F489431

General Info

Members Datasets Scaffolds Average Seq Length
1068 448 2136 252

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10081884|Ga0070709_100818842
Length 294
Sequence MSSVARSAPTGAVRPRPASGVNGNDIHSSPVVRQKNNRMVVARKVFNQVIFYSLLLGVWALLAKLKVWPPYLFPAPWQVAEALWAGFKDHSLPIAIGVTMKRMLIGYSLSVMLGMILGIGVASNRFLEETVGPLLVSLQSLPSICWVPLAILWFGLTEKAILFVVLMGCILSVTIAMEDGRKQMPKIYTMAGRNLGASGIRLFLYVMLPASLPYIVSGLKQGWAFGWRSLIQAEMIFLTIGLGQQLMMGRDLNDMSQVISVMLLIVALGYLVNRIVFRTMDRALQSRWGLNPTV

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
7 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
217 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
220 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
222 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
235 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
245 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
260 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
261 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
264 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
267 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
278 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
279 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
282 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
294 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
297 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
305 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
306 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
307 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
319 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
336 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
337 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
338 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
339 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
340 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
341 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
342 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
343 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
344 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
345 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
346 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
347 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
348 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
356 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
357 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
358 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
359 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
360 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
361 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
362 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
363 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
364 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
365 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
366 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
367 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
368 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
369 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
370 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
371 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
372 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
373 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
374 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
375 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
376 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
377 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
378 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
379 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
380 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
381 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
382 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
383 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
384 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
385 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
386 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
387 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
388 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
389 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
390 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
391 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
392 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
393 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
394 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
395 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
396 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
397 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
398 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
399 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
400 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
401 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
402 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
403 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
404 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
405 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
406 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
407 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
408 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
409 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
412 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
413 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
414 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
415 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
416 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
417 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
418 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
419 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
420 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
421 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
422 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
423 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
424 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
425 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
426 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
427 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
428 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
429 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
430 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
431 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
432 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
433 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
434 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
435 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
436 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
437 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
438 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
439 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
440 2773857925 Microvirga vignae BR3299 Isolate Unclassified
441 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
442 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
443 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
444 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
445 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
446 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
447 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
448 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 0.19
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0.47
Rhizoplane 4.31
Rhizosphere 92.7
Stem 0
Stem Tuber 0
Unclassified 5.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10081884 3300005434 Bacteria 2108
2 SwRhRL2b_contig_510538 2162886007 Bacteria 1512
3 JGI24737J22298_10023517 3300001990 Bacteria 1954
4 rootH1_10051132 3300003316 Bacteria 2897
5 rootL2_10095643 3300003322 Bacteria 3413
6 JGI26145J50221_1000614 3300003371 Bacteria 3015
7 JGI26132J50249_100881 3300003405 Bacteria 960
8 Ga0065712_10073914 3300005290 Bacteria 4244
9 Ga0065712_10074092 3300005290 Bacteria 4180
10 Ga0065712_10075782 3300005290 Bacteria 3791
11 Ga0065712_10189403 3300005290 Bacteria 1155
12 Ga0065715_10028470 3300005293 Unclassified 1146
13 Ga0065715_10042363 3300005293 Bacteria 1043
14 Ga0065715_10140639 3300005293 Bacteria 1859
15 Ga0065707_10002075 3300005295 Bacteria 5072
16 Ga0065707_10004588 3300005295 Bacteria 3901
17 Ga0065707_10347868 3300005295 Bacteria 916
18 Ga0070658_10032203 3300005327 Bacteria 4215
19 Ga0070658_10582653 3300005327 Bacteria 969
20 Ga0070676_10003201 3300005328 Bacteria 8491
21 Ga0070676_10056770 3300005328 Bacteria 2314
22 Ga0070676_10061182 3300005328 Bacteria 2238
23 Ga0070676_10139867 3300005328 Bacteria 1540
24 Ga0070683_100076215 3300005329 Bacteria 3135
25 Ga0070683_100079552 3300005329 Bacteria 3068
26 Ga0070683_100295306 3300005329 Bacteria 1541
27 Ga0070683_100654781 3300005329 Unclassified 1006
28 Ga0070690_100093389 3300005330 Bacteria 1984
29 Ga0070670_100015769 3300005331 Bacteria 6488
30 Ga0070670_100133826 3300005331 Bacteria 2142
31 Ga0070670_100437573 3300005331 Bacteria 1158
32 Ga0070677_10003217 3300005333 Bacteria 5253
33 Ga0070677_10078348 3300005333 Bacteria 1408
34 Ga0070666_10080586 3300005335 Bacteria 2225
35 Ga0070666_10086370 3300005335 Bacteria 2149
36 Ga0070666_10174751 3300005335 Bacteria 1505
37 Ga0070680_100000167 3300005336 Bacteria 41644
38 Ga0070680_100198990 3300005336 Bacteria 1689
39 Ga0070680_100282865 3300005336 Bacteria 1405
40 Ga0070682_100058029 3300005337 Bacteria 2440
41 Ga0070682_100418227 3300005337 Unclassified 1018
42 Ga0068868_100119755 3300005338 Bacteria 2146
43 Ga0068868_100339077 3300005338 Bacteria 1285
44 Ga0070660_100121957 3300005339 Bacteria 2080
45 Ga0070660_100130154 3300005339 Unclassified 2013
46 Ga0070689_100028747 3300005340 Bacteria 4205
47 Ga0070689_100038912 3300005340 Bacteria 3639
48 Ga0070689_100045684 3300005340 Bacteria 3373
49 Ga0070689_100288962 3300005340 Unclassified 1362
50 Ga0070691_10058410 3300005341 Unclassified 1852
51 Ga0070691_10142696 3300005341 Bacteria 1222
52 Ga0070687_100000971 3300005343 Bacteria 9753
53 Ga0070687_100003161 3300005343 Bacteria 6352
54 Ga0070687_100100358 3300005343 Bacteria 1619
55 Ga0070661_100010642 3300005344 Bacteria 6401
56 Ga0070661_100095197 3300005344 Unclassified 2208
57 Ga0070661_100645116 3300005344 Bacteria 859
58 Ga0070668_100019705 3300005347 Bacteria 5080
59 Ga0070668_100042798 3300005347 Bacteria 3471
60 Ga0070668_100044752 3300005347 Bacteria 3396
61 Ga0070668_100165816 3300005347 Bacteria 1795
