F489536

General Info

Members Datasets Scaffolds Average Seq Length
1074 631 2148 281

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1004420|JGI25160J50197_10044205
Length 323
Sequence MPGLVPGIHGLTTTVATGNVDGRDKPGHDGNIGPMTPRTATLIGLTAILMWSLLSVMTVATGRIPAXQLAAMTFAIGGLVGLLTWIGRGEAAKSLRQPLVVWAVGVGGLFGYHALYFLALRFAPPAEAGLLNYLWPLLIVLFSSFLPGERLALHHIVGAMLGLXGTVLLFAGNTSGFAAEXXPGLAAAFIAAFVWAAYSVLSRRLKAVPTDAVAGFCLATAVLAALMHGLLETTVWPETALQWLSVIALGIGPVGAAFYAWDIGMKRGDIRVLGAASYATPLLSTGFLIAAGFAKASANIAIAAILIAGGGLIAAKDMVLRKR

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
79 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
80 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
108 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
109 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
110 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
177 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
178 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
179 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
184 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
187 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
188 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
193 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
212 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
238 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
258 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
259 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
260 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
261 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
262 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
263 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
266 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
267 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
270 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
271 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
281 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
326 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
327 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
328 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
329 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
335 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
362 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
363 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
370 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
371 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
374 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
377 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
378 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
379 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
380 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
381 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
382 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
383 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
384 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
385 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
388 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
389 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
390 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
391 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
392 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
393 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
394 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
395 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
396 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
397 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
398 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
399 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
400 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
401 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
402 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
403 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
404 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
405 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
406 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
407 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
408 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
412 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
413 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
414 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
415 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
416 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
417 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
418 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
419 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
420 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
421 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
422 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
423 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
424 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
425 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
426 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
427 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
428 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
429 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
430 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
431 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
432 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
433 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
434 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
435 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
436 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
437 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
438 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
439 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
440 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
441 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
442 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
443 2791355199
444 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
445 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
446 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
447 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
448 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
449 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
450 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
451 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
452 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
453 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
454 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
455 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
456 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
457 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
458 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
459 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
460 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
461 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
462 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
463 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
464 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
465 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
466 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
467 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
468 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
469 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
470 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
471 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
472 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
473 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
474 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
475 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
476 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
477 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
478 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
479 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
480 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
481 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
482 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
483 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
484 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
485 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
486 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
487 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
488 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
489 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
490 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
491 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
492 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
493 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
494 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
495 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
496 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
497 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
498 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
499 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
500 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
501 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
502 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
503 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
504 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
505 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
506 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
507 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
508 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
509 2904699407
510 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
511 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
512 2906610324
513 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
514 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
515 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
516 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
517 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
518 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
519 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
520 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
521 2922368715
522 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
523 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
524 2922425934
525 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
526 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
527 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
528 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
529 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
530 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
531 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
532 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
533 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
534 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
535 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
536 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
537 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
538 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
539 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
