F489523

General Info

Members Datasets Scaffolds Average Seq Length
1073 482 949 421

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100098637|Ga0070679_1000986372
Length 509
Sequence MPHVTHRTGGSTVKRLFVLKGRDFSRAVSLISRTVASATEGISLVPPRLFRTLFSRWGTFFNLTHTTISPRSRRFRHKTLKYIVMIDPAFVRANLAHVEEKLRTRGIDPAVALGSFATVDRERREAITQLETLKAQRNKLTEEIAKLRRAGSDATAQDHRLQEMMQSIPNLPHDSVPIGKSEQDNRVEKLWGTPPAFDFPAKPHWELGEALGILDFNRAAKISGSRFVVHFGQGARLERALANFMLDLHTSQHGYTEVLPPYMVNSKSLFGTGQLPKFAEDLFHCDDKGSYEPGNYQDSDHWMIPTAEVPVTNLFRDEILDESQLPTSFCAYTPCFRSEAGSYGKDVRGMIRQHQFQKVELVKFVKPEDSEAEHELLTRHAETVLEKLGLPYRRVLLCTGDMGFASAKTYDLEVWLPGQNLYREISSCSNFEAFQARRANIRYRPAGSKKNEFLHTLNGSGLAVGRTYLAILENYQQADGSIRIPEALIPYMNGDTVITSQQRRSTHHV