62 Ga0070668_100313903 3300005347 Bacteria 1318
63 Ga0070669_100002728 3300005353 Bacteria 12738
64 Ga0070675_100025100 3300005354 Bacteria 4776
65 Ga0070675_100046201 3300005354 Bacteria 3565
66 Ga0070675_100070042 3300005354 Bacteria 2906
67 Ga0070675_100132259 3300005354 Bacteria 2127
68 Ga0070675_100207968 3300005354 Bacteria 1700
69 Ga0070675_100211794 3300005354 Bacteria 1685
70 Ga0070675_100493744 3300005354 Bacteria 1102
71 Ga0070671_100014818 3300005355 Bacteria 6298
72 Ga0070671_100015101 3300005355 Bacteria 6237
73 Ga0070671_100110023 3300005355 Bacteria 2314
74 Ga0070671_100263125 3300005355 Bacteria 1466
75 Ga0070671_100511864 3300005355 Bacteria 1033
76 Ga0070671_100583664 3300005355 Bacteria 965
77 Ga0070674_100000385 3300005356 Bacteria 22118
78 Ga0070674_100001895 3300005356 Bacteria 11362
79 Ga0070674_100078859 3300005356 Bacteria 2348
80 Ga0070674_100180017 3300005356 Bacteria 1618
81 Ga0070673_100007148 3300005364 Bacteria 7333
82 Ga0070673_100007562 3300005364 Bacteria 7182
83 Ga0070673_100036588 3300005364 Bacteria 3733
84 Ga0070673_100127557 3300005364 Bacteria 2130
85 Ga0070673_100206753 3300005364 Bacteria 1693
86 Ga0070673_100290350 3300005364 Bacteria 1437
87 Ga0070688_100011471 3300005365 Bacteria 4924
88 Ga0070688_100027570 3300005365 Bacteria 3384
89 Ga0070688_100135804 3300005365 Bacteria 1665
90 Ga0070659_100004159 3300005366 Bacteria 10321
91 Ga0070659_100027270 3300005366 Bacteria 4400
92 Ga0070659_100042201 3300005366 Bacteria 3566
93 Ga0070667_100077349 3300005367 Bacteria 2841
94 Ga0070667_100080903 3300005367 Bacteria 2779
95 Ga0070667_100161058 3300005367 Bacteria 1976
96 Ga0070709_10011001 3300005434 Bacteria 5027
97 Ga0070709_10029691 3300005434 Bacteria 3274
98 Ga0070709_10034393 3300005434 Bacteria 3072
99 Ga0070709_10292828 3300005434 Bacteria 1187
100 Ga0070709_10401858 3300005434 Unclassified 1023
101 Ga0070714_100071808 3300005435 Bacteria 2994
102 Ga0070714_100095456 3300005435 Bacteria 2611
103 Ga0070714_100112466 3300005435 Bacteria 2413
104 Ga0070714_100119069 3300005435 Bacteria 2346
105 Ga0070714_100196016 3300005435 Bacteria 1845
106 Ga0070714_100212954 3300005435 Bacteria 1772
107 Ga0070714_100256501 3300005435 Bacteria 1618
108 Ga0070714_100470019 3300005435 Bacteria 1196
109 Ga0070713_100000084 3300005436 Bacteria 59438
110 Ga0070713_100002024 3300005436 Bacteria 13097
111 Ga0070713_100006573 3300005436 Bacteria 8078
112 Ga0070713_100028305 3300005436 Bacteria 4424
113 Ga0070713_100029007 3300005436 Bacteria 4376
114 Ga0070713_100029331 3300005436 Bacteria 4356
115 Ga0070713_100030673 3300005436 Bacteria 4272
116 Ga0070713_100086436 3300005436 Bacteria 2689
117 Ga0070713_100095905 3300005436 Bacteria 2560
118 Ga0070713_100438091 3300005436 Bacteria 1226
119 Ga0070710_10021880 3300005437 Bacteria 3338
120 Ga0070710_10063306 3300005437 Bacteria 2113
121 Ga0070710_10081138 3300005437 Bacteria 1893
122 Ga0070710_10109883 3300005437 Bacteria 1655
123 Ga0070710_10205031 3300005437 Bacteria 1247
124 Ga0070711_100012633 3300005439 Bacteria 5281
125 Ga0070711_100024494 3300005439 Bacteria 3936
126 Ga0070711_100028675 3300005439 Bacteria 3665
127 Ga0070711_100034503 3300005439 Bacteria 3375
128 Ga0070711_100052699 3300005439 Bacteria 2801
129 Ga0070711_100090239 3300005439 Bacteria 2207
130 Ga0070711_100180687 3300005439 Bacteria 1615
131 Ga0070711_100319002 3300005439 Bacteria 1241
132 Ga0070711_100372581 3300005439 Bacteria 1152
133 Ga0070711_100437066 3300005439 Bacteria 1069
134 Ga0070705_100089202 3300005440 Unclassified 1916
135 Ga0070705_100096901 3300005440 Bacteria 1853
136 Ga0070705_100104837 3300005440 Bacteria 1794
137 Ga0070705_100509165 3300005440 Unclassified 915
138 Ga0070700_100044965 3300005441 Bacteria 2722
139 Ga0070694_100036313 3300005444 Bacteria 3264
140 Ga0070708_100011000 3300005445 Bacteria 7353
141 Ga0070708_100031125 3300005445 Bacteria 4616
142 Ga0070708_100077831 3300005445 Bacteria 2997
143 Ga0070708_100105638 3300005445 Bacteria 2584
144 Ga0070708_100190968 3300005445 Bacteria 1915
145 Ga0070708_100279465 3300005445 Bacteria 1571
146 Ga0070663_100077985 3300005455 Bacteria 2427
147 Ga0070663_100192482 3300005455 Unclassified 1588
148 Ga0070678_100003379 3300005456 Bacteria 8898
149 Ga0070678_100022634 3300005456 Bacteria 4170
150 Ga0070678_100048545 3300005456 Bacteria 3057
151 Ga0070678_100476614 3300005456 Bacteria 1097
152 Ga0070662_100000649 3300005457 Bacteria 21039
153 Ga0070662_100171046 3300005457 Bacteria 1706
154 Ga0070662_100314978 3300005457 Bacteria 1275
155 Ga0070662_100432539 3300005457 Bacteria 1090
156 Ga0070681_10008068 3300005458 Bacteria 10304
157 Ga0070681_10014788 3300005458 Bacteria 7761
158 Ga0070681_10104124 3300005458 Bacteria 2781
159 Ga0070681_10182844 3300005458 Unclassified 2017
160 Ga0070681_10345875 3300005458 Bacteria 1397
161 Ga0070681_10502648 3300005458 Bacteria 1125
162 Ga0068867_100006869 3300005459 Bacteria 8052
163 Ga0068867_100074517 3300005459 Bacteria 2544
164 Ga0070685_10051874 3300005466 Bacteria 2372
165 Ga0070706_100000072 3300005467 Bacteria 117347
166 Ga0070706_100015531 3300005467 Bacteria 7033
167 Ga0070706_100021589 3300005467 Bacteria 5928
168 Ga0070706_100061960 3300005467 Bacteria 3455
169 Ga0070706_100196623 3300005467 Bacteria 1884
170 Ga0070706_100205592 3300005467 Bacteria 1839
171 Ga0070706_100215066 3300005467 Bacteria 1794
172 Ga0070707_100001205 3300005468 Bacteria 25431
173 Ga0070707_100009587 3300005468 Bacteria 8994
174 Ga0070707_100010644 3300005468 Bacteria 8569
175 Ga0070707_100196271 3300005468 Bacteria 1968
176 Ga0070707_100329923 3300005468 Bacteria 1482
177 Ga0070698_100007279 3300005471 Bacteria 11988
178 Ga0070698_100037594 3300005471 Bacteria 4990
179 Ga0070698_100134167 3300005471 Bacteria 2430
180 Ga0070698_100224697 3300005471 Bacteria 1811
181 Ga0070699_100004356 3300005518 Bacteria 12508
182 Ga0070699_100005682 3300005518 Bacteria 10923
183 Ga0070699_100006883 3300005518 Bacteria 9888
184 Ga0070699_100046134 3300005518 Bacteria 3771
185 Ga0070699_100168462 3300005518 Bacteria 1940
186 Ga0070699_100215513 3300005518 Bacteria 1710
187 Ga0070679_100028867 3300005530 Bacteria 5472
188 Ga0070679_100039953 3300005530 Bacteria 4664
189 Ga0070679_100097630 3300005530 Bacteria 2925
190 Ga0070679_100105508 3300005530 Bacteria 2804
191 Ga0070679_100154858 3300005530 Bacteria 2267
192 Ga0070679_100630759 3300005530 Bacteria 1015
193 Ga0070684_100293881 3300005535 Bacteria 1490
194 Ga0070684_100441881 3300005535 Unclassified 1202
195 Ga0070684_100565985 3300005535 Bacteria 1055
196 Ga0070697_100000113 3300005536 Bacteria 63284
197 Ga0070697_100001895 3300005536 Bacteria 15983
198 Ga0070697_100003932 3300005536 Bacteria 11419
199 Ga0070697_100024116 3300005536 Bacteria 4842
200 Ga0070697_100034025 3300005536 Bacteria 4107
201 Ga0070697_100083096 3300005536 Bacteria 2641
202 Ga0070697_100099882 3300005536 Bacteria 2409
203 Ga0070697_100106261 3300005536 Bacteria 2335
204 Ga0070697_100140650 3300005536 Bacteria 2030
205 Ga0070697_100158636 3300005536 Bacteria 1911
206 Ga0070697_100395608 3300005536 Bacteria 1198
207 Ga0070697_100496256 3300005536 Unclassified 1067
208 Ga0070697_100719700 3300005536 Unclassified 881
209 Ga0070672_100003922 3300005543 Bacteria 9694
210 Ga0070672_100011647 3300005543 Bacteria 6138
211 Ga0070672_100059204 3300005543 Bacteria 3013
212 Ga0070672_100100272 3300005543 Bacteria 2348
213 Ga0070672_100189597 3300005543 Bacteria 1716
214 Ga0070686_100002480 3300005544 Bacteria 10158
215 Ga0070686_100133026 3300005544 Bacteria 1722
216 Ga0070686_100504344 3300005544 Bacteria 939
217 Ga0070695_100040020 3300005545 Bacteria 2966
218 Ga0070695_100044557 3300005545 Unclassified 2825
219 Ga0070696_100022055 3300005546 Bacteria 4323
220 Ga0070696_100026183 3300005546 Bacteria 3967
221 Ga0070696_100185202 3300005546 Bacteria 1547
222 Ga0070693_100080754 3300005547 Unclassified 1938
223 Ga0070665_100049286 3300005548 Bacteria 4227
224 Ga0070665_100099430 3300005548 Bacteria 2913
225 Ga0070665_100129865 3300005548 Bacteria 2522
226 Ga0070665_100195255 3300005548 Bacteria 2025
227 Ga0070665_100293203 3300005548 Bacteria 1629
228 Ga0070704_100020423 3300005549 Bacteria 4270
229 Ga0070704_100022697 3300005549 Bacteria 4087
230 Ga0070704_100131276 3300005549 Bacteria 1942
231 Ga0070704_100305713 3300005549 Unclassified 1327
232 Ga0070704_100512451 3300005549 Bacteria 1043
233 Ga0068855_100164779 3300005563 Bacteria 2513
234 Ga0068855_100224487 3300005563 Bacteria 2105
235 Ga0068855_100405617 3300005563 Bacteria 1493
236 Ga0070664_100013086 3300005564 Bacteria 6753
237 Ga0068857_100013918 3300005577 Bacteria 7001
238 Ga0068857_100070415 3300005577 Bacteria 3115
239 Ga0068857_100079273 3300005577 Bacteria 2932
240 Ga0068854_100032206 3300005578 Bacteria 3646
241 Ga0068854_100095806 3300005578 Bacteria 2216
242 Ga0068854_100110612 3300005578 Bacteria 2072
243 Ga0068856_100000755 3300005614 Bacteria 35138
244 Ga0068856_100004317 3300005614 Bacteria 14185
245 Ga0068856_100198027 3300005614 Bacteria 2023
246 Ga0068856_100320199 3300005614 Bacteria 1568
247 Ga0068856_100489945 3300005614 Bacteria 1250
248 Ga0068856_100510735 3300005614 Bacteria 1223
249 Ga0070702_100248015 3300005615 Bacteria 1205
250 Ga0068859_100710636 3300005617 Bacteria 1095
251 Ga0068859_100965094 3300005617 Unclassified 935
252 Ga0068864_100085454 3300005618 Bacteria 2774
253 Ga0068864_100153317 3300005618 Bacteria 2089
254 Ga0068866_10070469 3300005718 Bacteria 1846
255 Ga0068861_100041952 3300005719 Bacteria 3429
256 Ga0068870_10007417 3300005840 Bacteria 4887
257 Ga0068863_100150975 3300005841 Bacteria 2223
258 Ga0068863_100280048 3300005841 Bacteria 1615
259 Ga0068858_100443499 3300005842 Bacteria 1250
260 Ga0068858_100765182 3300005842 Unclassified 941
261 Ga0068860_100017560 3300005843 Bacteria 6971
262 Ga0068860_100061892 3300005843 Bacteria 3556
263 Ga0068860_100351291 3300005843 Bacteria 1451
264 Ga0068860_100454300 3300005843 Bacteria 1274
265 Ga0068862_100046907 3300005844 Bacteria 3686
266 Ga0081539_10063094 3300005985 Bacteria 2023
267 Ga0070717_10001346 3300006028 Bacteria 16894
268 Ga0070717_10005388 3300006028 Bacteria 9339
269 Ga0070717_10028889 3300006028 Bacteria 4443
270 Ga0070717_10036469 3300006028 Bacteria 3988
271 Ga0070717_10127444 3300006028 Bacteria 2186
272 Ga0070717_10223172 3300006028 Bacteria 1657
273 Ga0070717_10253844 3300006028 Bacteria 1554
274 Ga0070717_10305741 3300006028 Bacteria 1414
275 Ga0070717_10329370 3300006028 Bacteria 1362
276 Ga0070717_10371879 3300006028 Unclassified 1281
277 Ga0075432_10001294 3300006058 Bacteria 8074
278 Ga0070715_10016525 3300006163 Bacteria 2774
279 Ga0070715_10062330 3300006163 Bacteria 1640
280 Ga0070716_100000274 3300006173 Bacteria 20780
281 Ga0070716_100019584 3300006173 Bacteria 3538