540 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
541 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
542 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
543 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
544 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
545 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
546 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
547 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
548 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
549 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
550 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
551 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
552 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
553 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
554 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
555 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
556 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
557 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
558 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
559 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
560 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
561 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
562 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
563 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
564 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
565 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
566 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
567 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
568 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
569 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
570 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
571 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
572 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
573 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
574 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
575 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
576 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
577 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
578 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
579 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
580 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
581 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
582 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
583 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
584 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
585 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
586 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
587 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
588 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
589 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
590 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
591 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
592 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
593 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
594 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
595 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
596 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
597 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
598 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
599 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
600 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
601 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
602 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
603 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
604 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
605 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
606 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
607 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
608 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
609 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
610 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
611 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
612 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
613 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
614 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
615 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
616 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
617 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
618 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
619 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
620 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
621 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
622 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
623 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
624 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
625 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
626 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
627 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
628 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
629 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
630 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
631 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.79
Metatranscriptomes 0
Isolates 20.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.27
Nodule 16.95
Rhizoplane 6.52
Rhizosphere 52.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1004420 3300003354 Bacteria 6089
2 JGI24735J21928_10007902 3300002067 Bacteria 3456
3 JGI24738J21930_10033436 3300002075 Bacteria 1048
4 JGI25406J46586_10000037 3300003203 Bacteria 60422
5 JGI25406J46586_10005680 3300003203 Bacteria 5767
6 JGI25153J46596_10000591 3300003215 Bacteria 22150
7 JGI25153J46596_10004986 3300003215 Bacteria 7047
8 JGI25153J46596_10013134 3300003215 Bacteria 3520
9 JGI25153J46596_10013961 3300003215 Bacteria 3369
10 rootH2_10064097 3300003320 Bacteria 1362
11 rootH2_10064098 3300003320 Bacteria 1426
12 rootL2_10140331 3300003322 Bacteria 2103
13 rootL2_10162604 3300003322 Bacteria 1263
14 rootH1_10032470 3300003323 Bacteria 2350
15 JGI25160J50197_1005757 3300003354 Bacteria 5111
16 JGI25404J52841_10004260 3300003659 Bacteria 2885
17 Ga0055531_10006094 3300003794 Bacteria 6906
18 Ga0055543_1001867 3300004625 Bacteria 7671
19 Ga0065165_1000588 3300005262 Bacteria 53386
20 Ga0065165_1000740 3300005262 Bacteria 45296
21 Ga0065165_1005557 3300005262 Bacteria 7012
22 Ga0065165_1006740 3300005262 Bacteria 5888
23 Ga0070676_10297577 3300005328 Bacteria 1093
24 Ga0070690_100105838 3300005330 Bacteria 1870
25 Ga0068869_100140484 3300005334 Bacteria 1864
26 Ga0068869_100498225 3300005334 Bacteria 1016
27 Ga0070680_100023369 3300005336 Bacteria 4930
28 Ga0070680_100056984 3300005336 Bacteria 3194
29 Ga0070680_100105672 3300005336 Bacteria 2340
30 Ga0070682_100302675 3300005337 Bacteria 1174
31 Ga0070682_100339768 3300005337 Bacteria 1116
32 Ga0068868_100009478 3300005338 Bacteria 7012
33 Ga0068868_100058016 3300005338 Bacteria 3059
34 Ga0068868_100202618 3300005338 Bacteria 1655
35 Ga0070660_100008728 3300005339 Bacteria 7097
36 Ga0070660_100564668 3300005339 Bacteria 950
37 Ga0070691_10012605 3300005341 Bacteria 3872
38 Ga0070691_10221437 3300005341 Bacteria 1003
39 Ga0070661_100087129 3300005344 Bacteria 2309
40 Ga0070668_100064166 3300005347 Bacteria 2847
41 Ga0070669_100180247 3300005353 Bacteria 1652
42 Ga0070669_100208283 3300005353 Bacteria 1541
43 Ga0070674_100075340 3300005356 Bacteria 2396
44 Ga0070688_100257976 3300005365 Bacteria 1244
45 Ga0070659_100022689 3300005366 Bacteria 4794
46 Ga0070667_100059232 3300005367 Bacteria 3239
47 Ga0070709_10003001 3300005434 Bacteria 9085
48 Ga0070709_10004744 3300005434 Bacteria 7340
49 Ga0070709_10011463 3300005434 Bacteria 4942
50 Ga0070709_10029937 3300005434 Bacteria 3262
51 Ga0070714_100033539 3300005435 Bacteria 4292
52 Ga0070714_100039511 3300005435 Bacteria 3973
53 Ga0070714_100201789 3300005435 Bacteria 1819
54 Ga0070713_100005050 3300005436 Bacteria 8974
55 Ga0070713_100018203 3300005436 Bacteria 5337
56 Ga0070713_100024984 3300005436 Bacteria 4663
57 Ga0070713_100121255 3300005436 Bacteria 2294
58 Ga0070713_100188815 3300005436 Bacteria 1856
59 Ga0070710_10000783 3300005437 Bacteria 15215
60 Ga0070711_100008994 3300005439 Bacteria 6131
61 Ga0070711_100056390 3300005439 Bacteria 2717
62 Ga0070711_100268875 3300005439 Bacteria 1344
63 Ga0070700_100233337 3300005441 Bacteria 1311
64 Ga0070708_100139482 3300005445 Bacteria 2248
65 Ga0070663_100105173 3300005455 Bacteria 2112
66 Ga0070663_100128273 3300005455 Bacteria 1923
67 Ga0070663_100133634 3300005455 Bacteria 1887
68 Ga0070663_100192007 3300005455 Bacteria 1590
69 Ga0070663_100236330 3300005455 Bacteria 1441
70 Ga0070663_100259590 3300005455 Bacteria 1378
71 Ga0070678_100024087 3300005456 Bacteria 4068
72 Ga0070678_100086309 3300005456 Bacteria 2394
73 Ga0070678_100209447 3300005456 Bacteria 1614
74 Ga0070662_100291718 3300005457 Bacteria 1323
75 Ga0070681_10023619 3300005458 Bacteria 6185
76 Ga0070681_10099564 3300005458 Bacteria 2852
77 Ga0070681_10121594 3300005458 Bacteria 2545
78 Ga0070681_10483068 3300005458 Bacteria 1152
79 Ga0070707_100099457 3300005468 Bacteria 2818
80 Ga0070698_100151680 3300005471 Bacteria 2265
81 Ga0070679_100023442 3300005530 Bacteria 6041
82 Ga0070679_100112332 3300005530 Bacteria 2710
83 Ga0070684_100057912 3300005535 Bacteria 3384
84 Ga0070684_100111137 3300005535 Bacteria 2457
85 Ga0070684_100329082 3300005535 Bacteria 1404
86 Ga0068853_100001674 3300005539 Bacteria 16220
87 Ga0068853_100082622 3300005539 Bacteria 2814
88 Ga0068853_100225855 3300005539 Bacteria 1711
89 Ga0068853_100257971 3300005539 Bacteria 1602
90 Ga0070672_100290136 3300005543 Bacteria 1385
91 Ga0070665_100012097 3300005548 Bacteria 8707
92 Ga0070665_100079373 3300005548 Bacteria 3287
93 Ga0070665_100124175 3300005548 Bacteria 2583
94 Ga0070665_100205182 3300005548 Bacteria 1972
95 Ga0070665_100418948 3300005548 Bacteria 1348
96 Ga0068855_100079092 3300005563 Bacteria 3814
97 Ga0068855_100140528 3300005563 Bacteria 2753
98 Ga0068855_100299191 3300005563 Bacteria 1782
99 Ga0068855_100603901 3300005563 Bacteria 1183
100 Ga0070664_100117829 3300005564 Bacteria 2323
101 Ga0070664_100209020 3300005564 Bacteria 1744
102 Ga0070664_100548216 3300005564 Bacteria 1069
103 Ga0068857_100069478 3300005577 Bacteria 3136
104 Ga0068857_100106916 3300005577 Bacteria 2513
105 Ga0068857_100238126 3300005577 Bacteria 1666
106 Ga0068854_100119694 3300005578 Bacteria 1997
107 Ga0068856_100281813 3300005614 Bacteria 1679
108 Ga0068856_100426216 3300005614 Bacteria 1347
109 Ga0068856_100427383 3300005614 Bacteria 1345
110 Ga0068852_100003231 3300005616 Bacteria 11378
111 Ga0068852_100006469 3300005616 Bacteria 8463
112 Ga0068852_100333887 3300005616 Bacteria 1476
113 Ga0068859_100112363 3300005617 Bacteria 2787
114 Ga0068864_100177960 3300005618 Bacteria 1943
115 Ga0068864_100318743 3300005618 Bacteria 1460
116 Ga0068864_100482690 3300005618 Bacteria 1190
117 Ga0068866_10064605 3300005718 Bacteria 1911
118 Ga0068861_100659326 3300005719 Bacteria 968
119 Ga0068863_100494658 3300005841 Bacteria 1204
120 Ga0068858_100018713 3300005842 Bacteria 6482
121 Ga0068858_100195923 3300005842 Bacteria 1909
122 Ga0068858_100246336 3300005842 Bacteria 1697
123 Ga0068858_100495591 3300005842 Bacteria 1180
124 Ga0068860_100001139 3300005843 Bacteria 29182
