Ga0207647_100981982 187
649 3300025904 Ga0207647_10481369 Ga0207647_104813691 187
650 3300025905 Ga0207685_10266569 Ga0207685_102665691 187
651 3300025907 Ga0207645_10000378 Ga0207645_1000037818 187
652 3300025907 Ga0207645_10001750 Ga0207645_1000175015 187
653 3300025907 Ga0207645_10064892 Ga0207645_100648922 187
654 3300025907 Ga0207645_10142954 Ga0207645_101429542 187
655 3300025908 Ga0207643_10003255 Ga0207643_100032559 187
656 3300025908 Ga0207643_10006561 Ga0207643_100065611 187
657 3300025908 Ga0207643_10096130 Ga0207643_100961302 187
658 3300025908 Ga0207643_10399306 Ga0207643_103993062 187
659 3300025909 Ga0207705_10000717 Ga0207705_100007178 187
660 3300025909 Ga0207705_10310450 Ga0207705_103104501 187
661 3300025909 Ga0207705_10432917 Ga0207705_104329172 187
662 3300025911 Ga0207654_10000259 Ga0207654_100002599 187
663 3300025911 Ga0207654_10001858 Ga0207654_100018588 187
664 3300025911 Ga0207654_10236921 Ga0207654_102369212 187
665 3300025911 Ga0207654_10502640 Ga0207654_105026401 187
666 3300025912 Ga0207707_10064209 Ga0207707_100642095 187
667 3300025913 Ga0207695_10000071 Ga0207695_10000071203 187
668 3300025913 Ga0207695_10003138 Ga0207695_1000313812 187
669 3300025913 Ga0207695_10151543 Ga0207695_101515432 187
670 3300025913 Ga0207695_10402521 Ga0207695_104025212 187
671 3300025914 Ga0207671_10001584 Ga0207671_1000158417 187
672 3300025914 Ga0207671_10001605 Ga0207671_1000160519 187
673 3300025914 Ga0207671_10011203 Ga0207671_100112034 187
674 3300025914 Ga0207671_10011315 Ga0207671_100113154 187
675 3300025914 Ga0207671_10011494 Ga0207671_100114943 187
676 3300025914 Ga0207671_10024824 Ga0207671_100248243 187
677 3300025917 Ga0207660_10595829 Ga0207660_105958291 187
678 3300025918 Ga0207662_10031022 Ga0207662_100310222 187
679 3300025918 Ga0207662_10201020 Ga0207662_102010202 187
680 3300025919 Ga0207657_10001201 Ga0207657_1000120120 187
681 3300025919 Ga0207657_10224636 Ga0207657_102246361 187
682 3300025920 Ga0207649_10001403 Ga0207649_1000140312 187
683 3300025920 Ga0207649_10048281 Ga0207649_100482812 187
684 3300025920 Ga0207649_10155754 Ga0207649_101557542 187
685 3300025920 Ga0207649_10201995 Ga0207649_102019952 187
686 3300025921 Ga0207652_10125949 Ga0207652_101259493 187
687 3300025921 Ga0207652_10202896 Ga0207652_102028961 187
688 3300025923 Ga0207681_10015733 Ga0207681_100157333 187
689 3300025923 Ga0207681_10160043 Ga0207681_101600431 187
690 3300025923 Ga0207681_10196981 Ga0207681_101969812 187
691 3300025923 Ga0207681_10677541 Ga0207681_106775411 187
692 3300025924 Ga0207694_10015117 Ga0207694_100151173 187
693 3300025924 Ga0207694_10126588 Ga0207694_101265882 187
694 3300025925 Ga0207650_10002349 Ga0207650_100023498 187
695 3300025925 Ga0207650_10015855 Ga0207650_100158552 187
696 3300025925 Ga0207650_10073238 Ga0207650_100732384 187
697 3300025925 Ga0207650_10203655 Ga0207650_102036552 187
698 3300025925 Ga0207650_10508621 Ga0207650_105086212 187
699 3300025925 Ga0207650_10530879 Ga0207650_105308791 187
700 3300025925 Ga0207650_10708065 Ga0207650_107080651 187
701 3300025926 Ga0207659_10012507 Ga0207659_100125074 187
702 3300025926 Ga0207659_10016982 Ga0207659_100169824 187
703 3300025926 Ga0207659_10059936 Ga0207659_100599361 187
704 3300025926 Ga0207659_10079825 Ga0207659_100798252 187
705 3300025926 Ga0207659_10237656 Ga0207659_102376562 187
706 3300025926 Ga0207659_10296936 Ga0207659_102969361 187