282 Ga0070716_100052972 3300006173 Bacteria 2312
283 Ga0070716_100138986 3300006173 Bacteria 1546
284 Ga0070716_100148151 3300006173 Bacteria 1506
285 Ga0070716_100364917 3300006173 Bacteria 1027
286 Ga0070716_100592064 3300006173 Unclassified 833
287 Ga0070712_100000106 3300006175 Bacteria 43079
288 Ga0070712_100004726 3300006175 Bacteria 8423
289 Ga0070712_100008733 3300006175 Bacteria 6380
290 Ga0070712_100024347 3300006175 Bacteria 4011
291 Ga0070712_100176607 3300006175 Bacteria 1661
292 Ga0070712_100236060 3300006175 Bacteria 1454
293 Ga0075427_10003926 3300006194 Bacteria 2075
294 Ga0097621_100001385 3300006237 Bacteria 16681
295 Ga0097621_100009158 3300006237 Bacteria 7178
296 Ga0097621_100017018 3300006237 Bacteria 5513
297 Ga0097621_100020222 3300006237 Bacteria 5128
298 Ga0097621_100056388 3300006237 Bacteria 3210
299 Ga0097621_100575347 3300006237 Unclassified 1027
300 Ga0068871_100009154 3300006358 Bacteria 7157
301 Ga0068871_100010844 3300006358 Bacteria 6671
302 Ga0068871_100113889 3300006358 Bacteria 2278
303 Ga0075428_100013513 3300006844 Bacteria 9088
304 Ga0075428_100018113 3300006844 Bacteria 7782
305 Ga0075430_100008311 3300006846 Bacteria 8768
306 Ga0075431_100070518 3300006847 Bacteria 3606
307 Ga0075433_10000913 3300006852 Bacteria 20789
308 Ga0075433_10014277 3300006852 Bacteria 6487
309 Ga0075433_10125800 3300006852 Bacteria 2276
310 Ga0075434_100000253 3300006871 Bacteria 37649
311 Ga0075434_100019249 3300006871 Bacteria 6604
312 Ga0075434_100019639 3300006871 Bacteria 6540
313 Ga0075434_100234340 3300006871 Bacteria 1855
314 Ga0075434_100519001 3300006871 Bacteria 1212
315 Ga0075434_100965503 3300006871 Bacteria 866
316 Ga0068865_100004508 3300006881 Bacteria 8405
317 Ga0068865_100021768 3300006881 Bacteria 4173
318 Ga0075436_100026097 3300006914 Bacteria 4022
319 Ga0075436_100041976 3300006914 Bacteria 3154
320 Ga0097620_100710719 3300006931 Bacteria 1095
321 Ga0097620_100965147 3300006931 Unclassified 935
322 Ga0075435_100000234 3300007076 Bacteria 34046
323 Ga0075435_100001191 3300007076 Bacteria 16636
324 Ga0075435_100053921 3300007076 Bacteria 3244
325 Ga0075435_100308659 3300007076 Bacteria 1354
326 Ga0099794_10018509 3300007265 Bacteria 3125
327 Ga0099794_10154215 3300007265 Bacteria 1166
328 Ga0099795_10019095 3300007788 Unclassified 2213
329 Ga0099795_10020654 3300007788 Bacteria 2149
330 Ga0105240_10021993 3300009093 Bacteria 8471
331 Ga0105240_10039955 3300009093 Bacteria 6005
332 Ga0105240_10067425 3300009093 Bacteria 4435
333 Ga0105240_10397616 3300009093 Bacteria 1553
334 Ga0105240_10496370 3300009093 Bacteria 1358
335 Ga0111539_10062241 3300009094 Bacteria 4418
336 Ga0111539_10062696 3300009094 Bacteria 4400
337 Ga0111539_10118643 3300009094 Bacteria 3101
338 Ga0111539_10511603 3300009094 Unclassified 1398
339 Ga0111539_10513411 3300009094 Bacteria 1396
340 Ga0111539_10725872 3300009094 Bacteria 1157
341 Ga0111539_10976792 3300009094 Bacteria 985
342 Ga0105245_10006914 3300009098 Bacteria 9948
343 Ga0105245_10008205 3300009098 Bacteria 9133
344 Ga0105245_10008208 3300009098 Bacteria 9130
345 Ga0105245_10482715 3300009098 Bacteria 1253
346 Ga0105247_10321326 3300009101 Bacteria 1080
347 Ga0105247_10527773 3300009101 Bacteria 864
348 Ga0114129_10017199 3300009147 Bacteria 10299
349 Ga0114129_10024476 3300009147 Bacteria 8555
350 Ga0114129_10114977 3300009147 Bacteria 3710
351 Ga0114129_10270845 3300009147 Bacteria 2272
352 Ga0114129_10489715 3300009147 Bacteria 1607
353 Ga0105243_10000414 3300009148 Bacteria 44876
354 Ga0105241_10138141 3300009174 Bacteria 1981
355 Ga0105241_10172763 3300009174 Unclassified 1786
356 Ga0105241_10631788 3300009174 Bacteria 971
357 Ga0105242_10005509 3300009176 Bacteria 9772
358 Ga0105242_10111522 3300009176 Bacteria 2333
359 Ga0105242_10559993 3300009176 Bacteria 1097
360 Ga0105242_10696010 3300009176 Bacteria 994
361 Ga0105248_10042569 3300009177 Bacteria 5094
362 Ga0105237_10011974 3300009545 Bacteria 9168
363 Ga0105237_10229475 3300009545 Bacteria 1857
364 Ga0105237_10347353 3300009545 Bacteria 1488
365 Ga0105238_10173474 3300009551 Bacteria 2133
366 Ga0105249_10003933 3300009553 Bacteria 12831
367 Ga0105249_10873438 3300009553 Bacteria 966
368 Ga0099796_10006841 3300010159 Bacteria 2944
369 Ga0099796_10025714 3300010159 Bacteria 1862
370 Ga0099796_10087847 3300010159 Bacteria 1151
371 Ga0105239_10113753 3300010375 Bacteria 3001
372 Ga0105239_10115581 3300010375 Bacteria 2977
373 Ga0105239_10549006 3300010375 Bacteria 1316
374 Ga0105246_10000130 3300011119 Bacteria 35001
375 Ga0105246_10159389 3300011119 Bacteria 1717
376 Ga0105246_10211157 3300011119 Bacteria 1515
377 Ga0157373_10003878 3300013100 Bacteria 11302
378 Ga0157373_10028714 3300013100 Bacteria 4012
379 Ga0157371_10019095 3300013102 Bacteria 5061
380 Ga0157371_10157736 3300013102 Unclassified 1620
381 Ga0157370_10027500 3300013104 Bacteria 5608
382 Ga0157370_10043493 3300013104 Bacteria 4322
383 Ga0157370_10204582 3300013104 Bacteria 1831
384 Ga0157369_10009595 3300013105 Bacteria 11068
385 Ga0157369_10088489 3300013105 Bacteria 3305
386 Ga0157369_10188680 3300013105 Unclassified 2167
387 Ga0157369_10459371 3300013105 Unclassified 1318
388 Ga0157369_10552930 3300013105 Bacteria 1189
389 Ga0157374_10000068 3300013296 Bacteria 106195
390 Ga0157374_10004858 3300013296 Bacteria 11282
391 Ga0157374_10015477 3300013296 Bacteria 6690
392 Ga0157374_10140802 3300013296 Bacteria 2341
393 Ga0157374_10322630 3300013296 Unclassified 1531
394 Ga0157378_10002374 3300013297 Bacteria 16730
395 Ga0157378_10003652 3300013297 Bacteria 13632
396 Ga0157378_10072539 3300013297 Bacteria 3094
397 Ga0157378_10239427 3300013297 Unclassified 1733
398 Ga0157378_10327168 3300013297 Unclassified 1491
399 Ga0157378_10363890 3300013297 Bacteria 1416
400 Ga0157378_10487893 3300013297 Bacteria 1229
401 Ga0163162_10003595 3300013306 Bacteria 14843
402 Ga0163162_10117183 3300013306 Bacteria 2765
403 Ga0163162_10185584 3300013306 Bacteria 2207
404 Ga0163162_10906082 3300013306 Unclassified 995
405 Ga0157372_10004816 3300013307 Bacteria 14345
406 Ga0157372_10006638 3300013307 Bacteria 12316
407 Ga0157372_10011099 3300013307 Bacteria 9581
408 Ga0157372_10013707 3300013307 Bacteria 8665
409 Ga0157372_10018858 3300013307 Bacteria 7423
410 Ga0157372_10022540 3300013307 Bacteria 6815
411 Ga0157372_10162946 3300013307 Unclassified 2578
412 Ga0157372_10251333 3300013307 Bacteria 2052
413 Ga0157372_10440517 3300013307 Bacteria 1519
414 Ga0157375_10002248 3300013308 Bacteria 16689
415 Ga0157375_10043724 3300013308 Bacteria 4347
416 Ga0157375_10072099 3300013308 Bacteria 3469
417 Ga0157375_10260513 3300013308 Bacteria 1896
418 Ga0157375_10280219 3300013308 Bacteria 1830
419 Ga0157375_10444360 3300013308 Bacteria 1462
420 Ga0157375_11287844 3300013308 Bacteria 859
421 Ga0163163_10057762 3300014325 Bacteria 3837
422 Ga0163163_10085528 3300014325 Bacteria 3162
423 Ga0163163_10257064 3300014325 Bacteria 1797
424 Ga0163163_10335189 3300014325 Bacteria 1568
425 Ga0157380_10038409 3300014326 Bacteria 3717
426 Ga0182008_10080573 3300014497 Unclassified 1602
427 Ga0157377_10005381 3300014745 Bacteria 6012
428 Ga0157379_10027874 3300014968 Bacteria 5027
429 Ga0157379_10046103 3300014968 Bacteria 3891
430 Ga0157376_10001790 3300014969 Bacteria 14318
431 Ga0157376_10002339 3300014969 Bacteria 12795
432 Ga0157376_10014931 3300014969 Bacteria 5852
433 Ga0157376_10130612 3300014969 Bacteria 2241
434 Ga0157376_10991132 3300014969 Unclassified 862
435 Ga0182006_1008826 3300015261 Unclassified 4553
436 Ga0182006_1057475 3300015261 Bacteria 1479
437 Ga0182007_10006678 3300015262 Bacteria 4931
438 Ga0182005_1039451 3300015265 Bacteria 1284
439 Ga0163161_10063788 3300017792 Bacteria 2686
440 Ga0163161_10147410 3300017792 Bacteria 1786
441 Ga0206356_11396592 3300020070 Bacteria 1982
442 Ga0213872_10084408 3300021361 Bacteria 1424
443 Ga0213876_10046543 3300021384 Bacteria 2293
444 Ga0207666_1029196 3300025271 Unclassified 840
445 Ga0207697_10000465 3300025315 Bacteria 22852
446 Ga0207697_10006542 3300025315 Bacteria 5259
447 Ga0207697_10014431 3300025315 Bacteria 3276
448 Ga0207682_10008155 3300025893 Bacteria 4153
449 Ga0207682_10033499 3300025893 Bacteria 2069
450 Ga0207692_10015719 3300025898 Bacteria 3338
451 Ga0207692_10025075 3300025898 Bacteria 2781
452 Ga0207692_10166737 3300025898 Bacteria 1273
453 Ga0207642_10062879 3300025899 Bacteria 1734
454 Ga0207642_10217441 3300025899 Bacteria 1066
455 Ga0207688_10001108 3300025901 Bacteria 13831
456 Ga0207688_10001495 3300025901 Bacteria 12265
457 Ga0207688_10034388 3300025901 Bacteria 2807
458 Ga0207688_10035459 3300025901 Bacteria 2764
459 Ga0207688_10126338 3300025901 Bacteria 1496
460 Ga0207680_10021953 3300025903 Bacteria 3464
461 Ga0207680_10205787 3300025903 Bacteria 1343
462 Ga0207647_10202087 3300025904 Bacteria 1149
463 Ga0207699_10000756 3300025906 Bacteria 15451
464 Ga0207699_10029346 3300025906 Bacteria 3067
465 Ga0207699_10062799 3300025906 Bacteria 2241
466 Ga0207699_10078612 3300025906 Bacteria 2038
467 Ga0207645_10000012 3300025907 Bacteria 131374
468 Ga0207645_10002843 3300025907 Bacteria 13430
469 Ga0207645_10118907 3300025907 Bacteria 1714
470 Ga0207645_10298811 3300025907 Bacteria 1072
471 Ga0207643_10011714 3300025908 Bacteria 4738
472 Ga0207705_10123098 3300025909 Bacteria 1926
473 Ga0207684_10038482 3300025910 Bacteria 4058
474 Ga0207684_10053255 3300025910 Bacteria 3435
475 Ga0207684_10192263 3300025910 Bacteria 1760
476 Ga0207654_10020414 3300025911 Bacteria 3511
477 Ga0207707_10014117 3300025912 Bacteria 6961
478 Ga0207707_10051140 3300025912 Bacteria 3598
479 Ga0207707_10060653 3300025912 Bacteria 3290
480 Ga0207695_10007980 3300025913 Bacteria 13347
481 Ga0207695_10017288 3300025913 Bacteria 8397
482 Ga0207695_10027313 3300025913 Bacteria 6358
483 Ga0207695_10197137 3300025913 Bacteria 1929
484 Ga0207671_10032357 3300025914 Bacteria 3894
485 Ga0207671_10207703 3300025914 Bacteria 1531
486 Ga0207693_10000033 3300025915 Bacteria 114840
487 Ga0207693_10008418 3300025915 Bacteria 8439
488 Ga0207693_10008661 3300025915 Bacteria 8324
489 Ga0207693_10012562 3300025915 Bacteria 6840
490 Ga0207693_10018610 3300025915 Bacteria 5530
491 Ga0207693_10179322 3300025915 Bacteria 1667
492 Ga0207693_10425485 3300025915 Bacteria 1038
493 Ga0207663_10011327 3300025916 Bacteria 4786
494 Ga0207663_10017700 3300025916 Bacteria 3978
495 Ga0207663_10037325 3300025916 Bacteria 2929
496 Ga0207663_10068994 3300025916 Bacteria 2273
497 Ga0207663_10159346 3300025916 Bacteria 1591
498 Ga0207663_10198015 3300025916 Bacteria 1447
499 Ga0207663_10512979 3300025916 Bacteria 933
500 Ga0207660_10020529 3300025917 Bacteria 4435
501 Ga0207660_10031923 3300025917 Bacteria 3632
502 Ga0207660_10049922 3300025917 Bacteria 2969
503 Ga0207660_10059616 3300025917 Bacteria 2741