125 Ga0068860_100343730 3300005843 Bacteria 1467
126 Ga0068862_100110481 3300005844 Bacteria 2412
127 Ga0068862_100114980 3300005844 Bacteria 2366
128 Ga0081455_10001309 3300005937 Bacteria 30858
129 Ga0081455_10018523 3300005937 Bacteria 6628
130 Ga0081455_10020228 3300005937 Bacteria 6275
131 Ga0081455_10036634 3300005937 Bacteria 4365
132 Ga0081455_10049752 3300005937 Bacteria 3611
133 Ga0081455_10084588 3300005937 Bacteria 2589
134 Ga0081540_1000974 3300005983 Bacteria 25845
135 Ga0081540_1004883 3300005983 Bacteria 10099
136 Ga0081540_1015371 3300005983 Bacteria 4849
137 Ga0081540_1017362 3300005983 Bacteria 4459
138 Ga0081540_1022426 3300005983 Bacteria 3729
139 Ga0081540_1038246 3300005983 Bacteria 2531
140 Ga0081540_1057292 3300005983 Bacteria 1885
141 Ga0081540_1095749 3300005983 Bacteria 1293
142 Ga0081539_10000129 3300005985 Bacteria 178675
143 Ga0081539_10001014 3300005985 Bacteria 51820
144 Ga0070717_10004800 3300006028 Bacteria 9834
145 Ga0075365_10031330 3300006038 Bacteria 3411
146 Ga0075365_10096692 3300006038 Bacteria 2018
147 Ga0075365_10154047 3300006038 Bacteria 1599
148 Ga0075363_100017604 3300006048 Bacteria 3546
149 Ga0075363_100148447 3300006048 Bacteria 1322
150 Ga0075364_10048128 3300006051 Bacteria 2778
151 Ga0075364_10076027 3300006051 Bacteria 2216
152 Ga0070716_100202773 3300006173 Bacteria 1320
153 Ga0070712_100032032 3300006175 Bacteria 3547
154 Ga0070712_100046641 3300006175 Bacteria 2996
155 Ga0070712_100064176 3300006175 Bacteria 2603
156 Ga0075362_10073483 3300006177 Bacteria 1565
157 Ga0075362_10092345 3300006177 Bacteria 1406
158 Ga0075367_10111522 3300006178 Bacteria 1679
159 Ga0075369_10095058 3300006186 Bacteria 1332
160 Ga0075369_10141667 3300006186 Bacteria 1096
161 Ga0075366_10044260 3300006195 Bacteria 2638
162 Ga0075366_10052019 3300006195 Bacteria 2434
163 Ga0075366_10101128 3300006195 Bacteria 1730
164 Ga0075366_10131770 3300006195 Bacteria 1509
165 Ga0075370_10019630 3300006353 Bacteria 3683
166 Ga0075370_10041526 3300006353 Bacteria 2596
167 Ga0075370_10051126 3300006353 Bacteria 2344
168 Ga0068871_100250145 3300006358 Bacteria 1544
169 Ga0075428_100182995 3300006844 Bacteria 2267
170 Ga0075434_100005953 3300006871 Bacteria 11160
171 Ga0097620_100112364 3300006931 Bacteria 2787
172 Ga0099824_1002409 3300006942 Bacteria 27310
173 Ga0099824_1026240 3300006942 Bacteria 3036
174 Ga0099822_1000008 3300006943 Bacteria 76583
175 Ga0099822_1032243 3300006943 Bacteria 3749
176 Ga0099823_1036150 3300006944 Bacteria 3811
177 Ga0075435_100241077 3300007076 Bacteria 1538
178 Ga0099794_10017446 3300007265 Bacteria 3200
179 Ga0099794_10046357 3300007265 Bacteria 2082
180 Ga0105240_10006107 3300009093 Bacteria 17771
181 Ga0105240_10021775 3300009093 Bacteria 8518
182 Ga0105240_10043731 3300009093 Bacteria 5695
183 Ga0105240_10238966 3300009093 Bacteria 2107
184 Ga0111539_10191497 3300009094 Bacteria 2386
185 Ga0105247_10041523 3300009101 Bacteria 2815
186 Ga0105247_10117833 3300009101 Bacteria 1717
187 Ga0105247_10137536 3300009101 Bacteria 1597
188 Ga0114129_10304702 3300009147 Bacteria 2122
189 Ga0114129_10408551 3300009147 Bacteria 1788
190 Ga0105243_10057383 3300009148 Bacteria 3100
191 Ga0105243_10145425 3300009148 Bacteria 2028
192 Ga0105243_10251293 3300009148 Bacteria 1579
193 Ga0105241_10022183 3300009174 Bacteria 4700
194 Ga0105241_10079311 3300009174 Bacteria 2567
195 Ga0105241_10532661 3300009174 Bacteria 1052
196 Ga0105242_10090821 3300009176 Bacteria 2570
197 Ga0105242_10229631 3300009176 Bacteria 1663
198 Ga0105248_10037613 3300009177 Bacteria 5414
199 Ga0105248_10590436 3300009177 Bacteria 1253
200 Ga0105237_10009904 3300009545 Bacteria 10175
201 Ga0105237_10033108 3300009545 Bacteria 5236
202 Ga0105237_10060031 3300009545 Bacteria 3804
203 Ga0105237_10062170 3300009545 Bacteria 3733
204 Ga0105237_10073283 3300009545 Bacteria 3417
205 Ga0105237_10083748 3300009545 Bacteria 3180
206 Ga0105237_10120420 3300009545 Bacteria 2619
207 Ga0105237_10255954 3300009545 Bacteria 1753
208 Ga0105238_10014653 3300009551 Bacteria 7928
209 Ga0105238_10024115 3300009551 Bacteria 6202
210 Ga0105238_10071502 3300009551 Bacteria 3467
211 Ga0105238_10184498 3300009551 Bacteria 2063
212 Ga0099796_10028566 3300010159 Bacteria 1792
213 Ga0105239_10014496 3300010375 Bacteria 8745
214 Ga0105239_10047760 3300010375 Bacteria 4692
215 Ga0105239_10082518 3300010375 Bacteria 3540
216 Ga0105239_10099300 3300010375 Bacteria 3218
217 Ga0105239_10111999 3300010375 Bacteria 3025
218 Ga0105239_10134528 3300010375 Bacteria 2752
219 Ga0105239_10194047 3300010375 Bacteria 2274
220 Ga0105239_10335920 3300010375 Bacteria 1705
221 Ga0105239_10376322 3300010375 Bacteria 1605
222 Ga0105239_10622578 3300010375 Bacteria 1232
223 Ga0157373_10041341 3300013100 Bacteria 3298
224 Ga0157370_10152261 3300013104 Bacteria 2152
225 Ga0157369_10040768 3300013105 Bacteria 5069
226 Ga0157369_10111758 3300013105 Bacteria 2904
227 Ga0157378_10279543 3300013297 Bacteria 1608
228 Ga0157378_10435969 3300013297 Bacteria 1298
229 Ga0157378_10652212 3300013297 Bacteria 1068
230 Ga0163162_10023466 3300013306 Bacteria 6088
231 Ga0163162_10154941 3300013306 Bacteria 2411
232 Ga0157372_10210171 3300013307 Bacteria 2255
233 Ga0157372_10397355 3300013307 Bacteria 1606
234 Ga0157375_10052325 3300013308 Bacteria 4014
235 Ga0157375_10616215 3300013308 Bacteria 1244
236 Ga0163163_10147150 3300014325 Bacteria 2400
237 Ga0163163_10567132 3300014325 Bacteria 1198
238 Ga0157380_10092615 3300014326 Bacteria 2498
239 Ga0157379_10081849 3300014968 Bacteria 2892
240 Ga0157376_10213362 3300014969 Bacteria 1783
241 Ga0157376_10383619 3300014969 Bacteria 1354
242 Ga0163161_10107106 3300017792 Bacteria 2086
243 Ga0214544_1000087 3300021320 Bacteria 119600
244 Ga0214542_1000018 3300021321 Bacteria 202226
245 Ga0214542_1024233 3300021321 Bacteria 3437
246 Ga0214545_1000009 3300021324 Bacteria 202915
247 Ga0214545_1024968 3300021324 Bacteria 3566
248 Ga0214543_1000037 3300021327 Bacteria 182113
249 Ga0214543_1025986 3300021327 Bacteria 3251
250 Ga0213876_10008883 3300021384 Bacteria 5419
251 Ga0207425_1005095 3300025245 Bacteria 3805
252 Ga0209677_100881 3300025253 Bacteria 14742
253 Ga0209677_101632 3300025253 Bacteria 9454
254 Ga0209148_1000192 3300025254 Bacteria 115724
255 Ga0209233_1007650 3300025261 Bacteria 3405
256 Ga0209233_1010065 3300025261 Bacteria 2850
257 Ga0209455_1002675 3300025272 Bacteria 6708
258 Ga0209455_1003697 3300025272 Bacteria 5294
259 Ga0209564_1000602 3300025295 Bacteria 56176
260 Ga0209564_1002977 3300025295 Bacteria 12171
261 Ga0209564_1013312 3300025295 Bacteria 3507
262 Ga0209758_1000030 3300025297 Bacteria 509217
263 Ga0209758_1001028 3300025297 Bacteria 36645
264 Ga0209758_1001172 3300025297 Bacteria 33281
265 Ga0209758_1003935 3300025297 Bacteria 12926
266 Ga0209758_1007247 3300025297 Bacteria 7626
267 Ga0209758_1009369 3300025297 Bacteria 6101
268 Ga0209758_1021361 3300025297 Bacteria 3019
269 Ga0209256_1013525 3300025299 Bacteria 3021
270 Ga0209256_1041933 3300025299 Bacteria 1159
271 Ga0207426_1000663 3300025302 Bacteria 42213
272 Ga0207426_1001191 3300025302 Bacteria 23117
273 Ga0207426_1002497 3300025302 Bacteria 11626
274 Ga0207426_1017997 3300025302 Bacteria 2500
275 Ga0207426_1041337 3300025302 Bacteria 1430
276 Ga0209257_1000797 3300025304 Bacteria 46045
277 Ga0207697_10055160 3300025315 Bacteria 1647
278 Ga0207692_10006519 3300025898 Bacteria 4737
279 Ga0207642_10210262 3300025899 Bacteria 1080
280 Ga0207710_10080294 3300025900 Bacteria 1512
281 Ga0207710_10179865 3300025900 Bacteria 1037
282 Ga0207688_10063383 3300025901 Bacteria 2085
283 Ga0207647_10014234 3300025904 Bacteria 5489
284 Ga0207647_10096177 3300025904 Bacteria 1763
285 Ga0207647_10106034 3300025904 Bacteria 1664
286 Ga0207647_10173607 3300025904 Bacteria 1254
287 Ga0207699_10014508 3300025906 Bacteria 4064
288 Ga0207699_10026467 3300025906 Bacteria 3198
289 Ga0207645_10080300 3300025907 Bacteria 2091
290 Ga0207645_10230635 3300025907 Bacteria 1222
291 Ga0207705_10048689 3300025909 Bacteria 3049
292 Ga0207705_10059192 3300025909 Bacteria 2764
293 Ga0207654_10038638 3300025911 Bacteria 2680
294 Ga0207654_10082964 3300025911 Bacteria 1934
295 Ga0207707_10010369 3300025912 Bacteria 8084
296 Ga0207695_10000059 3300025913 Bacteria 363920
297 Ga0207695_10015974 3300025913 Bacteria 8812
298 Ga0207695_10079155 3300025913 Bacteria 3332
299 Ga0207695_10146739 3300025913 Bacteria 2302
300 Ga0207671_10001093 3300025914 Bacteria 32794
301 Ga0207671_10023342 3300025914 Bacteria 4665
302 Ga0207671_10107955 3300025914 Bacteria 2115
303 Ga0207671_10278007 3300025914 Bacteria 1320
304 Ga0207693_10015453 3300025915 Bacteria 6123
305 Ga0207693_10060810 3300025915 Bacteria 2959
306 Ga0207693_10075510 3300025915 Bacteria 2639
307 Ga0207663_10012680 3300025916 Bacteria 4563
308 Ga0207660_10028980 3300025917 Bacteria 3793
309 Ga0207660_10036289 3300025917 Bacteria 3426
310 Ga0207660_10059611 3300025917 Bacteria 2741
311 Ga0207657_10006265 3300025919 Bacteria 12367
312 Ga0207657_10020772 3300025919 Bacteria 6197
313 Ga0207657_10053834 3300025919 Bacteria 3483
314 Ga0207657_10269232 3300025919 Bacteria 1354
315 Ga0207649_10147247 3300025920 Bacteria 1618
316 Ga0207649_10213672 3300025920 Bacteria 1370
317 Ga0207649_10432678 3300025920 Bacteria 990
318 Ga0207652_10001895 3300025921 Bacteria 18099
319 Ga0207652_10010071 3300025921 Bacteria 7614
320 Ga0207646_10317173 3300025922 Bacteria 1408
321 Ga0207681_10084029 3300025923 Bacteria 2255
322 Ga0207681_10157167 3300025923 Bacteria 1710
323 Ga0207694_10061421 3300025924 Bacteria 2924
324 Ga0207700_10004339 3300025928 Bacteria 8342
325 Ga0207700_10014940 3300025928 Bacteria 5102
326 Ga0207700_10082527 3300025928 Bacteria 2513
327 Ga0207700_10193833 3300025928 Bacteria 1709
328 Ga0207664_10213947 3300025929 Bacteria 1669
329 Ga0207644_10090111 3300025931 Bacteria 2284
330 Ga0207644_10339378 3300025931 Bacteria 1218
331 Ga0207690_10068398 3300025932 Bacteria 2440
332 Ga0207706_10080449 3300025933 Bacteria 2865
333 Ga0207706_10476395 3300025933 Bacteria 1079
334 Ga0207686_10042818 3300025934 Bacteria 2771
335 Ga0207709_10099276 3300025935 Bacteria 1921
336 Ga0207669_10010465 3300025937 Bacteria 4467
337 Ga0207704_10121119 3300025938 Bacteria 1791
338 Ga0207704_10167466 3300025938 Bacteria 1571
339 Ga0207665_10189240 3300025939 Bacteria 1494
340 Ga0207665_10221051 3300025939 Bacteria 1388
341 Ga0207691_10413741 3300025940 Bacteria 1149
342 Ga0207711_10100950 3300025941 Bacteria 2553
343 Ga0207689_10087476 3300025942 Bacteria 2560
344 Ga0207661_10471701 3300025944 Bacteria 1145
345 Ga0207679_10066042 3300025945 Bacteria 2709
346 Ga0207679_10516478 3300025945 Bacteria 1068
347 Ga0207667_10010276 3300025949 Bacteria 10955
348 Ga0207667_10146722 3300025949 Bacteria 2429
349 Ga0207667_10304495 3300025949 Bacteria 1628
350 Ga0207667_10333346 3300025949 Bacteria 1549
351 Ga0207651_10372685 3300025960 Bacteria 1208
352 Ga0207712_10069292 3300025961 Bacteria 2530
353 Ga0207668_10011093 3300025972 Bacteria 5465
354 Ga0207668_10036095 3300025972 Bacteria 3297
355 Ga0207640_10162117 3300025981 Bacteria 1656
356 Ga0207658_10607003 3300025986 Bacteria 983
357 Ga0207677_10043134 3300026023 Bacteria 2996
358 Ga0207677_10087756 3300026023 Bacteria 2253
359 Ga0207703_10114320 3300026035 Bacteria 2308
360 Ga0207703_10136058 3300026035 Bacteria 2127
361 Ga0207703_10339408 3300026035 Bacteria 1380
362 Ga0207703_10418535 3300026035 Bacteria 1246
363 Ga0207639_10002861 3300026041 Bacteria 11594
364 Ga0207639_10274251 3300026041 Bacteria 1481
