F489431
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1068 | 448 | 2136 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10081884|Ga0070709_100818842 |
| Length | 294 |
| Sequence | MSSVARSAPTGAVRPRPASGVNGNDIHSSPVVRQKNNRMVVARKVFNQVIFYSLLLGVWALLAKLKVWPPYLFPAPWQVAEALWAGFKDHSLPIAIGVTMKRMLIGYSLSVMLGMILGIGVASNRFLEETVGPLLVSLQSLPSICWVPLAILWFGLTEKAILFVVLMGCILSVTIAMEDGRKQMPKIYTMAGRNLGASGIRLFLYVMLPASLPYIVSGLKQGWAFGWRSLIQAEMIFLTIGLGQQLMMGRDLNDMSQVISVMLLIVALGYLVNRIVFRTMDRALQSRWGLNPTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 7 | 3300003405 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 217 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 218 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 235 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 260 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 261 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 264 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 265 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 266 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 267 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 268 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 269 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 324 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 335 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 336 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 337 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 338 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 339 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 340 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 341 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 342 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 343 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 344 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 345 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 346 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 347 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 348 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 349 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 360 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 361 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 362 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 363 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 364 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 365 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 366 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 367 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 368 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 369 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 370 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 371 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 372 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 373 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 374 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 375 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 376 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 377 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 378 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 379 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 380 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 381 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 382 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 383 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 384 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 385 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 386 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 387 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 388 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 390 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 391 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 392 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 393 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 394 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 395 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 396 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 397 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 398 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 399 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 400 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 401 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 402 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 403 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 404 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 405 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 406 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 407 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 408 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 409 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 412 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 413 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 429 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 430 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 431 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 432 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 433 