504 Ga0207660_10179995 3300025917 Unclassified 1641
505 Ga0207660_10279031 3300025917 Bacteria 1326
506 Ga0207662_10000967 3300025918 Bacteria 13355
507 Ga0207662_10016291 3300025918 Bacteria 4192
508 Ga0207657_10005628 3300025919 Bacteria 13078
509 Ga0207657_10044352 3300025919 Unclassified 3909
510 Ga0207657_10093755 3300025919 Bacteria 2501
511 Ga0207657_10148702 3300025919 Bacteria 1909
512 Ga0207649_10052791 3300025920 Bacteria 2523
513 Ga0207652_10008847 3300025921 Bacteria 8111
514 Ga0207652_10051815 3300025921 Bacteria 3520
515 Ga0207652_10063841 3300025921 Bacteria 3185
516 Ga0207652_10121725 3300025921 Bacteria 2322
517 Ga0207652_10254960 3300025921 Bacteria 1582
518 Ga0207652_10334022 3300025921 Unclassified 1368
519 Ga0207652_10696971 3300025921 Bacteria 906
520 Ga0207646_10002936 3300025922 Bacteria 19762
521 Ga0207646_10040006 3300025922 Bacteria 4219
522 Ga0207646_10174121 3300025922 Bacteria 1943
523 Ga0207646_10195392 3300025922 Bacteria 1827
524 Ga0207646_10586852 3300025922 Unclassified 1001
525 Ga0207681_10016862 3300025923 Bacteria 4579
526 Ga0207681_10057151 3300025923 Bacteria 2664
527 Ga0207650_10038372 3300025925 Bacteria 3497
528 Ga0207650_10244445 3300025925 Bacteria 1451
529 Ga0207659_10004515 3300025926 Bacteria 8416
530 Ga0207659_10026996 3300025926 Bacteria 3882
531 Ga0207659_10034581 3300025926 Bacteria 3486
532 Ga0207659_10064578 3300025926 Bacteria 2649
533 Ga0207659_10129473 3300025926 Bacteria 1946
534 Ga0207659_10320807 3300025926 Bacteria 1278
535 Ga0207687_10011501 3300025927 Bacteria 5784
536 Ga0207687_10022484 3300025927 Bacteria 4197
537 Ga0207687_10305823 3300025927 Bacteria 1282
538 Ga0207700_10000902 3300025928 Bacteria 17046
539 Ga0207700_10009675 3300025928 Bacteria 6036
540 Ga0207700_10013431 3300025928 Bacteria 5328
541 Ga0207700_10016833 3300025928 Bacteria 4868
542 Ga0207700_10033007 3300025928 Bacteria 3700
543 Ga0207700_10035245 3300025928 Bacteria 3603
544 Ga0207700_10042396 3300025928 Bacteria 3336
545 Ga0207700_10045699 3300025928 Bacteria 3233
546 Ga0207700_10054135 3300025928 Bacteria 3010
547 Ga0207700_10116301 3300025928 Bacteria 2161
548 Ga0207700_10188026 3300025928 Bacteria 1734
549 Ga0207700_10210597 3300025928 Bacteria 1643
550 Ga0207700_10821464 3300025928 Bacteria 831
551 Ga0207664_10000097 3300025929 Bacteria 80906
552 Ga0207664_10081918 3300025929 Bacteria 2627
553 Ga0207664_10121407 3300025929 Bacteria 2187
554 Ga0207664_10139134 3300025929 Bacteria 2051
555 Ga0207664_10192361 3300025929 Bacteria 1757
556 Ga0207664_10238151 3300025929 Bacteria 1584
557 Ga0207664_10506177 3300025929 Bacteria 1082
558 Ga0207644_10010293 3300025931 Bacteria 6164
559 Ga0207644_10011125 3300025931 Bacteria 5944
560 Ga0207644_10075836 3300025931 Bacteria 2472
561 Ga0207644_10102781 3300025931 Bacteria 2150
562 Ga0207644_10118296 3300025931 Bacteria 2013
563 Ga0207644_10289089 3300025931 Bacteria 1318
564 Ga0207644_10586288 3300025931 Bacteria 925
565 Ga0207690_10038078 3300025932 Bacteria 3127
566 Ga0207690_10182791 3300025932 Bacteria 1580
567 Ga0207706_10002781 3300025933 Bacteria 17009
568 Ga0207706_10032159 3300025933 Unclassified 4672
569 Ga0207706_10125657 3300025933 Bacteria 2256
570 Ga0207706_10176569 3300025933 Bacteria 1876
571 Ga0207706_10237179 3300025933 Bacteria 1595
572 Ga0207706_10296370 3300025933 Bacteria 1409
573 Ga0207686_10035362 3300025934 Bacteria 2998
574 Ga0207686_10106991 3300025934 Bacteria 1879
575 Ga0207686_10279144 3300025934 Bacteria 1232
576 Ga0207709_10017882 3300025935 Bacteria 3963
577 Ga0207670_10004496 3300025936 Bacteria 7515
578 Ga0207670_10032753 3300025936 Bacteria 3344
579 Ga0207670_10317871 3300025936 Bacteria 1224
580 Ga0207669_10006395 3300025937 Bacteria 5380
581 Ga0207669_10015129 3300025937 Bacteria 3882
582 Ga0207669_10124918 3300025937 Bacteria 1755
583 Ga0207669_10269063 3300025937 Bacteria 1279
584 Ga0207704_10001929 3300025938 Bacteria 9284
585 Ga0207704_10014560 3300025938 Bacteria 3975
586 Ga0207665_10000176 3300025939 Bacteria 42953
587 Ga0207665_10007817 3300025939 Bacteria 7057
588 Ga0207665_10017360 3300025939 Bacteria 4729
589 Ga0207665_10048055 3300025939 Bacteria 2863
590 Ga0207665_10057546 3300025939 Bacteria 2626
591 Ga0207665_10092172 3300025939 Bacteria 2101
592 Ga0207665_10177803 3300025939 Bacteria 1540
593 Ga0207665_10526265 3300025939 Unclassified 916
594 Ga0207691_10000097 3300025940 Bacteria 76545
595 Ga0207691_10000155 3300025940 Bacteria 63923
596 Ga0207691_10020569 3300025940 Bacteria 6240
597 Ga0207691_10029883 3300025940 Bacteria 5097
598 Ga0207691_10189891 3300025940 Bacteria 1792
599 Ga0207661_10105275 3300025944 Bacteria 2377
600 Ga0207661_10587956 3300025944 Bacteria 1021
601 Ga0207679_10003563 3300025945 Bacteria 9649
602 Ga0207679_10004282 3300025945 Bacteria 8867
603 Ga0207679_10127698 3300025945 Bacteria 2035
604 Ga0207679_10259927 3300025945 Bacteria 1480
605 Ga0207667_10210645 3300025949 Bacteria 1992
606 Ga0207667_11001329 3300025949 Bacteria 823
607 Ga0207651_10014892 3300025960 Bacteria 4503
608 Ga0207651_10033902 3300025960 Bacteria 3299
609 Ga0207651_10038422 3300025960 Bacteria 3146
610 Ga0207651_10260527 3300025960 Bacteria 1423
611 Ga0207651_10333252 3300025960 Bacteria 1272
612 Ga0207712_10042926 3300025961 Bacteria 3117
613 Ga0207712_10080983 3300025961 Bacteria 2363
614 Ga0207712_10188194 3300025961 Bacteria 1627
615 Ga0207668_10009679 3300025972 Bacteria 5788
616 Ga0207668_10030284 3300025972 Bacteria 3555
617 Ga0207668_10193517 3300025972 Bacteria 1614
618 Ga0207640_10020256 3300025981 Bacteria 3948
619 Ga0207640_10058904 3300025981 Bacteria 2532
620 Ga0207640_10391940 3300025981 Bacteria 1128
621 Ga0207677_10011704 3300026023 Bacteria 5010
622 Ga0207677_10064600 3300026023 Bacteria 2550
623 Ga0207677_10090363 3300026023 Bacteria 2225
624 Ga0207677_10337447 3300026023 Bacteria 1258
625 Ga0207677_10454822 3300026023 Bacteria 1098
626 Ga0207639_10036735 3300026041 Unclassified 3632
627 Ga0207678_10035266 3300026067 Bacteria 4356
628 Ga0207708_10000199 3300026075 Bacteria 47758
629 Ga0207702_10000137 3300026078 Bacteria 88042
630 Ga0207702_10002313 3300026078 Bacteria 18218
631 Ga0207702_10077834 3300026078 Bacteria 2869
632 Ga0207702_10163809 3300026078 Bacteria 2032
633 Ga0207702_10303406 3300026078 Bacteria 1516
634 Ga0207702_10326734 3300026078 Bacteria 1462
635 Ga0207702_10592999 3300026078 Unclassified 1087
636 Ga0207641_10055242 3300026088 Unclassified 3372
637 Ga0207641_10066193 3300026088 Unclassified 3093
638 Ga0207641_10281456 3300026088 Bacteria 1564
639 Ga0207648_10000064 3300026089 Bacteria 99090
640 Ga0207648_10005435 3300026089 Bacteria 12838
641 Ga0207648_10122582 3300026089 Bacteria 2286
642 Ga0207648_10204015 3300026089 Unclassified 1754
643 Ga0207676_10082205 3300026095 Bacteria 2619
644 Ga0207676_10146150 3300026095 Bacteria 2031
645 Ga0207674_10016572 3300026116 Bacteria 8059
646 Ga0207674_10022686 3300026116 Bacteria 6738
647 Ga0207675_100061567 3300026118 Bacteria 3503
648 Ga0207683_10000028 3300026121 Bacteria 109908
649 Ga0207683_10012967 3300026121 Bacteria 7116
650 Ga0207683_10014269 3300026121 Bacteria 6769
651 Ga0207683_10109002 3300026121 Bacteria 2478
652 Ga0207683_10300929 3300026121 Bacteria 1468
653 Ga0207698_10215480 3300026142 Bacteria 1731
654 Ga0209973_1002126 3300027252 Bacteria 1817
655 Ga0209967_1000058 3300027364 Bacteria 14445
656 Ga0209981_1000185 3300027378 Bacteria 7697
657 Ga0209996_1000043 3300027395 Bacteria 18481
658 Ga0210000_1000362 3300027462 Bacteria 6410
659 Ga0209995_1000117 3300027471 Bacteria 12499
660 Ga0209179_1016496 3300027512 Bacteria 1386
661 Ga0209968_1000159 3300027526 Bacteria 11811
662 Ga0209999_1000282 3300027543 Bacteria 7500
663 Ga0209982_1000795 3300027552 Bacteria 4087
664 Ga0209970_1002907 3300027614 Bacteria 2888
665 Ga0210002_1000092 3300027617 Bacteria 14134
666 Ga0209588_1001918 3300027671 Bacteria 5564
667 Ga0209971_1000121 3300027682 Bacteria 23135
668 Ga0209971_1058817 3300027682 Bacteria 930
669 Ga0209966_1000276 3300027695 Bacteria 18110
670 Ga0209998_10000015 3300027717 Bacteria 86345
671 Ga0209974_10000001 3300027876 Bacteria 86862
672 Ga0207428_10000237 3300027907 Bacteria 75743
673 Ga0207428_10036697 3300027907 Bacteria 3995
674 Ga0207428_10120057 3300027907 Bacteria 2016
675 Ga0268266_10047044 3300028379 Bacteria 3693
676 Ga0268266_10091524 3300028379 Bacteria 2667
677 Ga0268266_10272636 3300028379 Bacteria 1571
678 Ga0268266_10731662 3300028379 Bacteria 954
679 Ga0268265_10021702 3300028380 Bacteria 4503
680 Ga0268265_10076558 3300028380 Bacteria 2625
681 Ga0268264_10340025 3300028381 Bacteria 1425
682 Ga0268264_10612036 3300028381 Bacteria 1074
683 Ga0265326_10030582 3300028558 Bacteria 1534
684 Ga0265319_1003474 3300028563 Bacteria 8201
685 Ga0265338_10034702 3300028800 Bacteria 4869
686 Ga0265338_10107225 3300028800 Bacteria 2260
687 Ga0265338_10125037 3300028800 Bacteria 2042
688 Ga0265338_10132461 3300028800 Bacteria 1965
689 Ga0265338_10156753 3300028800 Bacteria 1763
690 Ga0265338_10328794 3300028800 Bacteria 1104
691 Ga0265324_10028559 3300029957 Bacteria 1966
692 Ga0265762_1039079 3300030760 Bacteria 923
693 Ga0265332_10002293 3300031238 Bacteria 9786
694 Ga0265320_10001827 3300031240 Bacteria 15091
695 Ga0265325_10006803 3300031241 Bacteria 6911
696 Ga0265325_10008935 3300031241 Bacteria 5885
697 Ga0265325_10027094 3300031241 Bacteria 3100
698 Ga0265325_10036779 3300031241 Bacteria 2592
699 Ga0265340_10003648 3300031247 Bacteria 8655
700 Ga0265340_10043396 3300031247 Bacteria 2204
701 Ga0265340_10138376 3300031247 Bacteria 1114
702 Ga0265339_10002587 3300031249 Bacteria 12907
703 Ga0265339_10018297 3300031249 Bacteria 4132
704 Ga0265339_10067131 3300031249 Bacteria 1919
705 Ga0265339_10084121 3300031249 Bacteria 1677
706 Ga0265339_10111724 3300031249 Bacteria 1413
707 Ga0265339_10190495 3300031249 Bacteria 1017
708 Ga0265331_10027074 3300031250 Bacteria 2877
709 Ga0265331_10041248 3300031250 Bacteria 2243
710 Ga0265316_10001005 3300031344 Bacteria 30618
711 Ga0265316_10040722 3300031344 Bacteria 3723
712 Ga0265316_10070756 3300031344 Bacteria 2690
713 Ga0265316_10092282 3300031344 Bacteria 2309
714 Ga0265316_10098165 3300031344 Bacteria 2229
715 Ga0265313_10000041 3300031595 Bacteria 119119
716 Ga0265313_10000538 3300031595 Bacteria 39535
717 Ga0265313_10003540 3300031595 Bacteria 12587
718 Ga0265314_10000279 3300031711 Bacteria 74300
719 Ga0265314_10001994 3300031711 Bacteria 21660
720 Ga0265314_10011035 3300031711 Bacteria 7492
721 Ga0265314_10025037 3300031711 Bacteria 4510
722 Ga0265314_10130697 3300031711 Bacteria 1567
723 Ga0265342_10023338 3300031712 Bacteria 3918
724 Ga0265342_10062636 3300031712 Bacteria 2188
725 Ga0307407_10120568 3300031903 Bacteria 1662
726 Ga0307412_10083956 3300031911 Bacteria 2210