365 Ga0207639_10300134 3300026041 Bacteria 1419
366 Ga0207678_10035223 3300026067 Bacteria 4359
367 Ga0207678_10046828 3300026067 Bacteria 3740
368 Ga0207678_10102809 3300026067 Bacteria 2439
369 Ga0207678_10186219 3300026067 Bacteria 1773
370 Ga0207678_10193149 3300026067 Bacteria 1740
371 Ga0207678_10194690 3300026067 Bacteria 1733
372 Ga0207702_10042166 3300026078 Bacteria 3828
373 Ga0207702_10082120 3300026078 Bacteria 2801
374 Ga0207702_10273991 3300026078 Bacteria 1593
375 Ga0207648_10564938 3300026089 Bacteria 1046
376 Ga0207676_10141034 3300026095 Bacteria 2063
377 Ga0207676_10306213 3300026095 Bacteria 1453
378 Ga0207676_10464614 3300026095 Bacteria 1196
379 Ga0207674_10023661 3300026116 Bacteria 6576
380 Ga0207674_10096611 3300026116 Bacteria 2939
381 Ga0207674_10129067 3300026116 Bacteria 2492
382 Ga0207675_100229858 3300026118 Bacteria 1789
383 Ga0207675_100758828 3300026118 Bacteria 982
384 Ga0207683_10031362 3300026121 Bacteria 4612
385 Ga0207683_10041954 3300026121 Bacteria 3996
386 Ga0207683_10066027 3300026121 Bacteria 3190
387 Ga0207683_10156849 3300026121 Bacteria 2056
388 Ga0207698_10053239 3300026142 Bacteria 3105
389 Ga0207698_10401564 3300026142 Bacteria 1310
390 Ga0207698_10804097 3300026142 Bacteria 942
391 Ga0209389_1000110 3300027296 Bacteria 72586
392 Ga0209389_1000161 3300027296 Bacteria 55526
393 Ga0209589_1000026 3300027357 Bacteria 158154
394 Ga0209589_1000103 3300027357 Bacteria 86516
395 Ga0209489_100046 3300027361 Bacteria 158154
396 Ga0209489_100304 3300027361 Bacteria 86516
397 Ga0209489_100524 3300027361 Bacteria 72457
398 Ga0209700_100047 3300027363 Bacteria 158154
399 Ga0209700_100334 3300027363 Bacteria 84979
400 Ga0268266_10004957 3300028379 Bacteria 12595
401 Ga0268266_10047216 3300028379 Bacteria 3688
402 Ga0268266_10133150 3300028379 Bacteria 2225
403 Ga0268266_10267424 3300028379 Bacteria 1586
404 Ga0268265_10092983 3300028380 Bacteria 2415
405 Ga0268265_10124476 3300028380 Bacteria 2130
406 Ga0268265_10395011 3300028380 Bacteria 1276
407 Ga0268264_10000050 3300028381 Bacteria 323697
408 Ga0268264_10078398 3300028381 Bacteria 2817
409 Ga0268264_10087292 3300028381 Bacteria 2682
410 Ga0268264_10297500 3300028381 Bacteria 1518
411 Ga0265326_10018806 3300028558 Bacteria 1986
412 Ga0265319_1011928 3300028563 Bacteria 3533
413 Ga0265334_10010205 3300028573 Bacteria 3965
414 Ga0265323_10006969 3300028653 Bacteria 4725
415 Ga0265322_10051530 3300028654 Bacteria 1168
416 Ga0265336_10013462 3300028666 Bacteria 2726
417 Ga0307517_10001290 3300028786 Bacteria 42017
418 Ga0307515_10145937 3300028794 Bacteria 2506
419 Ga0265338_10000621 3300028800 Bacteria 61786
420 Ga0265324_10006053 3300029957 Bacteria 5109
421 Ga0307511_10031209 3300030521 Bacteria 4765
422 Ga0265325_10020612 3300031241 Bacteria 3632
423 Ga0265339_10009337 3300031249 Bacteria 6170
424 Ga0307513_10113410 3300031456 Bacteria 2698
425 Ga0307509_10081246 3300031507 Bacteria 3348
426 Ga0307509_10095050 3300031507 Bacteria 3037
427 Ga0307509_10347766 3300031507 Bacteria 1207
428 Ga0307408_100616523 3300031548 Bacteria 966
429 Ga0265313_10023176 3300031595 Bacteria 3349
430 Ga0307508_10000005 3300031616 Bacteria 286511
431 Ga0307508_10293429 3300031616 Bacteria 1219
432 Ga0265314_10007878 3300031711 Bacteria 9194
433 Ga0265314_10036683 3300031711 Bacteria 3559
434 Ga0265342_10006975 3300031712 Bacteria 8350
435 Ga0265342_10095403 3300031712 Bacteria 1700
436 Ga0307516_10084774 3300031730 Bacteria 3007
437 Ga0307516_10119292 3300031730 Bacteria 2431
438 Ga0307410_10456850 3300031852 Bacteria 1043
439 Ga0307406_10124723 3300031901 Bacteria 1797
440 Ga0307409_100060937 3300031995 Bacteria 2945
441 Ga0307411_10555232 3300032005 Bacteria 980
442 Ga0307415_100321496 3300032126 Bacteria 1290
443 Ga0307415_100482317 3300032126 Bacteria 1080
444 Ga0307507_10028790 3300033179 Bacteria 5909
445 Ga0307510_10004440 3300033180 Bacteria 16500
446 Ga0307510_10025506 3300033180 Bacteria 6815
447 Ga0307510_10026894 3300033180 Bacteria 6602
448 Ga0307510_10046651 3300033180 Bacteria 4654
449 Ga0307510_10129729 3300033180 Bacteria 2198
450 Ga0315911_1000019 3300033442 Bacteria 146597
451 Ga0373928_0017127 3300035084 Bacteria 1489
452 Ga0373953_0043169 3300035117 Bacteria 1799
453 Ga0373954_0021377 3300035118 Bacteria 2930
454 Ga0373943_0004550 3300035170 Bacteria 6268
455 Ga0373946_0031148 3300035171 Bacteria 2134
456 Ga0373924_0034360 3300035410 Bacteria 2052
457 Ga0373931_0002560 3300035691 Bacteria 8092
458 Ga0373927_0015032 3300035695 Bacteria 5118
459 Ga0373927_0028187 3300035695 Bacteria 3664
460 Ga0373927_0032103 3300035695 Bacteria 3420
461 Ga0373927_0311843 3300035695 Bacteria 1036
462 Ga0373933_0000173 3300035724 Bacteria 42306
463 Ga0373933_0199415 3300035724 Bacteria 1280
464 Ga0373947_0021042 3300035725 Bacteria 3773
465 Ga0373947_0038272 3300035725 Bacteria 2849
466 Ga0373947_0090081 3300035725 Bacteria 1911
467 Ga0373947_0333815 3300035725 Bacteria 1015
468 Ga0373937_0069773 3300036401 Bacteria 3240
469 Ga0373925_0002606 3300037068 Bacteria 14321
470 Ga0373925_0050328 3300037068 Bacteria 3107
471 Ga0373925_0072289 3300037068 Bacteria 2610
472 Ga0395900_0058007 3300037418 Bacteria 3986
473 Ga0395900_0567189 3300037418 Bacteria 1078
474 Ga0395898_0037259 3300037466 Bacteria 4826
475 Ga0395898_0141722 3300037466 Bacteria 2301
476 Ga0395898_0282179 3300037466 Bacteria 1584
477 Ga0395898_0302307 3300037466 Bacteria 1526
478 Ga0395905_0004599 3300037471 Bacteria 14276
479 Ga0395905_0136315 3300037471 Bacteria 2309
480 Ga0395905_0472854 3300037471 Bacteria 1152
481 Ga0436364_0140141 3300037853 Bacteria 3398
482 Ga0436364_0561121 3300037853 Bacteria 2417
483 Ga0436364_0852789 3300037853 Bacteria 2163
484 Ga0436365_1639838 3300039437 Bacteria 14264
485 Ga0436361_0018446 3300039447 Bacteria 3041
486 Ga0436362_0887147 3300039453 Bacteria 3205
487 Ga0436362_0986292 3300039453 Bacteria 1961
488 Ga0466969_0083135 3300044656 Bacteria 1525
489 Ga0466972_0000237 3300044658 Bacteria 38144
490 Ga0466972_0016874 3300044658 Bacteria 3652
491 Ga0466966_0000137 3300044684 Bacteria 46695
492 Ga0466966_0073566 3300044684 Bacteria 2137
493 Ga0466961_0000039 3300044693 Bacteria 79787
494 Ga0466961_0071465 3300044693 Bacteria 2202
495 Ga0466964_0013093 3300044706 Bacteria 3144
496 Ga0453684_0036083 3300044712 Bacteria 6820
497 Ga0466971_0036585 3300044719 Bacteria 2202
498 Ga0466968_0001785 3300044735 Bacteria 7760
499 Ga0466968_0024330 3300044735 Bacteria 2473
500 Ga0466957_0095772 3300044842 Bacteria 1865
501 Ga0466960_0008939 3300044901 Bacteria 4117
502 Ga0466960_0018269 3300044901 Bacteria 3070
503 Ga0466959_0005535 3300045049 Bacteria 8667
504 Ga0466967_0048936 3300045976 Bacteria 3695
505 Ga0466967_0084864 3300045976 Bacteria 2866
506 Ga0466967_0737984 3300045976 Bacteria 976
507 Ga0495617_016193 3300046452 Bacteria 2521
508 Ga0495603_0010674 3300046455 Bacteria 5569
509 Ga0495603_0012795 3300046455 Bacteria 5074
510 Ga0495603_0013252 3300046455 Bacteria 4985
511 Ga0495603_0135850 3300046455 Bacteria 1431
512 Ga0495629_0004877 3300046459 Bacteria 10068
513 Ga0495629_0387688 3300046459 Bacteria 950
514 Ga0495638_0010469 3300046460 Bacteria 6433
515 Ga0495638_0029936 3300046460 Bacteria 3509
516 Ga0495638_0046479 3300046460 Bacteria 2727
517 Ga0495651_0149526 3300046462 Bacteria 1685
518 Ga0495651_0357434 3300046462 Bacteria 963
519 Ga0495650_0051054 3300046471 Bacteria 1706
520 Ga0495650_0055079 3300046471 Bacteria 1620
521 Ga0495580_0012717 3300046472 Bacteria 6451
522 Ga0495580_0083223 3300046472 Bacteria 2230
523 Ga0495582_0039677 3300046473 Bacteria 2592
524 Ga0495605_0031536 3300046474 Bacteria 2707
525 Ga0495639_0115089 3300046475 Bacteria 1279
526 Ga0495662_0074231 3300046476 Bacteria 1650
527 Ga0495662_0144176 3300046476 Bacteria 1173
528 Ga0495664_0021111 3300046477 Bacteria 3761
529 Ga0495664_0038590 3300046477 Bacteria 2820
530 Ga0495664_0077843 3300046477 Bacteria 1986
531 Ga0495664_0347198 3300046477 Bacteria 894
532 Ga0495584_0041691 3300046491 Bacteria 2317
533 Ga0495584_0115101 3300046491 Bacteria 1361
534 Ga0495584_0171860 3300046491 Bacteria 1101
535 Ga0495585_0044900 3300046492 Bacteria 2467
536 Ga0495594_0097674 3300046499 Bacteria 1651
537 Ga0495594_0384488 3300046499 Bacteria 799
538 Ga0495583_0025783 3300046506 Bacteria 2931
539 Ga0495606_0000858 3300046507 Bacteria 45651
540 Ga0495606_0020521 3300046507 Bacteria 4867
541 Ga0495606_0038167 3300046507 Bacteria 3252
542 Ga0495606_0046300 3300046507 Bacteria 2876
543 Ga0495608_0063364 3300046511 Bacteria 2426
544 Ga0495610_0041953 3300046512 Bacteria 2292
545 Ga0495610_0046822 3300046512 Bacteria 2131
546 Ga0495616_0078358 3300046513 Bacteria 1585
547 Ga0495620_0072985 3300046515 Bacteria 1400
548 Ga0495630_0009423 3300046517 Bacteria 7019
549 Ga0495631_0018028 3300046518 Bacteria 3330
550 Ga0495632_0029390 3300046519 Bacteria 2862
551 Ga0495632_0114108 3300046519 Bacteria 1267
552 Ga0495643_0122213 3300046522 Bacteria 1314
553 Ga0495643_0180228 3300046522 Bacteria 1027
554 Ga0495644_0027197 3300046523 Bacteria 2168
555 Ga0495644_0035039 3300046523 Bacteria 1895
556 Ga0495648_0000664 3300046524 Bacteria 36757
557 Ga0495648_0021725 3300046524 Bacteria 4440
558 Ga0495648_0050206 3300046524 Bacteria 2551
559 Ga0495648_0058146 3300046524 Bacteria 2314
560 Ga0495663_0017479 3300046525 Bacteria 2036
561 Ga0495654_0082733 3300046530 Bacteria 1502
562 Ga0495654_0104446 3300046530 Bacteria 1300
563 Ga0495665_0006523 3300046531 Bacteria 6302
564 Ga0495640_0031708 3300046533 Bacteria 3769
565 Ga0495640_0041701 3300046533 Bacteria 3206
566 Ga0495597_0009650 3300046542 Bacteria 4758
567 Ga0495645_0122526 3300046543 Bacteria 1829
568 Ga0495622_0012115 3300046557 Bacteria 3989
569 Ga0495622_0042074 3300046557 Bacteria 2124
570 Ga0495667_0365256 3300046559 Bacteria 911
571 Ga0495656_0248687 3300046615 Bacteria 897
572 Ga0495668_0079444 3300046616 Bacteria 1800
573 Ga0495634_0031268 3300046642 Bacteria 3667
574 Ga0495611_0039307 3300046648 Bacteria 2106
575 Ga0495625_0036439 3300046660 Bacteria 3616
576 Ga0495625_0060061 3300046660 Bacteria 2694
577 Ga0495625_0325195 3300046660 Bacteria 978
578 Ga0495659_0119255 3300046664 Bacteria 1037
579 Ga0495661_0087952 3300046665 Bacteria 1775
580 Ga0495657_0028907 3300046675 Bacteria 3892
581 Ga0495657_0104061 3300046675 Bacteria 1805
582 Ga0495599_0058488 3300046678 Bacteria 2411
583 Ga0495623_0031423 3300046679 Bacteria 3413
584 Ga0495623_0045839 3300046679 Bacteria 2776
585 Ga0495658_0055287 3300046683 Bacteria 2261
586 Ga0495669_0036747 3300046684 Bacteria 2166
587 Ga0495669_0043255 3300046684 Bacteria 2005
588 Ga0495613_0081248 3300046689 Bacteria 2355
589 Ga0495613_0188177 3300046689 Bacteria 1460
590 Ga0495624_0149974 3300046690 Bacteria 1426
591 Ga0495671_0156570 3300046692 Bacteria 1109
592 Ga0495649_0051176 3300046694 Bacteria 2240
593 Ga0495600_0169557 3300046809 Bacteria 1409
594 Ga0495581_0178010 3300047315 Bacteria 1243
595 Ga0495604_0011616 3300047317 Bacteria 7001
596 Ga0495604_0285669 3300047317 Bacteria 1113
597 Ga0495636_0145999 3300047318 Bacteria 1059
598 Ga0495674_0006754 3300047319 Bacteria 10985
599 Ga0495674_0144274 3300047319 Bacteria 1999
600 Ga0495672_0092499 3300047320 Bacteria 1658
601 Ga0495680_0080402 3300047322 Bacteria 2463
602 Ga0495683_0046950 3300047323 Bacteria 2167
603 Ga0495675_0110446 3300047444 Bacteria 1716
604 Ga0495673_0085426 3300047469 Bacteria 1299
605 Ga0495673_0186255 3300047469 Bacteria 783
606 Ga0495684_0016237 3300047471 Bacteria 5733
607 Ga0495686_0117913 3300047472 Bacteria 1585
608 Ga0495686_0282510 3300047472 Bacteria 922