Samples

Sample ID Description Type Environment
1 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
2 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
3 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
4 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
5 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
6 2554235283 Bacillus safensis VK Isolate Rhizosphere
7 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
8 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
9 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
10 2643221729 Bacillus sp. Root11 Isolate Unclassified
11 2643221730 Bacillus sp. Root131 Isolate Unclassified
12 2643221731 Bacillus sp. Root147 Isolate Unclassified
13 2643221732 Bacillus sp. Root239 Isolate Unclassified
14 2643221735 Bacillus sp. Root920 Isolate Unclassified
15 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
16 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
17 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
18 2684622632 Bacillus cereus 905 Isolate Unclassified
19 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
20 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
21 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
22 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
23 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
24 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
25 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
26 2738541295 Bacillus sp. OK085 Isolate Unclassified
27 2738541358 Bacillus sp. OV752 Isolate Unclassified
28 2738543006 Bacillus sp. OK077 Isolate Unclassified
29 2738543010 Bacillus sp. YR335 Isolate Unclassified
30 2738543017 Bacillus sp. OV186 Isolate Unclassified
31 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
32 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
33 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
34 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
35 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
36 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
37 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
38 2811994870 Bacillus sp. JB4 Isolate Unclassified
39 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
40 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
41 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
42 2818991441 Niallia circulans 3243 Isolate Rhizosphere
43 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
44 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
45 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
46 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
47 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
48 2842682962 Bacillus sp. R-72492 Isolate Unclassified
49 2842882022 Bacillus sp. R-71893 Isolate Unclassified
50 2849139964 Bacillus sp. R-71875 Isolate Unclassified
51 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
52 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
53 2857472729 Cohnella sp. R-74144 Isolate Unclassified
54 2857581216 Bacillus sp. R-71922 Isolate Unclassified
55 2857586860 Bacillus sp. R-71935 Isolate Unclassified
56 2860837431 Bacillus sp. WR11 Isolate Unclassified
57 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
58 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
59 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
60 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
61 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
62 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
63 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
64 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
65 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
66 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
67 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
68 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
69 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
70 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
71 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
72 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
73 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
74 2919720352 Priestia megaterium 4340 Isolate Unclassified
75 2919726948 Bacillus pumilus 4489 Isolate Unclassified
76 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
77 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
78 2929004312 Priestia megaterium 1104 Isolate Unclassified
79 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
80 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
81 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
82 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
83 2938917290 Bacillus sp. CR71 Isolate Unclassified
84 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
85 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
86 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
87 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
88 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
89 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
90 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
91 2965761152 Bacillus sp. COPE52 Isolate Unclassified
92 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
93 2969141011 Bacillus velezensis MH25 Isolate Unclassified
94 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
95 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
96 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
97 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
98 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
99 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
100 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
101 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
102 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
103 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
104 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
105 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
106 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
107 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
108 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
109 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
110 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
111 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
112 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
113 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
114 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
115 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
116 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
117 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
118 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
120 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
121 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
122 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
123 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
124 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
125 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
126 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
127 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
128 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
129 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
130 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
131 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
132 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
133 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
134 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
135 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
136 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
137 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
138 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
139 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
140 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
141 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
142 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
143 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
144 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
145 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
146 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
147 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
148 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
149 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
150 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
151 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
152 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
153 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
154 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
155 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
156 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
157 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
158 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
159 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
160 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
161 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
162 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
163 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
164 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
165 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
166 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
167 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
168 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
169 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
170 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
171 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
172 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
173 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
174 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
175 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
176 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
177 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
178 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
179 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
180 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
181 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
182 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
183 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
184 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
185 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
186 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
187 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
188 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
189 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
190 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
191 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
192 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
193 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
194 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
195 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
196 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
197 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
198 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
199 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
200 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
201 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
202 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
203 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
204 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
205 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
206 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
207 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
208 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
209 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
210 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
211 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
212 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
213 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
214 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
215 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
216 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
217 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
218 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
219 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
220 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
221 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
222 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
223 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
224 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
225 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
226 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
227 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
229 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
230 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
231 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
288 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
291 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
292 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
293 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
294 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
295 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
296 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
297 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
298 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
299 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
300 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
301 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
302 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
303 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
304 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
305 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
306 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
307 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
308 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
309 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
310 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
311 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
312 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
313 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
314 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
315 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
316 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
317 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
318 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
319 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
320 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
321 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
322 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
323 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
324 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
325 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
326 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
327 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
328 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
329 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
330 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
331 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
332 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
333 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
334 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
335 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
336 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
337 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
338 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
339 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
340 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
341 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
342 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
343 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
344 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
345 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
346 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
347 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
348 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
349 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
350 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
351 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
352 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
353 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
354 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
355 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
356 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
357 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
358 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
359 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
360 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
361 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
362 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
363 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
364 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
365 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
366 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
367 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
368 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
369 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
370 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
371 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
372 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
373 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
374 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
375 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
376 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
377 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
378 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
379 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
380 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
381 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
382 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
383 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
384 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
385 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
386 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
387 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
388 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
389 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
390 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
391 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
392 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
393 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
394 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
395 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
396 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
397 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
398 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
399 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
400 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
401 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
402 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
403 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
404 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
405 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
406 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
407 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
408 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
409 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
414 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
415 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
416 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
417 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
418 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
419 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
420 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
421 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
443 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
444 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
445 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
446 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
447 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
448 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
449 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
452 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
453 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
455 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
456 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
457 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
458 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
459 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
460 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
461 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
462 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
463 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
464 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
465 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
466 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
468 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
469 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