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 434 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 435 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 436 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 437 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 438 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 439 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 440 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 441 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 442 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 443 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 444 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 445 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 446 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 447 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 448 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.5 |
| Metatranscriptomes | 0.19 |
| Isolates | 1.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0.47 |
| Rhizoplane | 4.31 |
| Rhizosphere | 92.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070709_10081884 | 3300005434 | Bacteria | 2108 |
| 2 | SwRhRL2b_contig_510538 | 2162886007 | Bacteria | 1512 |
| 3 | JGI24737J22298_10023517 | 3300001990 | Bacteria | 1954 |
| 4 | rootH1_10051132 | 3300003316 | Bacteria | 2897 |
| 5 | rootL2_10095643 | 3300003322 | Bacteria | 3413 |
| 6 | JGI26145J50221_1000614 | 3300003371 | Bacteria | 3015 |
| 7 | JGI26132J50249_100881 | 3300003405 | Bacteria | 960 |
| 8 | Ga0065712_10073914 | 3300005290 | Bacteria | 4244 |
| 9 | Ga0065712_10074092 | 3300005290 | Bacteria | 4180 |
| 10 | Ga0065712_10075782 | 3300005290 | Bacteria | 3791 |
| 11 | Ga0065712_10189403 | 3300005290 | Bacteria | 1155 |
| 12 | Ga0065715_10028470 | 3300005293 | Unclassified | 1146 |
| 13 | Ga0065715_10042363 | 3300005293 | Bacteria | 1043 |
| 14 | Ga0065715_10140639 | 3300005293 | Bacteria | 1859 |
| 15 | Ga0065707_10002075 | 3300005295 | Bacteria | 5072 |
| 16 | Ga0065707_10004588 | 3300005295 | Bacteria | 3901 |
| 17 | Ga0065707_10347868 | 3300005295 | Bacteria | 916 |
| 18 | Ga0070658_10032203 | 3300005327 | Bacteria | 4215 |
| 19 | Ga0070658_10582653 | 3300005327 | Bacteria | 969 |
| 20 | Ga0070676_10003201 | 3300005328 | Bacteria | 8491 |
| 21 | Ga0070676_10056770 | 3300005328 | Bacteria | 2314 |
| 22 | Ga0070676_10061182 | 3300005328 | Bacteria | 2238 |
| 23 | Ga0070676_10139867 | 3300005328 | Bacteria | 1540 |
| 24 | Ga0070683_100076215 | 3300005329 | Bacteria | 3135 |
| 25 | Ga0070683_100079552 | 3300005329 | Bacteria | 3068 |
| 26 | Ga0070683_100295306 | 3300005329 | Bacteria | 1541 |
| 27 | Ga0070683_100654781 | 3300005329 | Unclassified | 1006 |
| 28 | Ga0070690_100093389 | 3300005330 | Bacteria | 1984 |
| 29 | Ga0070670_100015769 | 3300005331 | Bacteria | 6488 |
| 30 | Ga0070670_100133826 | 3300005331 | Bacteria | 2142 |
| 31 | Ga0070670_100437573 | 3300005331 | Bacteria | 1158 |
| 32 | Ga0070677_10003217 | 3300005333 | Bacteria | 5253 |
| 33 | Ga0070677_10078348 | 3300005333 | Bacteria | 1408 |
| 34 | Ga0070666_10080586 | 3300005335 | Bacteria | 2225 |
| 35 | Ga0070666_10086370 | 3300005335 | Bacteria | 2149 |
| 36 | Ga0070666_10174751 | 3300005335 | Bacteria | 1505 |
| 37 | Ga0070680_100000167 | 3300005336 | Bacteria | 41644 |
| 38 | Ga0070680_100198990 | 3300005336 | Bacteria | 1689 |
| 39 | Ga0070680_100282865 | 3300005336 | Bacteria | 1405 |
| 40 | Ga0070682_100058029 | 3300005337 | Bacteria | 2440 |
| 41 | Ga0070682_100418227 | 3300005337 | Unclassified | 1018 |
| 42 | Ga0068868_100119755 | 3300005338 | Bacteria | 2146 |
| 43 | Ga0068868_100339077 | 3300005338 | Bacteria | 1285 |
| 44 | Ga0070660_100121957 | 3300005339 | Bacteria | 2080 |
| 45 | Ga0070660_100130154 | 3300005339 | Unclassified | 2013 |
| 46 | Ga0070689_100028747 | 3300005340 | Bacteria | 4205 |
| 47 | Ga0070689_100038912 | 3300005340 | Bacteria | 3639 |
| 48 | Ga0070689_100045684 | 3300005340 | Bacteria | 3373 |
| 49 | Ga0070689_100288962 | 3300005340 | Unclassified | 1362 |
| 50 | Ga0070691_10058410 | 3300005341 | Unclassified | 1852 |
| 51 | Ga0070691_10142696 | 3300005341 | Bacteria | 1222 |
| 52 | Ga0070687_100000971 | 3300005343 | Bacteria | 9753 |
| 53 | Ga0070687_100003161 | 3300005343 | Bacteria | 6352 |
| 54 | Ga0070687_100100358 | 3300005343 | Bacteria | 1619 |
| 55 | Ga0070661_100010642 | 3300005344 | Bacteria | 6401 |
| 56 | Ga0070661_100095197 | 3300005344 | Unclassified | 2208 |
| 57 | Ga0070661_100645116 | 3300005344 | Bacteria | 859 |
| 58 | Ga0070668_100019705 | 3300005347 | Bacteria | 5080 |
| 59 | Ga0070668_100042798 | 3300005347 | Bacteria | 3471 |
| 60 | Ga0070668_100044752 | 3300005347 | Bacteria | 3396 |
| 61 | Ga0070668_100165816 | 3300005347 | Bacteria | 1795 |
| 62 | Ga0070668_100313903 | 3300005347 | Bacteria | 1318 |
| 63 | Ga0070669_100002728 | 3300005353 | Bacteria | 12738 |
| 64 | Ga0070675_100025100 | 3300005354 | Bacteria | 4776 |
| 65 | Ga0070675_100046201 | 3300005354 | Bacteria | 3565 |
| 66 | Ga0070675_100070042 | 3300005354 | Bacteria | 2906 |
| 67 | Ga0070675_100132259 | 3300005354 | Bacteria | 2127 |
| 68 | Ga0070675_100207968 | 3300005354 | Bacteria | 1700 |
| 69 | Ga0070675_100211794 | 3300005354 | Bacteria | 1685 |
| 70 | Ga0070675_100493744 | 3300005354 | Bacteria | 1102 |
| 71 | Ga0070671_100014818 | 3300005355 | Bacteria | 6298 |