609 Ga0495593_0006734 3300047673 Bacteria 6726
610 Ga0495593_0089972 3300047673 Bacteria 1581
611 Ga0495602_0031704 3300048088 Bacteria 4992
612 Ga0495602_0087863 3300048088 Bacteria 2589
613 Ga0495614_0106083 3300048089 Bacteria 1231
614 Ga0496100_0024662 3300048903 Bacteria 3670
615 Ga0496100_0072281 3300048903 Bacteria 2305
616 Ga0496101_0002190 3300048904 Bacteria 11933
617 Ga0496101_0008388 3300048904 Bacteria 6753
618 Ga0496101_0142989 3300048904 Bacteria 1825
619 Ga0496101_0197748 3300048904 Bacteria 1553
620 Ga0496101_0255073 3300048904 Bacteria 1367
621 Ga0496102_0010012 3300048905 Bacteria 8152
622 Ga0496102_0029471 3300048905 Bacteria 4910
623 Ga0496102_0545718 3300048905 Bacteria 1082
624 Ga0496103_0014895 3300048906 Bacteria 4622
625 Ga0496103_0017768 3300048906 Bacteria 4260
626 Ga0496103_0173798 3300048906 Bacteria 1384
627 Ga0496104_0013446 3300048907 Bacteria 7375
628 Ga0496104_0032748 3300048907 Bacteria 4838
629 Ga0496104_0056763 3300048907 Bacteria 3704
630 Ga0496104_0096170 3300048907 Bacteria 2833
631 Ga0496104_0252170 3300048907 Bacteria 1677
632 Ga0496105_0011000 3300048908 Bacteria 7131
633 Ga0496105_0036120 3300048908 Bacteria 4069
634 Ga0496105_0062790 3300048908 Bacteria 3065
635 Ga0496105_0203024 3300048908 Bacteria 1617
636 Ga0496105_0396097 3300048908 Bacteria 1097
637 Ga0496106_0012440 3300048909 Bacteria 6284
638 Ga0496106_0019557 3300048909 Bacteria 5024
639 Ga0496106_0047707 3300048909 Bacteria 3224
640 Ga0496106_0106830 3300048909 Bacteria 2176
641 Ga0496106_0158399 3300048909 Bacteria 1789
642 Ga0496107_0001583 3300048910 Bacteria 14155
643 Ga0496107_0006405 3300048910 Bacteria 8090
644 Ga0496107_0067384 3300048910 Bacteria 2597
645 Ga0496107_0115320 3300048910 Bacteria 1977
646 Ga0496108_0000553 3300048911 Bacteria 29302
647 Ga0496108_0027863 3300048911 Bacteria 4670
648 Ga0496108_0041531 3300048911 Bacteria 3840
649 Ga0496109_0000574 3300048912 Bacteria 30746
650 Ga0496109_0006764 3300048912 Bacteria 9656
651 Ga0496109_0016182 3300048912 Bacteria 6518
652 Ga0496109_0086671 3300048912 Bacteria 2892
653 Ga0496109_0174567 3300048912 Bacteria 2017
654 Ga0496110_0010079 3300048913 Bacteria 7673
655 Ga0496110_0057835 3300048913 Bacteria 3414
656 Ga0496110_0109814 3300048913 Bacteria 2477
657 Ga0496110_0155884 3300048913 Bacteria 2069
658 Ga0496110_0345498 3300048913 Bacteria 1355
659 Ga0496111_0031465 3300048914 Bacteria 3780
660 Ga0496111_0086111 3300048914 Bacteria 2298
661 Ga0496111_0169914 3300048914 Bacteria 1620
662 Ga0496112_0000065 3300048915 Bacteria 70119
663 Ga0496112_0004587 3300048915 Bacteria 11748
664 Ga0496112_0005425 3300048915 Bacteria 11026
665 Ga0496112_0058823 3300048915 Bacteria 3786
666 Ga0496112_0068528 3300048915 Bacteria 3504
667 Ga0496112_0127214 3300048915 Bacteria 2518
668 Ga0496112_0347282 3300048915 Bacteria 1426
669 Ga0496113_0007724 3300048916 Bacteria 6941
670 Ga0496113_0243250 3300048916 Bacteria 1436
671 Ga0496113_0270290 3300048916 Bacteria 1358
672 Ga0496113_0278089 3300048916 Bacteria 1338
673 Ga0496114_0007664 3300048917 Bacteria 8536
674 Ga0496114_0023654 3300048917 Bacteria 5014
675 Ga0496114_0197468 3300048917 Bacteria 1761
676 Ga0496114_0251834 3300048917 Bacteria 1554
677 Ga0496115_0003865 3300048918 Bacteria 10798
678 Ga0496115_0033209 3300048918 Bacteria 4073
679 Ga0496115_0049513 3300048918 Bacteria 3364
680 Ga0496115_0151571 3300048918 Bacteria 1915
681 Ga0496115_0349798 3300048918 Bacteria 1205
682 Ga0496115_0454918 3300048918 Bacteria 1033
683 Ga0496116_0048522 3300048919 Bacteria 2849
684 Ga0496117_0003382 3300048920 Bacteria 18582
685 Ga0496117_0033659 3300048920 Bacteria 3872
686 Ga0496117_0053735 3300048920 Bacteria 2828
687 Ga0496117_0057551 3300048920 Bacteria 2699
688 Ga0496117_0075113 3300048920 Bacteria 2247
689 Ga0496118_0001355 3300048921 Bacteria 36910
690 Ga0496118_0051890 3300048921 Bacteria 3134
691 Ga0496118_0121897 3300048921 Bacteria 1697
692 Ga0496119_0016513 3300048922 Bacteria 5613
693 Ga0496119_0068978 3300048922 Bacteria 2079
694 Ga0496119_0243960 3300048922 Bacteria 909
695 Ga0496120_0006060 3300048923 Bacteria 9394
696 Ga0496121_0000453 3300048924 Bacteria 80749
697 Ga0496121_0008484 3300048924 Bacteria 12057
698 Ga0496121_0016803 3300048924 Bacteria 7525
699 Ga0496121_0022695 3300048924 Bacteria 6075
700 Ga0496121_0039770 3300048924 Bacteria 4136
701 Ga0496121_0058573 3300048924 Bacteria 3183
702 Ga0496121_0059888 3300048924 Bacteria 3136
703 Ga0496121_0070498 3300048924 Bacteria 2815
704 Ga0496121_0148300 3300048924 Bacteria 1730
705 Ga0496121_0223390 3300048924 Bacteria 1325
706 Ga0496121_0231128 3300048924 Bacteria 1295
707 Ga0496124_0000750 3300048927 Bacteria 53262
708 Ga0496124_0073545 3300048927 Bacteria 2828
709 Ga0496124_0122682 3300048927 Bacteria 2074
710 Ga0496124_0125594 3300048927 Bacteria 2044
711 Ga0496124_0166464 3300048927 Bacteria 1713
712 Ga0496124_0175306 3300048927 Bacteria 1656
713 Ga0496124_0260734 3300048927 Bacteria 1276
714 Ga0496124_0269467 3300048927 Bacteria 1248
715 Ga0496125_0003090 3300048928 Bacteria 20775
716 Ga0496125_0036035 3300048928 Bacteria 4327
717 Ga0496125_0071977 3300048928 Bacteria 2697
718 Ga0496125_0083545 3300048928 Bacteria 2429
719 Ga0496125_0089697 3300048928 Bacteria 2311
720 Ga0496126_0007757 3300048929 Bacteria 11698
721 Ga0496126_0023489 3300048929 Bacteria 5974
722 Ga0496126_0043537 3300048929 Bacteria 4141
723 Ga0496126_0046866 3300048929 Bacteria 3960
724 Ga0496126_0079033 3300048929 Bacteria 2913
725 Ga0496126_0088357 3300048929 Bacteria 2730
726 Ga0496126_0143802 3300048929 Bacteria 2050
727 Ga0496126_0174582 3300048929 Bacteria 1829
728 Ga0496126_0222882 3300048929 Bacteria 1583
729 Ga0496126_0227742 3300048929 Bacteria 1563
730 Ga0496126_0396251 3300048929 Bacteria 1121
731 Ga0495682_0009452 3300049460 Bacteria 3804
732 Ga0501031_0000869 3300049568 Bacteria 18186
733 Ga0501032_0004658 3300049569 Bacteria 10307
734 Ga0501033_0023821 3300049570 Bacteria 4617
735 Ga0501033_0046730 3300049570 Bacteria 3219
736 Ga0501034_0000082 3300049571 Bacteria 170039
737 Ga0501036_0035284 3300049572 Bacteria 4231
738 Ga0501036_0054341 3300049572 Bacteria 3392
739 Ga0501036_0093643 3300049572 Bacteria 2538
740 Ga0501037_0000346 3300049573 Bacteria 39162
741 Ga0501038_0002420 3300049574 Bacteria 17392
742 Ga0501039_0001826 3300049575 Bacteria 15745
743 Ga0501039_0131546 3300049575 Bacteria 1964
744 Ga0501039_0284277 3300049575 Bacteria 1300
745 Ga0501043_0000109 3300049579 Bacteria 77120
746 Ga0501043_0134314 3300049579 Bacteria 1938
747 Ga0501046_0000101 3300049580 Bacteria 91179
748 Ga0501047_0022781 3300049581 Bacteria 6013
749 Ga0501048_0001990 3300049582 Bacteria 15532
750 Ga0501067_0006271 3300049583 Bacteria 6597
751 Ga0501068_0000276 3300049584 Bacteria 25409
752 Ga0501069_0025598 3300049585 Bacteria 3226
753 Ga0501069_0132412 3300049585 Bacteria 1428
754 Ga0501070_0014924 3300049586 Bacteria 6534
755 Ga0501070_0192549 3300049586 Bacteria 1676
756 Ga0501071_0013158 3300049587 Bacteria 5633
757 Ga0501072_0002689 3300049588 Bacteria 13338
758 Ga0501072_0045059 3300049588 Bacteria 3467
759 Ga0501073_0000101 3300049589 Bacteria 54365
760 Ga0501073_0265830 3300049589 Bacteria 1184
761 Ga0501074_0000187 3300049590 Bacteria 33711
762 Ga0501074_0285545 3300049590 Bacteria 1173
763 Ga0501076_0090540 3300049592 Bacteria 2461
764 Ga0501079_0020792 3300049741 Bacteria 5018
765 Ga0501080_0000151 3300049742 Bacteria 49588
766 Ga0501080_0426162 3300049742 Bacteria 1191
767 Ga0501083_0005054 3300049744 Bacteria 9345
768 Ga0501083_0144986 3300049744 Bacteria 1554
769 Ga0501083_0313552 3300049744 Bacteria 1020
770 Ga0501035_0004366 3300049822 Bacteria 13429
771 Ga0501035_0368988 3300049822 Bacteria 1198
772 Ga0501035_0374564 3300049822 Bacteria 1188
773 Ga0501044_0000247 3300049823 Bacteria 68674
774 Ga0501044_0168423 3300049823 Bacteria 2163
775 Ga0501044_0382711 3300049823 Bacteria 1322
776 Ga0501045_0116536 3300049824 Bacteria 1982
777 nmdc:mga03683_100577_c1 3300050489 Bacteria 1270
778 nmdc:mga03683_13608_c1 3300050489 Bacteria 2998
779 nmdc:mga00v17_186598_c1 3300050491 Bacteria 1338
780 nmdc:mga00v17_59792_c1 3300050491 Bacteria 2339
781 nmdc:mga0yw44_106396_c1 3300050492 Bacteria 1793
782 nmdc:mga0yw44_116004_c1 3300050492 Bacteria 1721
783 nmdc:mga0yw44_173679_c1 3300050492 Bacteria 1416
784 nmdc:mga0yw44_246790_c1 3300050492 Bacteria 1188
785 nmdc:mga0yw44_65047_c1 3300050492 Bacteria 1938
786 nmdc:mga0k408_13118_c1 3300050493 Bacteria 4539
787 nmdc:mga0k408_188959_c1 3300050493 Bacteria 1229
788 nmdc:mga04h51_66898_c1 3300050495 Bacteria 1246
789 nmdc:mga07m45_120085_c1 3300050496 Bacteria 1518
790 nmdc:mga07m45_14044_c1 3300050496 Bacteria 4260
791 nmdc:mga07m45_56834_c1 3300050496 Bacteria 2212
792 nmdc:mga05p37_120763_c1 3300050507 Bacteria 3219
793 nmdc:mga05p37_351113_c1 3300050507 Bacteria 1736
794 nmdc:mga08y16_223316_c1 3300050511 Bacteria 1949
795 nmdc:mga08y16_280457_c1 3300050511 Bacteria 1719
796 nmdc:mga0n895_4095_c1 3300050512 Bacteria 11871
797 nmdc:mga0sz30_53541_c1 3300050516 Bacteria 1715
798 Ga0495601_0073241 3300053077 Bacteria 2189
799 Ga0495612_0007851 3300053078 Bacteria 4351
800 Ga0500635_0007250 3300053080 Bacteria 3002
801 Ga0500635_0007396 3300053080 Bacteria 2976
802 Ga0495619_0083718 3300053085 Bacteria 2152
803 Ga0495619_0189887 3300053085 Bacteria 1422
804 Ga0500647_0094057 3300053091 Bacteria 1434
805 Ga0500647_0112445 3300053091 Bacteria 1293
806 Ga0500566_0000029 3300053094 Bacteria 75384
807 Ga0500640_009478 3300053095 Bacteria 3891
808 Ga0500641_0014121 3300053096 Bacteria 2943
809 Ga0500648_062774 3300053097 Bacteria 2105
810 Ga0500554_003167 3300053102 Bacteria 3329
811 Ga0500562_002438 3300053108 Bacteria 4667
812 Ga0500572_008697 3300053111 Bacteria 2380
813 Ga0500593_018097 3300053117 Bacteria 3067
814 Ga0500594_0007525 3300053118 Bacteria 2465
815 Ga0500595_002815 3300053119 Bacteria 8364
816 Ga0500595_009908 3300053119 Bacteria 3817
817 Ga0500595_015192 3300053119 Bacteria 2894
818 Ga0500595_015352 3300053119 Bacteria 2878
819 Ga0500608_048296 3300053122 Bacteria 2044
820 Ga0500642_0000099 3300053130 Bacteria 42097
821 Ga0500642_0011143 3300053130 Bacteria 3204
822 Ga0500655_021346 3300053133 Bacteria 1214
823 Ga0500658_0021750 3300053134 Bacteria 2431
824 Ga0500559_0076255 3300053136 Bacteria 1517
825 Ga0500561_0002612 3300053137 Bacteria 3051
826 Ga0500573_0171791 3300053140 Bacteria 1171
827 Ga0500577_0187089 3300053142 Bacteria 890
828 Ga0500590_169987 3300053148 Bacteria 960
829 Ga0500603_003339 3300053150 Bacteria 3450
830 Ga0500616_0045773 3300053153 Bacteria 2329
831 Ga0500622_0036449 3300053156 Bacteria 2570
832 Ga0500633_0120514 3300053160 Bacteria 976
833 Ga0500638_004574 3300053162 Bacteria 5360
834 Ga0500638_109183 3300053162 Bacteria 1280
835 Ga0500636_0000035 3300053177 Bacteria 72245
836 Ga0500636_0044429 3300053177 Bacteria 2620
837 Ga0500636_0087417 3300053177 Bacteria 1789
838 Ga0500636_0135869 3300053177 Bacteria 1365
839 Ga0500636_0139370 3300053177 Bacteria 1343
840 Ga0500637_0000531 3300053178 Bacteria 14845
841 Ga0500637_0083006 3300053178 Bacteria 1852
842 Ga0500637_0176280 3300053178 Bacteria 1227
843 Ga0500649_053485 3300053722 Bacteria 1694
844 Ga0500657_071277 3300053728 Bacteria 1522
845 Ga0500645_019105 3300053730 Bacteria 2135
846 Ga0500645_023133 3300053730 Bacteria 1906
847 Ga0500609_002287 3300053731 Bacteria 2733
848 Ga0500599_000208 3300053736 Bacteria 5482
849 Ga0500601_000399 3300053737 Bacteria 7445
850 Ga0501084_0003100 3300054114 Bacteria 13478