470 8022653035 Bacillus sp. Rc4 Isolate Unclassified
471 8022792930 Bacillus sp. Xin Isolate Rhizosphere
472 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
473 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
474 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
475 8023438354 Bacillus sp. BH2 Isolate Unclassified
476 8023444577 Bacillus sp. BH32 Isolate Unclassified
477 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
478 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
479 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
480 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
481 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
482 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.51
Metatranscriptomes 0.93
Isolates 11.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0.09
Rhizoplane 2.42
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 10.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1003836 3300002987 Bacteria 5172
2 JGI25159J45721_1011665 3300002987 Bacteria 2139
3 JGI25151J46595_10001224 3300003187 Bacteria 18347
4 JGI25151J46595_10004028 3300003187 Bacteria 7885
5 JGI25151J46595_10018501 3300003187 Bacteria 2988
6 JGI25151J46595_10019625 3300003187 Bacteria 2867
7 rootH1_10011021 3300003316 Bacteria 15615
8 rootH2_10106356 3300003320 Bacteria 9412
9 rootL2_10077587 3300003322 Bacteria 10705
10 Ga0006562J51391_1000455 3300003578 Bacteria 14071
11 Ga0006562J51391_1000784 3300003578 Bacteria 7053
12 Ga0006562J51391_1006087 3300003578 Bacteria 3094
13 Ga0006562J51391_1006330 3300003578 Bacteria 1690
14 Ga0055532_1000591 3300003758 Bacteria 14790
15 Ga0055532_1001494 3300003758 Bacteria 6449
16 Ga0055532_1004227 3300003758 Bacteria 2218
17 Ga0055528_1011818 3300003790 Bacteria 3434
18 Ga0058863_10105751 3300004799 Bacteria 3406
19 Ga0065712_10068955 3300005290 Bacteria 8470
20 Ga0065707_10092497 3300005295 Bacteria 3762
21 Ga0070658_10000010 3300005327 Bacteria 297212
22 Ga0070658_10031649 3300005327 Bacteria 4249
23 Ga0070658_10033191 3300005327 Bacteria 4152
24 Ga0070658_10042002 3300005327 Bacteria 3690
25 Ga0070658_10042663 3300005327 Bacteria 3664
26 Ga0070658_10070362 3300005327 Bacteria 2864
27 Ga0070683_100000039 3300005329 Bacteria 119209
28 Ga0070683_100008651 3300005329 Bacteria 8652
29 Ga0070683_100039510 3300005329 Bacteria 4332
30 Ga0070683_100085883 3300005329 Bacteria 2950
31 Ga0070683_100189242 3300005329 Bacteria 1954
32 Ga0070683_100342349 3300005329 Bacteria 1424
33 Ga0070690_100004238 3300005330 Bacteria 7938
34 Ga0070690_100096785 3300005330 Unclassified 1951
35 Ga0070670_100008933 3300005331 Bacteria 8558
36 Ga0070670_100071794 3300005331 Bacteria 2972
37 Ga0070670_100079247 3300005331 Unclassified 2823
38 Ga0068869_100000252 3300005334 Bacteria 28152
39 Ga0068869_100006774 3300005334 Bacteria 7282
40 Ga0070666_10105572 3300005335 Bacteria 1946
41 Ga0070680_100109335 3300005336 Bacteria 2300
42 Ga0070682_100076591 3300005337 Unclassified 2154
43 Ga0068868_100000205 3300005338 Bacteria 39972
44 Ga0068868_100015202 3300005338 Bacteria 5687
45 Ga0070660_100126581 3300005339 Bacteria 2041
46 Ga0070689_100000051 3300005340 Bacteria 73958
47 Ga0070689_100013934 3300005340 Bacteria 5832
48 Ga0070687_100004040 3300005343 Bacteria 5792
49 Ga0070661_100014711 3300005344 Bacteria 5518
50 Ga0070661_100016983 3300005344 Bacteria 5155
51 Ga0070669_100034646 3300005353 Bacteria 3655
52 Ga0070675_100007456 3300005354 Bacteria 8450
53 Ga0070675_100135562 3300005354 Bacteria 2101
54 Ga0070671_100004032 3300005355 Bacteria 11577
55 Ga0070671_100023233 3300005355 Bacteria 5072
56 Ga0070673_100005177 3300005364 Bacteria 8327
57 Ga0070673_100223123 3300005364 Bacteria 1632
58 Ga0070688_100000469 3300005365 Bacteria 20461
59 Ga0070659_100002675 3300005366 Bacteria 12666
60 Ga0070659_100024875 3300005366 Bacteria 4594
61 Ga0070659_100041141 3300005366 Bacteria 3612
62 Ga0070659_100171389 3300005366 Bacteria 1778
63 Ga0070667_100003759 3300005367 Bacteria 12894
64 Ga0070709_10016760 3300005434 Bacteria 4190
65 Ga0070714_100010572 3300005435 Bacteria 7299
66 Ga0070714_100031031 3300005435 Bacteria 4455
67 Ga0070714_100033807 3300005435 Bacteria 4278
68 Ga0070714_100079019 3300005435 Bacteria 2860
69 Ga0070713_100042247 3300005436 Bacteria 3720
70 Ga0070713_100058005 3300005436 Bacteria 3226
71 Ga0070713_100090819 3300005436 Bacteria 2626
72 Ga0070713_100278728 3300005436 Bacteria 1533
73 Ga0070701_10000660 3300005438 Bacteria 12113
74 Ga0070711_100013222 3300005439 Bacteria 5179
75 Ga0070711_100018291 3300005439 Bacteria 4471
76 Ga0070711_100048461 3300005439 Bacteria 2905
77 Ga0070694_100027042 3300005444 Bacteria 3723
78 Ga0070694_100117462 3300005444 Bacteria 1904
79 Ga0070708_100002312 3300005445 Bacteria 14753
80 Ga0070708_100007410 3300005445 Bacteria 8780
81 Ga0070708_100032993 3300005445 Unclassified 4496
82 Ga0070708_100081820 3300005445 Unclassified 2924
83 Ga0070708_100266588 3300005445 Bacteria 1610
84 Ga0070663_100074159 3300005455 Bacteria 2484
85 Ga0070681_10071508 3300005458 Bacteria 3434
86 Ga0070681_10124408 3300005458 Bacteria 2511
87 Ga0068867_100016358 3300005459 Bacteria 5265
88 Ga0070685_10000319 3300005466 Bacteria 29847
89 Ga0070685_10008224 3300005466 Bacteria 5351
90 Ga0070706_100032437 3300005467 Unclassified 4818
91 Ga0070707_100013845 3300005468 Bacteria 7553
92 Ga0070698_100000345 3300005471 Bacteria 47885
93 Ga0070698_100006271 3300005471 Bacteria 12929
94 Ga0070698_100021351 3300005471 Bacteria 6783
95 Ga0070699_100039953 3300005518 Bacteria 4063
96 Ga0070679_100000967 3300005530 Bacteria 24985
97 Ga0070679_100004611 3300005530 Bacteria 12725
98 Ga0070679_100009383 3300005530 Bacteria 9252
99 Ga0070679_100017304 3300005530 Bacteria 6976
100 Ga0070679_100098637 3300005530 Bacteria 2909
101 Ga0070684_100000027 3300005535 Bacteria 119209
102 Ga0070684_100010795 3300005535 Bacteria 7253
103 Ga0070684_100048177 3300005535 Bacteria 3696
104 Ga0070684_100057832 3300005535 Bacteria 3387
105 Ga0070697_100001652 3300005536 Bacteria 17000
106 Ga0070697_100004328 3300005536 Bacteria 10891
107 Ga0070697_100294298 3300005536 Bacteria 1395
108 Ga0068853_100002603 3300005539 Bacteria 13564
109 Ga0068853_100006865 3300005539 Bacteria 9080
110 Ga0068853_100010733 3300005539 Bacteria 7416
111 Ga0068853_100021464 3300005539 Bacteria 5385
112 Ga0070672_100069565 3300005543 Bacteria 2795
113 Ga0070686_100000074 3300005544 Bacteria 73901
114 Ga0070695_100010670 3300005545 Archaea 5490
115 Ga0070695_100046516 3300005545 Bacteria 2769
116 Ga0070696_100103796 3300005546 Bacteria 2040
117 Ga0070665_100007274 3300005548 Bacteria 11253
118 Ga0070665_100028174 3300005548 Bacteria 5657
119 Ga0070665_100074130 3300005548 Bacteria 3409
120 Ga0070665_100087055 3300005548 Bacteria 3129
121 Ga0068855_100008383 3300005563 Bacteria 12496
122 Ga0068855_100010646 3300005563 Bacteria 11092
123 Ga0068855_100023773 3300005563 Bacteria 7341
124 Ga0068855_100023885 3300005563 Bacteria 7323
125 Ga0068855_100024629 3300005563 Bacteria 7199
126 Ga0068855_100029188 3300005563 Bacteria 6596
127 Ga0068855_100074975 3300005563 Bacteria 3928
128 Ga0068855_100078333 3300005563 Bacteria 3834
129 Ga0068855_100123212 3300005563 Bacteria 2966
130 Ga0068855_100164208 3300005563 Bacteria 2518
131 Ga0070664_100105538 3300005564 Bacteria 2454
132 Ga0068857_100009186 3300005577 Bacteria 8581
133 Ga0068857_100009215 3300005577 Bacteria 8562
134 Ga0068857_100084050 3300005577 Bacteria 2844
135 Ga0068854_100000111 3300005578 Bacteria 55862
136 Ga0068854_100045692 3300005578 Bacteria 3115
137 Ga0068854_100061151 3300005578 Bacteria 2727
138 Ga0068856_100015765 3300005614 Bacteria 7307
139 Ga0068856_100016479 3300005614 Bacteria 7154
140 Ga0068856_100076674 3300005614 Bacteria 3312
141 Ga0068856_100114123 3300005614 Bacteria 2700
142 Ga0068856_100121634 3300005614 Bacteria 2612
143 Ga0068856_100211375 3300005614 Bacteria 1955
144 Ga0068856_100309344 3300005614 Bacteria 1598
145 Ga0068852_100000041 3300005616 Bacteria 92967
146 Ga0068852_100000964 3300005616 Bacteria 18918
147 Ga0068852_100023207 3300005616 Bacteria 4990
148 Ga0068852_100028656 3300005616 Bacteria 4562
149 Ga0068852_100045113 3300005616 Bacteria 3748
150 Ga0068852_100126961 3300005616 Bacteria 2344
151 Ga0068852_100151274 3300005616 Bacteria 2158
152 Ga0068859_100000794 3300005617 Bacteria 32018
153 Ga0068859_100025707 3300005617 Bacteria 5904
154 Ga0068859_100058272 3300005617 Bacteria 3890
155 Ga0068859_100065587 3300005617 Bacteria 3664
156 Ga0068859_100098592 3300005617 Bacteria 2976
157 Ga0068864_100002966 3300005618 Bacteria 14020
158 Ga0068864_100014310 3300005618 Bacteria 6591
159 Ga0068861_100047090 3300005719 Bacteria 3254
160 Ga0068851_10002493 3300005834 Bacteria 8093
161 Ga0068851_10013289 3300005834 Bacteria 3896
162 Ga0068863_100001668 3300005841 Bacteria 21945
163 Ga0068863_100072032 3300005841 Bacteria 3270
164 Ga0068858_100000835 3300005842 Bacteria 32071
165 Ga0068858_100009232 3300005842 Bacteria 9416
166 Ga0068858_100034248 3300005842 Bacteria 4711
167 Ga0068860_100000322 3300005843 Bacteria 65040
168 Ga0068860_100074896 3300005843 Bacteria 3219
169 Ga0068860_100161946 3300005843 Bacteria 2157
170 Ga0081538_10004954 3300005981 Bacteria 12137
171 Ga0081540_1025483 3300005983 Bacteria 3401
172 Ga0081539_10015061 3300005985 Bacteria 5662
173 Ga0070717_10022703 3300006028 Bacteria 4961
174 Ga0070717_10034388 3300006028 Bacteria 4097
175 Ga0070717_10038406 3300006028 Bacteria 3891
176 Ga0070717_10103227 3300006028 Bacteria 2423
177 Ga0070717_10152531 3300006028 Bacteria 2000
178 Ga0070717_10202269 3300006028 Bacteria 1740
179 Ga0070715_10001944 3300006163 Bacteria 6221
180 Ga0070716_100001422 3300006173 Bacteria 10639
181 Ga0070712_100004014 3300006175 Bacteria 9039
182 Ga0070712_100012027 3300006175 Bacteria 5500
183 Ga0097621_100000476 3300006237 Bacteria 28171
184 Ga0097621_100009750 3300006237 Bacteria 6990
185 Ga0097621_100011349 3300006237 Bacteria 6555
186 Ga0097621_100018869 3300006237 Bacteria 5281
187 Ga0097621_100049430 3300006237 Bacteria 3416
188 Ga0097621_100094021 3300006237 Bacteria 2513
189 Ga0097621_100153967 3300006237 Bacteria 1972
190 Ga0068871_100004447 3300006358 Bacteria 9756
191 Ga0068871_100013264 3300006358 Bacteria 6112
192 Ga0068871_100029694 3300006358 Bacteria 4297
193 Ga0068871_100062687 3300006358 Bacteria 3039
194 Ga0068871_100129810 3300006358 Bacteria 2136
195 Ga0075428_100097294 3300006844 Bacteria 3209
196 Ga0075431_100003197 3300006847 Bacteria 15840
197 Ga0075433_10000284 3300006852 Bacteria 30215
198 Ga0075434_100003227 3300006871 Bacteria 14552
199 Ga0075434_100019192 3300006871 Bacteria 6614
200 Ga0075429_100024328 3300006880 Bacteria 5255
201 Ga0068865_100081148 3300006881 Bacteria 2328
202 Ga0075436_100050909 3300006914 Bacteria 2858
203 Ga0075436_100057622 3300006914 Bacteria 2683
204 Ga0097620_100000794 3300006931 Bacteria 32018
205 Ga0097620_100025707 3300006931 Bacteria 5904
206 Ga0097620_100058275 3300006931 Bacteria 3890
207 Ga0097620_100065589 3300006931 Bacteria 3664
208 Ga0097620_100098595 3300006931 Bacteria 2976
209 Ga0075435_100026898 3300007076 Bacteria 4494
210 Ga0075435_100057496 3300007076 Bacteria 3147
211 Ga0105251_10027392 3300009011 Bacteria 2890
212 Ga0105250_10049827 3300009092 Bacteria 1680
213 Ga0105250_10051831 3300009092 Bacteria 1646
214 Ga0105240_10000002 3300009093 Bacteria 1924170
215 Ga0105240_10000251 3300009093 Bacteria 106709
216 Ga0105240_10001385 3300009093 Bacteria 41682
217 Ga0105240_10001456 3300009093 Bacteria 40471
218 Ga0105240_10001662 3300009093 Bacteria 37766
219 Ga0105240_10002880 3300009093 Bacteria 27177
220 Ga0105240_10003229 3300009093 Bacteria 25527
221 Ga0105240_10005528 3300009093 Bacteria 18829
222 Ga0105240_10012970 3300009093 Bacteria 11479
223 Ga0105240_10017400 3300009093 Bacteria 9688
224 Ga0105240_10041225 3300009093 Bacteria 5895
225 Ga0105240_10044447 3300009093 Bacteria 5644
226 Ga0105240_10050529 3300009093 Bacteria 5241
227 Ga0105240_10070490 3300009093 Bacteria 4324
228 Ga0105240_10174879 3300009093 Bacteria 2539
229 Ga0105240_10195841 3300009093 Bacteria 2373
230 Ga0111539_10004867 3300009094 Bacteria 17492
231 Ga0111539_10008483 3300009094 Bacteria 13061
232 Ga0111539_10028008 3300009094 Bacteria 6881
233 Ga0111539_10058687 3300009094 Bacteria 4565
234 Ga0111539_10058920 3300009094 Bacteria 4555
235 Ga0111539_10067241 3300009094 Bacteria 4232
236 Ga0105245_10003232 3300009098 Bacteria 14598
237 Ga0105245_10008585 3300009098 Bacteria 8909
238 Ga0105245_10015549 3300009098 Bacteria 6636
239 Ga0105245_10015662 3300009098 Bacteria 6612
240 Ga0105245_10017474 3300009098 Bacteria 6258
241 Ga0105245_10039298 3300009098 Bacteria 4211
242 Ga0105247_10004610 3300009101 Bacteria 8788
243 Ga0105247_10031365 3300009101 Bacteria 3225
244 Ga0105247_10035991 3300009101 Bacteria 3018
245 Ga0114129_10017177 3300009147 Bacteria 10305
246 Ga0114129_10043727 3300009147 Bacteria 6302
247 Ga0114129_10061591 3300009147 Bacteria 5244
248 Ga0114129_10097134 3300009147 Bacteria 4078
249 Ga0114129_10143770 3300009147 Bacteria 3268
250 Ga0114129_10395274 3300009147 Bacteria 1823
251 Ga0105243_10133339 3300009148 Bacteria 2110
252 Ga0105241_10000098 3300009174 Bacteria 64907
253 Ga0105241_10005821 3300009174 Bacteria 9103
254 Ga0105241_10007731 3300009174 Bacteria 7902
255 Ga0105241_10014170 3300009174 Bacteria 5842
256 Ga0105242_10033849 3300009176 Bacteria 4094
257 Ga0105242_10040384 3300009176 Bacteria 3760
258 Ga0105242_10045677 3300009176 Bacteria 3550
259 Ga0105242_10064793 3300009176 Bacteria 3013
260 Ga0105248_10000007 3300009177 Bacteria 471250
261 Ga0105248_10002347 3300009177 Bacteria 21003
262 Ga0105248_10003889 3300009177 Bacteria 16510
263 Ga0105248_10004620 3300009177 Bacteria 15224
264 Ga0105248_10004648 3300009177 Bacteria 15194
265 Ga0105248_10045095 3300009177 Bacteria 4944
266 Ga0105248_10081584 3300009177 Bacteria 3635
267 Ga0105248_10161313 3300009177 Bacteria 2529
268 Ga0105237_10006109 3300009545 Bacteria 13461
269 Ga0105237_10007736 3300009545 Bacteria 11734
270 Ga0105237_10027188 3300009545 Bacteria 5842
271 Ga0105237_10109668 3300009545 Bacteria 2752
272 Ga0105237_10153824 3300009545 Bacteria 2296
273 Ga0105237_10239052 3300009545 Bacteria 1817
274 Ga0105238_10000416 3300009551 Bacteria 44967
275 Ga0105238_10001077 3300009551 Bacteria 27578
276 Ga0105238_10001618 3300009551 Bacteria 22540
277 Ga0105238_10004730 3300009551 Bacteria 13462
278 Ga0105238_10026579 3300009551 Bacteria 5902
279 Ga0105238_10029793 3300009551 Bacteria 5559
280 Ga0105238_10068063 3300009551 Bacteria 3562
281 Ga0105238_10073974 3300009551 Bacteria 3401
282 Ga0105238_10127219 3300009551 Bacteria 2526
283 Ga0105249_10002693 3300009553 Bacteria 15358
284 Ga0105249_10007173 3300009553 Bacteria 9734
285 Ga0105249_10117367 3300009553 Bacteria 2524
286 Ga0105249_10231932 3300009553 Bacteria 1821
287 Ga0105239_10004570 3300010375 Bacteria 16500
288 Ga0105239_10006418 3300010375 Bacteria 13650
289 Ga0105239_10008318 3300010375 Bacteria 11824
290 Ga0105239_10014432 3300010375 Bacteria 8767
291 Ga0105239_10020047 3300010375 Bacteria 7378
292 Ga0105239_10094875 3300010375 Bacteria 3296
293 Ga0105246_10004304 3300011119 Bacteria 8660
294 Ga0105246_10005143 3300011119 Bacteria 7954
295 Ga0105246_10005522 3300011119 Bacteria 7714
296 Ga0105246_10052062 3300011119 Bacteria 2813
297 Ga0105246_10166176 3300011119 Bacteria 1685
298 Ga0157373_10130694 3300013100 Bacteria 1766
299 Ga0157370_10000003 3300013104 Bacteria 367417
300 Ga0157370_10001294 3300013104 Bacteria 31198
301 Ga0157370_10004975 3300013104 Bacteria 15044
302 Ga0157370_10005432 3300013104 Bacteria 14297
303 Ga0157370_10014105 3300013104 Bacteria 8197
304 Ga0157370_10015654 3300013104 Bacteria 7703
305 Ga0157370_10025185 3300013104 Bacteria 5890
306 Ga0157370_10031613 3300013104 Bacteria 5176
307 Ga0157370_10105990 3300013104 Bacteria 2631
308 Ga0157370_10303638 3300013104 Bacteria 1473
309 Ga0157369_10000094 3300013105 Bacteria 122205
310 Ga0157369_10000719 3300013105 Bacteria 42572
311 Ga0157369_10002577 3300013105 Bacteria 21701
312 Ga0157369_10003469 3300013105 Bacteria 18709
313 Ga0157369_10003568 3300013105 Bacteria 18484
314 Ga0157369_10004217 3300013105 Bacteria 17024
315 Ga0157369_10009244 3300013105 Bacteria 11273
316 Ga0157369_10013848 3300013105 Bacteria 9113
317 Ga0157369_10015106 3300013105 Bacteria 8714
318 Ga0157369_10028857 3300013105 Bacteria 6137
319 Ga0157369_10030225 3300013105 Bacteria 5976
320 Ga0157369_10099974 3300013105 Bacteria 3092
321 Ga0157369_10128430 3300013105 Bacteria 2687
322 Ga0157369_10165840 3300013105 Bacteria 2330
323 Ga0157369_10292476 3300013105 Bacteria 1695
324 Ga0157374_10004012 3300013296 Bacteria 12377
325 Ga0157374_10017652 3300013296 Bacteria 6287
326 Ga0157374_10060416 3300013296 Bacteria 3547
327 Ga0157374_10139410 3300013296 Bacteria 2353
328 Ga0157374_10206768 3300013296 Bacteria 1924
329 Ga0157374_10347999 3300013296 Bacteria 1472
330 Ga0157374_10356146 3300013296 Bacteria 1455
331 Ga0157378_10008917 3300013297 Bacteria 8731
332 Ga0157378_10009939 3300013297 Bacteria 8296
333 Ga0157378_10013737 3300013297 Bacteria 7083
334 Ga0157378_10014382 3300013297 Bacteria 6928
335 Ga0157378_10017090 3300013297 Bacteria 6360
336 Ga0157378_10020719 3300013297 Bacteria 5783
337 Ga0157378_10056706 3300013297 Bacteria 3491
338 Ga0163162_10007982 3300013306 Bacteria 10321
339 Ga0163162_10015635 3300013306 Bacteria 7416
340 Ga0163162_10054231 3300013306 Bacteria 4032
341 Ga0163162_10349245 3300013306 Bacteria 1612
342 Ga0157372_10000074 3300013307 Bacteria 106584
343 Ga0157372_10007215 3300013307 Bacteria 11834
344 Ga0157372_10008866 3300013307 Bacteria 10683
345 Ga0157372_10011163 3300013307 Bacteria 9554
346 Ga0157372_10016608 3300013307 Bacteria 7899
347 Ga0157372_10033475 3300013307 Bacteria 5645
348 Ga0157372_10036615 3300013307 Bacteria 5409
349 Ga0157372_10061668 3300013307 Bacteria 4200
350 Ga0157372_10077559 3300013307 Bacteria 3753
351 Ga0157372_10132277 3300013307 Bacteria 2871
352 Ga0157372_10139873 3300013307 Bacteria 2788
353 Ga0157372_10151700 3300013307 Bacteria 2675
354 Ga0157372_10219891 3300013307 Bacteria 2202
355 Ga0157372_10280825 3300013307 Bacteria 1936
356 Ga0157372_10325323 3300013307 Bacteria 1790
357 Ga0157375_10003858 3300013308 Bacteria 13012
358 Ga0157375_10027954 3300013308 Bacteria 5279
359 Ga0157375_10062045 3300013308 Bacteria 3713
360 Ga0157375_10101606 3300013308 Bacteria 2959
361 Ga0157375_10159821 3300013308 Bacteria 2394
362 Ga0157375_10163999 3300013308 Bacteria 2366
363 Ga0163163_10002565 3300014325 Bacteria 15382
364 Ga0163163_10003545 3300014325 Bacteria 13250
365 Ga0163163_10004928 3300014325 Bacteria 11482
366 Ga0163163_10025477 3300014325 Bacteria 5638
367 Ga0163163_10038959 3300014325 Bacteria 4636
368 Ga0163163_10106282 3300014325 Bacteria 2833
369 Ga0157380_10003543 3300014326 Bacteria 10733
370 Ga0157380_10130028 3300014326 Bacteria 2146
371 Ga0157379_10001327 3300014968 Bacteria 20184
372 Ga0157379_10008670 3300014968 Bacteria 8854
373 Ga0157379_10048555 3300014968 Bacteria 3788
374 Ga0157379_10085992 3300014968 Bacteria 2819
375 Ga0157379_10192682 3300014968 Bacteria 1842
376 Ga0157376_10000765 3300014969 Bacteria 20965
377 Ga0157376_10062014 3300014969 Bacteria 3145
378 Ga0157376_10218818 3300014969 Bacteria 1763
379 Ga0213872_10000270 3300021361 Bacteria 44678
380 Ga0213875_10000002 3300021388 Bacteria 921066
381 Ga0213875_10015485 3300021388 Bacteria 3710
382 Ga0213875_10048958 3300021388 Bacteria 1981
383 Ga0213875_10068647 3300021388 Bacteria 1655
384 Ga0213875_10089587 3300021388 Bacteria 1435
385 Ga0228598_1001095 3300024227 Bacteria 5962
386 Ga0209147_100136 3300025229 Bacteria 117683
387 Ga0209147_100757 3300025229 Bacteria 15860
388 Ga0209147_100998 3300025229 Bacteria 12255
389 Ga0209147_104161 3300025229 Bacteria 2495
390 Ga0209673_1010373 3300025273 Bacteria 3931
391 Ga0209130_1003752 3300025284 Bacteria 6201
392 Ga0209130_1009646 3300025284 Bacteria 2730
393 Ga0209130_1013157 3300025284 Bacteria 2131
394 Ga0209025_1002628 3300025294 Bacteria 18425
395 Ga0209025_1003350 3300025294 Bacteria 15368
396 Ga0209025_1003723 3300025294 Bacteria 14002
397 Ga0209025_1004926 3300025294 Bacteria 11224
398 Ga0209025_1005862 3300025294 Bacteria 9822
399 Ga0209025_1010384 3300025294 Bacteria 6314
400 Ga0209025_1033719 3300025294 Bacteria 2358
401 Ga0209025_1043626 3300025294 Bacteria 1886
402 Ga0207656_10018831 3300025321 Bacteria 2723
403 Ga0207696_1002864 3300025711 Bacteria 8143
404 Ga0207696_1003086 3300025711 Bacteria 7763
405 Ga0207696_1030654 3300025711 Bacteria 1632
406 Ga0207655_1016663 3300025728 Bacteria 4007
407 Ga0207713_1003390 3300025735 Bacteria 10900
408 Ga0207713_1027077 3300025735 Bacteria 2611
409 Ga0207710_10017581 3300025900 Bacteria 3033
410 Ga0207680_10091824 3300025903 Bacteria 1933
411 Ga0207647_10025732 3300025904 Bacteria 3860
412 Ga0207685_10014853 3300025905 Bacteria 2449
413 Ga0207685_10022278 3300025905 Bacteria 2138
414 Ga0207699_10031797 3300025906 Bacteria 2967
415 Ga0207645_10033305 3300025907 Bacteria 3312
416 Ga0207705_10000016 3300025909 Bacteria 377359
417 Ga0207705_10011364 3300025909 Bacteria 6447
418 Ga0207705_10016032 3300025909 Bacteria 5379
419 Ga0207705_10032545 3300025909 Bacteria 3726
420 Ga0207705_10077928 3300025909 Bacteria 2411
421 Ga0207705_10128462 3300025909 Bacteria 1885
422 Ga0207705_10164602 3300025909 Bacteria 1667
423 Ga0207684_10066125 3300025910 Unclassified 3070
424 Ga0207654_10001029 3300025911 Bacteria 15243
425 Ga0207654_10001324 3300025911 Bacteria 13188
426 Ga0207654_10016308 3300025911 Bacteria 3867
427 Ga0207654_10025171 3300025911 Bacteria 3207
428 Ga0207707_10002540 3300025912 Bacteria 16376
429 Ga0207707_10069541 3300025912 Bacteria 3068
430 Ga0207707_10131333 3300025912 Bacteria 2190
431 Ga0207707_10143697 3300025912 Bacteria 2086
432 Ga0207695_10000002 3300025913 Bacteria 2188391
433 Ga0207695_10000106 3300025913 Bacteria 253001
434 Ga0207695_10000129 3300025913 Bacteria 225939