727 Ga0307416_100274226 3300032002 Bacteria 1658
728 Ga0316214_1002333 3300033545 Bacteria 2332
729 Ga0373944_0036924 3300035089 Bacteria 1495
730 Ga0373944_0115505 3300035089 Bacteria 920
731 Ga0373936_0007613 3300035113 Bacteria 4070
732 Ga0373936_0019480 3300035113 Bacteria 2629
733 Ga0373936_0063758 3300035113 Bacteria 1509
734 Ga0373936_0109781 3300035113 Bacteria 1170
735 Ga0373936_0206606 3300035113 Bacteria 868
736 Ga0373941_0036427 3300035115 Unclassified 1496
737 Ga0373941_0054074 3300035115 Bacteria 1286
738 Ga0373945_0000332 3300035116 Bacteria 13460
739 Ga0373945_0068352 3300035116 Bacteria 1340
740 Ga0373953_0036289 3300035117 Bacteria 1941
741 Ga0373954_0046397 3300035118 Bacteria 2031
742 Ga0373943_0000199 3300035170 Bacteria 24471
743 Ga0373943_0002028 3300035170 Bacteria 9183
744 Ga0373943_0128623 3300035170 Bacteria 1353
745 Ga0373946_0005157 3300035171 Bacteria 4709
746 Ga0373955_0016668 3300035172 Bacteria 3621
747 Ga0373955_0078934 3300035172 Bacteria 1856
748 Ga0373955_0233341 3300035172 Bacteria 1101
749 Ga0373961_0046248 3300035241 Bacteria 1275
750 Ga0373924_0042554 3300035410 Bacteria 1863
751 Ga0373931_0245128 3300035691 Bacteria 1088
752 Ga0373935_0000576 3300035692 Bacteria 19099
753 Ga0373935_0013158 3300035692 Bacteria 4988
754 Ga0373927_0000041 3300035695 Bacteria 94763
755 Ga0373927_0011500 3300035695 Bacteria 5897
756 Ga0373927_0029951 3300035695 Bacteria 3551
757 Ga0373927_0031439 3300035695 Bacteria 3459
758 Ga0373927_0034939 3300035695 Bacteria 3269
759 Ga0373933_0303648 3300035724 Bacteria 1033
760 Ga0373947_0000315 3300035725 Bacteria 27406
761 Ga0373947_0005539 3300035725 Bacteria 7363
762 Ga0373947_0032219 3300035725 Bacteria 3088
763 Ga0373937_0020834 3300036401 Bacteria 5881
764 Ga0373937_0141860 3300036401 Bacteria 2248
765 Ga0373925_0000923 3300037068 Bacteria 26790
766 Ga0373925_0017680 3300037068 Bacteria 5173
767 Ga0373925_0028976 3300037068 Bacteria 4059
768 Ga0373925_0033468 3300037068 Bacteria 3787
769 Ga0373925_0067964 3300037068 Bacteria 2688
770 Ga0373925_0074635 3300037068 Bacteria 2569
771 Ga0373925_0081650 3300037068 Bacteria 2458
772 Ga0373925_0106103 3300037068 Bacteria 2165
773 Ga0373925_0482248 3300037068 Bacteria 1017
774 Ga0395899_0199313 3300037312 Bacteria 1397
775 Ga0395900_0005333 3300037418 Bacteria 13470
776 Ga0395898_0053512 3300037466 Bacteria 3943
777 Ga0395898_0565966 3300037466 Bacteria 1079
778 Ga0436364_0415091 3300037853 Bacteria 2631
779 Ga0395901_0005469 3300038443 Bacteria 12862
780 Ga0395901_0208906 3300038443 Bacteria 2044
781 Ga0436365_1008487 3300039437 Bacteria 933
782 Ga0436361_0513857 3300039447 Bacteria 3369
783 Ga0436361_0611757 3300039447 Bacteria 1519
784 Ga0436361_1068676 3300039447 Bacteria 2670
785 Ga0436363_0199314 3300039450 Bacteria 9545
786 Ga0436363_0813245 3300039450 Bacteria 1605
787 Ga0439453_0009410 3300041408 Bacteria 1591
788 Ga0451853_1013485 3300041512 Bacteria 1024
789 Ga0439443_000361 3300042003 Bacteria 3844
790 Ga0450890_004875 3300042127 Bacteria 1739
791 Ga0451577_0018001 3300042876 Bacteria 6514
792 Ga0451577_0034245 3300042876 Bacteria 4579
793 Ga0466972_0060153 3300044658 Bacteria 1823
794 Ga0453683_0427615 3300044673 Bacteria 855
795 Ga0453684_0000001 3300044712 Bacteria 2623166
796 Ga0466957_0307748 3300044842 Bacteria 1066
797 Ga0451576_0007210 3300045051 Bacteria 13399
798 Ga0451576_0197716 3300045051 Bacteria 2100
799 Ga0451576_0347292 3300045051 Unclassified 1553
800 Ga0466967_0023182 3300045976 Bacteria 5083
801 Ga0495603_0287657 3300046455 Unclassified 944
802 Ga0495591_029302 3300046458 Bacteria 1674
803 Ga0495629_0136277 3300046459 Bacteria 1709
804 Ga0495641_0036748 3300046461 Bacteria 2299
805 Ga0495651_0000931 3300046462 Bacteria 22653
806 Ga0495651_0088836 3300046462 Bacteria 2322
807 Ga0495651_0113142 3300046462 Bacteria 2004
808 Ga0495653_0043767 3300046463 Bacteria 3478
809 Ga0495580_0000777 3300046472 Bacteria 27451
810 Ga0495580_0001086 3300046472 Bacteria 23878
811 Ga0495580_0006659 3300046472 Bacteria 9380
812 Ga0495580_0007498 3300046472 Bacteria 8766
813 Ga0495580_0010227 3300046472 Bacteria 7319
814 Ga0495580_0038991 3300046472 Bacteria 3399
815 Ga0495580_0077744 3300046472 Bacteria 2314
816 Ga0495580_0121110 3300046472 Bacteria 1816
817 Ga0495580_0480695 3300046472 Bacteria 831
818 Ga0495582_0000160 3300046473 Bacteria 36317
819 Ga0495582_0007681 3300046473 Bacteria 5960
820 Ga0495582_0140998 3300046473 Bacteria 1366
821 Ga0495639_0054838 3300046475 Bacteria 1817
822 Ga0495662_0037038 3300046476 Bacteria 2355
823 Ga0495584_0019874 3300046491 Bacteria 3412
824 Ga0495584_0122219 3300046491 Bacteria 1319
825 Ga0495584_0244073 3300046491 Bacteria 913
826 Ga0495594_0191710 3300046499 Bacteria 1164
827 Ga0495594_0288336 3300046499 Unclassified 935
828 Ga0495608_0029063 3300046511 Bacteria 3753
829 Ga0495618_0102017 3300046514 Bacteria 1836
830 Ga0495630_0030906 3300046517 Bacteria 3986
831 Ga0495630_0034839 3300046517 Bacteria 3761
832 Ga0495644_0000571 3300046523 Bacteria 15453
833 Ga0495666_0112174 3300046526 Bacteria 1280
834 Ga0495652_0166198 3300046529 Bacteria 1707
835 Ga0495665_0030232 3300046531 Bacteria 2899
836 Ga0495665_0239741 3300046531 Unclassified 935
837 Ga0495640_0078045 3300046533 Bacteria 2206
838 Ga0495586_0100936 3300046535 Bacteria 1601
839 Ga0495598_0133340 3300046537 Bacteria 854
840 Ga0495609_0012142 3300046538 Bacteria 4088
841 Ga0495645_0092320 3300046543 Bacteria 2162
842 Ga0495622_0065231 3300046557 Bacteria 1683
843 Ga0495633_0004105 3300046558 Bacteria 9395
844 Ga0495667_0021144 3300046559 Bacteria 4389
845 Ga0495656_0002209 3300046615 Bacteria 6427
846 Ga0495635_0000999 3300046663 Bacteria 18684
847 Ga0495635_0007707 3300046663 Bacteria 7512
848 Ga0495659_0041178 3300046664 Unclassified 1649
849 Ga0495659_0091929 3300046664 Bacteria 1166
850 Ga0495659_0151462 3300046664 Bacteria 931
851 Ga0495661_0044998 3300046665 Bacteria 2702
852 Ga0495657_0189018 3300046675 Bacteria 1260
853 Ga0495623_0151437 3300046679 Bacteria 1371
854 Ga0495647_0032519 3300046681 Bacteria 1944
855 Ga0495658_0009124 3300046683 Bacteria 4931
856 Ga0495658_0074119 3300046683 Bacteria 1983
857 Ga0495669_0197701 3300046684 Bacteria 960
858 Ga0495624_0030749 3300046690 Bacteria 3495
859 Ga0495670_0000669 3300046691 Bacteria 16316
860 Ga0495670_0058565 3300046691 Bacteria 1934
861 Ga0495581_0012313 3300047315 Bacteria 4955
862 Ga0495581_0015188 3300047315 Bacteria 4470
863 Ga0495581_0158946 3300047315 Bacteria 1321
864 Ga0495581_0176531 3300047315 Bacteria 1249
865 Ga0495604_0007298 3300047317 Bacteria 8752
866 Ga0495604_0011241 3300047317 Bacteria 7106
867 Ga0495636_0000210 3300047318 Bacteria 22819
868 Ga0495674_0009183 3300047319 Bacteria 9395
869 Ga0495674_0033153 3300047319 Bacteria 4681
870 Ga0495674_0094639 3300047319 Unclassified 2548
871 Ga0495674_0102516 3300047319 Bacteria 2434
872 Ga0495676_0107817 3300047321 Bacteria 2050
873 Ga0495680_0009787 3300047322 Bacteria 8596
874 Ga0495680_0031551 3300047322 Bacteria 4310
875 Ga0495687_015124 3300047443 Bacteria 3937
876 Ga0495684_0004982 3300047471 Bacteria 10370
877 Ga0495593_0080223 3300047673 Bacteria 1688
878 Ga0495593_0171991 3300047673 Bacteria 1092
879 Ga0495602_0107089 3300048088 Bacteria 2280
880 Ga0495602_0161036 3300048088 Bacteria 1752
881 Ga0496100_0027878 3300048903 Bacteria 3477
882 Ga0496100_0331738 3300048903 Unclassified 1145
883 Ga0496100_0333455 3300048903 Bacteria 1142
884 Ga0496101_0034156 3300048904 Bacteria 3590
885 Ga0496101_0142938 3300048904 Bacteria 1825
886 Ga0496102_0009184 3300048905 Bacteria 8481
887 Ga0496102_0136758 3300048905 Bacteria 2296
888 Ga0496102_0175230 3300048905 Bacteria 2019
889 Ga0496102_0247404 3300048905 Bacteria 1681
890 Ga0496102_0311696 3300048905 Bacteria 1483
891 Ga0496102_0569060 3300048905 Bacteria 1056
892 Ga0496104_0012389 3300048907 Bacteria 7667
893 Ga0496104_0080482 3300048907 Bacteria 3106
894 Ga0496104_0152756 3300048907 Bacteria 2216
895 Ga0496104_0234005 3300048907 Unclassified 1749
896 Ga0496104_0593596 3300048907 Bacteria 1018
897 Ga0496105_0185943 3300048908 Bacteria 1700
898 Ga0496105_0217941 3300048908 Bacteria 1554
899 Ga0496106_0011211 3300048909 Bacteria 6632
900 Ga0496106_0138207 3300048909 Bacteria 1915
901 Ga0496107_0006454 3300048910 Bacteria 8066
902 Ga0496107_0134130 3300048910 Bacteria 1829
903 Ga0496107_0365588 3300048910 Bacteria 1073
904 Ga0496108_0076395 3300048911 Unclassified 2831
905 Ga0496108_0376751 3300048911 Bacteria 1239
906 Ga0496108_0767138 3300048911 Unclassified 833
907 Ga0496109_0037919 3300048912 Bacteria 4356
908 Ga0496109_0076350 3300048912 Bacteria 3082
909 Ga0496109_0157111 3300048912 Bacteria 2130
910 Ga0496110_0227330 3300048913 Bacteria 1697
911 Ga0496110_0248365 3300048913 Bacteria 1619
912 Ga0496111_0023234 3300048914 Bacteria 4352
913 Ga0496111_0118631 3300048914 Bacteria 1953
914 Ga0496112_0000541 3300048915 Bacteria 25895
915 Ga0496112_0016070 3300048915 Bacteria 6998
916 Ga0496112_0044633 3300048915 Bacteria 4344
917 Ga0496112_0073939 3300048915 Bacteria 3369
918 Ga0496112_0168860 3300048915 Bacteria 2153
919 Ga0496112_0304726 3300048915 Bacteria 1538
920 Ga0496113_0018963 3300048916 Bacteria 4803
921 Ga0496113_0124477 3300048916 Bacteria 2018
922 Ga0496113_0162927 3300048916 Bacteria 1763
923 Ga0496114_0047135 3300048917 Bacteria 3584
924 Ga0496115_0004910 3300048918 Bacteria 9707
925 Ga0496115_0037936 3300048918 Bacteria 3821
926 Ga0496115_0272729 3300048918 Bacteria 1390
927 Ga0496117_0072205 3300048920 Bacteria 2309
928 Ga0501290_000024 3300049513 Bacteria 20106
929 Ga0501291_000322 3300049514 Bacteria 5911
930 Ga0501292_000069 3300049515 Bacteria 20733
931 Ga0501293_000195 3300049516 Bacteria 4358
932 Ga0501294_000051 3300049517 Bacteria 12212
933 Ga0501295_000036 3300049518 Bacteria 13372
934 Ga0501296_000147 3300049519 Bacteria 7921
935 Ga0501297_000004 3300049520 Bacteria 22617
936 Ga0501298_000124 3300049521 Bacteria 9227
937 Ga0501299_000096 3300049522 Bacteria 9832
938 Ga0501300_000237 3300049523 Bacteria 8292
939 Ga0501301_000323 3300049524 Bacteria 2803
940 Ga0501302_000568 3300049525 Bacteria 1977
941 Ga0501034_0100942 3300049571 Bacteria 2879
942 Ga0501037_0169832 3300049573 Bacteria 1551
943 Ga0501038_0153691 3300049574 Bacteria 1875
944 Ga0501040_0238084 3300049576 Bacteria 1297
945 Ga0501042_0122801 3300049578 Bacteria 1870
946 Ga0501043_0119615 3300049579 Bacteria 2066
947 Ga0501068_0292259 3300049584 Bacteria 1042
948 Ga0501072_0205402 3300049588 Bacteria 1570
949 Ga0501075_0135017 3300049591 Bacteria 1879
950 Ga0501077_0172430 3300049593 Bacteria 1374
951 Ga0501198_003464 3300049649 Bacteria 2157
952 Ga0501199_001087 3300049650 Bacteria 2444
953 Ga0501202_000224 3300049652 Bacteria 7422
954 Ga0501207_001020 3300049654 Bacteria 3407
955 Ga0501209_000414 3300049656 Bacteria 5189