851 Ga0501084_0173692 3300054114 Bacteria 1819
852 Ga0501082_0000706 3300060353 Bacteria 29338
853 Ga0501082_0027912 3300060353 Bacteria 4860
854 2507505584 2507262055 Bacteria 8048963
855 2508539482 2508501009 Bacteria 7784016
856 2508695844 2508501042 Bacteria 8719808
857 2509150114 2508501128 Bacteria 8613869
858 2511399502 2511231028 Bacteria 8046582
859 2513624747 2513237092 Bacteria 8341956
860 2513642302 2513237094 Bacteria 8789602
861 2513652767 2513237095 Bacteria 8976980
862 2513660741 2513237096 Bacteria 8722461
863 2513680009 2513237098 Bacteria 9902361
864 2513694060 2513237101 Bacteria 7952346
865 2513700393 2513237102 Bacteria 7703324
866 2513718792 2513237104 Bacteria 10034502
867 2513863024 2513237137 Bacteria 9558895
868 2513876976 2513237139 Bacteria 8737671
869 2513890387 2513237141 Bacteria 8496279
870 2513922537 2513237145 Bacteria 8979722
871 2514016048 2513237161 Bacteria 8871253
872 2515623982 2515154112 Bacteria 8294334
873 2517105920 2517093001 Bacteria 9002274
874 2517888478 2517572143 Bacteria 9484767
875 2524440037 2524023205 Bacteria 8918781
876 2524468357 2524023210 Bacteria 9029266
877 2524535220 2524023228 Bacteria 10118060
878 2528852116 2528768022 Bacteria 10457665
879 2617353206 2617270735 Bacteria 9163226
880 2617377313 2617270741 Bacteria 8201522
881 2671123584 2667528175 Bacteria 7532676
882 2728752018 2728368998 Bacteria 8720350
883 2745077851 2744054633 Bacteria 8678936
884 2793065600 2791355196 Bacteria 7323613
885 2793067291 2791355197 Bacteria 8420563
886 2793077080
887 2805921229 2802429603 Bacteria 8777136
888 2818239219 2816332527 Bacteria 8933356
889 2824609057 2824600985 Bacteria 8488197
890 2824615651 2824609381 Bacteria 8672835
891 2824625636 2824617872 Bacteria 8814715
892 2824634972 2824626560 Bacteria 8813858
893 2824643376 2824635225 Bacteria 8785348
894 2824651659 2824644064 Bacteria 8743947
895 2824657458 2824653114 Bacteria 8493680
896 2824669326 2824661429 Bacteria 9877870
897 2824678163 2824671348 Bacteria 8369588
898 2824685902 2824679649 Bacteria 8248951
899 2824694553 2824687955 Bacteria 8360029
900 2824703074 2824696289 Bacteria 8335049
901 2824709489 2824704595 Bacteria 9667483
902 2824721780 2824714736 Bacteria 8717648
903 2824731634 2824723954 Bacteria 8758240
904 2824738328 2824732956 Bacteria 7810675
905 2824752614 2824746037 Bacteria 7911610
906 2824758792 2824753945 Bacteria 9787441
907 2824769262 2824763712 Bacteria 9792355
908 2824777479 2824773399 Bacteria 8360218
909 2838125713 2838122688 Bacteria 8803140
910 2841947924 2841941048 Bacteria 8688029
911 2841957021 2841949485 Bacteria 8680857
912 2841965154 2841957949 Bacteria 8652217
913 2841972752 2841966195 Bacteria 8673214
914 2841977530 2841974524 Bacteria 8931498
915 2841984913 2841983080 Bacteria 8395090
916 2842041329 2842038055 Bacteria 8002051
917 2842049371 2842045827 Bacteria 8006841
918 2844315819 2844315083 Bacteria 8138177
919 2847930751 2847930680 Bacteria 9342022
920 2847942630 2847939898 Bacteria 8606328
921 2849083386 2849076700 Bacteria 7039503
922 2857515599 2857509624 Bacteria 7472071
923 2874591606 2874590934 Bacteria 8299676
924 2874608409 2874604998 Bacteria 7834745
925 2874619126 2874612657 Bacteria 8252029
926 2874621345 2874620515 Bacteria 8290088
927 2874636797 2874628541 Bacteria 8630250
928 2874645972 2874645413 Bacteria 8214782
929 2876764022 2876761206 Bacteria 10111113
930 2876772067 2876771140 Bacteria 8287509
931 2876815935 2876808645 Bacteria 8824342
932 2876819276 2876818435 Bacteria 8274608
933 2879075525 2879074833 Bacteria 8279565
934 2879089891 2879083081 Bacteria 8587928
935 2879106742 2879099564 Bacteria 10442239
936 2879112821 2879110137 Bacteria 8907982
937 2879128000 2879127579 Bacteria 8294491
938 2879143299 2879142872 Bacteria 8267021
939 2881365564 2881364244 Bacteria 7710352
940 2881668393 2881665667 Bacteria 8175609
941 2885368684 2885366525 Bacteria 8326213
942 2885379792 2885374607 Bacteria 8927485
943 2885413376 2885409591 Bacteria 9235467
944 2888379147 2888378607 Bacteria 9652610
945 2888390325 2888388044 Bacteria 7304136
946 2888419917 2888419890 Bacteria 7857137
947 2889035853 2889033259 Bacteria 9099371
948 2903730881 2903727486 Bacteria 8281579
949 2903750123 2903748898 Bacteria 9972761
950 2904668015 2904666416 Bacteria 8226587
951 2904699239 2904690495 Bacteria 9412302
952 2904707988
953 2904714139 2904711408 Bacteria 9771557
954 2906603704 2906602504 Bacteria 8295279
955 2906614160
956 2906633178 2906626472 Bacteria 8826946
957 2906639319 2906635258 Bacteria 8601019
958 2906648070 2906643746 Bacteria 8722424
959 2906668414 2906660503 Bacteria 8595048
960 2908747008 2908739725 Bacteria 8628932
961 2908758839 2908756301 Bacteria 8864324
962 2908775828 2908775508 Bacteria 8092255
963 2922364332 2922361189 Bacteria 7436256
964 2922369105
965 2922389030 2922386360 Bacteria 7017218
966 2922394791 2922393267 Bacteria 8285685
967 2922425989
968 2929618967 2929615660 Bacteria 9193770
969 2929631044 2929624759 Bacteria 9339455
970 2932789008 2932784394 Bacteria 9704911
971 2932814354 2932809354 Bacteria 9135765
972 2932820480 2932818245 Bacteria 9955613
973 2932834513 2932828146 Bacteria 9745859
974 2933580323 2933577622 Bacteria 9116884
975 2935614645 2935608549 Bacteria 8203142
976 2935624495 2935616580 Bacteria 9032984
977 2935636653 2935630451 Bacteria 8169952
978 2935645885 2935638405 Bacteria 10015038
979 2935649027 2935648319 Bacteria 8801166
980 2935658201 2935656913 Bacteria 8965014
981 2935673452 2935665750 Bacteria 9571747
982 2935682629 2935675223 Bacteria 9928132
983 2935686757 2935684952 Bacteria 9590419
984 2935701564 2935694250 Bacteria 9291695
985 2935710462 2935703347 Bacteria 10242284
986 2935716445 2935713505 Bacteria 9608509
987 2935723430 2935722832 Bacteria 9608746
988 2935734986 2935732158 Bacteria 9706831
989 2935744223 2935741537 Bacteria 9707219
990 2935752723 2935750917 Bacteria 9590372
991 2935764730 2935760218 Bacteria 9817913
992 2935774149 2935769743 Bacteria 7878163
993 2935783717 2935777560 Bacteria 8077691
994 2935789134 2935785616 Bacteria 7962367
995 2935796884 2935793552 Bacteria 8012592
996 2935806159 2935801545 Bacteria 9301974
997 2935816925 2935810662 Bacteria 9401221
998 2935826314 2935819856 Bacteria 8261050
999 2935835214 2935827899 Bacteria 10038562
1000 2935841404 2935837841 Bacteria 9454360
1001 2935853810 2935847175 Bacteria 8228321
1002 2935863028 2935855204 Bacteria 9035059
1003 2935871838 2935864058 Bacteria 9784707
1004 2935882271 2935873716 Bacteria 9632195
1005 2935911033 2935908558 Bacteria 8568796
1006 2935924194 2935916978 Bacteria 9113783
1007 2935932753 2935926038 Bacteria 8601059
1008 2935937316 2935934488 Bacteria 8602579
1009 2935949483 2935942939 Bacteria 8599779
1010 2935958118 2935951376 Bacteria 8602333
1011 2935966452 2935959822 Bacteria 7869783
1012 2935971227 2935967501 Bacteria 8603075
1013 2935982175 2935975950 Bacteria 8347125
1014 2935985312 2935984226 Bacteria 8302647
1015 2936000158 2935992306 Bacteria 9802711
1016 2936010072 2936002035 Bacteria 9362176
1017 2936012420 2936011229 Bacteria 8801034
1018 2936020499 2936019824 Bacteria 8804134
1019 2936029713 2936028420 Bacteria 8965941
1020 2936043916 2936037263 Bacteria 9446081
1021 2936051822 2936046547 Bacteria 8903709
1022 2936056924 2936055302 Bacteria 8785755
1023 2940558636 2940556831 Bacteria 9590747
1024 2941513289 2941507105 Bacteria 8166816
1025 2941521252 2941515067 Bacteria 8166720
1026 2941529036 2941523033 Bacteria 8169134
1027 2941535670 2941531003 Bacteria 7653939
1028 2941543630 2941538514 Bacteria 9402094
1029 3005483556 3005474847 Bacteria 9259049
1030 3005489793 3005483717 Bacteria 7877331
1031 3005506249 3005506211 Bacteria 6943378
1032 3005593708 3005587118 Bacteria 7794411
1033 3005595408 3005594810 Bacteria 8716512
1034 3005711370 3005710791 Bacteria 7622528
1035 3005718636 3005718088 Bacteria 8283608
1036 8006931149 8006926726 Bacteria 6749210
1037 8006936688 8006933436 Bacteria 10410654
1038 8006970232 8006964411 Bacteria 8966052
1039 8006976658 8006973647 Bacteria 10679141
1040 8006992431 8006984368 Bacteria 9651211
1041 8007001929 8006994254 Bacteria 8309700
1042 8016517792 8016511872 Bacteria 9921665
1043 8016525857 8016522445 Bacteria 8156687
1044 8016539458 8016530956 Bacteria 8155261
1045 8016543746 8016539877 Bacteria 8155419
1046 8016549547 8016548790 Bacteria 8155074
1047 8016557968 8016557553 Bacteria 8154380
1048 8016569147 8016566248 Bacteria 8158151
1049 8016581785 8016575299 Bacteria 8154085
1050 8016585960 8016583857 Bacteria 10421953
1051 8016595985 8016595262 Bacteria 8149947
1052 8016606856 8016603502 Bacteria 8731218
1053 8016618764 8016613128 Bacteria 8794220
1054 8016622769 8016622563 Bacteria 7999408
1055 8016635262 8016630954 Bacteria 9217207
1056 8017058836 8017057580 Bacteria 10023680
1057 8019530737 8019530166 Bacteria 8155624
1058 8019540847 8019538911 Bacteria 7872763
1059 8019549768 8019547302 Bacteria 7996444
1060 8019562020 8019555841 Bacteria 9642137
1061 8019572085 8019565922 Bacteria 9639779
1062 8019576817 8019576017 Bacteria 10049540
1063 8019594870 8019586578 Bacteria 10212056
1064 8019606869 8019597564 Bacteria 10041141
1065 8019623321 8019619141 Bacteria 9218857
1066 8019629774 8019629233 Bacteria 8687553
1067 8019666621 8019659431 Bacteria 8577854
1068 8019676355 8019668869 Bacteria 8791617
1069 8019695821 8019687851 Bacteria 8712826
1070 8055742816 8055742211 Bacteria 9226248
1071 8056676315 8056673599 Bacteria 7871253
1072 8056683017 8056681323 Bacteria 8472857
1073 8056693948 8056689827 Bacteria 6712655
1074 8056975652 8056967851 Bacteria 9038162
1075 JGI25160J50197_1004420
1076 JGI24735J21928_10007902
1077 JGI24738J21930_10033436
1078 JGI25406J46586_10000037
1079 JGI25406J46586_10005680
1080 JGI25153J46596_10000591
1081 JGI25153J46596_10004986
1082 JGI25153J46596_10013134
1083 JGI25153J46596_10013961
1084 rootH2_10064097
1085 rootH2_10064098
1086 rootL2_10140331
1087 rootL2_10162604
1088 rootH1_10032470
1089 JGI25160J50197_1005757
1090 JGI25404J52841_10004260
1091 Ga0055531_10006094
1092 Ga0055543_1001867
1093 Ga0065165_1000588
1094 Ga0065165_1000740
1095 Ga0065165_1005557
1096 Ga0065165_1006740
1097 Ga0070676_10297577
1098 Ga0070690_100105838
1099 Ga0068869_100140484
1100 Ga0068869_100498225
1101 Ga0070680_100023369
1102 Ga0070680_100056984
1103 Ga0070680_100105672
1104 Ga0070682_100302675
1105 Ga0070682_100339768
1106 Ga0068868_100009478
1107 Ga0068868_100058016
1108 Ga0068868_100202618
1109 Ga0070660_100008728
1110 Ga0070660_100564668
1111 Ga0070691_10012605
1112 Ga0070691_10221437
1113 Ga0070661_100087129
1114 Ga0070668_100064166
1115 Ga0070669_100180247
1116 Ga0070669_100208283
1117 Ga0070674_100075340
1118 Ga0070688_100257976
1119 Ga0070659_100022689
1120 Ga0070667_100059232
1121 Ga0070709_10003001
1122 Ga0070709_10004744
1123 Ga0070709_10011463
1124 Ga0070709_10029937
1125 Ga0070714_100033539
1126 Ga0070714_100039511
1127 Ga0070714_100201789
1128 Ga0070713_100005050
1129 Ga0070713_100018203
1130 Ga0070713_100024984
1131 Ga0070713_100121255
1132 Ga0070713_100188815
1133 Ga0070710_10000783
1134 Ga0070711_100008994
1135 Ga0070711_100056390
1136 Ga0070711_100268875
1137 Ga0070700_100233337
1138 Ga0070708_100139482
1139 Ga0070663_100105173
1140 Ga0070663_100128273
1141 Ga0070663_100133634
1142 Ga0070663_100192007
1143 Ga0070663_100236330
1144 Ga0070663_100259590
1145 Ga0070678_100024087
1146 Ga0070678_100086309
1147 Ga0070678_100209447
1148 Ga0070662_100291718
1149 Ga0070681_10023619
1150 Ga0070681_10099564
1151 Ga0070681_10121594
1152 Ga0070681_10483068