435 Ga0207695_10000194 3300025913 Bacteria 171422
436 Ga0207695_10000603 3300025913 Bacteria 71985
437 Ga0207695_10000770 3300025913 Bacteria 60994
438 Ga0207695_10001665 3300025913 Bacteria 35766
439 Ga0207695_10005265 3300025913 Bacteria 17254
440 Ga0207695_10006691 3300025913 Bacteria 14872
441 Ga0207695_10007856 3300025913 Bacteria 13479
442 Ga0207695_10012314 3300025913 Bacteria 10276
443 Ga0207695_10072379 3300025913 Bacteria 3517
444 Ga0207695_10087418 3300025913 Bacteria 3140
445 Ga0207695_10102329 3300025913 Bacteria 2857
446 Ga0207695_10129121 3300025913 Bacteria 2486
447 Ga0207695_10233748 3300025913 Bacteria 1742
448 Ga0207671_10000936 3300025914 Bacteria 36464
449 Ga0207671_10004025 3300025914 Bacteria 14271
450 Ga0207671_10005189 3300025914 Bacteria 12108
451 Ga0207671_10118482 3300025914 Bacteria 2022
452 Ga0207693_10001742 3300025915 Bacteria 19096
453 Ga0207693_10054648 3300025915 Bacteria 3132
454 Ga0207693_10101909 3300025915 Bacteria 2251
455 Ga0207663_10046383 3300025916 Bacteria 2677
456 Ga0207663_10093493 3300025916 Bacteria 2001
457 Ga0207660_10009166 3300025917 Bacteria 6409
458 Ga0207657_10000493 3300025919 Bacteria 41704
459 Ga0207657_10067603 3300025919 Bacteria 3039
460 Ga0207657_10175714 3300025919 Bacteria 1733
461 Ga0207652_10001067 3300025921 Bacteria 24839
462 Ga0207652_10006572 3300025921 Bacteria 9372
463 Ga0207652_10089269 3300025921 Bacteria 2706
464 Ga0207652_10097462 3300025921 Bacteria 2592
465 Ga0207646_10000864 3300025922 Bacteria 39170
466 Ga0207681_10074789 3300025923 Bacteria 2374
467 Ga0207694_10000301 3300025924 Bacteria 46518
468 Ga0207694_10000484 3300025924 Bacteria 36222
469 Ga0207694_10001598 3300025924 Bacteria 19163
470 Ga0207694_10001712 3300025924 Bacteria 18367
471 Ga0207694_10005539 3300025924 Bacteria 9680
472 Ga0207694_10012420 3300025924 Bacteria 6419
473 Ga0207694_10019819 3300025924 Bacteria 5088
474 Ga0207694_10021364 3300025924 Bacteria 4905
475 Ga0207694_10036417 3300025924 Bacteria 3777
476 Ga0207650_10131415 3300025925 Bacteria 1959
477 Ga0207659_10003391 3300025926 Bacteria 9553
478 Ga0207659_10035935 3300025926 Bacteria 3428
479 Ga0207687_10014145 3300025927 Bacteria 5220
480 Ga0207687_10019479 3300025927 Bacteria 4496
481 Ga0207687_10021550 3300025927 Bacteria 4283
482 Ga0207687_10028708 3300025927 Bacteria 3738
483 Ga0207687_10030563 3300025927 Bacteria 3633
484 Ga0207700_10041775 3300025928 Bacteria 3357
485 Ga0207700_10045070 3300025928 Unclassified 3252
486 Ga0207700_10080161 3300025928 Bacteria 2545
487 Ga0207700_10189840 3300025928 Bacteria 1726
488 Ga0207664_10168306 3300025929 Bacteria 1874
489 Ga0207644_10031279 3300025931 Bacteria 3707
490 Ga0207690_10142010 3300025932 Bacteria 1770
491 Ga0207690_10178289 3300025932 Bacteria 1598
492 Ga0207706_10014418 3300025933 Bacteria 7164
493 Ga0207709_10007141 3300025935 Bacteria 6234
494 Ga0207670_10000060 3300025936 Bacteria 77828
495 Ga0207665_10002215 3300025939 Bacteria 13105
496 Ga0207691_10008522 3300025940 Bacteria 9849
497 Ga0207691_10089686 3300025940 Bacteria 2757
498 Ga0207691_10183350 3300025940 Bacteria 1828
499 Ga0207711_10000014 3300025941 Bacteria 506753
500 Ga0207711_10000016 3300025941 Bacteria 486741
501 Ga0207711_10000701 3300025941 Bacteria 33020
502 Ga0207711_10003048 3300025941 Bacteria 14647
503 Ga0207711_10004294 3300025941 Bacteria 12181
504 Ga0207711_10008512 3300025941 Bacteria 8582
505 Ga0207711_10020636 3300025941 Bacteria 5498
506 Ga0207711_10056276 3300025941 Bacteria 3379
507 Ga0207711_10118505 3300025941 Bacteria 2362
508 Ga0207689_10000096 3300025942 Bacteria 70686
509 Ga0207689_10000146 3300025942 Bacteria 60575
510 Ga0207689_10019506 3300025942 Bacteria 5714
511 Ga0207689_10056534 3300025942 Bacteria 3229
512 Ga0207689_10063772 3300025942 Bacteria 3032
513 Ga0207661_10000043 3300025944 Bacteria 119208
514 Ga0207661_10002207 3300025944 Bacteria 13431
515 Ga0207661_10012930 3300025944 Bacteria 6088
516 Ga0207661_10080946 3300025944 Bacteria 2681
517 Ga0207661_10092457 3300025944 Bacteria 2522
518 Ga0207667_10000776 3300025949 Bacteria 41369
519 Ga0207667_10001402 3300025949 Bacteria 30225
520 Ga0207667_10001669 3300025949 Bacteria 27969
521 Ga0207667_10008897 3300025949 Bacteria 11884
522 Ga0207667_10011691 3300025949 Bacteria 10185
523 Ga0207667_10017209 3300025949 Bacteria 8145
524 Ga0207667_10028501 3300025949 Bacteria 6065
525 Ga0207667_10029877 3300025949 Bacteria 5904
526 Ga0207667_10109061 3300025949 Bacteria 2855
527 Ga0207651_10012211 3300025960 Bacteria 4849
528 Ga0207651_10171900 3300025960 Bacteria 1710
529 Ga0207640_10000019 3300025981 Bacteria 185255
530 Ga0207640_10034051 3300025981 Bacteria 3176
531 Ga0207640_10035755 3300025981 Bacteria 3111
532 Ga0207658_10006347 3300025986 Bacteria 8071
533 Ga0207677_10004537 3300026023 Bacteria 7470
534 Ga0207677_10009738 3300026023 Bacteria 5412
535 Ga0207703_10015806 3300026035 Bacteria 5887
536 Ga0207703_10031084 3300026035 Bacteria 4220
537 Ga0207639_10000067 3300026041 Bacteria 97172
538 Ga0207639_10000200 3300026041 Bacteria 45090
539 Ga0207639_10004944 3300026041 Bacteria 8979
540 Ga0207639_10039314 3300026041 Bacteria 3524
541 Ga0207678_10009278 3300026067 Bacteria 8656
542 Ga0207678_10011601 3300026067 Bacteria 7740
543 Ga0207678_10047676 3300026067 Bacteria 3704
544 Ga0207708_10000616 3300026075 Bacteria 27381
545 Ga0207702_10001200 3300026078 Bacteria 26300
546 Ga0207702_10010045 3300026078 Bacteria 7936
547 Ga0207702_10012872 3300026078 Bacteria 6959
548 Ga0207702_10211694 3300026078 Bacteria 1802
549 Ga0207641_10000984 3300026088 Bacteria 29118
550 Ga0207641_10107297 3300026088 Bacteria 2470
551 Ga0207641_10221130 3300026088 Bacteria 1756
552 Ga0207648_10005638 3300026089 Bacteria 12575
553 Ga0207648_10022269 3300026089 Bacteria 5693
554 Ga0207676_10009743 3300026095 Bacteria 6831
555 Ga0207676_10056772 3300026095 Bacteria 3080
556 Ga0207676_10072144 3300026095 Bacteria 2774
557 Ga0207674_10020307 3300026116 Bacteria 7180
558 Ga0207674_10028421 3300026116 Bacteria 5902
559 Ga0207674_10209051 3300026116 Bacteria 1901
560 Ga0207683_10002717 3300026121 Bacteria 15448
561 Ga0207683_10138554 3300026121 Bacteria 2191
562 Ga0207698_10000017 3300026142 Bacteria 178846
563 Ga0207698_10000871 3300026142 Bacteria 17510
564 Ga0207698_10002829 3300026142 Bacteria 10386
565 Ga0207698_10027549 3300026142 Bacteria 4036
566 Ga0207698_10050045 3300026142 Bacteria 3185
567 Ga0209371_1003461 3300027312 Bacteria 7656
568 Ga0207428_10015548 3300027907 Bacteria 6578
569 Ga0268266_10008914 3300028379 Bacteria 8878
570 Ga0268266_10009917 3300028379 Bacteria 8367
571 Ga0268266_10027838 3300028379 Bacteria 4805
572 Ga0268266_10036809 3300028379 Bacteria 4168
573 Ga0268266_10070220 3300028379 Bacteria 3035
574 Ga0268264_10001788 3300028381 Bacteria 19646
575 Ga0268264_10044758 3300028381 Bacteria 3672
576 Ga0265326_10027021 3300028558 Bacteria 1636
577 Ga0265319_1000008 3300028563 Bacteria 215029
578 Ga0265319_1002037 3300028563 Bacteria 11374
579 Ga0265319_1014398 3300028563 Bacteria 3104
580 Ga0265334_10001450 3300028573 Bacteria 11401
581 Ga0265318_10000005 3300028577 Bacteria 303630
582 Ga0265318_10000487 3300028577 Bacteria 29170
583 Ga0265318_10001015 3300028577 Bacteria 17934
584 Ga0265323_10005852 3300028653 Bacteria 5201
585 Ga0265323_10006078 3300028653 Bacteria 5096
586 Ga0265323_10016282 3300028653 Bacteria 2907
587 Ga0265322_10023361 3300028654 Bacteria 1768
588 Ga0265336_10002817 3300028666 Bacteria 7023
589 Ga0265336_10009733 3300028666 Bacteria 3315
590 Ga0265338_10002257 3300028800 Bacteria 29354
591 Ga0265338_10002938 3300028800 Bacteria 24725
592 Ga0265338_10003158 3300028800 Bacteria 23521
593 Ga0265338_10008212 3300028800 Bacteria 12716
594 Ga0265324_10000227 3300029957 Bacteria 42589
595 Ga0265324_10004096 3300029957 Bacteria 6686
596 Ga0265324_10007470 3300029957 Bacteria 4422
597 Ga0237817_10387 3300030083 Bacteria 7583
598 Ga0237817_10388 3300030083 Bacteria 7579
599 Ga0268256_1003167 3300030500 Bacteria 7656
600 Ga0265330_10000360 3300031235 Bacteria 32097
601 Ga0265330_10000493 3300031235 Bacteria 26360
602 Ga0265330_10023875 3300031235 Bacteria 2774
603 Ga0265330_10032150 3300031235 Bacteria 2351
604 Ga0265330_10059344 3300031235 Bacteria 1666
605 Ga0265332_10018072 3300031238 Bacteria 3108
606 Ga0265328_10003745 3300031239 Bacteria 6702
607 Ga0265328_10024712 3300031239 Bacteria 2267
608 Ga0265320_10003774 3300031240 Bacteria 10076
609 Ga0265320_10006313 3300031240 Bacteria 7487
610 Ga0265320_10035339 3300031240 Bacteria 2534
611 Ga0265325_10000499 3300031241 Bacteria 28359
612 Ga0265325_10002318 3300031241 Bacteria 12919
613 Ga0265325_10007947 3300031241 Bacteria 6302
614 Ga0265325_10063228 3300031241 Bacteria 1873
615 Ga0265329_10008315 3300031242 Bacteria 3943
616 Ga0265340_10072632 3300031247 Bacteria 1629
617 Ga0265339_10000641 3300031249 Bacteria 27051
618 Ga0265339_10006179 3300031249 Bacteria 7885
619 Ga0265339_10008924 3300031249 Bacteria 6343
620 Ga0265339_10015445 3300031249 Bacteria 4576
621 Ga0265339_10080699 3300031249 Bacteria 1720
622 Ga0265331_10001584 3300031250 Bacteria 16638
623 Ga0265331_10001596 3300031250 Bacteria 16565
624 Ga0265331_10060151 3300031250 Bacteria 1795
625 Ga0265327_10001402 3300031251 Bacteria 30708
626 Ga0265327_10002240 3300031251 Bacteria 20965
627 Ga0265316_10000261 3300031344 Bacteria 60207
628 Ga0265316_10001317 3300031344 Bacteria 26719
629 Ga0265316_10001520 3300031344 Bacteria 24843
630 Ga0265316_10007557 3300031344 Bacteria 10228
631 Ga0265316_10011302 3300031344 Bacteria 8064
632 Ga0265316_10034727 3300031344 Bacteria 4094
633 Ga0265316_10054398 3300031344 Bacteria 3134
634 Ga0265316_10061949 3300031344 Bacteria 2904
635 Ga0265316_10065552 3300031344 Bacteria 2812
636 Ga0265316_10075722 3300031344 Bacteria 2587
637 Ga0265316_10084063 3300031344 Unclassified 2438
638 Ga0265316_10173157 3300031344 Bacteria 1609
639 Ga0265316_10176211 3300031344 Bacteria 1593
640 Ga0307408_100000053 3300031548 Bacteria 147370
641 Ga0307408_100025638 3300031548 Bacteria 4039
642 Ga0307408_100137120 3300031548 Bacteria 1916
643 Ga0307408_100183067 3300031548 Bacteria 1682
644 Ga0307408_100242868 3300031548 Bacteria 1481
645 Ga0265313_10001966 3300031595 Bacteria 18585
646 Ga0265313_10003001 3300031595 Bacteria 14041
647 Ga0265313_10009938 3300031595 Bacteria 6106
648 Ga0265313_10010937 3300031595 Bacteria 5686
649 Ga0265313_10042141 3300031595 Bacteria 2244
650 Ga0307508_10000200 3300031616 Bacteria 71996
651 Ga0265314_10000619 3300031711 Bacteria 43744
652 Ga0265314_10006307 3300031711 Bacteria 10518
653 Ga0265314_10006437 3300031711 Bacteria 10399
654 Ga0265314_10015143 3300031711 Bacteria 6132
655 Ga0265314_10015603 3300031711 Bacteria 6022
656 Ga0265314_10077158 3300031711 Bacteria 2211
657 Ga0265314_10106393 3300031711 Bacteria 1792
658 Ga0265342_10001454 3300031712 Bacteria 22057
659 Ga0265342_10005938 3300031712 Bacteria 9191
660 Ga0265342_10022815 3300031712 Bacteria 3973
661 Ga0265342_10043557 3300031712 Bacteria 2708
662 Ga0265342_10069259 3300031712 Bacteria 2060
663 Ga0307405_10066678 3300031731 Bacteria 2296
664 Ga0307413_10010520 3300031824 Bacteria 4493
665 Ga0307410_10000005 3300031852 Bacteria 100475
666 Ga0307412_10038897 3300031911 Bacteria 3067
667 Ga0307409_100000065 3300031995 Bacteria 38569
668 Ga0307409_100002768 3300031995 Bacteria 9268
669 Ga0307409_100102615 3300031995 Bacteria 2377
670 Ga0307409_100157951 3300031995 Bacteria 1979
671 Ga0307416_100000056 3300032002 Bacteria 107434
672 Ga0307416_100051970 3300032002 Bacteria 3278
673 Ga0373944_0027414 3300035089 Bacteria 1689
674 Ga0373951_0000493 3300035091 Bacteria 11200
675 Ga0373923_0079616 3300035111 Bacteria 1419
676 Ga0373954_0005972 3300035118 Bacteria 5296
677 Ga0316574_0041346 3300035398 Bacteria 2842
678 Ga0373935_0022029 3300035692 Bacteria 3902
679 Ga0373927_0006011 3300035695 Bacteria 8314
680 Ga0373927_0042692 3300035695 Bacteria 2938
681 Ga0373927_0065312 3300035695 Bacteria 2354
682 Ga0373933_0036982 3300035724 Bacteria 2861
683 Ga0373933_0060679 3300035724 Bacteria 2280
684 Ga0373937_0006149 3300036401 Bacteria 10338
685 Ga0373937_0027162 3300036401 Bacteria 5174
686 Ga0373937_0092704 3300036401 Bacteria 2800
687 Ga0373937_0317120 3300036401 Bacteria 1475
688 Ga0373925_0007871 3300037068 Bacteria 7763
689 Ga0373925_0038220 3300037068 Bacteria 3548
690 Ga0395900_0046266 3300037418 Bacteria 4481
691 Ga0395900_0100069 3300037418 Bacteria 2978
692 Ga0395898_0196266 3300037466 Bacteria 1928
693 Ga0395905_0000018 3300037471 Bacteria 369321
694 Ga0436364_0354295 3300037853 Bacteria 7133
695 Ga0436364_0789845 3300037853 Bacteria 12361
696 Ga0436364_0813613 3300037853 Bacteria 13974
697 Ga0436364_0934971 3300037853 Bacteria 5948
698 Ga0436364_0940248 3300037853 Bacteria 592364
699 Ga0400490_35416 3300038726 Bacteria 1488
700 Ga0400488_56663 3300038741 Bacteria 2274
701 Ga0436365_0575117 3300039437 Bacteria 3595
702 Ga0436365_0814324 3300039437 Bacteria 3297
703 Ga0436361_0761235 3300039447 Bacteria 90297
704 Ga0436363_0504372 3300039450 Bacteria 1866
705 Ga0436363_1188040 3300039450 Bacteria 1800
706 Ga0451795_0810233 3300041456 Bacteria 1845
707 Ga0451577_0000003 3300042876 Bacteria 921850
708 Ga0451577_0000441 3300042876 Bacteria 73410
709 Ga0451577_0001831 3300042876 Bacteria 27134
710 Ga0451577_0003471 3300042876 Bacteria 17534
711 Ga0451577_0092642 3300042876 Bacteria 2698
712 Ga0451577_0097365 3300042876 Bacteria 2627
713 Ga0451577_0198903 3300042876 Bacteria 1809
714 Ga0453683_0000046 3300044673 Bacteria 208120
715 Ga0453683_0024159 3300044673 Bacteria 3870
716 Ga0466963_0025853 3300044694 Bacteria 3748
717 Ga0453684_0000018 3300044712 Bacteria 921850
718 Ga0453684_0000177 3300044712 Bacteria 282969
719 Ga0453684_0000289 3300044712 Bacteria 215476
720 Ga0453684_0000777 3300044712 Bacteria 110019
721 Ga0453684_0003576 3300044712 Bacteria 34694
722 Ga0453684_0005807 3300044712 Bacteria 24052
723 Ga0453684_0042656 3300044712 Bacteria 6114
724 Ga0453684_0100245 3300044712 Bacteria 3545
725 Ga0453684_0247526 3300044712 Unclassified 2049
726 Ga0466970_0062205 3300044765 Bacteria 2001
727 Ga0466957_0001754 3300044842 Bacteria 11410
728 Ga0466959_0007352 3300045049 Bacteria 7722
729 Ga0466959_0075618 3300045049 Bacteria 2433
730 Ga0451576_0000155 3300045051 Bacteria 175508
731 Ga0451576_0000750 3300045051 Bacteria 64788
732 Ga0451576_0001658 3300045051 Bacteria 36968
733 Ga0451576_0002345 3300045051 Bacteria 28553
734 Ga0451576_0005816 3300045051 Bacteria 15329
735 Ga0451576_0006059 3300045051 Bacteria 14928
736 Ga0451576_0007300 3300045051 Bacteria 13276
737 Ga0451576_0072829 3300045051 Bacteria 3575
738 Ga0466958_0118954 3300045836 Bacteria 1653
739 Ga0466967_0040789 3300045976 Bacteria 3998
740 Ga0466967_0174638 3300045976 Bacteria 2024
741 Ga0495603_0028008 3300046455 Bacteria 3398
742 Ga0495629_0038355 3300046459 Bacteria 3375
743 Ga0495629_0066786 3300046459 Bacteria 2510
744 Ga0495653_0012166 3300046463 Bacteria 7023
745 Ga0495650_0000009 3300046471 Bacteria 653845
746 Ga0495580_0060173 3300046472 Unclassified 2669
747 Ga0495580_0063557 3300046472 Bacteria 2588
748 Ga0495580_0098660 3300046472 Bacteria 2032
749 Ga0495582_0000322 3300046473 Bacteria 26167
750 Ga0495639_0012090 3300046475 Bacteria 3721
751 Ga0495662_0034536 3300046476 Bacteria 2440
752 Ga0495664_0032374 3300046477 Bacteria 3067
753 Ga0495664_0043333 3300046477 Bacteria 2666
754 Ga0495584_0103448 3300046491 Bacteria 1440
755 Ga0495585_0007208 3300046492 Bacteria 6832
756 Ga0495585_0038960 3300046492 Bacteria 2674
757 Ga0495594_0000195 3300046499 Bacteria 29588
758 Ga0495594_0000602 3300046499 Bacteria 18547
759 Ga0495583_0029315 3300046506 Bacteria 2694
760 Ga0495606_0034413 3300046507 Bacteria 3479
761 Ga0495630_0125615 3300046517 Bacteria 1947
762 Ga0495630_0125932 3300046517 Bacteria 1944
763 Ga0495643_0052647 3300046522 Bacteria 2185
764 Ga0495644_0000634 3300046523 Bacteria 14670
765 Ga0495666_0045148 3300046526 Bacteria 2126
766 Ga0495666_0070894 3300046526 Bacteria 1657
767 Ga0495652_0013321 3300046529 Bacteria 7400
768 Ga0495640_0003434 3300046533 Bacteria 12748
769 Ga0495586_0001143 3300046535 Bacteria 14883
770 Ga0495645_0004247 3300046543 Bacteria 9785
771 Ga0495645_0035574 3300046543 Bacteria 3630
772 Ga0495645_0048818 3300046543 Bacteria 3082
773 Ga0495645_0151014 3300046543 Bacteria 1614
774 Ga0495645_0196388 3300046543 Bacteria 1372
775 Ga0495622_0010209 3300046557 Bacteria 4340
776 Ga0495622_0057644 3300046557 Bacteria 1800
777 Ga0495667_0002832 3300046559 Bacteria 11594
778 Ga0495667_0098530 3300046559 Bacteria 1893
779 Ga0495634_0010768 3300046642 Bacteria 6691
780 Ga0495611_0009661 3300046648 Bacteria 4076
781 Ga0495625_0000733 3300046660 Bacteria 45957
782 Ga0495635_0002061 3300046663 Bacteria 13615
783 Ga0495635_0062150 3300046663 Bacteria 2564
784 Ga0495635_0148673 3300046663 Bacteria 1595
785 Ga0495599_0022968 3300046678 Bacteria 3896
786 Ga0495623_0025212 3300046679 Bacteria 3830
787 Ga0495623_0136877 3300046679 Bacteria 1461
788 Ga0495646_0019922 3300046680 Bacteria 4241
789 Ga0495658_0017532 3300046683 Bacteria 3701
790 Ga0495669_0002191 3300046684 Bacteria 8014
791 Ga0495669_0012364 3300046684 Bacteria 3633
792 Ga0495669_0034117 3300046684 Bacteria 2243
793 Ga0495613_0000556 3300046689 Bacteria 30635
794 Ga0495613_0037733 3300046689 Bacteria 3582
795 Ga0495624_0064286 3300046690 Bacteria 2293
796 Ga0495649_0064721 3300046694 Bacteria 1963
797 Ga0495600_0000182 3300046809 Bacteria 36962
798 Ga0495600_0044757 3300046809 Bacteria 2887
799 Ga0495600_0132714 3300046809 Bacteria 1619
800 Ga0495660_0085798 3300046810 Bacteria 1644
801 Ga0495604_0001256 3300047317 Bacteria 20748
802 Ga0495604_0031479 3300047317 Bacteria 4207
803 Ga0495674_0012501 3300047319 Bacteria 7997
804 Ga0495674_0021236 3300047319 Bacteria 6007
805 Ga0495674_0040231 3300047319 Bacteria 4183
806 Ga0495674_0255742 3300047319 Bacteria 1440
807 Ga0495674_0256653 3300047319 Bacteria 1437
808 Ga0495676_0001269 3300047321 Bacteria 21668
809 Ga0495676_0076192 3300047321 Bacteria 2562
810 Ga0495676_0203742 3300047321 Bacteria 1373
811 Ga0495680_0085508 3300047322 Bacteria 2375
812 Ga0495680_0098511 3300047322 Bacteria 2181
813 Ga0495680_0101489 3300047322 Bacteria 2143
814 Ga0495687_036317 3300047443 Bacteria 2206
815 Ga0495675_0043302 3300047444 Bacteria 2868
816 Ga0495675_0123065 3300047444 Bacteria 1615
817 Ga0495684_0008806 3300047471 Bacteria 7800
818 Ga0495684_0012298 3300047471 Bacteria 6601
819 Ga0495684_0025122 3300047471 Bacteria 4581
820 Ga0495684_0036604 3300047471 Bacteria 3762
821 Ga0495686_0000027 3300047472 Bacteria 382657
822 Ga0495686_0002556 3300047472 Bacteria 16987
823 Ga0495686_0007360 3300047472 Bacteria 8258
824 Ga0495686_0014479 3300047472 Bacteria 5425
825 Ga0495593_0046597 3300047673 Bacteria 2309
826 Ga0495602_0001165 3300048088 Bacteria 25733
827 Ga0495602_0117830 3300048088 Bacteria 2143
828 Ga0495602_0118345 3300048088 Bacteria 2137
829 Ga0495614_0000054 3300048089 Bacteria 35520
830 Ga0495614_0004811 3300048089 Bacteria 6097
831 Ga0495626_0052099 3300048091 Bacteria 1887
832 Ga0496100_0002146 3300048903 Bacteria 9920
833 Ga0496102_0083577 3300048905 Bacteria 2946
834 Ga0496102_0179777 3300048905 Bacteria 1993
835 Ga0496104_0000014 3300048907 Bacteria 377972
836 Ga0496104_0006839 3300048907 Bacteria 10052
837 Ga0496104_0069479 3300048907 Bacteria 3348
838 Ga0496104_0101599 3300048907 Bacteria 2753
839 Ga0496106_0001861 3300048909 Bacteria 15792
840 Ga0496107_0003952 3300048910 Bacteria 9971
841 Ga0496108_0003539 3300048911 Bacteria 12521
842 Ga0496109_0097751 3300048912 Bacteria 2721
843 Ga0496109_0222797 3300048912 Bacteria 1774
844 Ga0496109_0245748 3300048912 Bacteria 1685
845 Ga0496110_0002800 3300048913 Bacteria 13164
846 Ga0496110_0016403 3300048913 Bacteria 6184
847 Ga0496110_0091482 3300048913 Bacteria 2721
848 Ga0496110_0137119 3300048913 Bacteria 2212
849 Ga0496111_0022000 3300048914 Bacteria 4458
850 Ga0496111_0067810 3300048914 Bacteria 2592
851 Ga0496112_0099546 3300048915 Bacteria 2877
852 Ga0496113_0066963 3300048916 Bacteria 2721
853 Ga0496114_0034612 3300048917 Bacteria 4169
854 Ga0496115_0004899 3300048918 Bacteria 9718
855 Ga0496115_0031849 3300048918 Bacteria 4157
856 Ga0496116_0007169 3300048919 Bacteria 9961
857 Ga0496116_0020634 3300048919 Bacteria 4998
858 Ga0496117_0015981 3300048920 Bacteria 6358
859 Ga0496119_0007342 3300048922 Bacteria 9965
860 Ga0496122_0003646 3300048925 Bacteria 20021
861 Ga0496122_0062631 3300048925 Bacteria 2721
862 Ga0496123_0007878 3300048926 Bacteria 9902
863 Ga0496124_0002395 3300048927 Bacteria 24663
864 Ga0496124_0038131 3300048927 Bacteria 4174
865 Ga0496125_0001868 3300048928 Bacteria 28928
866 Ga0496125_0004602 3300048928 Bacteria 15766
867 Ga0496126_0000074 3300048929 Bacteria 235643
868 Ga0496126_0000170 3300048929 Bacteria 148961
869 Ga0496126_0004515 3300048929 Bacteria 16577
870 Ga0496126_0073066 3300048929 Bacteria 3050
871 Ga0496126_0147231 3300048929 Bacteria 2021
872 Ga0496126_0177017 3300048929 Bacteria 1814
873 Ga0501312_000472 3300049528 Bacteria 3257
874 Ga0501315_002234 3300049531 Bacteria 1789
875 Ga0501316_001114 3300049532 Bacteria 2181
876 Ga0501321_000060 3300049537 Bacteria 4832
877 Ga0501031_0082766 3300049568 Bacteria 2092
878 Ga0501032_0001445 3300049569 Bacteria 18880
879 Ga0501032_0019100 3300049569 Bacteria 4796
880 Ga0501032_0075608 3300049569 Bacteria 2243
881 Ga0501032_0083520 3300049569 Bacteria 2124
882 Ga0501033_0002053 3300049570 Bacteria 17511
883 Ga0501034_0006213 3300049571 Bacteria 12860
884 Ga0501034_0048025 3300049571 Bacteria 4308
885 Ga0501036_0002227 3300049572 Bacteria 15163
886 Ga0501036_0044001 3300049572 Bacteria 3781
887 Ga0501037_0040681 3300049573 Bacteria 3420
888 Ga0501037_0059301 3300049573 Bacteria 2792
889 Ga0501037_0060427 3300049573 Bacteria 2764
890 Ga0501037_0109573 3300049573 Bacteria 1990
891 Ga0501038_0000072 3300049574 Bacteria 83742
892 Ga0501038_0064137 3300049574 Bacteria 3133