956 Ga0501216_000117 3300049660 Bacteria 7800
957 Ga0501217_000129 3300049661 Bacteria 10105
958 Ga0501228_002969 3300049666 Bacteria 1368
959 Ga0501230_000908 3300049667 Bacteria 3321
960 Ga0501233_000058 3300049668 Bacteria 14525
961 Ga0501235_000042 3300049669 Bacteria 20584
962 Ga0501236_001498 3300049670 Bacteria 2654
963 Ga0501239_000019 3300049672 Bacteria 10329
964 Ga0501243_000139 3300049675 Bacteria 8230
965 Ga0501246_001510 3300049676 Bacteria 1795
966 Ga0501247_000491 3300049677 Bacteria 3157
967 Ga0501249_000123 3300049679 Bacteria 23882
968 Ga0501251_000033 3300049681 Bacteria 10069
969 Ga0501252_009782 3300049682 Bacteria 1123
970 Ga0501253_000062 3300049683 Bacteria 7352
971 Ga0501257_001759 3300049686 Bacteria 4515
972 Ga0501258_000612 3300049687 Bacteria 2526
973 Ga0501259_004607 3300049688 Bacteria 2190
974 Ga0501260_000011 3300049689 Bacteria 13212
975 Ga0501261_001049 3300049690 Bacteria 3387
976 Ga0501219_001253 3300049703 Bacteria 2687
977 Ga0501221_000074 3300049704 Bacteria 11102
978 Ga0501225_0000250 3300049705 Bacteria 16815
979 Ga0501245_000329 3300049708 Bacteria 5632
980 Ga0501080_0015294 3300049742 Bacteria 7074
981 Ga0501080_0150380 3300049742 Bacteria 2152
982 Ga0501080_0346533 3300049742 Bacteria 1342
983 Ga0501232_001731 3300049757 Bacteria 1787
984 Ga0501241_015536 3300049758 Bacteria 1385
985 Ga0501262_008828 3300049759 Bacteria 1237
986 Ga0501264_001013 3300049761 Bacteria 3394
987 Ga0501265_000576 3300049762 Bacteria 3932
988 Ga0501266_000965 3300049763 Bacteria 3732
989 Ga0501268_000667 3300049765 Bacteria 3870
990 Ga0501269_001819 3300049766 Bacteria 2711
991 Ga0501270_000124 3300049767 Bacteria 5974
992 Ga0501271_000377 3300049768 Bacteria 3900
993 Ga0501272_000316 3300049769 Bacteria 4204
994 Ga0501273_000170 3300049770 Bacteria 4610
995 Ga0501274_000059 3300049771 Bacteria 6090
996 Ga0501275_001457 3300049772 Bacteria 2333
997 Ga0501276_000237 3300049773 Bacteria 3135
998 Ga0501278_000240 3300049774 Bacteria 4353
999 Ga0501279_000242 3300049775 Bacteria 7468
1000 Ga0501281_01385 3300049777 Bacteria 1912
1001 Ga0501282_000466 3300049778 Bacteria 4812
1002 Ga0501283_000044 3300049779 Bacteria 15150
1003 Ga0501035_0216334 3300049822 Bacteria 1638
1004 Ga0501035_0598673 3300049822 Bacteria 898
1005 Ga0501044_0238336 3300049823 Bacteria 1764
1006 Ga0501212_000262 3300049851 Bacteria 4751
1007 Ga0501226_000232 3300049853 Bacteria 8810
1008 nmdc:mga05p37_148110_c1 3300050507 Bacteria 2873
1009 nmdc:mga05p37_169470_c1 3300050507 Bacteria 2664
1010 nmdc:mga05p37_455569_c1 3300050507 Bacteria 1479
1011 nmdc:mga09592_55239_c1 3300050508 Bacteria 3356
1012 nmdc:mga0qj67_32131_c1 3300050509 Bacteria 4093
1013 nmdc:mga06r32_137644_c1 3300050510 Bacteria 2417
1014 nmdc:mga08y16_265250_c1 3300050511 Bacteria 1773
1015 nmdc:mga08y16_73110_c1 3300050511 Bacteria 3573
1016 nmdc:mga08y16_9680_c1 3300050511 Bacteria 10118
1017 nmdc:mga0n895_10165_c1 3300050512 Bacteria 8288
1018 nmdc:mga0n895_237_c1 3300050512 Bacteria 34922
1019 nmdc:mga0n895_246155_c1 3300050512 Unclassified 1814
1020 nmdc:mga0n895_27111_c1 3300050512 Bacteria 5438
1021 nmdc:mga0n895_288700_c1 3300050512 Bacteria 1663
1022 nmdc:mga0n895_421815_c1 3300050512 Unclassified 1349
1023 nmdc:mga0n895_508781_c1 3300050512 Bacteria 1213
1024 nmdc:mga0rr50_23495_c1 3300050513 Bacteria 4252
1025 nmdc:mga0rr50_290877_c1 3300050513 Bacteria 1365
1026 nmdc:mga0rr50_33452_c1 3300050513 Bacteria 3673
1027 nmdc:mga0rr50_440306_c1 3300050513 Bacteria 1104
1028 nmdc:mga0rr50_683_c1 3300050513 Bacteria 18182
1029 nmdc:mga08x19_2178_c1 3300050514 Bacteria 11961
1030 nmdc:mga08x19_46398_c1 3300050514 Bacteria 2779
1031 nmdc:mga08x19_79619_c1 3300050514 Bacteria 2149
1032 nmdc:mga0a205_11604_c2 3300050515 Bacteria 7513
1033 nmdc:mga0a205_221_c2 3300050515 Bacteria 25103
1034 nmdc:mga0a205_66075_c1 3300050515 Bacteria 3495
1035 Ga0495601_0016711 3300053077 Bacteria 4448
1036 Ga0495601_0033186 3300053077 Bacteria 3216
1037 Ga0495601_0086020 3300053077 Bacteria 2020
1038 Ga0495612_0009036 3300053078 Bacteria 4041
1039 Ga0495655_0036023 3300053083 Bacteria 1235
1040 Ga0495595_0000785 3300053084 Bacteria 12062
1041 Ga0495595_0000854 3300053084 Bacteria 11671
1042 Ga0495619_0000760 3300053085 Bacteria 21033
1043 Ga0495619_0001740 3300053085 Bacteria 14448
1044 Ga0495619_0056370 3300053085 Bacteria 2605
1045 Ga0500644_0000301 3300053088 Bacteria 26471
1046 Ga0500651_0058533 3300053093 Bacteria 2410
1047 Ga0500650_0016745 3300053098 Bacteria 3150
1048 Ga0500595_000144 3300053119 Bacteria 46478
1049 Ga0500652_009445 3300053131 Bacteria 3299
1050 Ga0500616_0000006 3300053153 Bacteria 944738
1051 Ga0500616_0002829 3300053153 Bacteria 13952
1052 Ga0500645_000946 3300053730 Bacteria 16529
1053 Ga0530510_0053716 3300061734 Bacteria 2911
1054 Ga0530510_0291320 3300061734 Bacteria 1220
1055 2509077788 2508501114 Bacteria 7082538
1056 2517566873 2517487022 Bacteria 7227575
1057 2643988902 2643221595 Bacteria 6565519
1058 2644154815 2643221627 Bacteria 6761570
1059 2692320437 2690316117 Bacteria 6800650
1060 2774872764 2773857925 Bacteria 6472445
1061 2776261782 2775506901 Bacteria 9631051
1062 2835313346 2835312727 Bacteria 7413381
1063 2847423884 2847417321 Bacteria 6913799
1064 2856318128 2856314179 Bacteria 6477897
1065 2879088833 2879083081 Bacteria 8587928
1066 2882458120 2882456835 Bacteria 6863978
1067 2894239401 2894232714 Bacteria 8834183
1068 2920822563 2920822456 Bacteria 6897201
1069 Ga0070709_10081884
1070 SwRhRL2b_contig_510538
1071 JGI24737J22298_10023517
1072 rootH1_10051132
1073 rootL2_10095643
1074 JGI26145J50221_1000614
1075 JGI26132J50249_100881
1076 Ga0065712_10073914
1077 Ga0065712_10074092
1078 Ga0065712_10075782
1079 Ga0065712_10189403
1080 Ga0065715_10028470
1081 Ga0065715_10042363
1082 Ga0065715_10140639
1083 Ga0065707_10002075
1084 Ga0065707_10004588
1085 Ga0065707_10347868
1086 Ga0070658_10032203
1087 Ga0070658_10582653
1088 Ga0070676_10003201
1089 Ga0070676_10056770
1090 Ga0070676_10061182
1091 Ga0070676_10139867
1092 Ga0070683_100076215
1093 Ga0070683_100079552
1094 Ga0070683_100295306
1095 Ga0070683_100654781
1096 Ga0070690_100093389
1097 Ga0070670_100015769
1098 Ga0070670_100133826
1099 Ga0070670_100437573
1100 Ga0070677_10003217
1101 Ga0070677_10078348
1102 Ga0070666_10080586
1103 Ga0070666_10086370
1104 Ga0070666_10174751
1105 Ga0070680_100000167
1106 Ga0070680_100198990
1107 Ga0070680_100282865
1108 Ga0070682_100058029
1109 Ga0070682_100418227
1110 Ga0068868_100119755
1111 Ga0068868_100339077
1112 Ga0070660_100121957
1113 Ga0070660_100130154
1114 Ga0070689_100028747
1115 Ga0070689_100038912
1116 Ga0070689_100045684
1117 Ga0070689_100288962
1118 Ga0070691_10058410
1119 Ga0070691_10142696
1120 Ga0070687_100000971
1121 Ga0070687_100003161
1122 Ga0070687_100100358
1123 Ga0070661_100010642
1124 Ga0070661_100095197
1125 Ga0070661_100645116
1126 Ga0070668_100019705
1127 Ga0070668_100042798
1128 Ga0070668_100044752
1129 Ga0070668_100165816
1130 Ga0070668_100313903
1131 Ga0070669_100002728
1132 Ga0070675_100025100
1133 Ga0070675_100046201
1134 Ga0070675_100070042
1135 Ga0070675_100132259
1136 Ga0070675_100207968
1137 Ga0070675_100211794
1138 Ga0070675_100493744
1139 Ga0070671_100014818
1140 Ga0070671_100015101
1141 Ga0070671_100110023
1142 Ga0070671_100263125
1143 Ga0070671_100511864
1144 Ga0070671_100583664
1145 Ga0070674_100000385
1146 Ga0070674_100001895
1147 Ga0070674_100078859
1148 Ga0070674_100180017
1149 Ga0070673_100007148
1150 Ga0070673_100007562
1151 Ga0070673_100036588
1152 Ga0070673_100127557
1153 Ga0070673_100206753
1154 Ga0070673_100290350
1155 Ga0070688_100011471
1156 Ga0070688_100027570
1157 Ga0070688_100135804
1158 Ga0070659_100004159
1159 Ga0070659_100027270
1160 Ga0070659_100042201
1161 Ga0070667_100077349
1162 Ga0070667_100080903
1163 Ga0070667_100161058
1164 Ga0070709_10011001
1165 Ga0070709_10029691
1166 Ga0070709_10034393
1167 Ga0070709_10292828
1168 Ga0070709_10401858
1169 Ga0070714_100071808
1170 Ga0070714_100095456
1171 Ga0070714_100112466
1172 Ga0070714_100119069
1173 Ga0070714_100196016
1174 Ga0070714_100212954
1175 Ga0070714_100256501
1176 Ga0070714_100470019
1177 Ga0070713_100000084
1178 Ga0070713_100002024
1179 Ga0070713_100006573
1180 Ga0070713_100028305
1181 Ga0070713_100029007
1182 Ga0070713_100029331
1183 Ga0070713_100030673
1184 Ga0070713_100086436
1185 Ga0070713_100095905
1186 Ga0070713_100438091
1187 Ga0070710_10021880
1188 Ga0070710_10063306
1189 Ga0070710_10081138
1190 Ga0070710_10109883
1191 Ga0070710_10205031
1192 Ga0070711_100012633
1193 Ga0070711_100024494
1194 Ga0070711_100028675
1195 Ga0070711_100034503
1196 Ga0070711_100052699
1197 Ga0070711_100090239
1198 Ga0070711_100180687
1199 Ga0070711_100319002
1200 Ga0070711_100372581
1201 Ga0070711_100437066
1202 Ga0070705_100089202
1203 Ga0070705_100096901
1204 Ga0070705_100104837
1205 Ga0070705_100509165
1206 Ga0070700_100044965
1207 Ga0070694_100036313
1208 Ga0070708_100011000
1209 Ga0070708_100031125
1210 Ga0070708_100077831
1211 Ga0070708_100105638
1212 Ga0070708_100190968
1213 Ga0070708_100279465
1214 Ga0070663_100077985
1215 Ga0070663_100192482
1216 Ga0070678_100003379
1217 Ga0070678_100022634
1218 Ga0070678_100048545
1219 Ga0070678_100476614
1220 Ga0070662_100000649
1221 Ga0070662_100171046
1222 Ga0070662_100314978
1223 Ga0070662_100432539
1224 Ga0070681_10008068
1225 Ga0070681_10014788
1226 Ga0070681_10104124
1227 Ga0070681_10182844
1228 Ga0070681_10345875
1229 Ga0070681_10502648
1230 Ga0068867_100006869
1231 Ga0068867_100074517
1232 Ga0070685_10051874
1233 Ga0070706_100000072
1234 Ga0070706_100015531
1235 Ga0070706_100021589
1236 Ga0070706_100061960
1237 Ga0070706_100196623
1238 Ga0070706_100205592
1239 Ga0070706_100215066
1240 Ga0070707_100001205
1241 Ga0070707_100009587
1242 Ga0070707_100010644
1243 Ga0070707_100196271
1244 Ga0070707_100329923
1245 Ga0070698_100007279
1246 Ga0070698_100037594
1247 Ga0070698_100134167
1248 Ga0070698_100224697
1249 Ga0070699_100004356
1250 Ga0070699_100005682
1251 Ga0070699_100006883
1252 Ga0070699_100046134
1253 Ga0070699_100168462
1254 Ga0070699_100215513
1255 Ga0070679_100028867
1256 Ga0070679_100039953
1257 Ga0070679_100097630
1258 Ga0070679_100105508
1259 Ga0070679_100154858
1260 Ga0070679_100630759
1261 Ga0070684_100293881
1262 Ga0070684_100441881
1263 Ga0070684_100565985
1264 Ga0070697_100000113
1265 Ga0070697_100001895
1266 Ga0070697_100003932
1267 Ga0070697_100024116
1268 Ga0070697_100034025
1269 Ga0070697_100083096
1270 Ga0070697_100099882
1271 Ga0070697_100106261
1272 Ga0070697_100140650
1273 Ga0070697_100158636
1274 Ga0070697_100395608
1275 Ga0070697_100496256
1276 Ga0070697_100719700
1277 Ga0070672_100003922
1278 Ga0070672_100011647
1279 Ga0070672_100059204
1280 Ga0070672_100100272
1281 Ga0070672_100189597
1282 Ga0070686_100002480