1153 Ga0070707_100099457
1154 Ga0070698_100151680
1155 Ga0070679_100023442
1156 Ga0070679_100112332
1157 Ga0070684_100057912
1158 Ga0070684_100111137
1159 Ga0070684_100329082
1160 Ga0068853_100001674
1161 Ga0068853_100082622
1162 Ga0068853_100225855
1163 Ga0068853_100257971
1164 Ga0070672_100290136
1165 Ga0070665_100012097
1166 Ga0070665_100079373
1167 Ga0070665_100124175
1168 Ga0070665_100205182
1169 Ga0070665_100418948
1170 Ga0068855_100079092
1171 Ga0068855_100140528
1172 Ga0068855_100299191
1173 Ga0068855_100603901
1174 Ga0070664_100117829
1175 Ga0070664_100209020
1176 Ga0070664_100548216
1177 Ga0068857_100069478
1178 Ga0068857_100106916
1179 Ga0068857_100238126
1180 Ga0068854_100119694
1181 Ga0068856_100281813
1182 Ga0068856_100426216
1183 Ga0068856_100427383
1184 Ga0068852_100003231
1185 Ga0068852_100006469
1186 Ga0068852_100333887
1187 Ga0068859_100112363
1188 Ga0068864_100177960
1189 Ga0068864_100318743
1190 Ga0068864_100482690
1191 Ga0068866_10064605
1192 Ga0068861_100659326
1193 Ga0068863_100494658
1194 Ga0068858_100018713
1195 Ga0068858_100195923
1196 Ga0068858_100246336
1197 Ga0068858_100495591
1198 Ga0068860_100001139
1199 Ga0068860_100343730
1200 Ga0068862_100110481
1201 Ga0068862_100114980
1202 Ga0081455_10001309
1203 Ga0081455_10018523
1204 Ga0081455_10020228
1205 Ga0081455_10036634
1206 Ga0081455_10049752
1207 Ga0081455_10084588
1208 Ga0081540_1000974
1209 Ga0081540_1004883
1210 Ga0081540_1015371
1211 Ga0081540_1017362
1212 Ga0081540_1022426
1213 Ga0081540_1038246
1214 Ga0081540_1057292
1215 Ga0081540_1095749
1216 Ga0081539_10000129
1217 Ga0081539_10001014
1218 Ga0070717_10004800
1219 Ga0075365_10031330
1220 Ga0075365_10096692
1221 Ga0075365_10154047
1222 Ga0075363_100017604
1223 Ga0075363_100148447
1224 Ga0075364_10048128
1225 Ga0075364_10076027
1226 Ga0070716_100202773
1227 Ga0070712_100032032
1228 Ga0070712_100046641
1229 Ga0070712_100064176
1230 Ga0075362_10073483
1231 Ga0075362_10092345
1232 Ga0075367_10111522
1233 Ga0075369_10095058
1234 Ga0075369_10141667
1235 Ga0075366_10044260
1236 Ga0075366_10052019
1237 Ga0075366_10101128
1238 Ga0075366_10131770
1239 Ga0075370_10019630
1240 Ga0075370_10041526
1241 Ga0075370_10051126
1242 Ga0068871_100250145
1243 Ga0075428_100182995
1244 Ga0075434_100005953
1245 Ga0097620_100112364
1246 Ga0099824_1002409
1247 Ga0099824_1026240
1248 Ga0099822_1000008
1249 Ga0099822_1032243
1250 Ga0099823_1036150
1251 Ga0075435_100241077
1252 Ga0099794_10017446
1253 Ga0099794_10046357
1254 Ga0105240_10006107
1255 Ga0105240_10021775
1256 Ga0105240_10043731
1257 Ga0105240_10238966
1258 Ga0111539_10191497
1259 Ga0105247_10041523
1260 Ga0105247_10117833
1261 Ga0105247_10137536
1262 Ga0114129_10304702
1263 Ga0114129_10408551
1264 Ga0105243_10057383
1265 Ga0105243_10145425
1266 Ga0105243_10251293
1267 Ga0105241_10022183
1268 Ga0105241_10079311
1269 Ga0105241_10532661
1270 Ga0105242_10090821
1271 Ga0105242_10229631
1272 Ga0105248_10037613
1273 Ga0105248_10590436
1274 Ga0105237_10009904
1275 Ga0105237_10033108
1276 Ga0105237_10060031
1277 Ga0105237_10062170
1278 Ga0105237_10073283
1279 Ga0105237_10083748
1280 Ga0105237_10120420
1281 Ga0105237_10255954
1282 Ga0105238_10014653
1283 Ga0105238_10024115
1284 Ga0105238_10071502
1285 Ga0105238_10184498
1286 Ga0099796_10028566
1287 Ga0105239_10014496
1288 Ga0105239_10047760
1289 Ga0105239_10082518
1290 Ga0105239_10099300
1291 Ga0105239_10111999
1292 Ga0105239_10134528
1293 Ga0105239_10194047
1294 Ga0105239_10335920
1295 Ga0105239_10376322
1296 Ga0105239_10622578
1297 Ga0157373_10041341
1298 Ga0157370_10152261
1299 Ga0157369_10040768
1300 Ga0157369_10111758
1301 Ga0157378_10279543
1302 Ga0157378_10435969
1303 Ga0157378_10652212
1304 Ga0163162_10023466
1305 Ga0163162_10154941
1306 Ga0157372_10210171
1307 Ga0157372_10397355
1308 Ga0157375_10052325
1309 Ga0157375_10616215
1310 Ga0163163_10147150
1311 Ga0163163_10567132
1312 Ga0157380_10092615
1313 Ga0157379_10081849
1314 Ga0157376_10213362
1315 Ga0157376_10383619
1316 Ga0163161_10107106
1317 Ga0214544_1000087
1318 Ga0214542_1000018
1319 Ga0214542_1024233
1320 Ga0214545_1000009
1321 Ga0214545_1024968
1322 Ga0214543_1000037
1323 Ga0214543_1025986
1324 Ga0213876_10008883
1325 Ga0207425_1005095
1326 Ga0209677_100881
1327 Ga0209677_101632
1328 Ga0209148_1000192
1329 Ga0209233_1007650
1330 Ga0209233_1010065
1331 Ga0209455_1002675
1332 Ga0209455_1003697
1333 Ga0209564_1000602
1334 Ga0209564_1002977
1335 Ga0209564_1013312
1336 Ga0209758_1000030
1337 Ga0209758_1001028
1338 Ga0209758_1001172
1339 Ga0209758_1003935
1340 Ga0209758_1007247
1341 Ga0209758_1009369
1342 Ga0209758_1021361
1343 Ga0209256_1013525
1344 Ga0209256_1041933
1345 Ga0207426_1000663
1346 Ga0207426_1001191
1347 Ga0207426_1002497
1348 Ga0207426_1017997
1349 Ga0207426_1041337
1350 Ga0209257_1000797
1351 Ga0207697_10055160
1352 Ga0207692_10006519
1353 Ga0207642_10210262
1354 Ga0207710_10080294
1355 Ga0207710_10179865
1356 Ga0207688_10063383
1357 Ga0207647_10014234
1358 Ga0207647_10096177
1359 Ga0207647_10106034
1360 Ga0207647_10173607
1361 Ga0207699_10014508
1362 Ga0207699_10026467
1363 Ga0207645_10080300
1364 Ga0207645_10230635
1365 Ga0207705_10048689
1366 Ga0207705_10059192
1367 Ga0207654_10038638
1368 Ga0207654_10082964
1369 Ga0207707_10010369
1370 Ga0207695_10000059
1371 Ga0207695_10015974
1372 Ga0207695_10079155
1373 Ga0207695_10146739
1374 Ga0207671_10001093
1375 Ga0207671_10023342
1376 Ga0207671_10107955
1377 Ga0207671_10278007
1378 Ga0207693_10015453
1379 Ga0207693_10060810
1380 Ga0207693_10075510
1381 Ga0207663_10012680
1382 Ga0207660_10028980
1383 Ga0207660_10036289
1384 Ga0207660_10059611
1385 Ga0207657_10006265
1386 Ga0207657_10020772
1387 Ga0207657_10053834
1388 Ga0207657_10269232
1389 Ga0207649_10147247
1390 Ga0207649_10213672
1391 Ga0207649_10432678
1392 Ga0207652_10001895
1393 Ga0207652_10010071
1394 Ga0207646_10317173
1395 Ga0207681_10084029
1396 Ga0207681_10157167
1397 Ga0207694_10061421
1398 Ga0207700_10004339
1399 Ga0207700_10014940
1400 Ga0207700_10082527
1401 Ga0207700_10193833
1402 Ga0207664_10213947
1403 Ga0207644_10090111
1404 Ga0207644_10339378
1405 Ga0207690_10068398
1406 Ga0207706_10080449
1407 Ga0207706_10476395
1408 Ga0207686_10042818
1409 Ga0207709_10099276
1410 Ga0207669_10010465
1411 Ga0207704_10121119
1412 Ga0207704_10167466
1413 Ga0207665_10189240
1414 Ga0207665_10221051
1415 Ga0207691_10413741
1416 Ga0207711_10100950
1417 Ga0207689_10087476
1418 Ga0207661_10471701
1419 Ga0207679_10066042
1420 Ga0207679_10516478
1421 Ga0207667_10010276
1422 Ga0207667_10146722
1423 Ga0207667_10304495
1424 Ga0207667_10333346
1425 Ga0207651_10372685
1426 Ga0207712_10069292
1427 Ga0207668_10011093
1428 Ga0207668_10036095
1429 Ga0207640_10162117
1430 Ga0207658_10607003
1431 Ga0207677_10043134
1432 Ga0207677_10087756
1433 Ga0207703_10114320
1434 Ga0207703_10136058
1435 Ga0207703_10339408
1436 Ga0207703_10418535
1437 Ga0207639_10002861
1438 Ga0207639_10274251
1439 Ga0207639_10300134
1440 Ga0207678_10035223
1441 Ga0207678_10046828
1442 Ga0207678_10102809
1443 Ga0207678_10186219
1444 Ga0207678_10193149
1445 Ga0207678_10194690
1446 Ga0207702_10042166
1447 Ga0207702_10082120
1448 Ga0207702_10273991
1449 Ga0207648_10564938
1450 Ga0207676_10141034
1451 Ga0207676_10306213
1452 Ga0207676_10464614
1453 Ga0207674_10023661
1454 Ga0207674_10096611
1455 Ga0207674_10129067
1456 Ga0207675_100229858
1457 Ga0207675_100758828
1458 Ga0207683_10031362
1459 Ga0207683_10041954
1460 Ga0207683_10066027
1461 Ga0207683_10156849
1462 Ga0207698_10053239
1463 Ga0207698_10401564
1464 Ga0207698_10804097
1465 Ga0209389_1000110
1466 Ga0209389_1000161
1467 Ga0209589_1000026
1468 Ga0209589_1000103
1469 Ga0209489_100046
1470 Ga0209489_100304
1471 Ga0209489_100524
1472 Ga0209700_100047
1473 Ga0209700_100334
1474 Ga0268266_10004957
1475 Ga0268266_10047216
1476 Ga0268266_10133150
1477 Ga0268266_10267424
1478 Ga0268265_10092983
1479 Ga0268265_10124476
1480 Ga0268265_10395011
1481 Ga0268264_10000050
1482 Ga0268264_10078398
1483 Ga0268264_10087292
1484 Ga0268264_10297500
1485 Ga0265326_10018806
1486 Ga0265319_1011928
1487 Ga0265334_10010205
1488 Ga0265323_10006969
1489 Ga0265322_10051530
1490 Ga0265336_10013462
1491 Ga0307517_10001290
1492 Ga0307515_10145937
1493 Ga0265338_10000621
1494 Ga0265324_10006053
1495 Ga0307511_10031209
1496 Ga0265325_10020612
1497 Ga0265339_10009337
1498 Ga0307513_10113410
1499 Ga0307509_10081246
1500 Ga0307509_10095050
1501 Ga0307509_10347766
1502 Ga0307408_100616523
1503 Ga0265313_10023176
1504 Ga0307508_10000005
1505 Ga0307508_10293429
1506 Ga0265314_10007878
1507 Ga0265314_10036683
1508 Ga0265342_10006975
1509 Ga0265342_10095403
1510 Ga0307516_10084774
1511 Ga0307516_10119292
1512 Ga0307410_10456850
1513 Ga0307406_10124723
1514 Ga0307409_100060937
1515 Ga0307411_10555232
1516 Ga0307415_100321496
1517 Ga0307415_100482317
1518 Ga0307507_10028790
1519 Ga0307510_10004440
1520 Ga0307510_10025506
1521 Ga0307510_10026894
1522 Ga0307510_10046651
1523 Ga0307510_10129729
1524 Ga0315911_1000019
1525 Ga0373928_0017127
1526 Ga0373953_0043169
1527 Ga0373954_0021377
1528 Ga0373943_0004550
1529 Ga0373946_0031148
1530 Ga0373924_0034360
1531 Ga0373931_0002560
1532 Ga0373927_0015032
1533 Ga0373927_0028187
1534 Ga0373927_0032103
1535 Ga0373927_0311843
1536 Ga0373933_0000173
1537 Ga0373933_0199415
1538 Ga0373947_0021042
1539 Ga0373947_0038272
1540 Ga0373947_0090081
1541 Ga0373947_0333815
1542 Ga0373937_0069773
1543 Ga0373925_0002606
1544 Ga0373925_0050328
1545 Ga0373925_0072289
1546 Ga0395900_0058007
1547 Ga0395900_0567189
1548 Ga0395898_0037259
1549 Ga0395898_0141722
1550 Ga0395898_0282179
1551 Ga0395898_0302307
1552 Ga0395905_0004599
1553 Ga0395905_0136315
1554 Ga0395905_0472854
1555 Ga0436364_0140141
1556 Ga0436364_0561121
1557 Ga0436364_0852789
1558 Ga0436365_1639838
1559 Ga0436361_0018446
1560 Ga0436362_0887147
1561 Ga0436362_0986292
1562 Ga0466969_0083135
1563 Ga0466972_0000237
1564 Ga0466972_0016874
1565 Ga0466966_0000137
1566 Ga0466966_0073566
1567 Ga0466961_0000039
1568 Ga0466961_0071465
1569 Ga0466964_0013093
1570 Ga0453684_0036083
1571 Ga0466971_0036585
1572 Ga0466968_0001785
1573 Ga0466968_0024330
1574 Ga0466957_0095772
1575 Ga0466960_0008939
1576 Ga0466960_0018269
1577 Ga0466959_0005535
1578 Ga0466967_0048936
1579 Ga0466967_0084864
1580 Ga0466967_0737984
1581 Ga0495617_016193
1582 Ga0495603_0010674
1583 Ga0495603_0012795
1584 Ga0495603_0013252
1585 Ga0495603_0135850
1586 Ga0495629_0004877
1587 Ga0495629_0387688
1588 Ga0495638_0010469
1589 Ga0495638_0029936
1590 Ga0495638_0046479
1591 Ga0495651_0149526
1592 Ga0495651_0357434
1593 Ga0495650_0051054
1594 Ga0495650_0055079
1595 Ga0495580_0012717
1596 Ga0495580_0083223
1597 Ga0495582_0039677
1598 Ga0495605_0031536
1599 Ga0495639_0115089
1600 Ga0495662_0074231
1601 Ga0495662_0144176
1602 Ga0495664_0021111
1603 Ga0495664_0038590
1604 Ga0495664_0077843
1605 Ga0495664_0347198
1606 Ga0495584_0041691
1607 Ga0495584_0115101
1608 Ga0495584_0171860
1609 Ga0495585_0044900
1610 Ga0495594_0097674
1611 Ga0495594_0384488
1612 Ga0495583_0025783
1613 Ga0495606_0000858
1614 Ga0495606_0020521
1615 Ga0495606_0038167
1616 Ga0495606_0046300
1617 Ga0495608_0063364
1618 Ga0495610_0041953
1619 Ga0495610_0046822
1620 Ga0495616_0078358
1621 Ga0495620_0072985
1622 Ga0495630_0009423
1623 Ga0495631_0018028
1624 Ga0495632_0029390
1625 Ga0495632_0114108
1626 Ga0495643_0122213
1627 Ga0495643_0180228
1628 Ga0495644_0027197
1629 Ga0495644_0035039
1630 Ga0495648_0000664
1631 Ga0495648_0021725
1632 Ga0495648_0050206
1633 Ga0495648_0058146
1634 Ga0495663_0017479
1635 Ga0495654_0082733
1636 Ga0495654_0104446
1637 Ga0495665_0006523