893 Ga0501039_0000098 3300049575 Bacteria 60633
894 Ga0501039_0012182 3300049575 Bacteria 6555
895 Ga0501039_0107364 3300049575 Bacteria 2181
896 Ga0501039_0127932 3300049575 Bacteria 1993
897 Ga0501041_0075608 3300049577 Bacteria 2071
898 Ga0501042_0044093 3300049578 Bacteria 3177
899 Ga0501043_0002457 3300049579 Bacteria 15672
900 Ga0501043_0167981 3300049579 Bacteria 1712
901 Ga0501046_0000811 3300049580 Bacteria 30402
902 Ga0501047_0001095 3300049581 Bacteria 26961
903 Ga0501047_0013881 3300049581 Bacteria 7650
904 Ga0501047_0093556 3300049581 Bacteria 2885
905 Ga0501048_0007184 3300049582 Bacteria 8457
906 Ga0501048_0077554 3300049582 Bacteria 2345
907 Ga0501048_0084042 3300049582 Bacteria 2245
908 Ga0501070_0034306 3300049586 Bacteria 4243
909 Ga0501070_0072319 3300049586 Bacteria 2855
910 Ga0501073_0007141 3300049589 Bacteria 8319
911 Ga0501075_0049421 3300049591 Bacteria 3161
912 Ga0501076_0085342 3300049592 Bacteria 2537
913 Ga0501076_0113489 3300049592 Bacteria 2192
914 Ga0501076_0189080 3300049592 Bacteria 1680
915 Ga0501077_0031752 3300049593 Bacteria 3360
916 Ga0501217_002096 3300049661 Bacteria 3869
917 Ga0501217_004704 3300049661 Bacteria 2815
918 Ga0501243_002898 3300049675 Bacteria 2526
919 Ga0501249_005545 3300049679 Bacteria 2580
920 Ga0501080_0021039 3300049742 Bacteria 6038
921 Ga0501080_0106155 3300049742 Bacteria 2603
922 Ga0501266_004337 3300049763 Bacteria 1757
923 Ga0501283_001920 3300049779 Bacteria 2686
924 Ga0501035_0006984 3300049822 Bacteria 10546
925 Ga0501035_0016439 3300049822 Bacteria 6825
926 Ga0501035_0037906 3300049822 Bacteria 4364
927 Ga0501035_0333790 3300049822 Bacteria 1272
928 Ga0501044_0000216 3300049823 Bacteria 73383
929 Ga0501044_0002307 3300049823 Bacteria 21740
930 Ga0501044_0008034 3300049823 Bacteria 11591
931 Ga0501044_0242950 3300049823 Bacteria 1744
932 nmdc:mga05p37_200480_c1 3300050507 Bacteria 2417
933 nmdc:mga09592_179739_c1 3300050508 Bacteria 1830
934 nmdc:mga08y16_1504_c1 3300050511 Bacteria 23455
935 nmdc:mga0n895_11291_c1 3300050512 Bacteria 7960
936 nmdc:mga0n895_15059_c1 3300050512 Bacteria 7047
937 nmdc:mga0rr50_17933_c1 3300050513 Bacteria 4741
938 nmdc:mga0rr50_31517_c1 3300050513 Bacteria 3766
939 nmdc:mga08x19_93618_c1 3300050514 Bacteria 1986
940 nmdc:mga08x19_97828_c1 3300050514 Bacteria 1943
941 nmdc:mga0a205_18482_c1 3300050515 Bacteria 6557
942 nmdc:mga0a205_2306_c1 3300050515 Bacteria 16848
943 Ga0495601_0084394 3300053077 Bacteria 2040
944 Ga0500651_0000010 3300053093 Bacteria 253038
945 Ga0500595_000053 3300053119 Bacteria 87978
946 Ga0500595_003237 3300053119 Bacteria 7684
947 Ga0500573_0084185 3300053140 Bacteria 1805
948 Ga0587067_001235 3300059640 Bacteria 2701
949 Ga0501082_0088886 3300060353 Bacteria 2667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046543 Ga0495645_0196388 Ga0495645_0196388_304_1350 325
2 3300046476 Ga0495662_0034536 Ga0495662_0034536_1288_2388 328
3 3300047322 Ga0495680_0085508 Ga0495680_0085508_1153_2253 328
4 3300039450 Ga0436363_1188040 Ga0436363_1188040_699_1766 329
5 3300046679 Ga0495623_0136877 Ga0495623_0136877_367_1446 329
6 3300048915 Ga0496112_0099546 Ga0496112_0099546_1804_2856 330
7 3300049575 Ga0501039_0107364 Ga0501039_0107364_1077_2138 332
8 3300049822 Ga0501035_0333790 Ga0501035_0333790_17_1204 342
9 3300046683 Ga0495658_0017532 Ga0495658_0017532_2630_3685 344
10 3300044712 Ga0453684_0247526 Ga0453684_0247526_823_2022 346
11 3300060353 Ga0501082_0088886 Ga0501082_0088886_1166_2440 353
12 3300046491 Ga0495584_0103448 Ga0495584_0103448_139_1395 354
13 3300046517 Ga0495630_0125615 Ga0495630_0125615_659_1918 354
14 3300025928 Ga0207700_10189840 Ga0207700_101898402 357
15 3300042876 Ga0451577_0001831 Ga0451577_0001831_6773_8095 358
16 3300044673 Ga0453683_0024159 Ga0453683_0024159_881_2167 358
17 3300044712 Ga0453684_0000289 Ga0453684_0000289_21883_23205 358
18 3300045051 Ga0451576_0006059 Ga0451576_0006059_4326_5648 358
19 3300013307 Ga0157372_10325323 Ga0157372_103253232 359
20 3300003320 rootH2_10106356 rootH2_101063565 360
21 3300037068 Ga0373925_0038220 Ga0373925_0038220_2278_3531 360
22 3300046684 Ga0495669_0012364 Ga0495669_0012364_1050_2369 360
23 3300047444 Ga0495675_0123065 Ga0495675_0123065_12_1256 360
24 3300047472 Ga0495686_0014479 Ga0495686_0014479_3434_4744 361
25 3300049679 Ga0501249_005545 Ga0501249_005545_1025_2347 361
26 3300021388 Ga0213875_10089587 Ga0213875_100895871 362
27 3300037853 Ga0436364_0934971 Ga0436364_0934971_117_1403 362
28 3300046472 Ga0495580_0060173 Ga0495580_0060173_1158_2444 362
29 3300003187 JGI25151J46595_10001224 JGI25151J46595_1000122416 363
30 3300003578 Ga0006562J51391_1000455 Ga0006562J51391_10004557 363
31 3300025294 Ga0209025_1002628 Ga0209025_100262816 363
32 3300006847 Ga0075431_100003197 Ga0075431_1000031977 364
33 3300025944 Ga0207661_10092457 Ga0207661_100924572 364
34 3300026116 Ga0207674_10028421 Ga0207674_100284212 364
35 3300046543 Ga0495645_0151014 Ga0495645_0151014_206_1480 364
36 3300046684 Ga0495669_0034117 Ga0495669_0034117_113_1405 364
37 3300048088 Ga0495602_0001165 Ga0495602_0001165_5175_6449 364
38 3300048912 Ga0496109_0222797 Ga0496109_0222797_38_1330 364
39 3300049571 Ga0501034_0048025 Ga0501034_0048025_930_2204 364
40 3300049573 Ga0501037_0040681 Ga0501037_0040681_1079_2353 364
41 3300049574 Ga0501038_0064137 Ga0501038_0064137_522_1796 364
42 3300049586 Ga0501070_0034306 Ga0501070_0034306_1174_2448 364
43 3300049822 Ga0501035_0016439 Ga0501035_0016439_2842_4116 364
44 3300003187 JGI25151J46595_10018501 JGI25151J46595_100185014 365
45 3300003316 rootH1_10011021 rootH1_1001102113 365
46 3300003322 rootL2_10077587 rootL2_1007758713 365
47 3300003578 Ga0006562J51391_1000784 Ga0006562J51391_10007847 365
48 3300003758 Ga0055532_1004227 Ga0055532_10042271 365
49 3300003790 Ga0055528_1011818 Ga0055528_10118184 365
50 3300005329 Ga0070683_100342349 Ga0070683_1003423491 365
51 3300005331 Ga0070670_100071794 Ga0070670_1000717943 365
52 3300005355 Ga0070671_100023233 Ga0070671_1000232334 365
53 3300005543 Ga0070672_100069565 Ga0070672_1000695654 365
54 3300005614 Ga0068856_100121634 Ga0068856_1001216342 365
55 3300009098 Ga0105245_10008585 Ga0105245_100085857 365
56 3300009101 Ga0105247_10031365 Ga0105247_100313653 365
57 3300011119 Ga0105246_10005143 Ga0105246_100051431 365
58 3300013297 Ga0157378_10020719 Ga0157378_100207196 365
59 3300025229 Ga0209147_104161 Ga0209147_1041612 365
60 3300025273 Ga0209673_1010373 Ga0209673_10103734 365
61 3300025711 Ga0207696_1002864 Ga0207696_10028648 365
62 3300025735 Ga0207713_1003390 Ga0207713_10033903 365
63 3300025935 Ga0207709_10007141 Ga0207709_100071413 365
64 3300025940 Ga0207691_10089686 Ga0207691_100896862 365
65 3300044765 Ga0466970_0062205 Ga0466970_0062205_335_1612 365
66 3300046492 Ga0495585_0007208 Ga0495585_0007208_4995_6272 365
67 3300047321 Ga0495676_0076192 Ga0495676_0076192_84_1361 365
68 3300048903 Ga0496100_0002146 Ga0496100_0002146_371_1648 365
69 3300048907 Ga0496104_0006839 Ga0496104_0006839_409_1686 365
70 3300048909 Ga0496106_0001861 Ga0496106_0001861_6188_7465 365
71 3300048910 Ga0496107_0003952 Ga0496107_0003952_386_1663 365
72 3300048911 Ga0496108_0003539 Ga0496108_0003539_2956_4233 365
73 3300048912 Ga0496109_0097751 Ga0496109_0097751_1074_2351 365
74 3300048913 Ga0496110_0091482 Ga0496110_0091482_1074_2351 365
75 3300048914 Ga0496111_0022000 Ga0496111_0022000_856_2133 365
76 3300048916 Ga0496113_0066963 Ga0496113_0066963_371_1648 365
77 3300048919 Ga0496116_0007169 Ga0496116_0007169_8314_9591 365
78 3300048920 Ga0496117_0015981 Ga0496117_0015981_1156_2433 365
79 3300048922 Ga0496119_0007342 Ga0496119_0007342_8318_9595 365
80 3300048925 Ga0496122_0062631 Ga0496122_0062631_371_1648 365
81 3300048927 Ga0496124_0038131 Ga0496124_0038131_1831_3108 365
82 3300048928 Ga0496125_0004602 Ga0496125_0004602_6188_7465 365
83 3300048929 Ga0496126_0147231 Ga0496126_0147231_341_1618 365
84 3300049528 Ga0501312_000472 Ga0501312_000472_1873_3150 365
85 3300005334 Ga0068869_100000252 Ga0068869_10000025211 366
86 3300006028 Ga0070717_10202269 Ga0070717_102022691 366
87 3300006237 Ga0097621_100011349 Ga0097621_1000113494 366
88 3300025942 Ga0207689_10000146 Ga0207689_1000014611 366
89 3300026089 Ga0207648_10005638 Ga0207648_1000563810 366
90 3300003758 Ga0055532_1001494 Ga0055532_10014943 367
91 3300005985 Ga0081539_10015061 Ga0081539_100150613 367
92 3300025229 Ga0209147_100136 Ga0209147_1001367 367
93 3300031235 Ga0265330_10032150 Ga0265330_100321502 367
94 3300031344 Ga0265316_10061949 Ga0265316_100619492 367
95 3300045051 Ga0451576_0000750 Ga0451576_0000750_2763_4034 367
96 3300047319 Ga0495674_0255742 Ga0495674_0255742_35_1312 367
97 3300047472 Ga0495686_0007360 Ga0495686_0007360_2337_3692 367
98 3300048919 Ga0496116_0020634 Ga0496116_0020634_829_2109 367
99 3300048925 Ga0496122_0003646 Ga0496122_0003646_17078_18358 367
100 3300048926 Ga0496123_0007878 Ga0496123_0007878_7930_9210 367
101 3300048927 Ga0496124_0002395 Ga0496124_0002395_8661_9941 367
102 3300048928 Ga0496125_0001868 Ga0496125_0001868_8874_10154 367
103 3300002987 JGI25159J45721_1011665 JGI25159J45721_10116651 368
104 3300003758 Ga0055532_1000591 Ga0055532_10005918 368
105 3300005353 Ga0070669_100034646 Ga0070669_1000346463 368
106 3300005354 Ga0070675_100135562 Ga0070675_1001355623 368
107 3300005444 Ga0070694_100027042 Ga0070694_1000270422 368
108 3300005617 Ga0068859_100025707 Ga0068859_1000257073 368
109 3300006028 Ga0070717_10103227 Ga0070717_101032272 368
110 3300006931 Ga0097620_100025707 Ga0097620_1000257074 368
111 3300009011 Ga0105251_10027392 Ga0105251_100273923 368
112 3300009092 Ga0105250_10049827 Ga0105250_100498272 368
113 3300009092 Ga0105250_10051831 Ga0105250_100518311 368
114 3300009147 Ga0114129_10043727 Ga0114129_100437275 368
115 3300009148 Ga0105243_10133339 Ga0105243_101333392 368
116 3300009553 Ga0105249_10002693 Ga0105249_100026935 368
117 3300009553 Ga0105249_10117367 Ga0105249_101173672 368
118 3300011119 Ga0105246_10166176 Ga0105246_101661761 368
119 3300025229 Ga0209147_100757 Ga0209147_10075712 368
120 3300025229 Ga0209147_100998 Ga0209147_1009985 368
121 3300025284 Ga0209130_1003752 Ga0209130_10037527 368
122 3300025284 Ga0209130_1009646 Ga0209130_10096461 368
123 3300025294 Ga0209025_1004926 Ga0209025_10049267 368
124 3300025294 Ga0209025_1033719 Ga0209025_10337192 368
125 3300025711 Ga0207696_1003086 Ga0207696_10030863 368
126 3300025711 Ga0207696_1030654 Ga0207696_10306542 368
127 3300025728 Ga0207655_1016663 Ga0207655_10166635 368
128 3300025735 Ga0207713_1027077 Ga0207713_10270774 368
129 3300025909 Ga0207705_10128462 Ga0207705_101284622 368
130 3300025923 Ga0207681_10074789 Ga0207681_100747894 368
131 3300025941 Ga0207711_10008512 Ga0207711_100085122 368
132 3300030083 Ga0237817_10387 Ga0237817_103878 368
133 3300030083 Ga0237817_10388 Ga0237817_103887 368
134 3300031616 Ga0307508_10000200 Ga0307508_1000020022 368
135 3300035091 Ga0373951_0000493 Ga0373951_0000493_4151_5440 368
136 3300035695 Ga0373927_0006011 Ga0373927_0006011_1367_2641 368
137 3300045976 Ga0466967_0040789 Ga0466967_0040789_1194_2468 368
138 3300046543 Ga0495645_0048818 Ga0495645_0048818_1598_2872 368
139 3300046663 Ga0495635_0148673 Ga0495635_0148673_203_1477 368
140 3300047319 Ga0495674_0021236 Ga0495674_0021236_4624_5898 368
141 3300047322 Ga0495680_0098511 Ga0495680_0098511_206_1480 368
142 3300047444 Ga0495675_0043302 Ga0495675_0043302_1155_2429 368
143 3300047471 Ga0495684_0012298 Ga0495684_0012298_1661_2935 368
144 iso_pu_bacteria 2786546940 2788436532 368
145 3300005330 Ga0070690_100004238 Ga0070690_1000042387 369
146 3300005340 Ga0070689_100000051 Ga0070689_10000005112 369
147 3300005343 Ga0070687_100004040 Ga0070687_1000040406 369
148 3300005365 Ga0070688_100000469 Ga0070688_10000046910 369
149 3300005438 Ga0070701_10000660 Ga0070701_100006609 369
150 3300005459 Ga0068867_100016358 Ga0068867_1000163582 369
151 3300005466 Ga0070685_10000319 Ga0070685_1000031922 369
152 3300005471 Ga0070698_100021351 Ga0070698_1000213515 369
153 3300005544 Ga0070686_100000074 Ga0070686_10000007459 369
154 3300005563 Ga0068855_100074975 Ga0068855_1000749754 369
155 3300005617 Ga0068859_100000794 Ga0068859_1000007943 369
156 3300006931 Ga0097620_100000794 Ga0097620_10000079430 369
157 3300007076 Ga0075435_100057496 Ga0075435_1000574962 369
158 3300009177 Ga0105248_10004620 Ga0105248_1000462016 369
159 3300013104 Ga0157370_10005432 Ga0157370_100054328 369
160 3300014326 Ga0157380_10003543 Ga0157380_100035438 369
161 3300014969 Ga0157376_10218818 Ga0157376_102188182 369
162 3300021388 Ga0213875_10000002 Ga0213875_10000002309 369
163 3300025904 Ga0207647_10025732 Ga0207647_100257322 369
164 3300025936 Ga0207670_10000060 Ga0207670_1000006059 369
165 3300025941 Ga0207711_10020636 Ga0207711_100206366 369
166 3300026067 Ga0207678_10009278 Ga0207678_100092786 369
167 3300026089 Ga0207648_10022269 Ga0207648_100222693 369
168 3300031548 Ga0307408_100242868 Ga0307408_1002428681 369
169 3300037418 Ga0395900_0100069 Ga0395900_0100069_480_1808 369
170 3300037853 Ga0436364_0940248 Ga0436364_0940248_533310_534581 369
171 3300042876 Ga0451577_0000003 Ga0451577_0000003_844301_845575 369
172 3300044712 Ga0453684_0000018 Ga0453684_0000018_721110_722384 369
173 3300046507 Ga0495606_0034413 Ga0495606_0034413_729_2048 369
174 3300046522 Ga0495643_0052647 Ga0495643_0052647_804_2123 369
175 3300049537 Ga0501321_000060 Ga0501321_000060_42_1322 369
176 3300050513 nmdc:mga0rr50_31517_c1 nmdc:mga0rr50_31517_c1_1363_2655 369
177 3300005327 Ga0070658_10070362 Ga0070658_100703622 370
178 3300009093 Ga0105240_10044447 Ga0105240_100444475 370
179 3300009176 Ga0105242_10033849 Ga0105242_100338495 370
180 3300021388 Ga0213875_10068647 Ga0213875_100686472 370
181 3300025909 Ga0207705_10077928 Ga0207705_100779282 370
182 3300025913 Ga0207695_10233748 Ga0207695_102337482 370
183 3300025914 Ga0207671_10118482 Ga0207671_101184822 370
184 3300026075 Ga0207708_10000616 Ga0207708_1000061614 370
185 3300027312 Ga0209371_1003461 Ga0209371_10034615 370
186 3300028800 Ga0265338_10002257 Ga0265338_1000225710 370
187 3300030500 Ga0268256_1003167 Ga0268256_10031674 370
188 3300031249 Ga0265339_10008924 Ga0265339_100089245 370
189 3300031344 Ga0265316_10007557 Ga0265316_100075575 370
190 3300031344 Ga0265316_10034727 Ga0265316_100347272 370
191 3300031711 Ga0265314_10077158 Ga0265314_100771581 370
192 3300037853 Ga0436364_0789845 Ga0436364_0789845_10707_11984 370
193 3300039437 Ga0436365_0575117 Ga0436365_0575117_271_1548 370
194 3300042876 Ga0451577_0092642 Ga0451577_0092642_1079_2365 370
195 3300045049 Ga0466959_0007352 Ga0466959_0007352_4267_5553 370
196 3300049569 Ga0501032_0075608 Ga0501032_0075608_938_2224 370
197 3300049570 Ga0501033_0002053 Ga0501033_0002053_4969_6258 370
198 3300049582 Ga0501048_0084042 Ga0501048_0084042_140_1426 370
199 3300049823 Ga0501044_0008034 Ga0501044_0008034_9428_10717 370
200 3300059640 Ga0587067_001235 Ga0587067_001235_1249_2529 370
201 3300003187 JGI25151J46595_10004028 JGI25151J46595_100040283 371
202 3300013296 Ga0157374_10356146 Ga0157374_103561461 371
203 3300025294 Ga0209025_1003350 Ga0209025_100335014 371
204 3300028563 Ga0265319_1000008 Ga0265319_1000008195 371
205 3300028563 Ga0265319_1002037 Ga0265319_10020372 371
206 3300028577 Ga0265318_10001015 Ga0265318_100010157 371
207 3300031240 Ga0265320_10003774 Ga0265320_100037748 371
208 3300031548 Ga0307408_100000053 Ga0307408_100000053103 371
209 3300031711 Ga0265314_10006437 Ga0265314_100064375 371
210 3300031852 Ga0307410_10000005 Ga0307410_1000000544 371
211 3300031995 Ga0307409_100000065 Ga0307409_10000006510 371
212 3300031995 Ga0307409_100157951 Ga0307409_1001579511 371
213 3300032002 Ga0307416_100000056 Ga0307416_10000005655 371
214 3300037471 Ga0395905_0000018 Ga0395905_0000018_70299_71672 371
215 3300044673 Ga0453683_0000046 Ga0453683_0000046_134935_136209 371
216 3300044712 Ga0453684_0042656 Ga0453684_0042656_1558_2826 371
217 3300045051 Ga0451576_0000155 Ga0451576_0000155_28255_29523 371
218 3300045051 Ga0451576_0002345 Ga0451576_0002345_15449_16717 371
219 3300045051 Ga0451576_0007300 Ga0451576_0007300_3589_4863 371
220 3300046471 Ga0495650_0000009 Ga0495650_0000009_516238_517563 371
221 3300047321 Ga0495676_0203742 Ga0495676_0203742_14_1291 371
222 3300047443 Ga0495687_036317 Ga0495687_036317_263_1582 371
223 3300048091 Ga0495626_0052099 Ga0495626_0052099_360_1640 371
224 3300049581 Ga0501047_0013881 Ga0501047_0013881_3426_4694 371
225 3300053093 Ga0500651_0000010 Ga0500651_0000010_88824_90149 371
226 3300005436 Ga0070713_100090819 Ga0070713_1000908192 372
227 3300005546 Ga0070696_100103796 Ga0070696_1001037963 372
228 3300025294 Ga0209025_1010384 Ga0209025_10103841 372
229 3300025294 Ga0209025_1043626 Ga0209025_10436262 372
230 3300026121 Ga0207683_10138554 Ga0207683_101385541 372
231 3300028558 Ga0265326_10027021 Ga0265326_100270212 372
232 3300028563 Ga0265319_1014398 Ga0265319_10143983 372
233 3300028573 Ga0265334_10001450 Ga0265334_100014503 372
234 3300028577 Ga0265318_10000005 Ga0265318_10000005196 372
235 3300028577 Ga0265318_10000487 Ga0265318_1000048712 372
236 3300028653 Ga0265323_10005852 Ga0265323_100058521 372
237 3300028653 Ga0265323_10016282 Ga0265323_100162822 372
238 3300028654 Ga0265322_10023361 Ga0265322_100233612 372
239 3300028666 Ga0265336_10002817 Ga0265336_100028176 372
240 3300028800 Ga0265338_10002938 Ga0265338_1000293811 372
241 3300029957 Ga0265324_10000227 Ga0265324_1000022731 372
242 3300029957 Ga0265324_10004096 Ga0265324_100040964 372
243 3300029957 Ga0265324_10007470 Ga0265324_100074702 372
244 3300031235 Ga0265330_10023875 Ga0265330_100238752 372
245 3300031239 Ga0265328_10024712 Ga0265328_100247122 372
246 3300031240 Ga0265320_10035339 Ga0265320_100353392 372
247 3300031247 Ga0265340_10072632 Ga0265340_100726322 372
248 3300031250 Ga0265331_10001596 Ga0265331_100015965 372
249 3300031250 Ga0265331_10060151 Ga0265331_100601511 372
250 3300031251 Ga0265327_10001402 Ga0265327_100014024 372
251 3300031251 Ga0265327_10002240 Ga0265327_100022406 372
252 3300031344 Ga0265316_10054398 Ga0265316_100543981 372
253 3300031344 Ga0265316_10084063 Ga0265316_100840632 372
254 3300031344 Ga0265316_10173157 Ga0265316_101731572 372
255 3300031548 Ga0307408_100183067 Ga0307408_1001830671 372
256 3300031595 Ga0265313_10009938 Ga0265313_100099382 372
257 3300031595 Ga0265313_10010937 Ga0265313_100109372 372
258 3300031711 Ga0265314_10000619 Ga0265314_100006199 372
259 3300031711 Ga0265314_10015603 Ga0265314_100156033 372
260 3300031712 Ga0265342_10069259 Ga0265342_100692591 372
261 3300044712 Ga0453684_0000777 Ga0453684_0000777_105819_107093 372
262 3300044712 Ga0453684_0005807 Ga0453684_0005807_14811_16082 372
263 3300044712 Ga0453684_0100245 Ga0453684_0100245_258_1535 372
264 3300045051 Ga0451576_0001658 Ga0451576_0001658_32646_33923 372
265 3300045051 Ga0451576_0005816 Ga0451576_0005816_4083_5360 372
266 3300046557 Ga0495622_0057644 Ga0495622_0057644_472_1746 372
267 3300049592 Ga0501076_0189080 Ga0501076_0189080_244_1497 372
268 3300049593 Ga0501077_0031752 Ga0501077_0031752_1202_2455 372
269 3300049661 Ga0501217_004704 Ga0501217_004704_145_1422 372
270 3300049742 Ga0501080_0106155 Ga0501080_0106155_1309_2562 372
271 iso_pu_bacteria 2884215851 2884216781 372
272 3300003187 JGI25151J46595_10019625 JGI25151J46595_100196251 373
273 3300004799 Ga0058863_10105751 Ga0058863_101057514 373
274 3300005327 Ga0070658_10042663 Ga0070658_100426631 373
275 3300005329 Ga0070683_100000039 Ga0070683_10000003939 373
276 3300005329 Ga0070683_100189242 Ga0070683_1001892422 373
277 3300005330 Ga0070690_100096785 Ga0070690_1000967852 373
278 3300005535 Ga0070684_100000027 Ga0070684_10000002769 373
279 3300005563 Ga0068855_100023885 Ga0068855_1000238852 373
280 3300005563 Ga0068855_100024629 Ga0068855_1000246295 373
281 3300005841 Ga0068863_100072032 Ga0068863_1000720322 373
282 3300005981 Ga0081538_10004954 Ga0081538_100049548 373
283 3300009093 Ga0105240_10002880 Ga0105240_1000288012 373
284 3300009094 Ga0111539_10058687 Ga0111539_100586873 373
285 3300013104 Ga0157370_10001294 Ga0157370_1000129410 373
286 3300013105 Ga0157369_10009244 Ga0157369_100092444 373
287 3300013306 Ga0163162_10349245 Ga0163162_103492451 373
288 3300013307 Ga0157372_10007215 Ga0157372_100072155 373
289 3300013307 Ga0157372_10077559 Ga0157372_100775594 373
290 3300014325 Ga0163163_10106282 Ga0163163_101062822 373
291 3300021388 Ga0213875_10015485 Ga0213875_100154854 373
292 3300025294 Ga0209025_1005862 Ga0209025_10058629 373
293 3300025909 Ga0207705_10016032 Ga0207705_100160324 373
294 3300025912 Ga0207707_10143697 Ga0207707_101436972 373
295 3300025913 Ga0207695_10005265 Ga0207695_100052656 373
296 3300025917 Ga0207660_10009166 Ga0207660_100091662 373
297 3300025944 Ga0207661_10000043 Ga0207661_1000004369 373
298 3300026142 Ga0207698_10002829 Ga0207698_100028298 373
299 3300028653 Ga0265323_10006078 Ga0265323_100060783 373
300 3300031235 Ga0265330_10000493 Ga0265330_1000049313 373
301 3300031235 Ga0265330_10059344 Ga0265330_100593442 373
302 3300031241 Ga0265325_10002318 Ga0265325_100023182 373
303 3300031249 Ga0265339_10006179 Ga0265339_100061796 373
304 3300031344 Ga0265316_10000261 Ga0265316_100002617 373
305 3300031344 Ga0265316_10176211 Ga0265316_101762112 373
306 3300031595 Ga0265313_10003001 Ga0265313_100030016 373
307 3300031595 Ga0265313_10042141 Ga0265313_100421412 373
308 3300031712 Ga0265342_10005938 Ga0265342_100059384 373
309 3300035398 Ga0316574_0041346 Ga0316574_0041346_1127_2401 373
310 3300037418 Ga0395900_0046266 Ga0395900_0046266_2584_3852 373
311 3300037466 Ga0395898_0196266 Ga0395898_0196266_273_1553 373
312 3300037853 Ga0436364_0813613 Ga0436364_0813613_8977_10254 373
313 3300042876 Ga0451577_0003471 Ga0451577_0003471_12599_13876 373
314 3300044712 Ga0453684_0003576 Ga0453684_0003576_9162_10439 373
315 3300045051 Ga0451576_0072829 Ga0451576_0072829_312_1583 373
316 3300046477 Ga0495664_0043333 Ga0495664_0043333_1353_2627 373
317 3300046642 Ga0495634_0010768 Ga0495634_0010768_2276_3550 373
318 3300046663 Ga0495635_0062150 Ga0495635_0062150_450_1724 373