1283 Ga0070686_100133026
1284 Ga0070686_100504344
1285 Ga0070695_100040020
1286 Ga0070695_100044557
1287 Ga0070696_100022055
1288 Ga0070696_100026183
1289 Ga0070696_100185202
1290 Ga0070693_100080754
1291 Ga0070665_100049286
1292 Ga0070665_100099430
1293 Ga0070665_100129865
1294 Ga0070665_100195255
1295 Ga0070665_100293203
1296 Ga0070704_100020423
1297 Ga0070704_100022697
1298 Ga0070704_100131276
1299 Ga0070704_100305713
1300 Ga0070704_100512451
1301 Ga0068855_100164779
1302 Ga0068855_100224487
1303 Ga0068855_100405617
1304 Ga0070664_100013086
1305 Ga0068857_100013918
1306 Ga0068857_100070415
1307 Ga0068857_100079273
1308 Ga0068854_100032206
1309 Ga0068854_100095806
1310 Ga0068854_100110612
1311 Ga0068856_100000755
1312 Ga0068856_100004317
1313 Ga0068856_100198027
1314 Ga0068856_100320199
1315 Ga0068856_100489945
1316 Ga0068856_100510735
1317 Ga0070702_100248015
1318 Ga0068859_100710636
1319 Ga0068859_100965094
1320 Ga0068864_100085454
1321 Ga0068864_100153317
1322 Ga0068866_10070469
1323 Ga0068861_100041952
1324 Ga0068870_10007417
1325 Ga0068863_100150975
1326 Ga0068863_100280048
1327 Ga0068858_100443499
1328 Ga0068858_100765182
1329 Ga0068860_100017560
1330 Ga0068860_100061892
1331 Ga0068860_100351291
1332 Ga0068860_100454300
1333 Ga0068862_100046907
1334 Ga0081539_10063094
1335 Ga0070717_10001346
1336 Ga0070717_10005388
1337 Ga0070717_10028889
1338 Ga0070717_10036469
1339 Ga0070717_10127444
1340 Ga0070717_10223172
1341 Ga0070717_10253844
1342 Ga0070717_10305741
1343 Ga0070717_10329370
1344 Ga0070717_10371879
1345 Ga0075432_10001294
1346 Ga0070715_10016525
1347 Ga0070715_10062330
1348 Ga0070716_100000274
1349 Ga0070716_100019584
1350 Ga0070716_100052972
1351 Ga0070716_100138986
1352 Ga0070716_100148151
1353 Ga0070716_100364917
1354 Ga0070716_100592064
1355 Ga0070712_100000106
1356 Ga0070712_100004726
1357 Ga0070712_100008733
1358 Ga0070712_100024347
1359 Ga0070712_100176607
1360 Ga0070712_100236060
1361 Ga0075427_10003926
1362 Ga0097621_100001385
1363 Ga0097621_100009158
1364 Ga0097621_100017018
1365 Ga0097621_100020222
1366 Ga0097621_100056388
1367 Ga0097621_100575347
1368 Ga0068871_100009154
1369 Ga0068871_100010844
1370 Ga0068871_100113889
1371 Ga0075428_100013513
1372 Ga0075428_100018113
1373 Ga0075430_100008311
1374 Ga0075431_100070518
1375 Ga0075433_10000913
1376 Ga0075433_10014277
1377 Ga0075433_10125800
1378 Ga0075434_100000253
1379 Ga0075434_100019249
1380 Ga0075434_100019639
1381 Ga0075434_100234340
1382 Ga0075434_100519001
1383 Ga0075434_100965503
1384 Ga0068865_100004508
1385 Ga0068865_100021768
1386 Ga0075436_100026097
1387 Ga0075436_100041976
1388 Ga0097620_100710719
1389 Ga0097620_100965147
1390 Ga0075435_100000234
1391 Ga0075435_100001191
1392 Ga0075435_100053921
1393 Ga0075435_100308659
1394 Ga0099794_10018509
1395 Ga0099794_10154215
1396 Ga0099795_10019095
1397 Ga0099795_10020654
1398 Ga0105240_10021993
1399 Ga0105240_10039955
1400 Ga0105240_10067425
1401 Ga0105240_10397616
1402 Ga0105240_10496370
1403 Ga0111539_10062241
1404 Ga0111539_10062696
1405 Ga0111539_10118643
1406 Ga0111539_10511603
1407 Ga0111539_10513411
1408 Ga0111539_10725872
1409 Ga0111539_10976792
1410 Ga0105245_10006914
1411 Ga0105245_10008205
1412 Ga0105245_10008208
1413 Ga0105245_10482715
1414 Ga0105247_10321326
1415 Ga0105247_10527773
1416 Ga0114129_10017199
1417 Ga0114129_10024476
1418 Ga0114129_10114977
1419 Ga0114129_10270845
1420 Ga0114129_10489715
1421 Ga0105243_10000414
1422 Ga0105241_10138141
1423 Ga0105241_10172763
1424 Ga0105241_10631788
1425 Ga0105242_10005509
1426 Ga0105242_10111522
1427 Ga0105242_10559993
1428 Ga0105242_10696010
1429 Ga0105248_10042569
1430 Ga0105237_10011974
1431 Ga0105237_10229475
1432 Ga0105237_10347353
1433 Ga0105238_10173474
1434 Ga0105249_10003933
1435 Ga0105249_10873438
1436 Ga0099796_10006841
1437 Ga0099796_10025714
1438 Ga0099796_10087847
1439 Ga0105239_10113753
1440 Ga0105239_10115581
1441 Ga0105239_10549006
1442 Ga0105246_10000130
1443 Ga0105246_10159389
1444 Ga0105246_10211157
1445 Ga0157373_10003878
1446 Ga0157373_10028714
1447 Ga0157371_10019095
1448 Ga0157371_10157736
1449 Ga0157370_10027500
1450 Ga0157370_10043493
1451 Ga0157370_10204582
1452 Ga0157369_10009595
1453 Ga0157369_10088489
1454 Ga0157369_10188680
1455 Ga0157369_10459371
1456 Ga0157369_10552930
1457 Ga0157374_10000068
1458 Ga0157374_10004858
1459 Ga0157374_10015477
1460 Ga0157374_10140802
1461 Ga0157374_10322630
1462 Ga0157378_10002374
1463 Ga0157378_10003652
1464 Ga0157378_10072539
1465 Ga0157378_10239427
1466 Ga0157378_10327168
1467 Ga0157378_10363890
1468 Ga0157378_10487893
1469 Ga0163162_10003595
1470 Ga0163162_10117183
1471 Ga0163162_10185584
1472 Ga0163162_10906082
1473 Ga0157372_10004816
1474 Ga0157372_10006638
1475 Ga0157372_10011099
1476 Ga0157372_10013707
1477 Ga0157372_10018858
1478 Ga0157372_10022540
1479 Ga0157372_10162946
1480 Ga0157372_10251333
1481 Ga0157372_10440517
1482 Ga0157375_10002248
1483 Ga0157375_10043724
1484 Ga0157375_10072099
1485 Ga0157375_10260513
1486 Ga0157375_10280219
1487 Ga0157375_10444360
1488 Ga0157375_11287844
1489 Ga0163163_10057762
1490 Ga0163163_10085528
1491 Ga0163163_10257064
1492 Ga0163163_10335189
1493 Ga0157380_10038409
1494 Ga0182008_10080573
1495 Ga0157377_10005381
1496 Ga0157379_10027874
1497 Ga0157379_10046103
1498 Ga0157376_10001790
1499 Ga0157376_10002339
1500 Ga0157376_10014931
1501 Ga0157376_10130612
1502 Ga0157376_10991132
1503 Ga0182006_1008826
1504 Ga0182006_1057475
1505 Ga0182007_10006678
1506 Ga0182005_1039451
1507 Ga0163161_10063788
1508 Ga0163161_10147410
1509 Ga0206356_11396592
1510 Ga0213872_10084408
1511 Ga0213876_10046543
1512 Ga0207666_1029196
1513 Ga0207697_10000465
1514 Ga0207697_10006542
1515 Ga0207697_10014431
1516 Ga0207682_10008155
1517 Ga0207682_10033499
1518 Ga0207692_10015719
1519 Ga0207692_10025075
1520 Ga0207692_10166737
1521 Ga0207642_10062879
1522 Ga0207642_10217441
1523 Ga0207688_10001108
1524 Ga0207688_10001495
1525 Ga0207688_10034388
1526 Ga0207688_10035459
1527 Ga0207688_10126338
1528 Ga0207680_10021953
1529 Ga0207680_10205787
1530 Ga0207647_10202087
1531 Ga0207699_10000756
1532 Ga0207699_10029346
1533 Ga0207699_10062799
1534 Ga0207699_10078612
1535 Ga0207645_10000012
1536 Ga0207645_10002843
1537 Ga0207645_10118907
1538 Ga0207645_10298811
1539 Ga0207643_10011714
1540 Ga0207705_10123098
1541 Ga0207684_10038482
1542 Ga0207684_10053255
1543 Ga0207684_10192263
1544 Ga0207654_10020414
1545 Ga0207707_10014117
1546 Ga0207707_10051140
1547 Ga0207707_10060653
1548 Ga0207695_10007980
1549 Ga0207695_10017288
1550 Ga0207695_10027313
1551 Ga0207695_10197137
1552 Ga0207671_10032357
1553 Ga0207671_10207703
1554 Ga0207693_10000033
1555 Ga0207693_10008418
1556 Ga0207693_10008661
1557 Ga0207693_10012562
1558 Ga0207693_10018610
1559 Ga0207693_10179322
1560 Ga0207693_10425485
1561 Ga0207663_10011327
1562 Ga0207663_10017700
1563 Ga0207663_10037325
1564 Ga0207663_10068994
1565 Ga0207663_10159346
1566 Ga0207663_10198015
1567 Ga0207663_10512979
1568 Ga0207660_10020529
1569 Ga0207660_10031923
1570 Ga0207660_10049922
1571 Ga0207660_10059616
1572 Ga0207660_10179995
1573 Ga0207660_10279031
1574 Ga0207662_10000967
1575 Ga0207662_10016291
1576 Ga0207657_10005628
1577 Ga0207657_10044352
1578 Ga0207657_10093755
1579 Ga0207657_10148702
1580 Ga0207649_10052791
1581 Ga0207652_10008847
1582 Ga0207652_10051815
1583 Ga0207652_10063841
1584 Ga0207652_10121725
1585 Ga0207652_10254960
1586 Ga0207652_10334022
1587 Ga0207652_10696971
1588 Ga0207646_10002936
1589 Ga0207646_10040006
1590 Ga0207646_10174121
1591 Ga0207646_10195392
1592 Ga0207646_10586852
1593 Ga0207681_10016862
1594 Ga0207681_10057151
1595 Ga0207650_10038372
1596 Ga0207650_10244445
1597 Ga0207659_10004515
1598 Ga0207659_10026996
1599 Ga0207659_10034581
1600 Ga0207659_10064578
1601 Ga0207659_10129473
1602 Ga0207659_10320807
1603 Ga0207687_10011501
1604 Ga0207687_10022484
1605 Ga0207687_10305823
1606 Ga0207700_10000902
1607 Ga0207700_10009675
1608 Ga0207700_10013431
1609 Ga0207700_10016833
1610 Ga0207700_10033007
1611 Ga0207700_10035245
1612 Ga0207700_10042396
1613 Ga0207700_10045699
1614 Ga0207700_10054135
1615 Ga0207700_10116301
1616 Ga0207700_10188026
1617 Ga0207700_10210597
1618 Ga0207700_10821464
1619 Ga0207664_10000097
1620 Ga0207664_10081918
1621 Ga0207664_10121407
1622 Ga0207664_10139134
1623 Ga0207664_10192361
1624 Ga0207664_10238151
1625 Ga0207664_10506177
1626 Ga0207644_10010293
1627 Ga0207644_10011125
1628 Ga0207644_10075836
1629 Ga0207644_10102781
1630 Ga0207644_10118296
1631 Ga0207644_10289089
1632 Ga0207644_10586288
1633 Ga0207690_10038078
1634 Ga0207690_10182791
1635 Ga0207706_10002781
1636 Ga0207706_10032159
1637 Ga0207706_10125657
1638 Ga0207706_10176569
1639 Ga0207706_10237179
1640 Ga0207706_10296370
1641 Ga0207686_10035362
1642 Ga0207686_10106991
1643 Ga0207686_10279144
1644 Ga0207709_10017882
1645 Ga0207670_10004496
1646 Ga0207670_10032753
1647 Ga0207670_10317871
1648 Ga0207669_10006395
1649 Ga0207669_10015129
1650 Ga0207669_10124918
1651 Ga0207669_10269063
1652 Ga0207704_10001929
1653 Ga0207704_10014560
1654 Ga0207665_10000176
1655 Ga0207665_10007817
1656 Ga0207665_10017360
1657 Ga0207665_10048055
1658 Ga0207665_10057546
1659 Ga0207665_10092172
1660 Ga0207665_10177803
1661 Ga0207665_10526265
1662 Ga0207691_10000097
1663 Ga0207691_10000155
1664 Ga0207691_10020569
1665 Ga0207691_10029883
1666 Ga0207691_10189891
1667 Ga0207661_10105275
1668 Ga0207661_10587956
1669 Ga0207679_10003563
1670 Ga0207679_10004282
1671 Ga0207679_10127698
1672 Ga0207679_10259927
1673 Ga0207667_10210645
1674 Ga0207667_11001329
1675 Ga0207651_10014892
1676 Ga0207651_10033902
1677 Ga0207651_10038422
1678 Ga0207651_10260527
1679 Ga0207651_10333252
1680 Ga0207712_10042926
1681 Ga0207712_10080983
1682 Ga0207712_10188194
1683 Ga0207668_10009679
1684 Ga0207668_10030284
1685 Ga0207668_10193517
1686 Ga0207640_10020256
1687 Ga0207640_10058904
1688 Ga0207640_10391940
1689 Ga0207677_10011704
1690 Ga0207677_10064600
1691 Ga0207677_10090363
1692 Ga0207677_10337447
1693 Ga0207677_10454822
1694 Ga0207639_10036735
1695 Ga0207678_10035266
1696 Ga0207708_10000199
1697 Ga0207702_10000137
1698 Ga0207702_10002313
1699 Ga0207702_10077834
1700 Ga0207702_10163809
1701 Ga0207702_10303406
1702 Ga0207702_10326734
1703 Ga0207702_10592999
1704 Ga0207641_10055242
1705 Ga0207641_10066193
1706 Ga0207641_10281456
1707 Ga0207648_10000064
1708 Ga0207648_10005435
1709 Ga0207648_10122582
1710 Ga0207648_10204015
1711 Ga0207676_10082205
1712 Ga0207676_10146150
1713 Ga0207674_10016572
1714 Ga0207674_10022686
1715 Ga0207675_100061567
1716 Ga0207683_10000028
1717 Ga0207683_10012967
1718 Ga0207683_10014269
1719 Ga0207683_10109002
1720 Ga0207683_10300929
1721 Ga0207698_10215480
1722 Ga0209973_1002126
1723 Ga0209967_1000058
1724 Ga0209981_1000185
1725 Ga0209996_1000043
1726 Ga0210000_1000362
1727 Ga0209995_1000117
1728 Ga0209179_1016496