707 3300025926 Ga0207659_10321875 Ga0207659_103218752 187
708 3300025926 Ga0207659_10793781 Ga0207659_107937812 187
709 3300025926 Ga0207659_11044438 Ga0207659_110444381 187
710 3300025927 Ga0207687_10558495 Ga0207687_105584952 187
711 3300025931 Ga0207644_10193968 Ga0207644_101939681 187
712 3300025931 Ga0207644_10366810 Ga0207644_103668101 187
713 3300025931 Ga0207644_10433588 Ga0207644_104335882 187
714 3300025931 Ga0207644_10437842 Ga0207644_104378422 187
715 3300025931 Ga0207644_10691384 Ga0207644_106913841 187
716 3300025932 Ga0207690_10011658 Ga0207690_100116583 187
717 3300025932 Ga0207690_10392426 Ga0207690_103924261 187
718 3300025933 Ga0207706_10014988 Ga0207706_100149887 187
719 3300025933 Ga0207706_10019835 Ga0207706_100198358 187
720 3300025933 Ga0207706_10063987 Ga0207706_100639873 187
721 3300025933 Ga0207706_10111772 Ga0207706_101117722 187
722 3300025933 Ga0207706_10530618 Ga0207706_105306182 187
723 3300025933 Ga0207706_10739502 Ga0207706_107395021 187
724 3300025933 Ga0207706_10995053 Ga0207706_109950531 187
725 3300025934 Ga0207686_10002728 Ga0207686_100027286 187
726 3300025934 Ga0207686_10184808 Ga0207686_101848082 187
727 3300025934 Ga0207686_10253974 Ga0207686_102539741 187
728 3300025934 Ga0207686_10977059 Ga0207686_109770591 187
729 3300025935 Ga0207709_10033145 Ga0207709_100331452 187
730 3300025935 Ga0207709_10349223 Ga0207709_103492232 187
731 3300025935 Ga0207709_10882657 Ga0207709_108826571 187
732 3300025936 Ga0207670_10010013 Ga0207670_100100132 187
733 3300025936 Ga0207670_10020775 Ga0207670_100207753 187
734 3300025936 Ga0207670_10077464 Ga0207670_100774643 187
735 3300025936 Ga0207670_10136811 Ga0207670_101368112 187
736 3300025936 Ga0207670_10139113 Ga0207670_101391132 187
737 3300025936 Ga0207670_10281808 Ga0207670_102818082 187
738 3300025936 Ga0207670_10483086 Ga0207670_104830861 187
739 3300025936 Ga0207670_11077491 Ga0207670_110774911 187
740 3300025937 Ga0207669_10013132 Ga0207669_100131324 187
741 3300025937 Ga0207669_10476034 Ga0207669_104760341 187
742 3300025938 Ga0207704_10035825 Ga0207704_100358254 187
743 3300025938 Ga0207704_10062612 Ga0207704_100626123 187
744 3300025938 Ga0207704_10085916 Ga0207704_100859162 187
745 3300025938 Ga0207704_10145587 Ga0207704_101455872 187
746 3300025938 Ga0207704_10374304 Ga0207704_103743042 187
747 3300025938 Ga0207704_10585272 Ga0207704_105852722 187
748 3300025938 Ga0207704_10644324 Ga0207704_106443241 187
749 3300025940 Ga0207691_10000227 Ga0207691_1000022735 187
750 3300025940 Ga0207691_10018303 Ga0207691_100183038 187
751 3300025940 Ga0207691_10019517 Ga0207691_100195176 187
752 3300025940 Ga0207691_10023073 Ga0207691_100230732 187
753 3300025940 Ga0207691_10070385 Ga0207691_100703852 187
754 3300025940 Ga0207691_10473036 Ga0207691_104730362 187
755 3300025941 Ga0207711_10593479 Ga0207711_105934791 187
756 3300025942 Ga0207689_10004619 Ga0207689_100046193 187
757 3300025942 Ga0207689_10005259 Ga0207689_100052597 187
758 3300025942 Ga0207689_10005402 Ga0207689_100054026 187
759 3300025942 Ga0207689_10012962 Ga0207689_100129624 187
760 3300025942 Ga0207689_10052909 Ga0207689_100529092 187
761 3300025942 Ga0207689_10081387 Ga0207689_100813873 187
762 3300025942 Ga0207689_10101900 Ga0207689_101019003 187
763 3300025942 Ga0207689_10293775 Ga0207689_102937752 187
764 3300025942 Ga0207689_10395411 Ga0207689_103954112 187
765 3300025942 Ga0207689_10652924 Ga0207689_106529241 187