1638 Ga0495640_0031708
1639 Ga0495640_0041701
1640 Ga0495597_0009650
1641 Ga0495645_0122526
1642 Ga0495622_0012115
1643 Ga0495622_0042074
1644 Ga0495667_0365256
1645 Ga0495656_0248687
1646 Ga0495668_0079444
1647 Ga0495634_0031268
1648 Ga0495611_0039307
1649 Ga0495625_0036439
1650 Ga0495625_0060061
1651 Ga0495625_0325195
1652 Ga0495659_0119255
1653 Ga0495661_0087952
1654 Ga0495657_0028907
1655 Ga0495657_0104061
1656 Ga0495599_0058488
1657 Ga0495623_0031423
1658 Ga0495623_0045839
1659 Ga0495658_0055287
1660 Ga0495669_0036747
1661 Ga0495669_0043255
1662 Ga0495613_0081248
1663 Ga0495613_0188177
1664 Ga0495624_0149974
1665 Ga0495671_0156570
1666 Ga0495649_0051176
1667 Ga0495600_0169557
1668 Ga0495581_0178010
1669 Ga0495604_0011616
1670 Ga0495604_0285669
1671 Ga0495636_0145999
1672 Ga0495674_0006754
1673 Ga0495674_0144274
1674 Ga0495672_0092499
1675 Ga0495680_0080402
1676 Ga0495683_0046950
1677 Ga0495675_0110446
1678 Ga0495673_0085426
1679 Ga0495673_0186255
1680 Ga0495684_0016237
1681 Ga0495686_0117913
1682 Ga0495686_0282510
1683 Ga0495593_0006734
1684 Ga0495593_0089972
1685 Ga0495602_0031704
1686 Ga0495602_0087863
1687 Ga0495614_0106083
1688 Ga0496100_0024662
1689 Ga0496100_0072281
1690 Ga0496101_0002190
1691 Ga0496101_0008388
1692 Ga0496101_0142989
1693 Ga0496101_0197748
1694 Ga0496101_0255073
1695 Ga0496102_0010012
1696 Ga0496102_0029471
1697 Ga0496102_0545718
1698 Ga0496103_0014895
1699 Ga0496103_0017768
1700 Ga0496103_0173798
1701 Ga0496104_0013446
1702 Ga0496104_0032748
1703 Ga0496104_0056763
1704 Ga0496104_0096170
1705 Ga0496104_0252170
1706 Ga0496105_0011000
1707 Ga0496105_0036120
1708 Ga0496105_0062790
1709 Ga0496105_0203024
1710 Ga0496105_0396097
1711 Ga0496106_0012440
1712 Ga0496106_0019557
1713 Ga0496106_0047707
1714 Ga0496106_0106830
1715 Ga0496106_0158399
1716 Ga0496107_0001583
1717 Ga0496107_0006405
1718 Ga0496107_0067384
1719 Ga0496107_0115320
1720 Ga0496108_0000553
1721 Ga0496108_0027863
1722 Ga0496108_0041531
1723 Ga0496109_0000574
1724 Ga0496109_0006764
1725 Ga0496109_0016182
1726 Ga0496109_0086671
1727 Ga0496109_0174567
1728 Ga0496110_0010079
1729 Ga0496110_0057835
1730 Ga0496110_0109814
1731 Ga0496110_0155884
1732 Ga0496110_0345498
1733 Ga0496111_0031465
1734 Ga0496111_0086111
1735 Ga0496111_0169914
1736 Ga0496112_0000065
1737 Ga0496112_0004587
1738 Ga0496112_0005425
1739 Ga0496112_0058823
1740 Ga0496112_0068528
1741 Ga0496112_0127214
1742 Ga0496112_0347282
1743 Ga0496113_0007724
1744 Ga0496113_0243250
1745 Ga0496113_0270290
1746 Ga0496113_0278089
1747 Ga0496114_0007664
1748 Ga0496114_0023654
1749 Ga0496114_0197468
1750 Ga0496114_0251834
1751 Ga0496115_0003865
1752 Ga0496115_0033209
1753 Ga0496115_0049513
1754 Ga0496115_0151571
1755 Ga0496115_0349798
1756 Ga0496115_0454918
1757 Ga0496116_0048522
1758 Ga0496117_0003382
1759 Ga0496117_0033659
1760 Ga0496117_0053735
1761 Ga0496117_0057551
1762 Ga0496117_0075113
1763 Ga0496118_0001355
1764 Ga0496118_0051890
1765 Ga0496118_0121897
1766 Ga0496119_0016513
1767 Ga0496119_0068978
1768 Ga0496119_0243960
1769 Ga0496120_0006060
1770 Ga0496121_0000453
1771 Ga0496121_0008484
1772 Ga0496121_0016803
1773 Ga0496121_0022695
1774 Ga0496121_0039770
1775 Ga0496121_0058573
1776 Ga0496121_0059888
1777 Ga0496121_0070498
1778 Ga0496121_0148300
1779 Ga0496121_0223390
1780 Ga0496121_0231128
1781 Ga0496124_0000750
1782 Ga0496124_0073545
1783 Ga0496124_0122682
1784 Ga0496124_0125594
1785 Ga0496124_0166464
1786 Ga0496124_0175306
1787 Ga0496124_0260734
1788 Ga0496124_0269467
1789 Ga0496125_0003090
1790 Ga0496125_0036035
1791 Ga0496125_0071977
1792 Ga0496125_0083545
1793 Ga0496125_0089697
1794 Ga0496126_0007757
1795 Ga0496126_0023489
1796 Ga0496126_0043537
1797 Ga0496126_0046866
1798 Ga0496126_0079033
1799 Ga0496126_0088357
1800 Ga0496126_0143802
1801 Ga0496126_0174582
1802 Ga0496126_0222882
1803 Ga0496126_0227742
1804 Ga0496126_0396251
1805 Ga0495682_0009452
1806 Ga0501031_0000869
1807 Ga0501032_0004658
1808 Ga0501033_0023821
1809 Ga0501033_0046730
1810 Ga0501034_0000082
1811 Ga0501036_0035284
1812 Ga0501036_0054341
1813 Ga0501036_0093643
1814 Ga0501037_0000346
1815 Ga0501038_0002420
1816 Ga0501039_0001826
1817 Ga0501039_0131546
1818 Ga0501039_0284277
1819 Ga0501043_0000109
1820 Ga0501043_0134314
1821 Ga0501046_0000101
1822 Ga0501047_0022781
1823 Ga0501048_0001990
1824 Ga0501067_0006271
1825 Ga0501068_0000276
1826 Ga0501069_0025598
1827 Ga0501069_0132412
1828 Ga0501070_0014924
1829 Ga0501070_0192549
1830 Ga0501071_0013158
1831 Ga0501072_0002689
1832 Ga0501072_0045059
1833 Ga0501073_0000101
1834 Ga0501073_0265830
1835 Ga0501074_0000187
1836 Ga0501074_0285545
1837 Ga0501076_0090540
1838 Ga0501079_0020792
1839 Ga0501080_0000151
1840 Ga0501080_0426162
1841 Ga0501083_0005054
1842 Ga0501083_0144986
1843 Ga0501083_0313552
1844 Ga0501035_0004366
1845 Ga0501035_0368988
1846 Ga0501035_0374564
1847 Ga0501044_0000247
1848 Ga0501044_0168423
1849 Ga0501044_0382711
1850 Ga0501045_0116536
1851 nmdc:mga03683_100577_c1
1852 nmdc:mga03683_13608_c1
1853 nmdc:mga00v17_186598_c1
1854 nmdc:mga00v17_59792_c1
1855 nmdc:mga0yw44_106396_c1
1856 nmdc:mga0yw44_116004_c1
1857 nmdc:mga0yw44_173679_c1
1858 nmdc:mga0yw44_246790_c1
1859 nmdc:mga0yw44_65047_c1
1860 nmdc:mga0k408_13118_c1
1861 nmdc:mga0k408_188959_c1
1862 nmdc:mga04h51_66898_c1
1863 nmdc:mga07m45_120085_c1
1864 nmdc:mga07m45_14044_c1
1865 nmdc:mga07m45_56834_c1
1866 nmdc:mga05p37_120763_c1
1867 nmdc:mga05p37_351113_c1
1868 nmdc:mga08y16_223316_c1
1869 nmdc:mga08y16_280457_c1
1870 nmdc:mga0n895_4095_c1
1871 nmdc:mga0sz30_53541_c1
1872 Ga0495601_0073241
1873 Ga0495612_0007851
1874 Ga0500635_0007250
1875 Ga0500635_0007396
1876 Ga0495619_0083718
1877 Ga0495619_0189887
1878 Ga0500647_0094057
1879 Ga0500647_0112445
1880 Ga0500566_0000029
1881 Ga0500640_009478
1882 Ga0500641_0014121
1883 Ga0500648_062774
1884 Ga0500554_003167
1885 Ga0500562_002438
1886 Ga0500572_008697
1887 Ga0500593_018097
1888 Ga0500594_0007525
1889 Ga0500595_002815
1890 Ga0500595_009908
1891 Ga0500595_015192
1892 Ga0500595_015352
1893 Ga0500608_048296
1894 Ga0500642_0000099
1895 Ga0500642_0011143
1896 Ga0500655_021346
1897 Ga0500658_0021750
1898 Ga0500559_0076255
1899 Ga0500561_0002612
1900 Ga0500573_0171791
1901 Ga0500577_0187089
1902 Ga0500590_169987
1903 Ga0500603_003339
1904 Ga0500616_0045773
1905 Ga0500622_0036449
1906 Ga0500633_0120514
1907 Ga0500638_004574
1908 Ga0500638_109183
1909 Ga0500636_0000035
1910 Ga0500636_0044429
1911 Ga0500636_0087417
1912 Ga0500636_0135869
1913 Ga0500636_0139370
1914 Ga0500637_0000531
1915 Ga0500637_0083006
1916 Ga0500637_0176280
1917 Ga0500649_053485
1918 Ga0500657_071277
1919 Ga0500645_019105
1920 Ga0500645_023133
1921 Ga0500609_002287
1922 Ga0500599_000208
1923 Ga0500601_000399
1924 Ga0501084_0003100
1925 Ga0501084_0173692
1926 Ga0501082_0000706
1927 Ga0501082_0027912
1928 2507505584
1929 2508539482
1930 2508695844
1931 2509150114
1932 2511399502
1933 2513624747
1934 2513642302
1935 2513652767
1936 2513660741
1937 2513680009
1938 2513694060
1939 2513700393
1940 2513718792
1941 2513863024
1942 2513876976
1943 2513890387
1944 2513922537
1945 2514016048
1946 2515623982
1947 2517105920
1948 2517888478
1949 2524440037
1950 2524468357
1951 2524535220
1952 2528852116
1953 2617353206
1954 2617377313
1955 2671123584
1956 2728752018
1957 2745077851
1958 2793065600
1959 2793067291
1960 2793077080
1961 2805921229
1962 2818239219
1963 2824609057
1964 2824615651
1965 2824625636
1966 2824634972
1967 2824643376
1968 2824651659
1969 2824657458
1970 2824669326
1971 2824678163
1972 2824685902
1973 2824694553
1974 2824703074
1975 2824709489
1976 2824721780
1977 2824731634
1978 2824738328
1979 2824752614
1980 2824758792
1981 2824769262
1982 2824777479
1983 2838125713
1984 2841947924
1985 2841957021
1986 2841965154
1987 2841972752
1988 2841977530
1989 2841984913
1990 2842041329
1991 2842049371
1992 2844315819
1993 2847930751
1994 2847942630
1995 2849083386
1996 2857515599
1997 2874591606
1998 2874608409
1999 2874619126
2000 2874621345
2001 2874636797
2002 2874645972
2003 2876764022
2004 2876772067
2005 2876815935
2006 2876819276
2007 2879075525
2008 2879089891
2009 2879106742
2010 2879112821
2011 2879128000
2012 2879143299
2013 2881365564
2014 2881668393
2015 2885368684
2016 2885379792
2017 2885413376
2018 2888379147
2019 2888390325
2020 2888419917
2021 2889035853
2022 2903730881
2023 2903750123
2024 2904668015
2025 2904699239
2026 2904707988
2027 2904714139
2028 2906603704
2029 2906614160
2030 2906633178
2031 2906639319
2032 2906648070
2033 2906668414
2034 2908747008
2035 2908758839
2036 2908775828
2037 2922364332
2038 2922369105
2039 2922389030
2040 2922394791
2041 2922425989
2042 2929618967
2043 2929631044
2044 2932789008
2045 2932814354
2046 2932820480
2047 2932834513
2048 2933580323
2049 2935614645
2050 2935624495
2051 2935636653
2052 2935645885
2053 2935649027
2054 2935658201
2055 2935673452
2056 2935682629
2057 2935686757
2058 2935701564
2059 2935710462
2060 2935716445
2061 2935723430
2062 2935734986
2063 2935744223
2064 2935752723
2065 2935764730
2066 2935774149
2067 2935783717
2068 2935789134
2069 2935796884
2070 2935806159
2071 2935816925
2072 2935826314
2073 2935835214
2074 2935841404
2075 2935853810
2076 2935863028
2077 2935871838
2078 2935882271
2079 2935911033
2080 2935924194
2081 2935932753
2082 2935937316
2083 2935949483
2084 2935958118
2085 2935966452
2086 2935971227
2087 2935982175
2088 2935985312
2089 2936000158
2090 2936010072
2091 2936012420
2092 2936020499
2093 2936029713
2094 2936043916
2095 2936051822
2096 2936056924
2097 2940558636
2098 2941513289
2099 2941521252
2100 2941529036
2101 2941535670
2102 2941543630
2103 3005483556
2104 3005489793
2105 3005506249
2106 3005593708
2107 3005595408
2108 3005711370
2109 3005718636
2110 8006931149
2111 8006936688
2112 8006970232
2113 8006976658
2114 8006992431
2115 8007001929
2116 8016517792
2117 8016525857
2118 8016539458
2119 8016543746
2120 8016549547
2121 8016557968
2122 8016569147
2123 8016581785
2124 8016585960
2125 8016595985
2126 8016606856
2127 8016618764
2128 8016622769
2129 8016635262
2130 8017058836
2131 8019530737
2132 8019540847
2133 8019549768
2134 8019562020
2135 8019572085
2136 8019576817
2137 8019594870
2138 8019606869
2139 8019623321
2140 8019629774
2141 8019666621
2142 8019676355
2143 8019695821
2144 8055742816
2145 8056676315
2146 8056683017
2147 8056693948
2148 8056975652

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

38

171

0.91

PF00892

EamA

EamA-like transporter family

182

315

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i20-assembly3.cif.gz_C crystal structure of protein 0.8228 2 259
5i20-assembly2.cif.gz_B crystal structure of protein 0.8181 5 268
5i20-assembly5.cif.gz_E crystal structure of protein 0.8151 5 259
5i20-assembly2.cif.gz_B crystal structure of protein 0.8045 5 268
5i20-assembly4.cif.gz_D crystal structure of protein 0.8041 5 259
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.705 11 259 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6586 11 259 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6355 9 265 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6118 9 265 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.5919 6 261 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A429XGQ9-F1-model_v4 EamA domain-containing protein 0.8945 17 259 GO:0016020
AF-A0A2G1ZRJ6-F1-model_v4 EamA domain-containing protein 0.8672 3 264 GO:0005886
AF-A0A037V0B7-F1-model_v4 deleted 0.8601 1 268
AF-A0A037V0B7-F1-model_v4 deleted 0.8571 1 268
AF-A0A2G1ZRJ6-F1-model_v4 EamA domain-containing protein 0.846 3 264 GO:0005886

Map