| 72 | Ga0070671_100015101 | 3300005355 | Bacteria | 6237 |
| 73 | Ga0070671_100110023 | 3300005355 | Bacteria | 2314 |
| 74 | Ga0070671_100263125 | 3300005355 | Bacteria | 1466 |
| 75 | Ga0070671_100511864 | 3300005355 | Bacteria | 1033 |
| 76 | Ga0070671_100583664 | 3300005355 | Bacteria | 965 |
| 77 | Ga0070674_100000385 | 3300005356 | Bacteria | 22118 |
| 78 | Ga0070674_100001895 | 3300005356 | Bacteria | 11362 |
| 79 | Ga0070674_100078859 | 3300005356 | Bacteria | 2348 |
| 80 | Ga0070674_100180017 | 3300005356 | Bacteria | 1618 |
| 81 | Ga0070673_100007148 | 3300005364 | Bacteria | 7333 |
| 82 | Ga0070673_100007562 | 3300005364 | Bacteria | 7182 |
| 83 | Ga0070673_100036588 | 3300005364 | Bacteria | 3733 |
| 84 | Ga0070673_100127557 | 3300005364 | Bacteria | 2130 |
| 85 | Ga0070673_100206753 | 3300005364 | Bacteria | 1693 |
| 86 | Ga0070673_100290350 | 3300005364 | Bacteria | 1437 |
| 87 | Ga0070688_100011471 | 3300005365 | Bacteria | 4924 |
| 88 | Ga0070688_100027570 | 3300005365 | Bacteria | 3384 |
| 89 | Ga0070688_100135804 | 3300005365 | Bacteria | 1665 |
| 90 | Ga0070659_100004159 | 3300005366 | Bacteria | 10321 |
| 91 | Ga0070659_100027270 | 3300005366 | Bacteria | 4400 |
| 92 | Ga0070659_100042201 | 3300005366 | Bacteria | 3566 |
| 93 | Ga0070667_100077349 | 3300005367 | Bacteria | 2841 |
| 94 | Ga0070667_100080903 | 3300005367 | Bacteria | 2779 |
| 95 | Ga0070667_100161058 | 3300005367 | Bacteria | 1976 |
| 96 | Ga0070709_10011001 | 3300005434 | Bacteria | 5027 |
| 97 | Ga0070709_10029691 | 3300005434 | Bacteria | 3274 |
| 98 | Ga0070709_10034393 | 3300005434 | Bacteria | 3072 |
| 99 | Ga0070709_10292828 | 3300005434 | Bacteria | 1187 |
| 100 | Ga0070709_10401858 | 3300005434 | Unclassified | 1023 |
| 101 | Ga0070714_100071808 | 3300005435 | Bacteria | 2994 |
| 102 | Ga0070714_100095456 | 3300005435 | Bacteria | 2611 |
| 103 | Ga0070714_100112466 | 3300005435 | Bacteria | 2413 |
| 104 | Ga0070714_100119069 | 3300005435 | Bacteria | 2346 |
| 105 | Ga0070714_100196016 | 3300005435 | Bacteria | 1845 |
| 106 | Ga0070714_100212954 | 3300005435 | Bacteria | 1772 |
| 107 | Ga0070714_100256501 | 3300005435 | Bacteria | 1618 |
| 108 | Ga0070714_100470019 | 3300005435 | Bacteria | 1196 |
| 109 | Ga0070713_100000084 | 3300005436 | Bacteria | 59438 |
| 110 | Ga0070713_100002024 | 3300005436 | Bacteria | 13097 |
| 111 | Ga0070713_100006573 | 3300005436 | Bacteria | 8078 |
| 112 | Ga0070713_100028305 | 3300005436 | Bacteria | 4424 |
| 113 | Ga0070713_100029007 | 3300005436 | Bacteria | 4376 |
| 114 | Ga0070713_100029331 | 3300005436 | Bacteria | 4356 |
| 115 | Ga0070713_100030673 | 3300005436 | Bacteria | 4272 |
| 116 | Ga0070713_100086436 | 3300005436 | Bacteria | 2689 |
| 117 | Ga0070713_100095905 | 3300005436 | Bacteria | 2560 |
| 118 | Ga0070713_100438091 | 3300005436 | Bacteria | 1226 |
| 119 | Ga0070710_10021880 | 3300005437 | Bacteria | 3338 |
| 120 | Ga0070710_10063306 | 3300005437 | Bacteria | 2113 |
| 121 | Ga0070710_10081138 | 3300005437 | Bacteria | 1893 |
| 122 | Ga0070710_10109883 | 3300005437 | Bacteria | 1655 |
| 123 | Ga0070710_10205031 | 3300005437 | Bacteria | 1247 |
| 124 | Ga0070711_100012633 | 3300005439 | Bacteria | 5281 |
| 125 | Ga0070711_100024494 | 3300005439 | Bacteria | 3936 |
| 126 | Ga0070711_100028675 | 3300005439 | Bacteria | 3665 |
| 127 | Ga0070711_100034503 | 3300005439 | Bacteria | 3375 |
| 128 | Ga0070711_100052699 | 3300005439 | Bacteria | 2801 |
| 129 | Ga0070711_100090239 | 3300005439 | Bacteria | 2207 |
| 130 | Ga0070711_100180687 | 3300005439 | Bacteria | 1615 |
| 131 | Ga0070711_100319002 | 3300005439 | Bacteria | 1241 |
| 132 | Ga0070711_100372581 | 3300005439 | Bacteria | 1152 |
| 133 | Ga0070711_100437066 | 3300005439 | Bacteria | 1069 |
| 134 | Ga0070705_100089202 | 3300005440 | Unclassified | 1916 |
| 135 | Ga0070705_100096901 | 3300005440 | Bacteria | 1853 |
| 136 | Ga0070705_100104837 | 3300005440 | Bacteria | 1794 |
| 137 | Ga0070705_100509165 | 3300005440 | Unclassified | 915 |
| 138 | Ga0070700_100044965 | 3300005441 | Bacteria | 2722 |
| 139 | Ga0070694_100036313 | 3300005444 | Bacteria | 3264 |
| 140 | Ga0070708_100011000 | 3300005445 | Bacteria | 7353 |
| 141 | Ga0070708_100031125 | 3300005445 | Bacteria | 4616 |
| 142 | Ga0070708_100077831 | 3300005445 | Bacteria | 2997 |
| 143 | Ga0070708_100105638 | 3300005445 | Bacteria | 2584 |
| 144 | Ga0070708_100190968 | 3300005445 | Bacteria | 1915 |
| 145 | Ga0070708_100279465 | 3300005445 | Bacteria | 1571 |
| 146 | Ga0070663_100077985 | 3300005455 | Bacteria | 2427 |
| 147 | Ga0070663_100192482 | 3300005455 | Unclassified | 1588 |
| 148 | Ga0070678_100003379 | 3300005456 | Bacteria | 8898 |
| 149 | Ga0070678_100022634 | 3300005456 | Bacteria | 4170 |
| 150 | Ga0070678_100048545 | 3300005456 | Bacteria | 3057 |
| 151 | Ga0070678_100476614 | 3300005456 | Bacteria | 1097 |
| 152 | Ga0070662_100000649 | 3300005457 | Bacteria | 21039 |
| 153 | Ga0070662_100171046 | 3300005457 | Bacteria | 1706 |
| 154 | Ga0070662_100314978 | 3300005457 | Bacteria | 1275 |
| 155 | Ga0070662_100432539 | 3300005457 | Bacteria | 1090 |
| 156 | Ga0070681_10008068 | 3300005458 | Bacteria | 10304 |
| 157 | Ga0070681_10014788 | 3300005458 | Bacteria | 7761 |
| 158 | Ga0070681_10104124 | 3300005458 | Bacteria | 2781 |
| 159 | Ga0070681_10182844 | 3300005458 | Unclassified | 2017 |
| 160 | Ga0070681_10345875 | 3300005458 | Bacteria | 1397 |