766 3300025942 Ga0207689_10965166 Ga0207689_109651661 187
767 3300025944 Ga0207661_10003913 Ga0207661_100039133 187
768 3300025944 Ga0207661_10005361 Ga0207661_100053615 187
769 3300025944 Ga0207661_10011467 Ga0207661_100114674 187
770 3300025944 Ga0207661_10052051 Ga0207661_100520514 187
771 3300025944 Ga0207661_10084855 Ga0207661_100848553 187
772 3300025944 Ga0207661_10099900 Ga0207661_100999001 187
773 3300025944 Ga0207661_10218416 Ga0207661_102184162 187
774 3300025944 Ga0207661_10220429 Ga0207661_102204292 187
775 3300025945 Ga0207679_10000866 Ga0207679_1000086613 187
776 3300025945 Ga0207679_10148306 Ga0207679_101483062 187
777 3300025945 Ga0207679_10157852 Ga0207679_101578523 187
778 3300025945 Ga0207679_10294695 Ga0207679_102946952 187
779 3300025945 Ga0207679_10759619 Ga0207679_107596191 187
780 3300025945 Ga0207679_10829787 Ga0207679_108297871 187
781 3300025949 Ga0207667_10000177 Ga0207667_1000017750 187
782 3300025949 Ga0207667_10045605 Ga0207667_100456054 187
783 3300025949 Ga0207667_10117097 Ga0207667_101170971 187
784 3300025949 Ga0207667_10178273 Ga0207667_101782733 187
785 3300025949 Ga0207667_10208610 Ga0207667_102086102 187
786 3300025960 Ga0207651_10006597 Ga0207651_100065974 187
787 3300025960 Ga0207651_10035717 Ga0207651_100357171 187
788 3300025960 Ga0207651_10075671 Ga0207651_100756711 187
789 3300025960 Ga0207651_10094555 Ga0207651_100945552 187
790 3300025960 Ga0207651_10111969 Ga0207651_101119692 187
791 3300025960 Ga0207651_10131738 Ga0207651_101317383 187
792 3300025960 Ga0207651_10210006 Ga0207651_102100061 187
793 3300025960 Ga0207651_10250091 Ga0207651_102500912 187
794 3300025960 Ga0207651_10446132 Ga0207651_104461322 187
795 3300025960 Ga0207651_10716179 Ga0207651_107161792 187
796 3300025960 Ga0207651_10837462 Ga0207651_108374621 187
797 3300025961 Ga0207712_10023170 Ga0207712_100231705 187
798 3300025961 Ga0207712_10053607 Ga0207712_100536071 187
799 3300025961 Ga0207712_10053644 Ga0207712_100536443 187
800 3300025961 Ga0207712_10061186 Ga0207712_100611863 187
801 3300025961 Ga0207712_10076648 Ga0207712_100766482 187
802 3300025961 Ga0207712_10111513 Ga0207712_101115132 187
803 3300025961 Ga0207712_10117017 Ga0207712_101170173 187
804 3300025961 Ga0207712_10120443 Ga0207712_101204433 187
805 3300025961 Ga0207712_10805608 Ga0207712_108056081 187
806 3300025961 Ga0207712_11112258 Ga0207712_111122581 187
807 3300025972 Ga0207668_10000679 Ga0207668_100006792 187
808 3300025972 Ga0207668_10301533 Ga0207668_103015332 187
809 3300025972 Ga0207668_10890313 Ga0207668_108903131 187
810 3300025981 Ga0207640_10163792 Ga0207640_101637922 187
811 3300025981 Ga0207640_10242161 Ga0207640_102421612 187
812 3300025981 Ga0207640_10312204 Ga0207640_103122042 187
813 3300025981 Ga0207640_10337008 Ga0207640_103370081 187
814 3300025981 Ga0207640_10407162 Ga0207640_104071622 187
815 3300025981 Ga0207640_10846054 Ga0207640_108460542 187
816 3300025986 Ga0207658_10000176 Ga0207658_1000017642 187
817 3300025986 Ga0207658_10062740 Ga0207658_100627403 187
818 3300025986 Ga0207658_10183778 Ga0207658_101837782 187
819 3300025986 Ga0207658_10349102 Ga0207658_103491022 187
820 3300025986 Ga0207658_10977550 Ga0207658_109775501 187
821 3300026023 Ga0207677_10004540 Ga0207677_100045408 187
822 3300026023 Ga0207677_10020044 Ga0207677_100200444 187
823 3300026023 Ga0207677_10087350 Ga0207677_100873502 187
824 3300026023 Ga0207677_10160935 Ga0207677_101609351 187