319 3300046678 Ga0495599_0022968 Ga0495599_0022968_554_1828 373
320 3300046679 Ga0495623_0025212 Ga0495623_0025212_543_1817 373
321 3300046689 Ga0495613_0037733 Ga0495613_0037733_1892_3166 373
322 3300046809 Ga0495600_0044757 Ga0495600_0044757_1478_2752 373
323 3300047317 Ga0495604_0031479 Ga0495604_0031479_364_1638 373
324 3300047322 Ga0495680_0101489 Ga0495680_0101489_86_1360 373
325 3300047471 Ga0495684_0008806 Ga0495684_0008806_1037_2311 373
326 3300047471 Ga0495684_0025122 Ga0495684_0025122_2838_4112 373
327 3300048088 Ga0495602_0117830 Ga0495602_0117830_507_1781 373
328 3300048088 Ga0495602_0118345 Ga0495602_0118345_227_1501 373
329 iso_pu_bacteria 2511231119 2511697873 373
330 iso_pu_bacteria 2512564039 2512729439 373
331 iso_pu_bacteria 2545555800 2545559990 373
332 iso_pu_bacteria 2551306519 2553395790 373
333 iso_pu_bacteria 2554235283 2555471100 373
334 iso_pu_bacteria 2576861599 2578931776 373
335 iso_pu_bacteria 2593339131 2595092390 373
336 iso_pu_bacteria 2630968484 2631982879 373
337 iso_pu_bacteria 2643221729 2644706545 373
338 iso_pu_bacteria 2643221730 2644713528 373
339 iso_pu_bacteria 2643221731 2644720158 373
340 iso_pu_bacteria 2643221732 2644724661 373
341 iso_pu_bacteria 2643221735 2644740395 373
342 iso_pu_bacteria 2648501850 2651531538 373
343 iso_pu_bacteria 2671180330 2672333458 373
344 iso_pu_bacteria 2671180844 2674421239 373
345 iso_pu_bacteria 2684622632 2685153458 373
346 iso_pu_bacteria 2684623153 2686995194 373
347 iso_pu_bacteria 2687453109 2687496442 373
348 iso_pu_bacteria 2695420354 2695629787 373
349 iso_pu_bacteria 2695420987 2698319731 373
350 iso_pu_bacteria 2703719227 2705991907 373
351 iso_pu_bacteria 2716884898 2717914524 373
352 iso_pu_bacteria 2718218445 2721503329 373
353 iso_pu_bacteria 2738541295 2738817972 373
354 iso_pu_bacteria 2738541358 2739160432 373
355 iso_pu_bacteria 2738543006 2739213075 373
356 iso_pu_bacteria 2738543010 2739235045 373
357 iso_pu_bacteria 2738543017 2739272023 373
358 iso_pu_bacteria 2757320391 2757569119 373
359 iso_pu_bacteria 2775507177 2777763461 373
360 iso_pu_bacteria 2775507192 2777837224 373
361 iso_pu_bacteria 2791355222 2793183118 373
362 iso_pu_bacteria 2808606364 2808871047 373
363 iso_pu_bacteria 2808606399 2809057230 373
364 iso_pu_bacteria 2811994870 2812314330 373
365 iso_pu_bacteria 2816332186 2816861259 373
366 iso_pu_bacteria 2816332295 2817478055 373
367 iso_pu_bacteria 2816332336 2817616303 373
368 iso_pu_bacteria 2818991441 2819571617 373
369 iso_pu_bacteria 2818991443 2819585370 373
370 iso_pu_bacteria 2818991465 2819712232 373
371 iso_pu_bacteria 2818991468 2819726175 373
372 iso_pu_bacteria 2823526263 2823526282 373
373 iso_pu_bacteria 2831905167 2831907932 373
374 iso_pu_bacteria 2842682962 2842688597 373
375 iso_pu_bacteria 2842882022 2842888547 373
376 iso_pu_bacteria 2849139964 2849145619 373
377 iso_pu_bacteria 2857453340 2857460206 373
378 iso_pu_bacteria 2857460504 2857464225 373
379 iso_pu_bacteria 2857472729 2857474341 373
380 iso_pu_bacteria 2857581216 2857586805 373
381 iso_pu_bacteria 2857586860 2857591339 373
382 iso_pu_bacteria 2860837431 2860837449 373
383 iso_pu_bacteria 2865002811 2865006778 373
384 iso_pu_bacteria 2877768649 2877768667 373
385 iso_pu_bacteria 2880169592 2880169610 373
386 iso_pu_bacteria 2881644220 2881647334 373
387 iso_pu_bacteria 2889049205 2889052438 373
388 iso_pu_bacteria 2897109615 2897109633 373
389 iso_pu_bacteria 2898907183 2898908230 373
390 iso_pu_bacteria 2904524088 2904530430 373
391 iso_pu_bacteria 2904560550 2904564627 373
392 iso_pu_bacteria 2908665501 2908669369 373
393 iso_pu_bacteria 2915597211 2915598460 373
394 iso_pu_bacteria 2915606848 2915610799 373
395 iso_pu_bacteria 2919093281 2919097121 373
396 iso_pu_bacteria 2919143609 2919150280 373
397 iso_pu_bacteria 2919414237 2919419826 373
398 iso_pu_bacteria 2919517244 2919523484 373
399 iso_pu_bacteria 2919720352 2919726833 373
400 iso_pu_bacteria 2919726948 2919730800 373
401 iso_pu_bacteria 2925326138 2925329221 373
402 iso_pu_bacteria 2928093941 2928100306 373
403 iso_pu_bacteria 2929004312 2929010450 373
404 iso_pu_bacteria 2929183550 2929183598 373
405 iso_pu_bacteria 2929233124 2929233141 373
406 iso_pu_bacteria 2936340661 2936343801 373
407 iso_pu_bacteria 2936361878 2936363569 373
408 iso_pu_bacteria 2938917290 2938917309 373
409 iso_pu_bacteria 2947426588 2947426606 373
410 iso_pu_bacteria 2954773129 2954776211 373
411 iso_pu_bacteria 2956897341 2956902471 373
412 iso_pu_bacteria 2960319331 2960323623 373
413 iso_pu_bacteria 2960375949 2960379353 373
414 iso_pu_bacteria 2962290636 2962290657 373
415 iso_pu_bacteria 2964375228 2964376530 373
416 iso_pu_bacteria 2965761152 2965761159 373
417 iso_pu_bacteria 2969136845 2969136865 373
418 iso_pu_bacteria 2969141011 2969141030 373
419 iso_pu_bacteria 2969765954 2969766365 373
420 iso_pu_bacteria 2969770375 2969770446 373
421 iso_pu_bacteria 2971893375 2971893394 373
422 iso_pu_bacteria 2977254563 2977254824 373
423 iso_pu_bacteria 2979083700 2979089161 373
424 iso_pu_bacteria 2980125574 2980130391 373
425 iso_pu_bacteria 2980492589 2980492609 373
426 iso_pu_bacteria 2990275345 2990275822 373
427 iso_pu_bacteria 3001892409 3001894195 373
428 iso_pu_bacteria 3006826541 3006829559 373
429 iso_pu_bacteria 3006858327 3006858376 373
430 iso_pu_bacteria 3006879489 3006883580 373
431 iso_pu_bacteria 3006969106 3006970044 373
432 iso_pu_bacteria 3006973921 3006976392 373
433 iso_pu_bacteria 3006978542 3006980143 373
434 iso_pu_bacteria 8022621104 8022621110 373
435 iso_pu_bacteria 8022630665 8022631775 373
436 iso_pu_bacteria 8022653035 8022656259 373
437 iso_pu_bacteria 8022792930 8022794837 373
438 iso_pu_bacteria 8022893055 8022896573 373
439 iso_pu_bacteria 8022914991 8022919344 373
440 iso_pu_bacteria 8022948649 8022952800 373
441 iso_pu_bacteria 8023438354 8023440931 373
442 iso_pu_bacteria 8023444577 8023448513 373
443 iso_pu_bacteria 8051952484 8051956632 373
444 iso_pu_bacteria 8052174270 8052175168 373
445 iso_pu_bacteria 8054280661 8054283493 373
446 iso_pu_bacteria 8057473075 8057473082 373
447 iso_pu_bacteria 8057582654 8057582672 373
448 iso_pu_bacteria 8057632132 8057632149 373
449 3300005329 Ga0070683_100008651 Ga0070683_1000086519 374
450 3300005329 Ga0070683_100039510 Ga0070683_1000395103 374
451 3300005336 Ga0070680_100109335 Ga0070680_1001093351 374
452 3300005337 Ga0070682_100076591 Ga0070682_1000765911 374
453 3300005366 Ga0070659_100171389 Ga0070659_1001713892 374
454 3300005435 Ga0070714_100010572 Ga0070714_1000105723 374
455 3300005435 Ga0070714_100031031 Ga0070714_1000310313 374
456 3300005436 Ga0070713_100278728 Ga0070713_1002787281 374
457 3300005439 Ga0070711_100018291 Ga0070711_1000182912 374
458 3300005530 Ga0070679_100004611 Ga0070679_1000046112 374
459 3300005535 Ga0070684_100010795 Ga0070684_1000107954 374
460 3300005535 Ga0070684_100048177 Ga0070684_1000481772 374
461 3300005536 Ga0070697_100294298 Ga0070697_1002942981 374
462 3300005539 Ga0068853_100006865 Ga0068853_1000068653 374
463 3300005548 Ga0070665_100028174 Ga0070665_1000281744 374
464 3300005563 Ga0068855_100010646 Ga0068855_1000106469 374
465 3300005563 Ga0068855_100123212 Ga0068855_1001232122 374
466 3300005577 Ga0068857_100009215 Ga0068857_1000092156 374
467 3300005577 Ga0068857_100084050 Ga0068857_1000840502 374
468 3300005614 Ga0068856_100016479 Ga0068856_1000164793 374
469 3300005616 Ga0068852_100023207 Ga0068852_1000232072 374
470 3300005616 Ga0068852_100028656 Ga0068852_1000286567 374
471 3300005842 Ga0068858_100034248 Ga0068858_1000342483 374
472 3300005843 Ga0068860_100161946 Ga0068860_1001619462 374
473 3300006028 Ga0070717_10038406 Ga0070717_100384062 374
474 3300006237 Ga0097621_100009750 Ga0097621_1000097502 374
475 3300006237 Ga0097621_100049430 Ga0097621_1000494302 374
476 3300006237 Ga0097621_100094021 Ga0097621_1000940212 374
477 3300006358 Ga0068871_100013264 Ga0068871_1000132643 374
478 3300006358 Ga0068871_100062687 Ga0068871_1000626872 374
479 3300006881 Ga0068865_100081148 Ga0068865_1000811482 374
480 3300006914 Ga0075436_100050909 Ga0075436_1000509092 374
481 3300009093 Ga0105240_10001385 Ga0105240_1000138511 374
482 3300009093 Ga0105240_10001456 Ga0105240_1000145626 374
483 3300009093 Ga0105240_10003229 Ga0105240_100032296 374
484 3300009093 Ga0105240_10050529 Ga0105240_100505292 374
485 3300009098 Ga0105245_10015662 Ga0105245_100156623 374
486 3300009098 Ga0105245_10039298 Ga0105245_100392983 374
487 3300009147 Ga0114129_10097134 Ga0114129_100971342 374
488 3300009147 Ga0114129_10143770 Ga0114129_101437704 374
489 3300009176 Ga0105242_10040384 Ga0105242_100403842 374
490 3300009176 Ga0105242_10045677 Ga0105242_100456771 374
491 3300009176 Ga0105242_10064793 Ga0105242_100647933 374
492 3300009177 Ga0105248_10003889 Ga0105248_100038896 374
493 3300009177 Ga0105248_10045095 Ga0105248_100450953 374
494 3300009545 Ga0105237_10006109 Ga0105237_100061093 374
495 3300009545 Ga0105237_10007736 Ga0105237_100077363 374
496 3300009545 Ga0105237_10153824 Ga0105237_101538242 374
497 3300009551 Ga0105238_10001077 Ga0105238_1000107727 374
498 3300009553 Ga0105249_10007173 Ga0105249_100071731 374
499 3300010375 Ga0105239_10006418 Ga0105239_100064183 374
500 3300010375 Ga0105239_10020047 Ga0105239_100200475 374
501 3300010375 Ga0105239_10094875 Ga0105239_100948752 374
502 3300011119 Ga0105246_10004304 Ga0105246_100043043 374
503 3300013100 Ga0157373_10130694 Ga0157373_101306942 374
504 3300013104 Ga0157370_10004975 Ga0157370_100049752 374
505 3300013104 Ga0157370_10031613 Ga0157370_100316135 374
506 3300013104 Ga0157370_10303638 Ga0157370_103036382 374
507 3300013105 Ga0157369_10002577 Ga0157369_1000257718 374
508 3300013105 Ga0157369_10003469 Ga0157369_1000346910 374
509 3300013105 Ga0157369_10003568 Ga0157369_1000356817 374
510 3300013105 Ga0157369_10030225 Ga0157369_100302254 374
511 3300013296 Ga0157374_10060416 Ga0157374_100604162 374
512 3300013296 Ga0157374_10139410 Ga0157374_101394102 374
513 3300013297 Ga0157378_10009939 Ga0157378_100099399 374
514 3300013297 Ga0157378_10013737 Ga0157378_100137372 374
515 3300013306 Ga0163162_10054231 Ga0163162_100542313 374
516 3300013307 Ga0157372_10008866 Ga0157372_100088669 374
517 3300013307 Ga0157372_10132277 Ga0157372_101322773 374
518 3300013307 Ga0157372_10219891 Ga0157372_102198912 374
519 3300013308 Ga0157375_10101606 Ga0157375_101016062 374
520 3300013308 Ga0157375_10163999 Ga0157375_101639992 374
521 3300014325 Ga0163163_10038959 Ga0163163_100389594 374
522 3300014968 Ga0157379_10085992 Ga0157379_100859922 374
523 3300021361 Ga0213872_10000270 Ga0213872_1000027016 374
524 3300021388 Ga0213875_10048958 Ga0213875_100489582 374
525 3300025911 Ga0207654_10025171 Ga0207654_100251712 374
526 3300025912 Ga0207707_10002540 Ga0207707_100025405 374
527 3300025912 Ga0207707_10069541 Ga0207707_100695413 374
528 3300025913 Ga0207695_10000770 Ga0207695_1000077020 374
529 3300025913 Ga0207695_10006691 Ga0207695_1000669110 374
530 3300025913 Ga0207695_10129121 Ga0207695_101291211 374
531 3300025914 Ga0207671_10005189 Ga0207671_100051899 374
532 3300025921 Ga0207652_10006572 Ga0207652_100065723 374
533 3300025921 Ga0207652_10089269 Ga0207652_100892693 374
534 3300025924 Ga0207694_10000484 Ga0207694_1000048425 374
535 3300025924 Ga0207694_10005539 Ga0207694_100055392 374
536 3300025924 Ga0207694_10021364 Ga0207694_100213643 374
537 3300025927 Ga0207687_10014145 Ga0207687_100141452 374
538 3300025927 Ga0207687_10021550 Ga0207687_100215502 374
539 3300025927 Ga0207687_10030563 Ga0207687_100305633 374
540 3300025929 Ga0207664_10168306 Ga0207664_101683061 374
541 3300025932 Ga0207690_10178289 Ga0207690_101782891 374
542 3300025941 Ga0207711_10000701 Ga0207711_100007013 374
543 3300025941 Ga0207711_10118505 Ga0207711_101185052 374
544 3300025942 Ga0207689_10056534 Ga0207689_100565342 374
545 3300025944 Ga0207661_10002207 Ga0207661_1000220713 374
546 3300025949 Ga0207667_10000776 Ga0207667_1000077635 374
547 3300025949 Ga0207667_10001669 Ga0207667_100016693 374
548 3300026041 Ga0207639_10004944 Ga0207639_100049447 374
549 3300026067 Ga0207678_10011601 Ga0207678_100116014 374
550 3300026078 Ga0207702_10010045 Ga0207702_100100453 374
551 3300026078 Ga0207702_10211694 Ga0207702_102116942 374
552 3300026088 Ga0207641_10221130 Ga0207641_102211302 374
553 3300026095 Ga0207676_10056772 Ga0207676_100567722 374
554 3300026116 Ga0207674_10020307 Ga0207674_100203076 374
555 3300026142 Ga0207698_10027549 Ga0207698_100275493 374
556 3300026142 Ga0207698_10050045 Ga0207698_100500454 374
557 3300028379 Ga0268266_10070220 Ga0268266_100702202 374
558 3300028381 Ga0268264_10044758 Ga0268264_100447582 374
559 3300028800 Ga0265338_10008212 Ga0265338_100082122 374
560 3300031241 Ga0265325_10063228 Ga0265325_100632282 374
561 3300031242 Ga0265329_10008315 Ga0265329_100083152 374
562 3300031249 Ga0265339_10080699 Ga0265339_100806991 374
563 3300031250 Ga0265331_10001584 Ga0265331_100015842 374
564 3300031344 Ga0265316_10011302 Ga0265316_100113023 374
565 3300031344 Ga0265316_10075722 Ga0265316_100757223 374
566 3300031711 Ga0265314_10106393 Ga0265314_101063932 374
567 3300031712 Ga0265342_10022815 Ga0265342_100228153 374
568 3300031712 Ga0265342_10043557 Ga0265342_100435571 374
569 3300035089 Ga0373944_0027414 Ga0373944_0027414_295_1581 374
570 3300035111 Ga0373923_0079616 Ga0373923_0079616_99_1385 374
571 3300035118 Ga0373954_0005972 Ga0373954_0005972_853_2127 374
572 3300035692 Ga0373935_0022029 Ga0373935_0022029_1064_2350 374
573 3300035695 Ga0373927_0042692 Ga0373927_0042692_1339_2625 374
574 3300035724 Ga0373933_0036982 Ga0373933_0036982_742_2046 374
575 3300035724 Ga0373933_0060679 Ga0373933_0060679_107_1381 374
576 3300036401 Ga0373937_0006149 Ga0373937_0006149_7667_8941 374
577 3300036401 Ga0373937_0092704 Ga0373937_0092704_137_1441 374
578 3300036401 Ga0373937_0317120 Ga0373937_0317120_41_1315 374
579 3300037068 Ga0373925_0007871 Ga0373925_0007871_1295_2581 374
580 3300037853 Ga0436364_0354295 Ga0436364_0354295_1086_2372 374
581 3300038726 Ga0400490_35416 Ga0400490_35416_73_1353 374
582 3300038741 Ga0400488_56663 Ga0400488_56663_207_1487 374
583 3300039437 Ga0436365_0814324 Ga0436365_0814324_1086_2372 374
584 3300039447 Ga0436361_0761235 Ga0436361_0761235_27222_28508 374
585 3300041456 Ga0451795_0810233 Ga0451795_0810233_421_1689 374
586 3300044842 Ga0466957_0001754 Ga0466957_0001754_1180_2466 374
587 3300045836 Ga0466958_0118954 Ga0466958_0118954_303_1634 374
588 3300046526 Ga0495666_0070894 Ga0495666_0070894_48_1322 374
589 3300047319 Ga0495674_0256653 Ga0495674_0256653_81_1355 374
590 3300047471 Ga0495684_0036604 Ga0495684_0036604_1075_2349 374
591 3300047472 Ga0495686_0000027 Ga0495686_0000027_325664_326989 374
592 3300048905 Ga0496102_0083577 Ga0496102_0083577_1260_2534 374
593 3300048905 Ga0496102_0179777 Ga0496102_0179777_325_1608 374
594 3300048907 Ga0496104_0000014 Ga0496104_0000014_318354_319679 374
595 3300048912 Ga0496109_0245748 Ga0496109_0245748_14_1297 374
596 3300048913 Ga0496110_0016403 Ga0496110_0016403_4499_5785 374
597 3300048918 Ga0496115_0004899 Ga0496115_0004899_3501_4784 374
598 3300048929 Ga0496126_0000170 Ga0496126_0000170_97206_98525 374
599 3300048929 Ga0496126_0073066 Ga0496126_0073066_1676_2962 374
600 3300049581 Ga0501047_0093556 Ga0501047_0093556_391_1674 374
601 3300049823 Ga0501044_0000216 Ga0501044_0000216_70637_71920 374
602 3300049823 Ga0501044_0002307 Ga0501044_0002307_6632_7915 374
603 3300049823 Ga0501044_0242950 Ga0501044_0242950_236_1513 374
604 3300050514 nmdc:mga08x19_93618_c1 nmdc:mga08x19_93618_c1_553_1836 374
605 3300003578 Ga0006562J51391_1006087 Ga0006562J51391_10060873 375
606 3300005327 Ga0070658_10042002 Ga0070658_100420022 375
607 3300005331 Ga0070670_100079247 Ga0070670_1000792472 375
608 3300005338 Ga0068868_100015202 Ga0068868_1000152023 375
609 3300005340 Ga0070689_100013934 Ga0070689_1000139343 375
610 3300005364 Ga0070673_100005177 Ga0070673_1000051775 375
611 3300005366 Ga0070659_100024875 Ga0070659_1000248754 375
612 3300005366 Ga0070659_100041141 Ga0070659_1000411413 375
613 3300005444 Ga0070694_100117462 Ga0070694_1001174622 375
614 3300005455 Ga0070663_100074159 Ga0070663_1000741591 375
615 3300005466 Ga0070685_10008224 Ga0070685_100082245 375
616 3300005518 Ga0070699_100039953 Ga0070699_1000399533 375
617 3300005530 Ga0070679_100000967 Ga0070679_10000096722 375
618 3300005530 Ga0070679_100098637 Ga0070679_1000986372 375
619 3300005539 Ga0068853_100010733 Ga0068853_1000107334 375
620 3300005539 Ga0068853_100021464 Ga0068853_1000214645 375
621 3300005545 Ga0070695_100010670 Ga0070695_1000106702 375
622 3300005545 Ga0070695_100046516 Ga0070695_1000465162 375
623 3300005548 Ga0070665_100074130 Ga0070665_1000741302 375
624 3300005563 Ga0068855_100164208 Ga0068855_1001642082 375
625 3300005564 Ga0070664_100105538 Ga0070664_1001055382 375
626 3300005618 Ga0068864_100014310 Ga0068864_1000143106 375
627 3300005719 Ga0068861_100047090 Ga0068861_1000470904 375
628 3300005834 Ga0068851_10013289 Ga0068851_100132894 375
629 3300005842 Ga0068858_100000835 Ga0068858_10000083530 375
630 3300005843 Ga0068860_100074896 Ga0068860_1000748961 375
631 3300006237 Ga0097621_100153967 Ga0097621_1001539671 375
632 3300006358 Ga0068871_100129810 Ga0068871_1001298103 375
633 3300006871 Ga0075434_100003227 Ga0075434_1000032279 375
634 3300006914 Ga0075436_100057622 Ga0075436_1000576222 375
635 3300009093 Ga0105240_10000002 Ga0105240_10000002685 375
636 3300009093 Ga0105240_10070490 Ga0105240_100704902 375
637 3300009094 Ga0111539_10008483 Ga0111539_100084834 375
638 3300009094 Ga0111539_10058920 Ga0111539_100589204 375
639 3300009098 Ga0105245_10015549 Ga0105245_100155494 375
640 3300009101 Ga0105247_10035991 Ga0105247_100359912 375
641 3300009177 Ga0105248_10081584 Ga0105248_100815843 375
642 3300009545 Ga0105237_10109668 Ga0105237_101096682 375
643 3300009553 Ga0105249_10231932 Ga0105249_102319321 375
644 3300011119 Ga0105246_10052062 Ga0105246_100520621 375
645 3300013104 Ga0157370_10014105 Ga0157370_100141053 375
646 3300013105 Ga0157369_10015106 Ga0157369_100151061 375
647 3300013105 Ga0157369_10165840 Ga0157369_101658403 375
648 3300013296 Ga0157374_10206768 Ga0157374_102067681 375
649 3300013307 Ga0157372_10036615 Ga0157372_100366152 375
650 3300013307 Ga0157372_10139873 Ga0157372_101398732 375
651 3300013307 Ga0157372_10280825 Ga0157372_102808251 375
652 3300013308 Ga0157375_10027954 Ga0157375_100279542 375
653 3300013308 Ga0157375_10062045 Ga0157375_100620452 375
654 3300014325 Ga0163163_10003545 Ga0163163_100035459 375
655 3300014325 Ga0163163_10025477 Ga0163163_100254773 375
656 3300014968 Ga0157379_10001327 Ga0157379_1000132716 375
657 3300014968 Ga0157379_10048555 Ga0157379_100485554 375
658 3300025321 Ga0207656_10018831 Ga0207656_100188313 375
659 3300025903 Ga0207680_10091824 Ga0207680_100918242 375
660 3300025907 Ga0207645_10033305 Ga0207645_100333054 375
661 3300025909 Ga0207705_10011364 Ga0207705_100113643 375
662 3300025909 Ga0207705_10164602 Ga0207705_101646021 375
663 3300025913 Ga0207695_10000002 Ga0207695_10000002688 375
664 3300025913 Ga0207695_10087418 Ga0207695_100874182 375
665 3300025921 Ga0207652_10001067 Ga0207652_100010674 375
666 3300025921 Ga0207652_10097462 Ga0207652_100974622 375
667 3300025924 Ga0207694_10019819 Ga0207694_100198192 375
668 3300025927 Ga0207687_10019479 Ga0207687_100194794 375
669 3300025928 Ga0207700_10080161 Ga0207700_100801612 375
670 3300025932 Ga0207690_10142010 Ga0207690_101420101 375
671 3300025933 Ga0207706_10014418 Ga0207706_100144185 375
672 3300025940 Ga0207691_10008522 Ga0207691_100085226 375
673 3300025941 Ga0207711_10056276 Ga0207711_100562764 375
674 3300025942 Ga0207689_10019506 Ga0207689_100195064 375
675 3300025949 Ga0207667_10109061 Ga0207667_101090612 375
676 3300026023 Ga0207677_10009738 Ga0207677_100097383 375
677 3300026035 Ga0207703_10015806 Ga0207703_100158062 375
678 3300026095 Ga0207676_10072144 Ga0207676_100721443 375
679 3300026121 Ga0207683_10002717 Ga0207683_100027176 375
680 3300031241 Ga0265325_10007947 Ga0265325_100079475 375
681 3300031249 Ga0265339_10015445 Ga0265339_100154452 375
682 3300031344 Ga0265316_10001520 Ga0265316_100015205 375
683 3300032002 Ga0307416_100051970 Ga0307416_1000519702 375
684 3300039450 Ga0436363_0504372 Ga0436363_0504372_391_1698 375
685 3300045049 Ga0466959_0075618 Ga0466959_0075618_231_1568 375
686 3300046459 Ga0495629_0038355 Ga0495629_0038355_1977_3308 375
687 3300046472 Ga0495580_0098660 Ga0495580_0098660_409_1701 375
688 3300046694 Ga0495649_0064721 Ga0495649_0064721_338_1612 375
689 3300048907 Ga0496104_0069479 Ga0496104_0069479_13_1341 375
690 3300048907 Ga0496104_0101599 Ga0496104_0101599_418_1749 375
691 3300048913 Ga0496110_0137119 Ga0496110_0137119_399_1730 375
692 3300048917 Ga0496114_0034612 Ga0496114_0034612_1113_2444 375
693 3300048918 Ga0496115_0031849 Ga0496115_0031849_1164_2483 375
694 3300049569 Ga0501032_0019100 Ga0501032_0019100_2088_3383 375
695 3300049569 Ga0501032_0083520 Ga0501032_0083520_154_1440 375
696 3300049572 Ga0501036_0044001 Ga0501036_0044001_536_1831 375
697 3300049573 Ga0501037_0059301 Ga0501037_0059301_289_1584 375
698 3300049575 Ga0501039_0000098 Ga0501039_0000098_44730_46016 375
699 3300049575 Ga0501039_0012182 Ga0501039_0012182_1102_2397 375
700 3300049577 Ga0501041_0075608 Ga0501041_0075608_612_1898 375
701 3300049578 Ga0501042_0044093 Ga0501042_0044093_769_2064 375
702 3300049579 Ga0501043_0167981 Ga0501043_0167981_314_1600 375
703 3300049582 Ga0501048_0007184 Ga0501048_0007184_4647_5942 375
704 3300049592 Ga0501076_0085342 Ga0501076_0085342_239_1534 375
705 3300049822 Ga0501035_0037906 Ga0501035_0037906_268_1554 375
706 3300050514 nmdc:mga08x19_97828_c1 nmdc:mga08x19_97828_c1_226_1503 375
707 3300050515 nmdc:mga0a205_18482_c1 nmdc:mga0a205_18482_c1_1346_2620 375
708 3300053119 Ga0500595_003237 Ga0500595_003237_2268_3596 375
709 3300005327 Ga0070658_10000010 Ga0070658_1000001033 376
710 3300005327 Ga0070658_10031649 Ga0070658_100316494 376