| 161 | Ga0070681_10502648 | 3300005458 | Bacteria | 1125 |
| 162 | Ga0068867_100006869 | 3300005459 | Bacteria | 8052 |
| 163 | Ga0068867_100074517 | 3300005459 | Bacteria | 2544 |
| 164 | Ga0070685_10051874 | 3300005466 | Bacteria | 2372 |
| 165 | Ga0070706_100000072 | 3300005467 | Bacteria | 117347 |
| 166 | Ga0070706_100015531 | 3300005467 | Bacteria | 7033 |
| 167 | Ga0070706_100021589 | 3300005467 | Bacteria | 5928 |
| 168 | Ga0070706_100061960 | 3300005467 | Bacteria | 3455 |
| 169 | Ga0070706_100196623 | 3300005467 | Bacteria | 1884 |
| 170 | Ga0070706_100205592 | 3300005467 | Bacteria | 1839 |
| 171 | Ga0070706_100215066 | 3300005467 | Bacteria | 1794 |
| 172 | Ga0070707_100001205 | 3300005468 | Bacteria | 25431 |
| 173 | Ga0070707_100009587 | 3300005468 | Bacteria | 8994 |
| 174 | Ga0070707_100010644 | 3300005468 | Bacteria | 8569 |
| 175 | Ga0070707_100196271 | 3300005468 | Bacteria | 1968 |
| 176 | Ga0070707_100329923 | 3300005468 | Bacteria | 1482 |
| 177 | Ga0070698_100007279 | 3300005471 | Bacteria | 11988 |
| 178 | Ga0070698_100037594 | 3300005471 | Bacteria | 4990 |
| 179 | Ga0070698_100134167 | 3300005471 | Bacteria | 2430 |
| 180 | Ga0070698_100224697 | 3300005471 | Bacteria | 1811 |
| 181 | Ga0070699_100004356 | 3300005518 | Bacteria | 12508 |
| 182 | Ga0070699_100005682 | 3300005518 | Bacteria | 10923 |
| 183 | Ga0070699_100006883 | 3300005518 | Bacteria | 9888 |
| 184 | Ga0070699_100046134 | 3300005518 | Bacteria | 3771 |
| 185 | Ga0070699_100168462 | 3300005518 | Bacteria | 1940 |
| 186 | Ga0070699_100215513 | 3300005518 | Bacteria | 1710 |
| 187 | Ga0070679_100028867 | 3300005530 | Bacteria | 5472 |
| 188 | Ga0070679_100039953 | 3300005530 | Bacteria | 4664 |
| 189 | Ga0070679_100097630 | 3300005530 | Bacteria | 2925 |
| 190 | Ga0070679_100105508 | 3300005530 | Bacteria | 2804 |
| 191 | Ga0070679_100154858 | 3300005530 | Bacteria | 2267 |
| 192 | Ga0070679_100630759 | 3300005530 | Bacteria | 1015 |
| 193 | Ga0070684_100293881 | 3300005535 | Bacteria | 1490 |
| 194 | Ga0070684_100441881 | 3300005535 | Unclassified | 1202 |
| 195 | Ga0070684_100565985 | 3300005535 | Bacteria | 1055 |
| 196 | Ga0070697_100000113 | 3300005536 | Bacteria | 63284 |
| 197 | Ga0070697_100001895 | 3300005536 | Bacteria | 15983 |
| 198 | Ga0070697_100003932 | 3300005536 | Bacteria | 11419 |
| 199 | Ga0070697_100024116 | 3300005536 | Bacteria | 4842 |
| 200 | Ga0070697_100034025 | 3300005536 | Bacteria | 4107 |
| 201 | Ga0070697_100083096 | 3300005536 | Bacteria | 2641 |
| 202 | Ga0070697_100099882 | 3300005536 | Bacteria | 2409 |
| 203 | Ga0070697_100106261 | 3300005536 | Bacteria | 2335 |
| 204 | Ga0070697_100140650 | 3300005536 | Bacteria | 2030 |
| 205 | Ga0070697_100158636 | 3300005536 | Bacteria | 1911 |
| 206 | Ga0070697_100395608 | 3300005536 | Bacteria | 1198 |
| 207 | Ga0070697_100496256 | 3300005536 | Unclassified | 1067 |
| 208 | Ga0070697_100719700 | 3300005536 | Unclassified | 881 |
| 209 | Ga0070672_100003922 | 3300005543 | Bacteria | 9694 |
| 210 | Ga0070672_100011647 | 3300005543 | Bacteria | 6138 |
| 211 | Ga0070672_100059204 | 3300005543 | Bacteria | 3013 |
| 212 | Ga0070672_100100272 | 3300005543 | Bacteria | 2348 |
| 213 | Ga0070672_100189597 | 3300005543 | Bacteria | 1716 |
| 214 | Ga0070686_100002480 | 3300005544 | Bacteria | 10158 |
| 215 | Ga0070686_100133026 | 3300005544 | Bacteria | 1722 |
| 216 | Ga0070686_100504344 | 3300005544 | Bacteria | 939 |
| 217 | Ga0070695_100040020 | 3300005545 | Bacteria | 2966 |
| 218 | Ga0070695_100044557 | 3300005545 | Unclassified | 2825 |
| 219 | Ga0070696_100022055 | 3300005546 | Bacteria | 4323 |
| 220 | Ga0070696_100026183 | 3300005546 | Bacteria | 3967 |
| 221 | Ga0070696_100185202 | 3300005546 | Bacteria | 1547 |
| 222 | Ga0070693_100080754 | 3300005547 | Unclassified | 1938 |
| 223 | Ga0070665_100049286 | 3300005548 | Bacteria | 4227 |
| 224 | Ga0070665_100099430 | 3300005548 | Bacteria | 2913 |
| 225 | Ga0070665_100129865 | 3300005548 | Bacteria | 2522 |
| 226 | Ga0070665_100195255 | 3300005548 | Bacteria | 2025 |
| 227 | Ga0070665_100293203 | 3300005548 | Bacteria | 1629 |
| 228 | Ga0070704_100020423 | 3300005549 | Bacteria | 4270 |
| 229 | Ga0070704_100022697 | 3300005549 | Bacteria | 4087 |
| 230 | Ga0070704_100131276 | 3300005549 | Bacteria | 1942 |
| 231 | Ga0070704_100305713 | 3300005549 | Unclassified | 1327 |
| 232 | Ga0070704_100512451 | 3300005549 | Bacteria | 1043 |
| 233 | Ga0068855_100164779 | 3300005563 | Bacteria | 2513 |
| 234 | Ga0068855_100224487 | 3300005563 | Bacteria | 2105 |
| 235 | Ga0068855_100405617 | 3300005563 | Bacteria | 1493 |
| 236 | Ga0070664_100013086 | 3300005564 | Bacteria | 6753 |
| 237 | Ga0068857_100013918 | 3300005577 | Bacteria | 7001 |
| 238 | Ga0068857_100070415 | 3300005577 | Bacteria | 3115 |
| 239 | Ga0068857_100079273 | 3300005577 | Bacteria | 2932 |
| 240 | Ga0068854_100032206 | 3300005578 | Bacteria | 3646 |
| 241 | Ga0068854_100095806 | 3300005578 | Bacteria | 2216 |
| 242 | Ga0068854_100110612 | 3300005578 | Bacteria | 2072 |
| 243 | Ga0068856_100000755 | 3300005614 | Bacteria | 35138 |
| 244 | Ga0068856_100004317 | 3300005614 | Bacteria | 14185 |
| 245 | Ga0068856_100198027 | 3300005614 | Bacteria | 2023 |
| 246 | Ga0068856_100320199 | 3300005614 | Bacteria | 1568 |
| 247 | Ga0068856_100489945 | 3300005614 | Bacteria | 1250 |