825 3300026023 Ga0207677_10221271 Ga0207677_102212712 187
826 3300026023 Ga0207677_10284267 Ga0207677_102842671 187
827 3300026035 Ga0207703_10006506 Ga0207703_100065065 187
828 3300026035 Ga0207703_10009195 Ga0207703_100091952 187
829 3300026035 Ga0207703_10079409 Ga0207703_100794093 187
830 3300026035 Ga0207703_10265000 Ga0207703_102650002 187
831 3300026035 Ga0207703_10361609 Ga0207703_103616091 187
832 3300026035 Ga0207703_10646556 Ga0207703_106465561 187
833 3300026035 Ga0207703_10974357 Ga0207703_109743571 187
834 3300026041 Ga0207639_10003909 Ga0207639_100039093 187
835 3300026041 Ga0207639_10004963 Ga0207639_100049639 187
836 3300026041 Ga0207639_10091444 Ga0207639_100914442 187
837 3300026041 Ga0207639_10115704 Ga0207639_101157043 187
838 3300026041 Ga0207639_10137462 Ga0207639_101374621 187
839 3300026041 Ga0207639_10344487 Ga0207639_103444872 187
840 3300026041 Ga0207639_10474254 Ga0207639_104742541 187
841 3300026067 Ga0207678_10040176 Ga0207678_100401763 187
842 3300026078 Ga0207702_10168646 Ga0207702_101686461 187
843 3300026078 Ga0207702_10183994 Ga0207702_101839942 187
844 3300026088 Ga0207641_10000631 Ga0207641_100006316 187
845 3300026088 Ga0207641_10001151 Ga0207641_1000115117 187
846 3300026088 Ga0207641_10002208 Ga0207641_100022089 187
847 3300026088 Ga0207641_10037605 Ga0207641_100376055 187
848 3300026088 Ga0207641_10100743 Ga0207641_101007432 187
849 3300026088 Ga0207641_10330327 Ga0207641_103303272 187
850 3300026088 Ga0207641_10356408 Ga0207641_103564082 187
851 3300026089 Ga0207648_10001692 Ga0207648_1000169214 187
852 3300026089 Ga0207648_10002605 Ga0207648_1000260511 187
853 3300026089 Ga0207648_10009064 Ga0207648_100090644 187
854 3300026089 Ga0207648_10076896 Ga0207648_100768963 187
855 3300026089 Ga0207648_10098855 Ga0207648_100988553 187
856 3300026089 Ga0207648_10137595 Ga0207648_101375952 187
857 3300026089 Ga0207648_10248623 Ga0207648_102486233 187
858 3300026095 Ga0207676_10005000 Ga0207676_100050003 187
859 3300026095 Ga0207676_10057114 Ga0207676_100571144 187
860 3300026095 Ga0207676_10065222 Ga0207676_100652223 187
861 3300026095 Ga0207676_10213664 Ga0207676_102136642 187
862 3300026095 Ga0207676_10215721 Ga0207676_102157212 187
863 3300026095 Ga0207676_10233315 Ga0207676_102333152 187
864 3300026095 Ga0207676_10283830 Ga0207676_102838302 187
865 3300026095 Ga0207676_10559975 Ga0207676_105599751 187
866 3300026095 Ga0207676_10561881 Ga0207676_105618812 187
867 3300026095 Ga0207676_10648211 Ga0207676_106482112 187
868 3300026095 Ga0207676_10819128 Ga0207676_108191281 187
869 3300026095 Ga0207676_10866019 Ga0207676_108660191 187
870 3300026116 Ga0207674_10006874 Ga0207674_1000687412 187
871 3300026116 Ga0207674_10007431 Ga0207674_100074319 187
872 3300026116 Ga0207674_10053745 Ga0207674_100537454 187
873 3300026116 Ga0207674_10102570 Ga0207674_101025703 187
874 3300026116 Ga0207674_10116330 Ga0207674_101163302 187
875 3300026116 Ga0207674_10122120 Ga0207674_101221202 187
876 3300026116 Ga0207674_10127989 Ga0207674_101279892 187
877 3300026116 Ga0207674_10296970 Ga0207674_102969702 187
878 3300026116 Ga0207674_10317100 Ga0207674_103171002 187
879 3300026116 Ga0207674_10509988 Ga0207674_105099882 187
880 3300026116 Ga0207674_10575690 Ga0207674_105756901 187
881 3300026116 Ga0207674_10935994 Ga0207674_109359942 187
882 3300026118 Ga0207675_100007646 Ga0207675_1000076467 187
883 3300026118 Ga0207675_100019361 Ga0207675_1000193613 187