711 3300005327 Ga0070658_10033191 Ga0070658_100331912 376
712 3300005329 Ga0070683_100085883 Ga0070683_1000858833 376
713 3300005331 Ga0070670_100008933 Ga0070670_1000089331 376
714 3300005334 Ga0068869_100006774 Ga0068869_1000067745 376
715 3300005335 Ga0070666_10105572 Ga0070666_101055722 376
716 3300005338 Ga0068868_100000205 Ga0068868_10000020520 376
717 3300005339 Ga0070660_100126581 Ga0070660_1001265813 376
718 3300005344 Ga0070661_100014711 Ga0070661_1000147114 376
719 3300005344 Ga0070661_100016983 Ga0070661_1000169833 376
720 3300005355 Ga0070671_100004032 Ga0070671_1000040323 376
721 3300005364 Ga0070673_100223123 Ga0070673_1002231231 376
722 3300005366 Ga0070659_100002675 Ga0070659_1000026752 376
723 3300005367 Ga0070667_100003759 Ga0070667_10000375910 376
724 3300005434 Ga0070709_10016760 Ga0070709_100167602 376
725 3300005435 Ga0070714_100033807 Ga0070714_1000338073 376
726 3300005435 Ga0070714_100079019 Ga0070714_1000790192 376
727 3300005436 Ga0070713_100042247 Ga0070713_1000422473 376
728 3300005436 Ga0070713_100058005 Ga0070713_1000580053 376
729 3300005439 Ga0070711_100013222 Ga0070711_1000132222 376
730 3300005439 Ga0070711_100048461 Ga0070711_1000484613 376
731 3300005445 Ga0070708_100002312 Ga0070708_1000023122 376
732 3300005445 Ga0070708_100007410 Ga0070708_10000741011 376
733 3300005445 Ga0070708_100032993 Ga0070708_1000329935 376
734 3300005445 Ga0070708_100081820 Ga0070708_1000818202 376
735 3300005445 Ga0070708_100266588 Ga0070708_1002665882 376
736 3300005458 Ga0070681_10071508 Ga0070681_100715083 376
737 3300005458 Ga0070681_10124408 Ga0070681_101244083 376
738 3300005467 Ga0070706_100032437 Ga0070706_1000324375 376
739 3300005468 Ga0070707_100013845 Ga0070707_1000138454 376
740 3300005471 Ga0070698_100000345 Ga0070698_10000034520 376
741 3300005530 Ga0070679_100009383 Ga0070679_1000093833 376
742 3300005530 Ga0070679_100017304 Ga0070679_1000173044 376
743 3300005535 Ga0070684_100057832 Ga0070684_1000578322 376
744 3300005536 Ga0070697_100001652 Ga0070697_1000016524 376
745 3300005536 Ga0070697_100004328 Ga0070697_1000043289 376
746 3300005539 Ga0068853_100002603 Ga0068853_1000026031 376
747 3300005548 Ga0070665_100007274 Ga0070665_1000072743 376
748 3300005548 Ga0070665_100087055 Ga0070665_1000870552 376
749 3300005563 Ga0068855_100008383 Ga0068855_1000083834 376
750 3300005563 Ga0068855_100023773 Ga0068855_1000237732 376
751 3300005563 Ga0068855_100029188 Ga0068855_1000291884 376
752 3300005563 Ga0068855_100078333 Ga0068855_1000783333 376
753 3300005577 Ga0068857_100009186 Ga0068857_1000091864 376
754 3300005578 Ga0068854_100000111 Ga0068854_10000011132 376
755 3300005578 Ga0068854_100045692 Ga0068854_1000456922 376
756 3300005578 Ga0068854_100061151 Ga0068854_1000611512 376
757 3300005614 Ga0068856_100015765 Ga0068856_1000157653 376
758 3300005614 Ga0068856_100076674 Ga0068856_1000766744 376
759 3300005614 Ga0068856_100114123 Ga0068856_1001141231 376
760 3300005614 Ga0068856_100211375 Ga0068856_1002113751 376
761 3300005614 Ga0068856_100309344 Ga0068856_1003093442 376
762 3300005616 Ga0068852_100000041 Ga0068852_10000004130 376
763 3300005616 Ga0068852_100000964 Ga0068852_1000009644 376
764 3300005616 Ga0068852_100045113 Ga0068852_1000451132 376
765 3300005616 Ga0068852_100126961 Ga0068852_1001269612 376
766 3300005616 Ga0068852_100151274 Ga0068852_1001512742 376
767 3300005617 Ga0068859_100065587 Ga0068859_1000655872 376
768 3300005618 Ga0068864_100002966 Ga0068864_1000029665 376
769 3300005834 Ga0068851_10002493 Ga0068851_100024933 376
770 3300005841 Ga0068863_100001668 Ga0068863_10000166820 376
771 3300005842 Ga0068858_100009232 Ga0068858_1000092326 376
772 3300005843 Ga0068860_100000322 Ga0068860_10000032225 376
773 3300005983 Ga0081540_1025483 Ga0081540_10254832 376
774 3300006028 Ga0070717_10022703 Ga0070717_100227033 376
775 3300006028 Ga0070717_10034388 Ga0070717_100343883 376
776 3300006028 Ga0070717_10152531 Ga0070717_101525312 376
777 3300006163 Ga0070715_10001944 Ga0070715_100019443 376
778 3300006173 Ga0070716_100001422 Ga0070716_1000014226 376
779 3300006175 Ga0070712_100004014 Ga0070712_1000040147 376
780 3300006175 Ga0070712_100012027 Ga0070712_1000120276 376
781 3300006237 Ga0097621_100000476 Ga0097621_1000004769 376
782 3300006237 Ga0097621_100018869 Ga0097621_1000188693 376
783 3300006358 Ga0068871_100004447 Ga0068871_1000044472 376
784 3300006358 Ga0068871_100029694 Ga0068871_1000296944 376
785 3300006844 Ga0075428_100097294 Ga0075428_1000972942 376
786 3300006852 Ga0075433_10000284 Ga0075433_1000028419 376
787 3300006871 Ga0075434_100019192 Ga0075434_1000191924 376
788 3300006931 Ga0097620_100065589 Ga0097620_1000655894 376
789 3300007076 Ga0075435_100026898 Ga0075435_1000268985 376
790 3300009093 Ga0105240_10000251 Ga0105240_1000025160 376
791 3300009093 Ga0105240_10001662 Ga0105240_1000166230 376
792 3300009093 Ga0105240_10005528 Ga0105240_100055283 376
793 3300009093 Ga0105240_10017400 Ga0105240_100174002 376
794 3300009093 Ga0105240_10041225 Ga0105240_100412255 376
795 3300009093 Ga0105240_10174879 Ga0105240_101748792 376
796 3300009093 Ga0105240_10195841 Ga0105240_101958412 376
797 3300009098 Ga0105245_10003232 Ga0105245_100032323 376
798 3300009098 Ga0105245_10017474 Ga0105245_100174746 376
799 3300009101 Ga0105247_10004610 Ga0105247_100046105 376
800 3300009147 Ga0114129_10017177 Ga0114129_100171777 376
801 3300009147 Ga0114129_10395274 Ga0114129_103952741 376
802 3300009174 Ga0105241_10000098 Ga0105241_1000009839 376
803 3300009174 Ga0105241_10005821 Ga0105241_100058213 376
804 3300009174 Ga0105241_10007731 Ga0105241_100077316 376
805 3300009174 Ga0105241_10014170 Ga0105241_100141705 376
806 3300009177 Ga0105248_10000007 Ga0105248_1000000718 376
807 3300009177 Ga0105248_10002347 Ga0105248_1000234711 376
808 3300009177 Ga0105248_10004648 Ga0105248_1000464811 376
809 3300009177 Ga0105248_10161313 Ga0105248_101613131 376
810 3300009545 Ga0105237_10027188 Ga0105237_100271885 376
811 3300009545 Ga0105237_10239052 Ga0105237_102390522 376
812 3300009551 Ga0105238_10000416 Ga0105238_1000041627 376
813 3300009551 Ga0105238_10001618 Ga0105238_1000161814 376
814 3300009551 Ga0105238_10004730 Ga0105238_1000473012 376
815 3300009551 Ga0105238_10026579 Ga0105238_100265793 376
816 3300009551 Ga0105238_10029793 Ga0105238_100297932 376
817 3300009551 Ga0105238_10068063 Ga0105238_100680634 376
818 3300009551 Ga0105238_10073974 Ga0105238_100739744 376
819 3300009551 Ga0105238_10127219 Ga0105238_101272193 376
820 3300010375 Ga0105239_10004570 Ga0105239_1000457015 376
821 3300010375 Ga0105239_10008318 Ga0105239_100083187 376
822 3300010375 Ga0105239_10014432 Ga0105239_100144322 376
823 3300011119 Ga0105246_10005522 Ga0105246_100055223 376
824 3300013104 Ga0157370_10000003 Ga0157370_10000003162 376
825 3300013104 Ga0157370_10015654 Ga0157370_100156545 376
826 3300013104 Ga0157370_10025185 Ga0157370_100251854 376
827 3300013104 Ga0157370_10105990 Ga0157370_101059902 376
828 3300013105 Ga0157369_10000094 Ga0157369_1000009459 376
829 3300013105 Ga0157369_10000719 Ga0157369_1000071942 376
830 3300013105 Ga0157369_10004217 Ga0157369_100042173 376
831 3300013105 Ga0157369_10013848 Ga0157369_100138485 376
832 3300013105 Ga0157369_10028857 Ga0157369_100288573 376
833 3300013105 Ga0157369_10099974 Ga0157369_100999742 376
834 3300013105 Ga0157369_10128430 Ga0157369_101284303 376
835 3300013105 Ga0157369_10292476 Ga0157369_102924762 376
836 3300013296 Ga0157374_10004012 Ga0157374_100040124 376
837 3300013296 Ga0157374_10017652 Ga0157374_100176525 376
838 3300013296 Ga0157374_10347999 Ga0157374_103479992 376
839 3300013297 Ga0157378_10008917 Ga0157378_100089174 376
840 3300013297 Ga0157378_10014382 Ga0157378_100143823 376
841 3300013297 Ga0157378_10017090 Ga0157378_100170905 376
842 3300013297 Ga0157378_10056706 Ga0157378_100567064 376
843 3300013306 Ga0163162_10007982 Ga0163162_100079828 376
844 3300013306 Ga0163162_10015635 Ga0163162_100156354 376
845 3300013307 Ga0157372_10000074 Ga0157372_1000007460 376
846 3300013307 Ga0157372_10011163 Ga0157372_100111632 376
847 3300013307 Ga0157372_10016608 Ga0157372_100166083 376
848 3300013307 Ga0157372_10033475 Ga0157372_100334751 376
849 3300013307 Ga0157372_10061668 Ga0157372_100616683 376
850 3300013307 Ga0157372_10151700 Ga0157372_101517003 376
851 3300013308 Ga0157375_10003858 Ga0157375_100038583 376
852 3300014325 Ga0163163_10002565 Ga0163163_100025653 376
853 3300014325 Ga0163163_10004928 Ga0163163_100049283 376
854 3300014968 Ga0157379_10008670 Ga0157379_100086705 376
855 3300014968 Ga0157379_10192682 Ga0157379_101926821 376
856 3300014969 Ga0157376_10000765 Ga0157376_100007654 376
857 3300014969 Ga0157376_10062014 Ga0157376_100620142 376
858 3300024227 Ga0228598_1001095 Ga0228598_10010951 376
859 3300025900 Ga0207710_10017581 Ga0207710_100175813 376
860 3300025905 Ga0207685_10014853 Ga0207685_100148533 376
861 3300025905 Ga0207685_10022278 Ga0207685_100222782 376
862 3300025906 Ga0207699_10031797 Ga0207699_100317973 376
863 3300025909 Ga0207705_10000016 Ga0207705_10000016100 376
864 3300025909 Ga0207705_10032545 Ga0207705_100325452 376
865 3300025910 Ga0207684_10066125 Ga0207684_100661252 376
866 3300025911 Ga0207654_10001029 Ga0207654_100010298 376
867 3300025911 Ga0207654_10001324 Ga0207654_100013245 376
868 3300025911 Ga0207654_10016308 Ga0207654_100163081 376
869 3300025912 Ga0207707_10131333 Ga0207707_101313332 376
870 3300025913 Ga0207695_10000106 Ga0207695_10000106189 376
871 3300025913 Ga0207695_10000129 Ga0207695_10000129173 376
872 3300025913 Ga0207695_10000194 Ga0207695_1000019499 376
873 3300025913 Ga0207695_10000603 Ga0207695_1000060352 376
874 3300025913 Ga0207695_10001665 Ga0207695_1000166521 376
875 3300025913 Ga0207695_10007856 Ga0207695_100078563 376
876 3300025913 Ga0207695_10012314 Ga0207695_100123147 376
877 3300025913 Ga0207695_10072379 Ga0207695_100723792 376
878 3300025913 Ga0207695_10102329 Ga0207695_101023293 376
879 3300025914 Ga0207671_10000936 Ga0207671_100009369 376
880 3300025914 Ga0207671_10004025 Ga0207671_100040255 376
881 3300025915 Ga0207693_10001742 Ga0207693_1000174211 376
882 3300025915 Ga0207693_10054648 Ga0207693_100546481 376
883 3300025915 Ga0207693_10101909 Ga0207693_101019091 376
884 3300025916 Ga0207663_10046383 Ga0207663_100463832 376
885 3300025916 Ga0207663_10093493 Ga0207663_100934931 376
886 3300025919 Ga0207657_10000493 Ga0207657_1000049321 376
887 3300025919 Ga0207657_10067603 Ga0207657_100676033 376
888 3300025919 Ga0207657_10175714 Ga0207657_101757141 376
889 3300025922 Ga0207646_10000864 Ga0207646_100008645 376
890 3300025924 Ga0207694_10000301 Ga0207694_1000030114 376
891 3300025924 Ga0207694_10001598 Ga0207694_1000159813 376
892 3300025924 Ga0207694_10001712 Ga0207694_1000171210 376
893 3300025924 Ga0207694_10012420 Ga0207694_100124203 376
894 3300025924 Ga0207694_10036417 Ga0207694_100364172 376
895 3300025925 Ga0207650_10131415 Ga0207650_101314152 376
896 3300025927 Ga0207687_10028708 Ga0207687_100287083 376
897 3300025928 Ga0207700_10041775 Ga0207700_100417753 376
898 3300025928 Ga0207700_10045070 Ga0207700_100450703 376
899 3300025931 Ga0207644_10031279 Ga0207644_100312793 376
900 3300025939 Ga0207665_10002215 Ga0207665_100022155 376
901 3300025941 Ga0207711_10000014 Ga0207711_10000014397 376
902 3300025941 Ga0207711_10000016 Ga0207711_10000016254 376
903 3300025941 Ga0207711_10003048 Ga0207711_1000304811 376
904 3300025941 Ga0207711_10004294 Ga0207711_100042949 376
905 3300025942 Ga0207689_10000096 Ga0207689_1000009649 376
906 3300025944 Ga0207661_10012930 Ga0207661_100129302 376
907 3300025944 Ga0207661_10080946 Ga0207661_100809462 376
908 3300025949 Ga0207667_10001402 Ga0207667_1000140220 376
909 3300025949 Ga0207667_10008897 Ga0207667_100088974 376
910 3300025949 Ga0207667_10011691 Ga0207667_100116915 376
911 3300025949 Ga0207667_10017209 Ga0207667_100172095 376
912 3300025949 Ga0207667_10028501 Ga0207667_100285012 376
913 3300025949 Ga0207667_10029877 Ga0207667_100298772 376
914 3300025960 Ga0207651_10171900 Ga0207651_101719002 376
915 3300025981 Ga0207640_10000019 Ga0207640_1000001927 376
916 3300025981 Ga0207640_10034051 Ga0207640_100340512 376
917 3300025981 Ga0207640_10035755 Ga0207640_100357551 376
918 3300025986 Ga0207658_10006347 Ga0207658_100063471 376
919 3300026023 Ga0207677_10004537 Ga0207677_100045373 376
920 3300026035 Ga0207703_10031084 Ga0207703_100310842 376
921 3300026041 Ga0207639_10000067 Ga0207639_1000006719 376
922 3300026041 Ga0207639_10000200 Ga0207639_1000020013 376
923 3300026041 Ga0207639_10039314 Ga0207639_100393143 376
924 3300026067 Ga0207678_10047676 Ga0207678_100476763 376
925 3300026078 Ga0207702_10001200 Ga0207702_1000120022 376
926 3300026078 Ga0207702_10012872 Ga0207702_100128723 376
927 3300026088 Ga0207641_10000984 Ga0207641_1000098416 376
928 3300026088 Ga0207641_10107297 Ga0207641_101072973 376
929 3300026095 Ga0207676_10009743 Ga0207676_100097435 376
930 3300026116 Ga0207674_10209051 Ga0207674_102090512 376
931 3300026142 Ga0207698_10000017 Ga0207698_1000001761 376
932 3300026142 Ga0207698_10000871 Ga0207698_1000087113 376
933 3300028379 Ga0268266_10008914 Ga0268266_100089143 376
934 3300028379 Ga0268266_10009917 Ga0268266_100099172 376
935 3300028379 Ga0268266_10027838 Ga0268266_100278385 376
936 3300028379 Ga0268266_10036809 Ga0268266_100368094 376
937 3300028381 Ga0268264_10001788 Ga0268264_1000178812 376
938 3300028666 Ga0265336_10009733 Ga0265336_100097334 376
939 3300028800 Ga0265338_10003158 Ga0265338_100031582 376
940 3300031235 Ga0265330_10000360 Ga0265330_1000036015 376
941 3300031238 Ga0265332_10018072 Ga0265332_100180722 376
942 3300031239 Ga0265328_10003745 Ga0265328_100037455 376
943 3300031240 Ga0265320_10006313 Ga0265320_100063134 376
944 3300031241 Ga0265325_10000499 Ga0265325_1000049921 376
945 3300031249 Ga0265339_10000641 Ga0265339_100006417 376
946 3300031344 Ga0265316_10001317 Ga0265316_1000131711 376
947 3300031344 Ga0265316_10065552 Ga0265316_100655522 376
948 3300031548 Ga0307408_100137120 Ga0307408_1001371202 376
949 3300031595 Ga0265313_10001966 Ga0265313_100019663 376
950 3300031711 Ga0265314_10006307 Ga0265314_100063077 376
951 3300031711 Ga0265314_10015143 Ga0265314_100151435 376
952 3300031712 Ga0265342_10001454 Ga0265342_100014548 376
953 3300035695 Ga0373927_0065312 Ga0373927_0065312_77_1378 376
954 3300036401 Ga0373937_0027162 Ga0373937_0027162_2850_4142 376
955 3300042876 Ga0451577_0000441 Ga0451577_0000441_39652_40935 376
956 3300042876 Ga0451577_0097365 Ga0451577_0097365_515_1792 376
957 3300042876 Ga0451577_0198903 Ga0451577_0198903_245_1537 376
958 3300044694 Ga0466963_0025853 Ga0466963_0025853_2160_3557 376
959 3300044712 Ga0453684_0000177 Ga0453684_0000177_13387_14670 376
960 3300045976 Ga0466967_0174638 Ga0466967_0174638_596_1927 376
961 3300046455 Ga0495603_0028008 Ga0495603_0028008_697_2121 376
962 3300046459 Ga0495629_0066786 Ga0495629_0066786_771_2096 376
963 3300046463 Ga0495653_0012166 Ga0495653_0012166_1146_2570 376
964 3300046472 Ga0495580_0063557 Ga0495580_0063557_168_1460 376
965 3300046473 Ga0495582_0000322 Ga0495582_0000322_5836_7260 376
966 3300046475 Ga0495639_0012090 Ga0495639_0012090_1156_2580 376
967 3300046477 Ga0495664_0032374 Ga0495664_0032374_467_1891 376
968 3300046492 Ga0495585_0038960 Ga0495585_0038960_151_1542 376
969 3300046499 Ga0495594_0000195 Ga0495594_0000195_26821_28245 376
970 3300046499 Ga0495594_0000602 Ga0495594_0000602_2264_3655 376
971 3300046506 Ga0495583_0029315 Ga0495583_0029315_199_1527 376
972 3300046517 Ga0495630_0125932 Ga0495630_0125932_103_1404 376
973 3300046523 Ga0495644_0000634 Ga0495644_0000634_11849_13240 376
974 3300046526 Ga0495666_0045148 Ga0495666_0045148_467_1891 376
975 3300046529 Ga0495652_0013321 Ga0495652_0013321_3968_5392 376
976 3300046533 Ga0495640_0003434 Ga0495640_0003434_5045_6469 376
977 3300046535 Ga0495586_0001143 Ga0495586_0001143_2733_4157 376
978 3300046543 Ga0495645_0004247 Ga0495645_0004247_5580_6929 376
979 3300046543 Ga0495645_0035574 Ga0495645_0035574_1432_2856 376
980 3300046557 Ga0495622_0010209 Ga0495622_0010209_1021_2346 376
981 3300046559 Ga0495667_0002832 Ga0495667_0002832_4366_5790 376
982 3300046559 Ga0495667_0098530 Ga0495667_0098530_103_1425 376
983 3300046648 Ga0495611_0009661 Ga0495611_0009661_1051_2442 376
984 3300046660 Ga0495625_0000733 Ga0495625_0000733_22256_23578 376
985 3300046663 Ga0495635_0002061 Ga0495635_0002061_6145_7569 376
986 3300046680 Ga0495646_0019922 Ga0495646_0019922_172_1596 376
987 3300046684 Ga0495669_0002191 Ga0495669_0002191_5366_6757 376
988 3300046689 Ga0495613_0000556 Ga0495613_0000556_26946_28271 376
989 3300046690 Ga0495624_0064286 Ga0495624_0064286_764_2188 376
990 3300046809 Ga0495600_0000182 Ga0495600_0000182_29386_30810 376
991 3300046809 Ga0495600_0132714 Ga0495600_0132714_223_1545 376
992 3300046810 Ga0495660_0085798 Ga0495660_0085798_259_1539 376
993 3300047317 Ga0495604_0001256 Ga0495604_0001256_17792_19216 376
994 3300047319 Ga0495674_0012501 Ga0495674_0012501_1657_3081 376
995 3300047319 Ga0495674_0040231 Ga0495674_0040231_26_1417 376
996 3300047321 Ga0495676_0001269 Ga0495676_0001269_1277_2701 376
997 3300047472 Ga0495686_0002556 Ga0495686_0002556_8746_10068 376
998 3300047673 Ga0495593_0046597 Ga0495593_0046597_79_1404 376
999 3300048089 Ga0495614_0000054 Ga0495614_0000054_26_1450 376
1000 3300048089 Ga0495614_0004811 Ga0495614_0004811_1676_3001 376
1001 3300048929 Ga0496126_0000074 Ga0496126_0000074_120112_121455 376
1002 3300048929 Ga0496126_0004515 Ga0496126_0004515_2811_4133 376
1003 3300048929 Ga0496126_0177017 Ga0496126_0177017_111_1427 376
1004 3300049569 Ga0501032_0001445 Ga0501032_0001445_12628_13953 376
1005 3300049571 Ga0501034_0006213 Ga0501034_0006213_9882_11207 376
1006 3300049572 Ga0501036_0002227 Ga0501036_0002227_929_2254 376
1007 3300049573 Ga0501037_0060427 Ga0501037_0060427_669_1994 376
1008 3300049573 Ga0501037_0109573 Ga0501037_0109573_109_1434 376
1009 3300049574 Ga0501038_0000072 Ga0501038_0000072_20571_21896 376
1010 3300049579 Ga0501043_0002457 Ga0501043_0002457_5100_6425 376
1011 3300049580 Ga0501046_0000811 Ga0501046_0000811_26705_28030 376
1012 3300049581 Ga0501047_0001095 Ga0501047_0001095_6558_7883 376
1013 3300049586 Ga0501070_0072319 Ga0501070_0072319_1138_2463 376
1014 3300049589 Ga0501073_0007141 Ga0501073_0007141_960_2300 376
1015 3300049675 Ga0501243_002898 Ga0501243_002898_384_1673 376
1016 3300049742 Ga0501080_0021039 Ga0501080_0021039_2300_3625 376
1017 3300049763 Ga0501266_004337 Ga0501266_004337_427_1719 376
1018 3300049779 Ga0501283_001920 Ga0501283_001920_1014_2303 376
1019 3300049822 Ga0501035_0006984 Ga0501035_0006984_5228_6553 376
1020 3300050507 nmdc:mga05p37_200480_c1 nmdc:mga05p37_200480_c1_76_1353 376
1021 3300050512 nmdc:mga0n895_11291_c1 nmdc:mga0n895_11291_c1_5614_6891 376
1022 3300050512 nmdc:mga0n895_15059_c1 nmdc:mga0n895_15059_c1_4110_5513 376
1023 3300050513 nmdc:mga0rr50_17933_c1 nmdc:mga0rr50_17933_c1_3062_4465 376
1024 3300050515 nmdc:mga0a205_2306_c1 nmdc:mga0a205_2306_c1_4954_6231 376
1025 3300053077 Ga0495601_0084394 Ga0495601_0084394_27_1358 376
1026 3300053119 Ga0500595_000053 Ga0500595_000053_60702_62030 376
1027 3300053140 Ga0500573_0084185 Ga0500573_0084185_282_1607 376
1028 3300002987 JGI25159J45721_1003836 JGI25159J45721_10038362 377
1029 3300003578 Ga0006562J51391_1006330 Ga0006562J51391_10063301 377
1030 3300005290 Ga0065712_10068955 Ga0065712_100689557 377
1031 3300005295 Ga0065707_10092497 Ga0065707_100924972 377
1032 3300005354 Ga0070675_100007456 Ga0070675_1000074562 377
1033 3300005471 Ga0070698_100006271 Ga0070698_10000627110 377
1034 3300005617 Ga0068859_100058272 Ga0068859_1000582724 377
1035 3300005617 Ga0068859_100098592 Ga0068859_1000985922 377
1036 3300006880 Ga0075429_100024328 Ga0075429_1000243285 377
1037 3300006931 Ga0097620_100058275 Ga0097620_1000582754 377
1038 3300006931 Ga0097620_100098595 Ga0097620_1000985952 377
1039 3300009093 Ga0105240_10012970 Ga0105240_100129703 377
1040 3300009094 Ga0111539_10004867 Ga0111539_100048679 377
1041 3300009094 Ga0111539_10028008 Ga0111539_100280082 377
1042 3300009094 Ga0111539_10067241 Ga0111539_100672412 377
1043 3300009147 Ga0114129_10061591 Ga0114129_100615913 377
1044 3300013308 Ga0157375_10159821 Ga0157375_101598212 377
1045 3300014326 Ga0157380_10130028 Ga0157380_101300282 377
1046 3300025284 Ga0209130_1013157 Ga0209130_10131571 377
1047 3300025294 Ga0209025_1003723 Ga0209025_10037235 377
1048 3300025926 Ga0207659_10003391 Ga0207659_100033917 377
1049 3300025926 Ga0207659_10035935 Ga0207659_100359353 377
1050 3300025940 Ga0207691_10183350 Ga0207691_101833503 377
1051 3300025942 Ga0207689_10063772 Ga0207689_100637724 377
1052 3300025960 Ga0207651_10012211 Ga0207651_100122113 377
1053 3300027907 Ga0207428_10015548 Ga0207428_100155482 377
1054 3300031548 Ga0307408_100025638 Ga0307408_1000256382 377
1055 3300031731 Ga0307405_10066678 Ga0307405_100666784 377
1056 3300031824 Ga0307413_10010520 Ga0307413_100105207 377
1057 3300031911 Ga0307412_10038897 Ga0307412_100388975 377
1058 3300031995 Ga0307409_100002768 Ga0307409_1000027687 377
1059 3300031995 Ga0307409_100102615 Ga0307409_1001026153 377
1060 3300048913 Ga0496110_0002800 Ga0496110_0002800_7294_8571 377
1061 3300048914 Ga0496111_0067810 Ga0496111_0067810_163_1440 377
1062 3300049531 Ga0501315_002234 Ga0501315_002234_56_1336 377
1063 3300049532 Ga0501316_001114 Ga0501316_001114_26_1306 377
1064 3300049568 Ga0501031_0082766 Ga0501031_0082766_609_1898 377
1065 3300049575 Ga0501039_0127932 Ga0501039_0127932_662_1948 377
1066 3300049582 Ga0501048_0077554 Ga0501048_0077554_429_1715 377
1067 3300049591 Ga0501075_0049421 Ga0501075_0049421_1247_2533 377
1068 3300049592 Ga0501076_0113489 Ga0501076_0113489_467_1756 377
1069 3300049661 Ga0501217_002096 Ga0501217_002096_1949_3229 377
1070 3300050508 nmdc:mga09592_179739_c1 nmdc:mga09592_179739_c1_87_1373 377
1071 3300050511 nmdc:mga08y16_1504_c1 nmdc:mga08y16_1504_c1_22098_23384 377
1072 iso_pu_bacteria 2540341094 2540605100 377
1073 iso_pu_bacteria 3006984091 3006988459 377