| 248 | Ga0068856_100510735 | 3300005614 | Bacteria | 1223 |
| 249 | Ga0070702_100248015 | 3300005615 | Bacteria | 1205 |
| 250 | Ga0068859_100710636 | 3300005617 | Bacteria | 1095 |
| 251 | Ga0068859_100965094 | 3300005617 | Unclassified | 935 |
| 252 | Ga0068864_100085454 | 3300005618 | Bacteria | 2774 |
| 253 | Ga0068864_100153317 | 3300005618 | Bacteria | 2089 |
| 254 | Ga0068866_10070469 | 3300005718 | Bacteria | 1846 |
| 255 | Ga0068861_100041952 | 3300005719 | Bacteria | 3429 |
| 256 | Ga0068870_10007417 | 3300005840 | Bacteria | 4887 |
| 257 | Ga0068863_100150975 | 3300005841 | Bacteria | 2223 |
| 258 | Ga0068863_100280048 | 3300005841 | Bacteria | 1615 |
| 259 | Ga0068858_100443499 | 3300005842 | Bacteria | 1250 |
| 260 | Ga0068858_100765182 | 3300005842 | Unclassified | 941 |
| 261 | Ga0068860_100017560 | 3300005843 | Bacteria | 6971 |
| 262 | Ga0068860_100061892 | 3300005843 | Bacteria | 3556 |
| 263 | Ga0068860_100351291 | 3300005843 | Bacteria | 1451 |
| 264 | Ga0068860_100454300 | 3300005843 | Bacteria | 1274 |
| 265 | Ga0068862_100046907 | 3300005844 | Bacteria | 3686 |
| 266 | Ga0081539_10063094 | 3300005985 | Bacteria | 2023 |
| 267 | Ga0070717_10001346 | 3300006028 | Bacteria | 16894 |
| 268 | Ga0070717_10005388 | 3300006028 | Bacteria | 9339 |
| 269 | Ga0070717_10028889 | 3300006028 | Bacteria | 4443 |
| 270 | Ga0070717_10036469 | 3300006028 | Bacteria | 3988 |
| 271 | Ga0070717_10127444 | 3300006028 | Bacteria | 2186 |
| 272 | Ga0070717_10223172 | 3300006028 | Bacteria | 1657 |
| 273 | Ga0070717_10253844 | 3300006028 | Bacteria | 1554 |
| 274 | Ga0070717_10305741 | 3300006028 | Bacteria | 1414 |
| 275 | Ga0070717_10329370 | 3300006028 | Bacteria | 1362 |
| 276 | Ga0070717_10371879 | 3300006028 | Unclassified | 1281 |
| 277 | Ga0075432_10001294 | 3300006058 | Bacteria | 8074 |
| 278 | Ga0070715_10016525 | 3300006163 | Bacteria | 2774 |
| 279 | Ga0070715_10062330 | 3300006163 | Bacteria | 1640 |
| 280 | Ga0070716_100000274 | 3300006173 | Bacteria | 20780 |
| 281 | Ga0070716_100019584 | 3300006173 | Bacteria | 3538 |
| 282 | Ga0070716_100052972 | 3300006173 | Bacteria | 2312 |
| 283 | Ga0070716_100138986 | 3300006173 | Bacteria | 1546 |
| 284 | Ga0070716_100148151 | 3300006173 | Bacteria | 1506 |
| 285 | Ga0070716_100364917 | 3300006173 | Bacteria | 1027 |
| 286 | Ga0070716_100592064 | 3300006173 | Unclassified | 833 |
| 287 | Ga0070712_100000106 | 3300006175 | Bacteria | 43079 |
| 288 | Ga0070712_100004726 | 3300006175 | Bacteria | 8423 |
| 289 | Ga0070712_100008733 | 3300006175 | Bacteria | 6380 |
| 290 | Ga0070712_100024347 | 3300006175 | Bacteria | 4011 |
| 291 | Ga0070712_100176607 | 3300006175 | Bacteria | 1661 |
| 292 | Ga0070712_100236060 | 3300006175 | Bacteria | 1454 |
| 293 | Ga0075427_10003926 | 3300006194 | Bacteria | 2075 |
| 294 | Ga0097621_100001385 | 3300006237 | Bacteria | 16681 |
| 295 | Ga0097621_100009158 | 3300006237 | Bacteria | 7178 |
| 296 | Ga0097621_100017018 | 3300006237 | Bacteria | 5513 |
| 297 | Ga0097621_100020222 | 3300006237 | Bacteria | 5128 |
| 298 | Ga0097621_100056388 | 3300006237 | Bacteria | 3210 |
| 299 | Ga0097621_100575347 | 3300006237 | Unclassified | 1027 |
| 300 | Ga0068871_100009154 | 3300006358 | Bacteria | 7157 |
| 301 | Ga0068871_100010844 | 3300006358 | Bacteria | 6671 |
| 302 | Ga0068871_100113889 | 3300006358 | Bacteria | 2278 |
| 303 | Ga0075428_100013513 | 3300006844 | Bacteria | 9088 |
| 304 | Ga0075428_100018113 | 3300006844 | Bacteria | 7782 |
| 305 | Ga0075430_100008311 | 3300006846 | Bacteria | 8768 |
| 306 | Ga0075431_100070518 | 3300006847 | Bacteria | 3606 |
| 307 | Ga0075433_10000913 | 3300006852 | Bacteria | 20789 |
| 308 | Ga0075433_10014277 | 3300006852 | Bacteria | 6487 |
| 309 | Ga0075433_10125800 | 3300006852 | Bacteria | 2276 |
| 310 | Ga0075434_100000253 | 3300006871 | Bacteria | 37649 |
| 311 | Ga0075434_100019249 | 3300006871 | Bacteria | 6604 |
| 312 | Ga0075434_100019639 | 3300006871 | Bacteria | 6540 |
| 313 | Ga0075434_100234340 | 3300006871 | Bacteria | 1855 |
| 314 | Ga0075434_100519001 | 3300006871 | Bacteria | 1212 |
| 315 | Ga0075434_100965503 | 3300006871 | Bacteria | 866 |
| 316 | Ga0068865_100004508 | 3300006881 | Bacteria | 8405 |
| 317 | Ga0068865_100021768 | 3300006881 | Bacteria | 4173 |
| 318 | Ga0075436_100026097 | 3300006914 | Bacteria | 4022 |
| 319 | Ga0075436_100041976 | 3300006914 | Bacteria | 3154 |
| 320 | Ga0097620_100710719 | 3300006931 | Bacteria | 1095 |
| 321 | Ga0097620_100965147 | 3300006931 | Unclassified | 935 |
| 322 | Ga0075435_100000234 | 3300007076 | Bacteria | 34046 |
| 323 | Ga0075435_100001191 | 3300007076 | Bacteria | 16636 |
| 324 | Ga0075435_100053921 | 3300007076 | Bacteria | 3244 |
| 325 | Ga0075435_100308659 | 3300007076 | Bacteria | 1354 |
| 326 | Ga0099794_10018509 | 3300007265 | Bacteria | 3125 |
| 327 | Ga0099794_10154215 | 3300007265 | Bacteria | 1166 |
| 328 | Ga0099795_10019095 | 3300007788 | Unclassified | 2213 |
| 329 | Ga0099795_10020654 | 3300007788 | Bacteria | 2149 |
| 330 | Ga0105240_10021993 | 3300009093 | Bacteria | 8471 |
| 331 | Ga0105240_10039955 | 3300009093 | Bacteria | 6005 |
| 332 | Ga0105240_10067425 | 3300009093 | Bacteria | 4435 |
| 333 | Ga0105240_10397616 | 3300009093 | Bacteria | 1553 |
| 334 | Ga0105240_10496370 | 3300009093 | Bacteria | 1358 |
| 335 | Ga0111539_10062241 | 3300009094 | Bacteria | 4418 |