884 3300026118 Ga0207675_100037348 Ga0207675_1000373482 187
885 3300026118 Ga0207675_100040464 Ga0207675_1000404643 187
886 3300026118 Ga0207675_100077392 Ga0207675_1000773923 187
887 3300026118 Ga0207675_100115439 Ga0207675_1001154393 187
888 3300026118 Ga0207675_100118493 Ga0207675_1001184933 187
889 3300026121 Ga0207683_10002881 Ga0207683_100028817 187
890 3300026121 Ga0207683_10036466 Ga0207683_100364663 187
891 3300026142 Ga0207698_10026276 Ga0207698_100262763 187
892 3300026142 Ga0207698_10058347 Ga0207698_100583475 187
893 3300026142 Ga0207698_10338777 Ga0207698_103387772 187
894 3300026142 Ga0207698_10555401 Ga0207698_105554012 187
895 3300026142 Ga0207698_10719298 Ga0207698_107192982 187
896 3300026142 Ga0207698_10913275 Ga0207698_109132751 187
897 3300027471 Ga0209995_1039129 Ga0209995_10391292 187
898 3300027907 Ga0207428_10030362 Ga0207428_100303623 187
899 3300027907 Ga0207428_10750218 Ga0207428_107502181 187
900 3300028379 Ga0268266_10003258 Ga0268266_100032588 187
901 3300028379 Ga0268266_10253760 Ga0268266_102537602 187
902 3300028380 Ga0268265_10004320 Ga0268265_100043202 187
903 3300028380 Ga0268265_10380226 Ga0268265_103802262 187
904 3300028380 Ga0268265_10879310 Ga0268265_108793101 187
905 3300028381 Ga0268264_10002823 Ga0268264_100028238 187
906 3300028381 Ga0268264_10003175 Ga0268264_100031753 187
907 3300028381 Ga0268264_10017151 Ga0268264_100171514 187
908 3300028381 Ga0268264_10034103 Ga0268264_100341032 187
909 3300028381 Ga0268264_10447713 Ga0268264_104477132 187
910 3300028381 Ga0268264_10552878 Ga0268264_105528782 187
911 3300028794 Ga0307515_10000072 Ga0307515_1000007284 187
912 3300031456 Ga0307513_10277312 Ga0307513_102773121 187
913 3300031507 Ga0307509_10111956 Ga0307509_101119562 187
914 3300031507 Ga0307509_10134744 Ga0307509_101347443 187
915 3300031595 Ga0265313_10098515 Ga0265313_100985153 187
916 3300031731 Ga0307405_10039704 Ga0307405_100397043 187
917 3300031824 Ga0307413_10046411 Ga0307413_100464112 187
918 3300031852 Ga0307410_10127969 Ga0307410_101279692 187
919 3300031901 Ga0307406_11073751 Ga0307406_110737511 187
920 3300031903 Ga0307407_10109982 Ga0307407_101099822 187
921 3300031903 Ga0307407_10585515 Ga0307407_105855151 187
922 3300031911 Ga0307412_10629936 Ga0307412_106299362 187
923 3300031911 Ga0307412_11376664 Ga0307412_113766641 187
924 3300031995 Ga0307409_100142886 Ga0307409_1001428863 187
925 3300032002 Ga0307416_100152767 Ga0307416_1001527672 187
926 3300032004 Ga0307414_10594060 Ga0307414_105940601 187
927 3300032005 Ga0307411_10064618 Ga0307411_100646183 187
928 3300032126 Ga0307415_100095007 Ga0307415_1000950073 187
929 3300032126 Ga0307415_100340303 Ga0307415_1003403032 187
930 3300032126 Ga0307415_100734209 Ga0307415_1007342092 187
931 3300033180 Ga0307510_10000091 Ga0307510_1000009164 187
932 3300035092 Ga0373952_0131773 Ga0373952_0131773_61_627 187
933 3300035111 Ga0373923_0035099 Ga0373923_0035099_425_991 187
934 3300035725 Ga0373947_0463711 Ga0373947_0463711_106_672 187
935 3300036401 Ga0373937_0038798 Ga0373937_0038798_3161_3727 187
936 3300037068 Ga0373925_0973541 Ga0373925_0973541_121_687 187
937 3300037418 Ga0395900_0060995 Ga0395900_0060995_170_736 187
938 3300037418 Ga0395900_0258219 Ga0395900_0258219_609_1175 187
939 3300037418 Ga0395900_0543223 Ga0395900_0543223_535_1098 187
940 3300037471 Ga0395905_0009263 Ga0395905_0009263_5512_6078 187
941 3300037471 Ga0395905_0032320 Ga0395905_0032320_391_957 187