1729 Ga0209968_1000159
1730 Ga0209999_1000282
1731 Ga0209982_1000795
1732 Ga0209970_1002907
1733 Ga0210002_1000092
1734 Ga0209588_1001918
1735 Ga0209971_1000121
1736 Ga0209971_1058817
1737 Ga0209966_1000276
1738 Ga0209998_10000015
1739 Ga0209974_10000001
1740 Ga0207428_10000237
1741 Ga0207428_10036697
1742 Ga0207428_10120057
1743 Ga0268266_10047044
1744 Ga0268266_10091524
1745 Ga0268266_10272636
1746 Ga0268266_10731662
1747 Ga0268265_10021702
1748 Ga0268265_10076558
1749 Ga0268264_10340025
1750 Ga0268264_10612036
1751 Ga0265326_10030582
1752 Ga0265319_1003474
1753 Ga0265338_10034702
1754 Ga0265338_10107225
1755 Ga0265338_10125037
1756 Ga0265338_10132461
1757 Ga0265338_10156753
1758 Ga0265338_10328794
1759 Ga0265324_10028559
1760 Ga0265762_1039079
1761 Ga0265332_10002293
1762 Ga0265320_10001827
1763 Ga0265325_10006803
1764 Ga0265325_10008935
1765 Ga0265325_10027094
1766 Ga0265325_10036779
1767 Ga0265340_10003648
1768 Ga0265340_10043396
1769 Ga0265340_10138376
1770 Ga0265339_10002587
1771 Ga0265339_10018297
1772 Ga0265339_10067131
1773 Ga0265339_10084121
1774 Ga0265339_10111724
1775 Ga0265339_10190495
1776 Ga0265331_10027074
1777 Ga0265331_10041248
1778 Ga0265316_10001005
1779 Ga0265316_10040722
1780 Ga0265316_10070756
1781 Ga0265316_10092282
1782 Ga0265316_10098165
1783 Ga0265313_10000041
1784 Ga0265313_10000538
1785 Ga0265313_10003540
1786 Ga0265314_10000279
1787 Ga0265314_10001994
1788 Ga0265314_10011035
1789 Ga0265314_10025037
1790 Ga0265314_10130697
1791 Ga0265342_10023338
1792 Ga0265342_10062636
1793 Ga0307407_10120568
1794 Ga0307412_10083956
1795 Ga0307416_100274226
1796 Ga0316214_1002333
1797 Ga0373944_0036924
1798 Ga0373944_0115505
1799 Ga0373936_0007613
1800 Ga0373936_0019480
1801 Ga0373936_0063758
1802 Ga0373936_0109781
1803 Ga0373936_0206606
1804 Ga0373941_0036427
1805 Ga0373941_0054074
1806 Ga0373945_0000332
1807 Ga0373945_0068352
1808 Ga0373953_0036289
1809 Ga0373954_0046397
1810 Ga0373943_0000199
1811 Ga0373943_0002028
1812 Ga0373943_0128623
1813 Ga0373946_0005157
1814 Ga0373955_0016668
1815 Ga0373955_0078934
1816 Ga0373955_0233341
1817 Ga0373961_0046248
1818 Ga0373924_0042554
1819 Ga0373931_0245128
1820 Ga0373935_0000576
1821 Ga0373935_0013158
1822 Ga0373927_0000041
1823 Ga0373927_0011500
1824 Ga0373927_0029951
1825 Ga0373927_0031439
1826 Ga0373927_0034939
1827 Ga0373933_0303648
1828 Ga0373947_0000315
1829 Ga0373947_0005539
1830 Ga0373947_0032219
1831 Ga0373937_0020834
1832 Ga0373937_0141860
1833 Ga0373925_0000923
1834 Ga0373925_0017680
1835 Ga0373925_0028976
1836 Ga0373925_0033468
1837 Ga0373925_0067964
1838 Ga0373925_0074635
1839 Ga0373925_0081650
1840 Ga0373925_0106103
1841 Ga0373925_0482248
1842 Ga0395899_0199313
1843 Ga0395900_0005333
1844 Ga0395898_0053512
1845 Ga0395898_0565966
1846 Ga0436364_0415091
1847 Ga0395901_0005469
1848 Ga0395901_0208906
1849 Ga0436365_1008487
1850 Ga0436361_0513857
1851 Ga0436361_0611757
1852 Ga0436361_1068676
1853 Ga0436363_0199314
1854 Ga0436363_0813245
1855 Ga0439453_0009410
1856 Ga0451853_1013485
1857 Ga0439443_000361
1858 Ga0450890_004875
1859 Ga0451577_0018001
1860 Ga0451577_0034245
1861 Ga0466972_0060153
1862 Ga0453683_0427615
1863 Ga0453684_0000001
1864 Ga0466957_0307748
1865 Ga0451576_0007210
1866 Ga0451576_0197716
1867 Ga0451576_0347292
1868 Ga0466967_0023182
1869 Ga0495603_0287657
1870 Ga0495591_029302
1871 Ga0495629_0136277
1872 Ga0495641_0036748
1873 Ga0495651_0000931
1874 Ga0495651_0088836
1875 Ga0495651_0113142
1876 Ga0495653_0043767
1877 Ga0495580_0000777
1878 Ga0495580_0001086
1879 Ga0495580_0006659
1880 Ga0495580_0007498
1881 Ga0495580_0010227
1882 Ga0495580_0038991
1883 Ga0495580_0077744
1884 Ga0495580_0121110
1885 Ga0495580_0480695
1886 Ga0495582_0000160
1887 Ga0495582_0007681
1888 Ga0495582_0140998
1889 Ga0495639_0054838
1890 Ga0495662_0037038
1891 Ga0495584_0019874
1892 Ga0495584_0122219
1893 Ga0495584_0244073
1894 Ga0495594_0191710
1895 Ga0495594_0288336
1896 Ga0495608_0029063
1897 Ga0495618_0102017
1898 Ga0495630_0030906
1899 Ga0495630_0034839
1900 Ga0495644_0000571
1901 Ga0495666_0112174
1902 Ga0495652_0166198
1903 Ga0495665_0030232
1904 Ga0495665_0239741
1905 Ga0495640_0078045
1906 Ga0495586_0100936
1907 Ga0495598_0133340
1908 Ga0495609_0012142
1909 Ga0495645_0092320
1910 Ga0495622_0065231
1911 Ga0495633_0004105
1912 Ga0495667_0021144
1913 Ga0495656_0002209
1914 Ga0495635_0000999
1915 Ga0495635_0007707
1916 Ga0495659_0041178
1917 Ga0495659_0091929
1918 Ga0495659_0151462
1919 Ga0495661_0044998
1920 Ga0495657_0189018
1921 Ga0495623_0151437
1922 Ga0495647_0032519
1923 Ga0495658_0009124
1924 Ga0495658_0074119
1925 Ga0495669_0197701
1926 Ga0495624_0030749
1927 Ga0495670_0000669
1928 Ga0495670_0058565
1929 Ga0495581_0012313
1930 Ga0495581_0015188
1931 Ga0495581_0158946
1932 Ga0495581_0176531
1933 Ga0495604_0007298
1934 Ga0495604_0011241
1935 Ga0495636_0000210
1936 Ga0495674_0009183
1937 Ga0495674_0033153
1938 Ga0495674_0094639
1939 Ga0495674_0102516
1940 Ga0495676_0107817
1941 Ga0495680_0009787
1942 Ga0495680_0031551
1943 Ga0495687_015124
1944 Ga0495684_0004982
1945 Ga0495593_0080223
1946 Ga0495593_0171991
1947 Ga0495602_0107089
1948 Ga0495602_0161036
1949 Ga0496100_0027878
1950 Ga0496100_0331738
1951 Ga0496100_0333455
1952 Ga0496101_0034156
1953 Ga0496101_0142938
1954 Ga0496102_0009184
1955 Ga0496102_0136758
1956 Ga0496102_0175230
1957 Ga0496102_0247404
1958 Ga0496102_0311696
1959 Ga0496102_0569060
1960 Ga0496104_0012389
1961 Ga0496104_0080482
1962 Ga0496104_0152756
1963 Ga0496104_0234005
1964 Ga0496104_0593596
1965 Ga0496105_0185943
1966 Ga0496105_0217941
1967 Ga0496106_0011211
1968 Ga0496106_0138207
1969 Ga0496107_0006454
1970 Ga0496107_0134130
1971 Ga0496107_0365588
1972 Ga0496108_0076395
1973 Ga0496108_0376751
1974 Ga0496108_0767138
1975 Ga0496109_0037919
1976 Ga0496109_0076350
1977 Ga0496109_0157111
1978 Ga0496110_0227330
1979 Ga0496110_0248365
1980 Ga0496111_0023234
1981 Ga0496111_0118631
1982 Ga0496112_0000541
1983 Ga0496112_0016070
1984 Ga0496112_0044633
1985 Ga0496112_0073939
1986 Ga0496112_0168860
1987 Ga0496112_0304726
1988 Ga0496113_0018963
1989 Ga0496113_0124477
1990 Ga0496113_0162927
1991 Ga0496114_0047135
1992 Ga0496115_0004910
1993 Ga0496115_0037936
1994 Ga0496115_0272729
1995 Ga0496117_0072205
1996 Ga0501290_000024
1997 Ga0501291_000322
1998 Ga0501292_000069
1999 Ga0501293_000195
2000 Ga0501294_000051
2001 Ga0501295_000036
2002 Ga0501296_000147
2003 Ga0501297_000004
2004 Ga0501298_000124
2005 Ga0501299_000096
2006 Ga0501300_000237
2007 Ga0501301_000323
2008 Ga0501302_000568
2009 Ga0501034_0100942
2010 Ga0501037_0169832
2011 Ga0501038_0153691
2012 Ga0501040_0238084
2013 Ga0501042_0122801
2014 Ga0501043_0119615
2015 Ga0501068_0292259
2016 Ga0501072_0205402
2017 Ga0501075_0135017
2018 Ga0501077_0172430
2019 Ga0501198_003464
2020 Ga0501199_001087
2021 Ga0501202_000224
2022 Ga0501207_001020
2023 Ga0501209_000414
2024 Ga0501216_000117
2025 Ga0501217_000129
2026 Ga0501228_002969
2027 Ga0501230_000908
2028 Ga0501233_000058
2029 Ga0501235_000042
2030 Ga0501236_001498
2031 Ga0501239_000019
2032 Ga0501243_000139
2033 Ga0501246_001510
2034 Ga0501247_000491
2035 Ga0501249_000123
2036 Ga0501251_000033
2037 Ga0501252_009782
2038 Ga0501253_000062
2039 Ga0501257_001759
2040 Ga0501258_000612
2041 Ga0501259_004607
2042 Ga0501260_000011
2043 Ga0501261_001049
2044 Ga0501219_001253
2045 Ga0501221_000074
2046 Ga0501225_0000250
2047 Ga0501245_000329
2048 Ga0501080_0015294
2049 Ga0501080_0150380
2050 Ga0501080_0346533
2051 Ga0501232_001731
2052 Ga0501241_015536
2053 Ga0501262_008828
2054 Ga0501264_001013
2055 Ga0501265_000576
2056 Ga0501266_000965
2057 Ga0501268_000667
2058 Ga0501269_001819
2059 Ga0501270_000124
2060 Ga0501271_000377
2061 Ga0501272_000316
2062 Ga0501273_000170
2063 Ga0501274_000059
2064 Ga0501275_001457
2065 Ga0501276_000237
2066 Ga0501278_000240
2067 Ga0501279_000242
2068 Ga0501281_01385
2069 Ga0501282_000466
2070 Ga0501283_000044
2071 Ga0501035_0216334
2072 Ga0501035_0598673
2073 Ga0501044_0238336
2074 Ga0501212_000262
2075 Ga0501226_000232
2076 nmdc:mga05p37_148110_c1
2077 nmdc:mga05p37_169470_c1
2078 nmdc:mga05p37_455569_c1
2079 nmdc:mga09592_55239_c1
2080 nmdc:mga0qj67_32131_c1
2081 nmdc:mga06r32_137644_c1
2082 nmdc:mga08y16_265250_c1
2083 nmdc:mga08y16_73110_c1
2084 nmdc:mga08y16_9680_c1
2085 nmdc:mga0n895_10165_c1
2086 nmdc:mga0n895_237_c1
2087 nmdc:mga0n895_246155_c1
2088 nmdc:mga0n895_27111_c1
2089 nmdc:mga0n895_288700_c1
2090 nmdc:mga0n895_421815_c1
2091 nmdc:mga0n895_508781_c1
2092 nmdc:mga0rr50_23495_c1
2093 nmdc:mga0rr50_290877_c1
2094 nmdc:mga0rr50_33452_c1
2095 nmdc:mga0rr50_440306_c1
2096 nmdc:mga0rr50_683_c1
2097 nmdc:mga08x19_2178_c1
2098 nmdc:mga08x19_46398_c1
2099 nmdc:mga08x19_79619_c1
2100 nmdc:mga0a205_11604_c2
2101 nmdc:mga0a205_221_c2
2102 nmdc:mga0a205_66075_c1
2103 Ga0495601_0016711
2104 Ga0495601_0033186
2105 Ga0495601_0086020
2106 Ga0495612_0009036
2107 Ga0495655_0036023
2108 Ga0495595_0000785
2109 Ga0495595_0000854
2110 Ga0495619_0000760
2111 Ga0495619_0001740
2112 Ga0495619_0056370
2113 Ga0500644_0000301
2114 Ga0500651_0058533
2115 Ga0500650_0016745
2116 Ga0500595_000144
2117 Ga0500652_009445
2118 Ga0500616_0000006
2119 Ga0500616_0002829
2120 Ga0500645_000946
2121 Ga0530510_0053716
2122 Ga0530510_0291320
2123 2509077788
2124 2517566873
2125 2643988902
2126 2644154815
2127 2692320437
2128 2774872764
2129 2776261782
2130 2835313346
2131 2847423884
2132 2856318128
2133 2879088833
2134 2882458120
2135 2894239401
2136 2920822563

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

110

289

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.8255 47 242
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8107 47 242
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.7881 5 246
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.7875 35 226
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7847 47 233
ID Description Score Start End Superfamily
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9514 45 240 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9472 44 242 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9434 43 239 1.10.3720.10
af_P14176_140_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.943 47 240 1.10.3720.10
af_Q2FVG9_10_202_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9425 47 241 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2V2SJV8-F1-model_v4 ABC transporter permease 0.98 2 250 GO:0005886
GO:0055085
AF-M2PV85-F1-model_v4 ABC-type sulfate transporter, permease protein 0.9799 2 247 GO:0005886
GO:0055085
AF-A0A1H0C808-F1-model_v4 NitT/TauT family transport system permease protein 0.9747 2 251 GO:0005886
GO:0055085
AF-A0A1Q5MD89-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.974 2 249 GO:0005886
GO:0055085
AF-A0A6G3PLZ5-F1-model_v4 ABC transporter permease 0.972 2 248 GO:0005886
GO:0055085

Map