| 336 | Ga0111539_10062696 | 3300009094 | Bacteria | 4400 |
| 337 | Ga0111539_10118643 | 3300009094 | Bacteria | 3101 |
| 338 | Ga0111539_10511603 | 3300009094 | Unclassified | 1398 |
| 339 | Ga0111539_10513411 | 3300009094 | Bacteria | 1396 |
| 340 | Ga0111539_10725872 | 3300009094 | Bacteria | 1157 |
| 341 | Ga0111539_10976792 | 3300009094 | Bacteria | 985 |
| 342 | Ga0105245_10006914 | 3300009098 | Bacteria | 9948 |
| 343 | Ga0105245_10008205 | 3300009098 | Bacteria | 9133 |
| 344 | Ga0105245_10008208 | 3300009098 | Bacteria | 9130 |
| 345 | Ga0105245_10482715 | 3300009098 | Bacteria | 1253 |
| 346 | Ga0105247_10321326 | 3300009101 | Bacteria | 1080 |
| 347 | Ga0105247_10527773 | 3300009101 | Bacteria | 864 |
| 348 | Ga0114129_10017199 | 3300009147 | Bacteria | 10299 |
| 349 | Ga0114129_10024476 | 3300009147 | Bacteria | 8555 |
| 350 | Ga0114129_10114977 | 3300009147 | Bacteria | 3710 |
| 351 | Ga0114129_10270845 | 3300009147 | Bacteria | 2272 |
| 352 | Ga0114129_10489715 | 3300009147 | Bacteria | 1607 |
| 353 | Ga0105243_10000414 | 3300009148 | Bacteria | 44876 |
| 354 | Ga0105241_10138141 | 3300009174 | Bacteria | 1981 |
| 355 | Ga0105241_10172763 | 3300009174 | Unclassified | 1786 |
| 356 | Ga0105241_10631788 | 3300009174 | Bacteria | 971 |
| 357 | Ga0105242_10005509 | 3300009176 | Bacteria | 9772 |
| 358 | Ga0105242_10111522 | 3300009176 | Bacteria | 2333 |
| 359 | Ga0105242_10559993 | 3300009176 | Bacteria | 1097 |
| 360 | Ga0105242_10696010 | 3300009176 | Bacteria | 994 |
| 361 | Ga0105248_10042569 | 3300009177 | Bacteria | 5094 |
| 362 | Ga0105237_10011974 | 3300009545 | Bacteria | 9168 |
| 363 | Ga0105237_10229475 | 3300009545 | Bacteria | 1857 |
| 364 | Ga0105237_10347353 | 3300009545 | Bacteria | 1488 |
| 365 | Ga0105238_10173474 | 3300009551 | Bacteria | 2133 |
| 366 | Ga0105249_10003933 | 3300009553 | Bacteria | 12831 |
| 367 | Ga0105249_10873438 | 3300009553 | Bacteria | 966 |
| 368 | Ga0099796_10006841 | 3300010159 | Bacteria | 2944 |
| 369 | Ga0099796_10025714 | 3300010159 | Bacteria | 1862 |
| 370 | Ga0099796_10087847 | 3300010159 | Bacteria | 1151 |
| 371 | Ga0105239_10113753 | 3300010375 | Bacteria | 3001 |
| 372 | Ga0105239_10115581 | 3300010375 | Bacteria | 2977 |
| 373 | Ga0105239_10549006 | 3300010375 | Bacteria | 1316 |
| 374 | Ga0105246_10000130 | 3300011119 | Bacteria | 35001 |
| 375 | Ga0105246_10159389 | 3300011119 | Bacteria | 1717 |
| 376 | Ga0105246_10211157 | 3300011119 | Bacteria | 1515 |
| 377 | Ga0157373_10003878 | 3300013100 | Bacteria | 11302 |
| 378 | Ga0157373_10028714 | 3300013100 | Bacteria | 4012 |
| 379 | Ga0157371_10019095 | 3300013102 | Bacteria | 5061 |
| 380 | Ga0157371_10157736 | 3300013102 | Unclassified | 1620 |
| 381 | Ga0157370_10027500 | 3300013104 | Bacteria | 5608 |
| 382 | Ga0157370_10043493 | 3300013104 | Bacteria | 4322 |
| 383 | Ga0157370_10204582 | 3300013104 | Bacteria | 1831 |
| 384 | Ga0157369_10009595 | 3300013105 | Bacteria | 11068 |
| 385 | Ga0157369_10088489 | 3300013105 | Bacteria | 3305 |
| 386 | Ga0157369_10188680 | 3300013105 | Unclassified | 2167 |
| 387 | Ga0157369_10459371 | 3300013105 | Unclassified | 1318 |
| 388 | Ga0157369_10552930 | 3300013105 | Bacteria | 1189 |
| 389 | Ga0157374_10000068 | 3300013296 | Bacteria | 106195 |
| 390 | Ga0157374_10004858 | 3300013296 | Bacteria | 11282 |
| 391 | Ga0157374_10015477 | 3300013296 | Bacteria | 6690 |
| 392 | Ga0157374_10140802 | 3300013296 | Bacteria | 2341 |
| 393 | Ga0157374_10322630 | 3300013296 | Unclassified | 1531 |
| 394 | Ga0157378_10002374 | 3300013297 | Bacteria | 16730 |
| 395 | Ga0157378_10003652 | 3300013297 | Bacteria | 13632 |
| 396 | Ga0157378_10072539 | 3300013297 | Bacteria | 3094 |
| 397 | Ga0157378_10239427 | 3300013297 | Unclassified | 1733 |
| 398 | Ga0157378_10327168 | 3300013297 | Unclassified | 1491 |
| 399 | Ga0157378_10363890 | 3300013297 | Bacteria | 1416 |
| 400 | Ga0157378_10487893 | 3300013297 | Bacteria | 1229 |
| 401 | Ga0163162_10003595 | 3300013306 | Bacteria | 14843 |
| 402 | Ga0163162_10117183 | 3300013306 | Bacteria | 2765 |
| 403 | Ga0163162_10185584 | 3300013306 | Bacteria | 2207 |
| 404 | Ga0163162_10906082 | 3300013306 | Unclassified | 995 |
| 405 | Ga0157372_10004816 | 3300013307 | Bacteria | 14345 |
| 406 | Ga0157372_10006638 | 3300013307 | Bacteria | 12316 |
| 407 | Ga0157372_10011099 | 3300013307 | Bacteria | 9581 |
| 408 | Ga0157372_10013707 | 3300013307 | Bacteria | 8665 |
| 409 | Ga0157372_10018858 | 3300013307 | Bacteria | 7423 |
| 410 | Ga0157372_10022540 | 3300013307 | Bacteria | 6815 |
| 411 | Ga0157372_10162946 | 3300013307 | Unclassified | 2578 |
| 412 | Ga0157372_10251333 | 3300013307 | Bacteria | 2052 |
| 413 | Ga0157372_10440517 | 3300013307 | Bacteria | 1519 |
| 414 | Ga0157375_10002248 | 3300013308 | Bacteria | 16689 |
| 415 | Ga0157375_10043724 | 3300013308 | Bacteria | 4347 |
| 416 | Ga0157375_10072099 | 3300013308 | Bacteria | 3469 |
| 417 | Ga0157375_10260513 | 3300013308 | Bacteria | 1896 |
| 418 | Ga0157375_10280219 | 3300013308 | Bacteria | 1830 |
| 419 | Ga0157375_10444360 | 3300013308 | Bacteria | 1462 |
| 420 | Ga0157375_11287844 | 3300013308 | Bacteria | 859 |
| 421 | Ga0163163_10057762 | 3300014325 | Bacteria | 3837 |
| 422 | Ga0163163_10085528 | 3300014325 | Bacteria | 3162 |
| 423 | Ga0163163_10257064 | 3300014325 | Bacteria | 1797 |
| 424 | Ga0163163_10335189 | 3300014325 | Bacteria | 1568 |