942 3300037471 Ga0395905_0078586 Ga0395905_0078586_2443_3009 187
943 3300037471 Ga0395905_0267038 Ga0395905_0267038_858_1424 187
944 3300037471 Ga0395905_0963051 Ga0395905_0963051_33_599 187
945 3300037471 Ga0395905_1059981 Ga0395905_1059981_124_690 187
946 3300039437 Ga0436365_1285215 Ga0436365_1285215_10262_10825 187
947 3300039450 Ga0436363_0330490 Ga0436363_0330490_484_1050 187
948 3300041460 Ga0451802_1218311 Ga0451802_1218311_75_638 187
949 3300041512 Ga0451853_3841961 Ga0451853_3841961_810_1376 187
950 3300041997 Ga0439431_0090559 Ga0439431_0090559_75_638 187
951 3300042001 Ga0439441_004375 Ga0439441_004375_1096_1662 187
952 3300042001 Ga0439441_024579 Ga0439441_024579_139_705 187
953 3300042003 Ga0439443_022276 Ga0439443_022276_93_659 187
954 3300042007 Ga0439449_0002804 Ga0439449_0002804_490_1056 187
955 3300042014 Ga0439457_031175 Ga0439457_031175_169_735 187
956 3300042439 Ga0439464_0097162 Ga0439464_0097162_216_782 187
957 3300042876 Ga0451577_0073865 Ga0451577_0073865_1991_2554 187
958 3300044656 Ga0466969_0001246 Ga0466969_0001246_8836_9399 187
959 3300044656 Ga0466969_0071945 Ga0466969_0071945_299_862 187
960 3300044658 Ga0466972_0000013 Ga0466972_0000013_89646_90209 187
961 3300044658 Ga0466972_0370278 Ga0466972_0370278_71_637 187
962 3300044683 Ga0466965_0198393 Ga0466965_0198393_10_573 187
963 3300044684 Ga0466966_0000045 Ga0466966_0000045_70115_70678 187
964 3300044684 Ga0466966_0066006 Ga0466966_0066006_628_1191 187
965 3300044719 Ga0466971_0145642 Ga0466971_0145642_371_934 187
966 3300044765 Ga0466970_0001156 Ga0466970_0001156_4506_5069 187
967 3300044842 Ga0466957_0000070 Ga0466957_0000070_38888_39451 187
968 3300044842 Ga0466957_0591986 Ga0466957_0591986_38_604 187
969 3300045049 Ga0466959_0000023 Ga0466959_0000023_76298_76861 187
970 3300045049 Ga0466959_0008989 Ga0466959_0008989_5515_6078 187
971 3300045049 Ga0466959_0125397 Ga0466959_0125397_72_638 187
972 3300045051 Ga0451576_1047326 Ga0451576_1047326_99_665 187
973 3300045976 Ga0466967_0123268 Ga0466967_0123268_116_682 187
974 3300046507 Ga0495606_0004249 Ga0495606_0004249_9716_10279 187
975 3300046516 Ga0495628_0112891 Ga0495628_0112891_50_616 187
976 3300046522 Ga0495643_0050744 Ga0495643_0050744_251_814 187
977 3300046536 Ga0495587_0051505 Ga0495587_0051505_144_710 187
978 3300046648 Ga0495611_0045973 Ga0495611_0045973_50_616 187
979 3300046660 Ga0495625_0436769 Ga0495625_0436769_19_582 187
980 3300046675 Ga0495657_0278633 Ga0495657_0278633_376_942 187
981 3300046689 Ga0495613_0367838 Ga0495613_0367838_376_942 187
982 3300047317 Ga0495604_0449793 Ga0495604_0449793_117_683 187
983 3300047319 Ga0495674_0096356 Ga0495674_0096356_1215_1784 187
984 3300047320 Ga0495672_0015619 Ga0495672_0015619_4004_4570 187
985 3300047321 Ga0495676_0293233 Ga0495676_0293233_259_825 187
986 3300047321 Ga0495676_0578522 Ga0495676_0578522_23_589 187
987 3300047322 Ga0495680_0218622 Ga0495680_0218622_672_1238 187
988 3300047443 Ga0495687_000001 Ga0495687_000001_396074_396637 187
989 3300047471 Ga0495684_0226719 Ga0495684_0226719_146_712 187
990 3300048908 Ga0496105_0159201 Ga0496105_0159201_830_1399 187
991 3300048912 Ga0496109_0311902 Ga0496109_0311902_769_1362 187
992 3300048913 Ga0496110_0171267 Ga0496110_0171267_1165_1731 187
993 3300048913 Ga0496110_0180830 Ga0496110_0180830_895_1461 187
994 3300049521 Ga0501298_009953 Ga0501298_009953_596_1162 187