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00587

tRNA-synt_2b

tRNA synthetase class II core domain (G, H, P, S and T)

291

475

0.95

PF02403

Seryl_tRNA_N

Seryl-tRNA synthetase N-terminal domain

85

183

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u2b-assembly1.cif.gz_A cryo-electron microscopy structure of human mt-serrs in complex with mt-trna(gcu-tl) 0.9389 75 377
7ydf-assembly1.cif.gz_A crystal structure of human sars2 catalytic domain 0.9383 74 376
8ffy-assembly1.cif.gz_A cryo-electron microscopy structure of human mt-serrs in complex with mt-trna(uga-tl) 0.9351 76 377
3err-assembly1.cif.gz_B microtubule binding domain from mouse cytoplasmic dynein as a fusion with seryl-trna synthetase 0.9327 27 375
7ydf-assembly1.cif.gz_A crystal structure of human sars2 catalytic domain 0.9131 74 376
ID Description Score Start End Superfamily
2dq3B02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9858 59 377 3.30.930.10
2dq3B02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9766 59 377 3.30.930.10
af_I1JVB5_172_505_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9696 59 377 3.30.930.10
af_P9WFT7_105_418_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9682 60 377 3.30.930.10
2dq0B02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9642 59 375 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A3B9M1A0-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 1.001 229 377 GO:0004828
GO:0005524
GO:0005737
GO:0006434
GO:0016740
AF-A0A257WTY7-F1-model_v4 deleted 0.9963 242 377
AF-A0A2P6GID8-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9955 248 375 GO:0004828
GO:0005524
GO:0005737
GO:0006434
AF-A0A2T4S6I2-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9945 260 377 GO:0004828
GO:0005524
GO:0005737
GO:0006434
GO:0016740
AF-A0A7V5GYJ3-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9935 233 375 GO:0004828
GO:0005524
GO:0005737
GO:0006434

Feature Viewer

pLDDT pTM Quality
93.47 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map