| 425 | Ga0157380_10038409 | 3300014326 | Bacteria | 3717 |
| 426 | Ga0182008_10080573 | 3300014497 | Unclassified | 1602 |
| 427 | Ga0157377_10005381 | 3300014745 | Bacteria | 6012 |
| 428 | Ga0157379_10027874 | 3300014968 | Bacteria | 5027 |
| 429 | Ga0157379_10046103 | 3300014968 | Bacteria | 3891 |
| 430 | Ga0157376_10001790 | 3300014969 | Bacteria | 14318 |
| 431 | Ga0157376_10002339 | 3300014969 | Bacteria | 12795 |
| 432 | Ga0157376_10014931 | 3300014969 | Bacteria | 5852 |
| 433 | Ga0157376_10130612 | 3300014969 | Bacteria | 2241 |
| 434 | Ga0157376_10991132 | 3300014969 | Unclassified | 862 |
| 435 | Ga0182006_1008826 | 3300015261 | Unclassified | 4553 |
| 436 | Ga0182006_1057475 | 3300015261 | Bacteria | 1479 |
| 437 | Ga0182007_10006678 | 3300015262 | Bacteria | 4931 |
| 438 | Ga0182005_1039451 | 3300015265 | Bacteria | 1284 |
| 439 | Ga0163161_10063788 | 3300017792 | Bacteria | 2686 |
| 440 | Ga0163161_10147410 | 3300017792 | Bacteria | 1786 |
| 441 | Ga0206356_11396592 | 3300020070 | Bacteria | 1982 |
| 442 | Ga0213872_10084408 | 3300021361 | Bacteria | 1424 |
| 443 | Ga0213876_10046543 | 3300021384 | Bacteria | 2293 |
| 444 | Ga0207666_1029196 | 3300025271 | Unclassified | 840 |
| 445 | Ga0207697_10000465 | 3300025315 | Bacteria | 22852 |
| 446 | Ga0207697_10006542 | 3300025315 | Bacteria | 5259 |
| 447 | Ga0207697_10014431 | 3300025315 | Bacteria | 3276 |
| 448 | Ga0207682_10008155 | 3300025893 | Bacteria | 4153 |
| 449 | Ga0207682_10033499 | 3300025893 | Bacteria | 2069 |
| 450 | Ga0207692_10015719 | 3300025898 | Bacteria | 3338 |
| 451 | Ga0207692_10025075 | 3300025898 | Bacteria | 2781 |
| 452 | Ga0207692_10166737 | 3300025898 | Bacteria | 1273 |
| 453 | Ga0207642_10062879 | 3300025899 | Bacteria | 1734 |
| 454 | Ga0207642_10217441 | 3300025899 | Bacteria | 1066 |
| 455 | Ga0207688_10001108 | 3300025901 | Bacteria | 13831 |
| 456 | Ga0207688_10001495 | 3300025901 | Bacteria | 12265 |
| 457 | Ga0207688_10034388 | 3300025901 | Bacteria | 2807 |
| 458 | Ga0207688_10035459 | 3300025901 | Bacteria | 2764 |
| 459 | Ga0207688_10126338 | 3300025901 | Bacteria | 1496 |
| 460 | Ga0207680_10021953 | 3300025903 | Bacteria | 3464 |
| 461 | Ga0207680_10205787 | 3300025903 | Bacteria | 1343 |
| 462 | Ga0207647_10202087 | 3300025904 | Bacteria | 1149 |
| 463 | Ga0207699_10000756 | 3300025906 | Bacteria | 15451 |
| 464 | Ga0207699_10029346 | 3300025906 | Bacteria | 3067 |
| 465 | Ga0207699_10062799 | 3300025906 | Bacteria | 2241 |
| 466 | Ga0207699_10078612 | 3300025906 | Bacteria | 2038 |
| 467 | Ga0207645_10000012 | 3300025907 | Bacteria | 131374 |
| 468 | Ga0207645_10002843 | 3300025907 | Bacteria | 13430 |
| 469 | Ga0207645_10118907 | 3300025907 | Bacteria | 1714 |
| 470 | Ga0207645_10298811 | 3300025907 | Bacteria | 1072 |
| 471 | Ga0207643_10011714 | 3300025908 | Bacteria | 4738 |
| 472 | Ga0207705_10123098 | 3300025909 | Bacteria | 1926 |
| 473 | Ga0207684_10038482 | 3300025910 | Bacteria | 4058 |
| 474 | Ga0207684_10053255 | 3300025910 | Bacteria | 3435 |
| 475 | Ga0207684_10192263 | 3300025910 | Bacteria | 1760 |
| 476 | Ga0207654_10020414 | 3300025911 | Bacteria | 3511 |
| 477 | Ga0207707_10014117 | 3300025912 | Bacteria | 6961 |
| 478 | Ga0207707_10051140 | 3300025912 | Bacteria | 3598 |
| 479 | Ga0207707_10060653 | 3300025912 | Bacteria | 3290 |
| 480 | Ga0207695_10007980 | 3300025913 | Bacteria | 13347 |
| 481 | Ga0207695_10017288 | 3300025913 | Bacteria | 8397 |
| 482 | Ga0207695_10027313 | 3300025913 | Bacteria | 6358 |
| 483 | Ga0207695_10197137 | 3300025913 | Bacteria | 1929 |
| 484 | Ga0207671_10032357 | 3300025914 | Bacteria | 3894 |
| 485 | Ga0207671_10207703 | 3300025914 | Bacteria | 1531 |
| 486 | Ga0207693_10000033 | 3300025915 | Bacteria | 114840 |
| 487 | Ga0207693_10008418 | 3300025915 | Bacteria | 8439 |
| 488 | Ga0207693_10008661 | 3300025915 | Bacteria | 8324 |
| 489 | Ga0207693_10012562 | 3300025915 | Bacteria | 6840 |
| 490 | Ga0207693_10018610 | 3300025915 | Bacteria | 5530 |
| 491 | Ga0207693_10179322 | 3300025915 | Bacteria | 1667 |
| 492 | Ga0207693_10425485 | 3300025915 | Bacteria | 1038 |
| 493 | Ga0207663_10011327 | 3300025916 | Bacteria | 4786 |
| 494 | Ga0207663_10017700 | 3300025916 | Bacteria | 3978 |
| 495 | Ga0207663_10037325 | 3300025916 | Bacteria | 2929 |
| 496 | Ga0207663_10068994 | 3300025916 | Bacteria | 2273 |
| 497 | Ga0207663_10159346 | 3300025916 | Bacteria | 1591 |
| 498 | Ga0207663_10198015 | 3300025916 | Bacteria | 1447 |
| 499 | Ga0207663_10512979 | 3300025916 | Bacteria | 933 |
| 500 | Ga0207660_10020529 | 3300025917 | Bacteria | 4435 |
| 501 | Ga0207660_10031923 | 3300025917 | Bacteria | 3632 |
| 502 | Ga0207660_10049922 | 3300025917 | Bacteria | 2969 |
| 503 | Ga0207660_10059616 | 3300025917 | Bacteria | 2741 |
| 504 | Ga0207660_10179995 | 3300025917 | Unclassified | 1641 |
| 505 | Ga0207660_10279031 | 3300025917 | Bacteria | 1326 |
| 506 | Ga0207662_10000967 | 3300025918 | Bacteria | 13355 |
| 507 | Ga0207662_10016291 | 3300025918 | Bacteria | 4192 |
| 508 | Ga0207657_10005628 | 3300025919 | Bacteria | 13078 |
| 509 | Ga0207657_10044352 | 3300025919 | Unclassified | 3909 |
| 510 | Ga0207657_10093755 | 3300025919 | Bacteria | 2501 |
| 511 | Ga0207657_10148702 | 3300025919 | Bacteria | 1909 |
| 512 | Ga0207649_10052791 | 3300025920 | Bacteria | 2523 |
| 513 | Ga0207652_10008847 | 3300025921 | Bacteria | 8111 |