995 3300049524 Ga0501301_016588 Ga0501301_016588_71_637 187
996 3300049568 Ga0501031_0287330 Ga0501031_0287330_401_967 187
997 3300049571 Ga0501034_0022717 Ga0501034_0022717_4503_5069 187
998 3300049571 Ga0501034_0558505 Ga0501034_0558505_306_872 187
999 3300049572 Ga0501036_0154076 Ga0501036_0154076_345_911 187
1000 3300049573 Ga0501037_0146479 Ga0501037_0146479_1020_1589 187
1001 3300049574 Ga0501038_0019364 Ga0501038_0019364_5020_5586 187
1002 3300049574 Ga0501038_0370341 Ga0501038_0370341_238_804 187
1003 3300049579 Ga0501043_0003765 Ga0501043_0003765_238_804 187
1004 3300049579 Ga0501043_0024677 Ga0501043_0024677_2669_3235 187
1005 3300049579 Ga0501043_0038841 Ga0501043_0038841_2945_3511 187
1006 3300049580 Ga0501046_0081476 Ga0501046_0081476_1709_2275 187
1007 3300049580 Ga0501046_0444175 Ga0501046_0444175_169_735 187
1008 3300049588 Ga0501072_0285552 Ga0501072_0285552_720_1286 187
1009 3300049589 Ga0501073_0024177 Ga0501073_0024177_513_1079 187
1010 3300049649 Ga0501198_020162 Ga0501198_020162_456_1022 187
1011 3300049649 Ga0501198_034988 Ga0501198_034988_184_750 187
1012 3300049652 Ga0501202_000075 Ga0501202_000075_9483_10049 187
1013 3300049652 Ga0501202_001677 Ga0501202_001677_2115_2681 187
1014 3300049653 Ga0501206_005016 Ga0501206_005016_161_727 187
1015 3300049654 Ga0501207_092800 Ga0501207_092800_13_579 187
1016 3300049656 Ga0501209_040616 Ga0501209_040616_571_1137 187
1017 3300049658 Ga0501211_009429 Ga0501211_009429_339_905 187
1018 3300049661 Ga0501217_002570 Ga0501217_002570_1819_2385 187
1019 3300049661 Ga0501217_004398 Ga0501217_004398_394_960 187
1020 3300049662 Ga0501222_023448 Ga0501222_023448_18_584 187
1021 3300049663 Ga0501223_002561 Ga0501223_002561_501_1115 187
1022 3300049664 Ga0501224_000798 Ga0501224_000798_2658_3224 187
1023 3300049664 Ga0501224_011073 Ga0501224_011073_440_1006 187
1024 3300049673 Ga0501240_004216 Ga0501240_004216_32_598 187
1025 3300049673 Ga0501240_031461 Ga0501240_031461_210_776 187
1026 3300049679 Ga0501249_082644 Ga0501249_082644_62_628 187
1027 3300049686 Ga0501257_000560 Ga0501257_000560_3344_3910 187
1028 3300049688 Ga0501259_000437 Ga0501259_000437_446_1012 187
1029 3300049688 Ga0501259_001665 Ga0501259_001665_1465_2031 187
1030 3300049703 Ga0501219_000027 Ga0501219_000027_20214_20777 187
1031 3300049704 Ga0501221_000197 Ga0501221_000197_7296_7862 187
1032 3300049704 Ga0501221_005522 Ga0501221_005522_201_767 187
1033 3300049705 Ga0501225_0012209 Ga0501225_0012209_806_1372 187
1034 3300049705 Ga0501225_0037378 Ga0501225_0037378_679_1245 187
1035 3300049705 Ga0501225_0037891 Ga0501225_0037891_35_601 187
1036 3300049706 Ga0501229_038859 Ga0501229_038859_47_613 187
1037 3300049707 Ga0501234_002498 Ga0501234_002498_2068_2634 187
1038 3300049707 Ga0501234_007842 Ga0501234_007842_80_646 187
1039 3300049708 Ga0501245_001664 Ga0501245_001664_1899_2465 187
1040 3300049708 Ga0501245_021133 Ga0501245_021133_431_997 187
1041 3300049742 Ga0501080_0355785 Ga0501080_0355785_593_1159 187
1042 3300049744 Ga0501083_0175553 Ga0501083_0175553_17_583 187
1043 3300049758 Ga0501241_019118 Ga0501241_019118_119_682 187
1044 3300049758 Ga0501241_062282 Ga0501241_062282_79_645 187
1045 3300049765 Ga0501268_001349 Ga0501268_001349_1394_1960 187
1046 3300049766 Ga0501269_013660 Ga0501269_013660_172_738 187
1047 3300049767 Ga0501270_016880 Ga0501270_016880_408_974 187
1048 3300049771 Ga0501274_015541 Ga0501274_015541_50_616 187
1049 3300049775 Ga0501279_012603 Ga0501279_012603_41_607 187
1050 3300049822 Ga0501035_0056798 Ga0501035_0056798_2424_2990 187
1051 3300049822 Ga0501035_0131122 Ga0501035_0131122_483_1049 187
1052 3300049823 Ga0501044_0045447 Ga0501044_0045447_411_977 187
1053 3300049823 Ga0501044_0157184 Ga0501044_0157184_525_1091 187
1054 3300050005 Ga0501284_00021 Ga0501284_00021_59958_60521 187
1055 3300050493 nmdc:mga0k408_218880_c1 nmdc:mga0k408_218880_c1_214_777 187
1056 3300050493 nmdc:mga0k408_23568_c1 nmdc:mga0k408_23568_c1_2307_2870 187
1057 3300050507 nmdc:mga05p37_12189_c1 nmdc:mga05p37_12189_c1_4394_4957 187
1058 3300050507 nmdc:mga05p37_129725_c1 nmdc:mga05p37_129725_c1_700_1266 187
1059 3300050508 nmdc:mga09592_152263_c1 nmdc:mga09592_152263_c1_875_1441 187
1060 3300050508 nmdc:mga09592_421360_c1 nmdc:mga09592_421360_c1_397_960 187
1061 3300050508 nmdc:mga09592_5207_c1 nmdc:mga09592_5207_c1_2160_2726 187
1062 3300050509 nmdc:mga0qj67_23710_c1 nmdc:mga0qj67_23710_c1_2085_2651 187
1063 3300050511 nmdc:mga08y16_85815_c1 nmdc:mga08y16_85815_c1_1873_2439 187
1064 3300050511 nmdc:mga08y16_96143_c1 nmdc:mga08y16_96143_c1_1700_2263 187
1065 3300050512 nmdc:mga0n895_1093269_c1 nmdc:mga0n895_1093269_c1_168_734 187
1066 3300050512 nmdc:mga0n895_402408_c1 nmdc:mga0n895_402408_c1_804_1370 187
1067 3300050513 nmdc:mga0rr50_1039330_c1 nmdc:mga0rr50_1039330_c1_39_605 187
1068 3300053093 Ga0500651_0325374 Ga0500651_0325374_126_689 187
1069 3300053096 Ga0500641_0006740 Ga0500641_0006740_267_830 187
1070 3300053146 Ga0500588_0000589 Ga0500588_0000589_2217_2780 187
1071 3300053178 Ga0500637_0114965 Ga0500637_0114965_546_1109 187
1072 3300053730 Ga0500645_006772 Ga0500645_006772_203_766 187
1073 3300055283 Ga0500661_017685 Ga0500661_017685_172_735 187
1074 3300061719 Ga0466962_0006963 Ga0466962_0006963_4312_4875 187

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vc1-assembly1.cif.gz_B crystal structure of the tm1442 protein from thermotoga maritima, a homolog of the bacillus subtilis general stress response anti-anti-sigma factor rsbv 0.7791 54 164
2ka5-assembly1.cif.gz_A nmr structure of the protein tm1081 0.7758 59 162
1h4y-assembly2.cif.gz_B structure of the anti-sigma factor antagonist spoiiaa in its unphosphorylated form 0.7735 57 180
1til-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii 0.771 54 167
1sbo-assembly1.cif.gz_A solution structure of putative anti sigma factor antagonist from thermotoga maritima (tm1442) 0.7701 54 162
ID Description Score Start End Superfamily
af_B0V3V8_450_565_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7803 57 165 3.30.750.24
af_P60070_1_106_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7695 54 165 3.30.750.24
af_P60070_1_106_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7575 54 165 3.30.750.24
3f43A01 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.757 62 165 3.30.750.24
af_A0A1D6ELD4_35_180_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7488 67 161 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A7C4UAG5-F1-model_v4 Uncharacterized protein 0.9792 104 186
AF-A0A4Q3EJ08-F1-model_v4 Uncharacterized protein 0.9438 58 187
AF-A0A7C4UAG5-F1-model_v4 Uncharacterized protein 0.9349 104 186
AF-A0A4Q3EJ08-F1-model_v4 Uncharacterized protein 0.9232 58 187
AF-A0A4Q5QRB9-F1-model_v4 DUF695 domain-containing protein 0.8868 37 187

Feature Viewer

pLDDT pTM Quality
83.24 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map