| 514 | Ga0207652_10051815 | 3300025921 | Bacteria | 3520 |
| 515 | Ga0207652_10063841 | 3300025921 | Bacteria | 3185 |
| 516 | Ga0207652_10121725 | 3300025921 | Bacteria | 2322 |
| 517 | Ga0207652_10254960 | 3300025921 | Bacteria | 1582 |
| 518 | Ga0207652_10334022 | 3300025921 | Unclassified | 1368 |
| 519 | Ga0207652_10696971 | 3300025921 | Bacteria | 906 |
| 520 | Ga0207646_10002936 | 3300025922 | Bacteria | 19762 |
| 521 | Ga0207646_10040006 | 3300025922 | Bacteria | 4219 |
| 522 | Ga0207646_10174121 | 3300025922 | Bacteria | 1943 |
| 523 | Ga0207646_10195392 | 3300025922 | Bacteria | 1827 |
| 524 | Ga0207646_10586852 | 3300025922 | Unclassified | 1001 |
| 525 | Ga0207681_10016862 | 3300025923 | Bacteria | 4579 |
| 526 | Ga0207681_10057151 | 3300025923 | Bacteria | 2664 |
| 527 | Ga0207650_10038372 | 3300025925 | Bacteria | 3497 |
| 528 | Ga0207650_10244445 | 3300025925 | Bacteria | 1451 |
| 529 | Ga0207659_10004515 | 3300025926 | Bacteria | 8416 |
| 530 | Ga0207659_10026996 | 3300025926 | Bacteria | 3882 |
| 531 | Ga0207659_10034581 | 3300025926 | Bacteria | 3486 |
| 532 | Ga0207659_10064578 | 3300025926 | Bacteria | 2649 |
| 533 | Ga0207659_10129473 | 3300025926 | Bacteria | 1946 |
| 534 | Ga0207659_10320807 | 3300025926 | Bacteria | 1278 |
| 535 | Ga0207687_10011501 | 3300025927 | Bacteria | 5784 |
| 536 | Ga0207687_10022484 | 3300025927 | Bacteria | 4197 |
| 537 | Ga0207687_10305823 | 3300025927 | Bacteria | 1282 |
| 538 | Ga0207700_10000902 | 3300025928 | Bacteria | 17046 |
| 539 | Ga0207700_10009675 | 3300025928 | Bacteria | 6036 |
| 540 | Ga0207700_10013431 | 3300025928 | Bacteria | 5328 |
| 541 | Ga0207700_10016833 | 3300025928 | Bacteria | 4868 |
| 542 | Ga0207700_10033007 | 3300025928 | Bacteria | 3700 |
| 543 | Ga0207700_10035245 | 3300025928 | Bacteria | 3603 |
| 544 | Ga0207700_10042396 | 3300025928 | Bacteria | 3336 |
| 545 | Ga0207700_10045699 | 3300025928 | Bacteria | 3233 |
| 546 | Ga0207700_10054135 | 3300025928 | Bacteria | 3010 |
| 547 | Ga0207700_10116301 | 3300025928 | Bacteria | 2161 |
| 548 | Ga0207700_10188026 | 3300025928 | Bacteria | 1734 |
| 549 | Ga0207700_10210597 | 3300025928 | Bacteria | 1643 |
| 550 | Ga0207700_10821464 | 3300025928 | Bacteria | 831 |
| 551 | Ga0207664_10000097 | 3300025929 | Bacteria | 80906 |
| 552 | Ga0207664_10081918 | 3300025929 | Bacteria | 2627 |
| 553 | Ga0207664_10121407 | 3300025929 | Bacteria | 2187 |
| 554 | Ga0207664_10139134 | 3300025929 | Bacteria | 2051 |
| 555 | Ga0207664_10192361 | 3300025929 | Bacteria | 1757 |
| 556 | Ga0207664_10238151 | 3300025929 | Bacteria | 1584 |
| 557 | Ga0207664_10506177 | 3300025929 | Bacteria | 1082 |
| 558 | Ga0207644_10010293 | 3300025931 | Bacteria | 6164 |
| 559 | Ga0207644_10011125 | 3300025931 | Bacteria | 5944 |
| 560 | Ga0207644_10075836 | 3300025931 | Bacteria | 2472 |
| 561 | Ga0207644_10102781 | 3300025931 | Bacteria | 2150 |
| 562 | Ga0207644_10118296 | 3300025931 | Bacteria | 2013 |
| 563 | Ga0207644_10289089 | 3300025931 | Bacteria | 1318 |
| 564 | Ga0207644_10586288 | 3300025931 | Bacteria | 925 |
| 565 | Ga0207690_10038078 | 3300025932 | Bacteria | 3127 |
| 566 | Ga0207690_10182791 | 3300025932 | Bacteria | 1580 |
| 567 | Ga0207706_10002781 | 3300025933 | Bacteria | 17009 |
| 568 | Ga0207706_10032159 | 3300025933 | Unclassified | 4672 |
| 569 | Ga0207706_10125657 | 3300025933 | Bacteria | 2256 |
| 570 | Ga0207706_10176569 | 3300025933 | Bacteria | 1876 |
| 571 | Ga0207706_10237179 | 3300025933 | Bacteria | 1595 |
| 572 | Ga0207706_10296370 | 3300025933 | Bacteria | 1409 |
| 573 | Ga0207686_10035362 | 3300025934 | Bacteria | 2998 |
| 574 | Ga0207686_10106991 | 3300025934 | Bacteria | 1879 |
| 575 | Ga0207686_10279144 | 3300025934 | Bacteria | 1232 |
| 576 | Ga0207709_10017882 | 3300025935 | Bacteria | 3963 |
| 577 | Ga0207670_10004496 | 3300025936 | Bacteria | 7515 |
| 578 | Ga0207670_10032753 | 3300025936 | Bacteria | 3344 |
| 579 | Ga0207670_10317871 | 3300025936 | Bacteria | 1224 |
| 580 | Ga0207669_10006395 | 3300025937 | Bacteria | 5380 |
| 581 | Ga0207669_10015129 | 3300025937 | Bacteria | 3882 |
| 582 | Ga0207669_10124918 | 3300025937 | Bacteria | 1755 |
| 583 | Ga0207669_10269063 | 3300025937 | Bacteria | 1279 |
| 584 | Ga0207704_10001929 | 3300025938 | Bacteria | 9284 |
| 585 | Ga0207704_10014560 | 3300025938 | Bacteria | 3975 |
| 586 | Ga0207665_10000176 | 3300025939 | Bacteria | 42953 |
| 587 | Ga0207665_10007817 | 3300025939 | Bacteria | 7057 |
| 588 | Ga0207665_10017360 | 3300025939 | Bacteria | 4729 |
| 589 | Ga0207665_10048055 | 3300025939 | Bacteria | 2863 |
| 590 | Ga0207665_10057546 | 3300025939 | Bacteria | 2626 |
| 591 | Ga0207665_10092172 | 3300025939 | Bacteria | 2101 |
| 592 | Ga0207665_10177803 | 3300025939 | Bacteria | 1540 |
| 593 | Ga0207665_10526265 | 3300025939 | Unclassified | 916 |
| 594 | Ga0207691_10000097 | 3300025940 | Bacteria | 76545 |
| 595 | Ga0207691_10000155 | 3300025940 | Bacteria | 63923 |
| 596 | Ga0207691_10020569 | 3300025940 | Bacteria | 6240 |
| 597 | Ga0207691_10029883 | 3300025940 | Bacteria | 5097 |
| 598 | Ga0207691_10189891 | 3300025940 | Bacteria | 1792 |
| 599 | Ga0207661_10105275 | 3300025944 | Bacteria | 2377 |
| 600 | Ga0207661_10587956 | 3300025944 | Bacteria | 1021 |
| 601 | Ga0207679_10003563 | 3300025945 | Bacteria | 9649 |
| 602 | Ga0207679_10004282 | 3300025945 | Bacteria | 8867 |
| 603 | Ga0207679_10127698 | 3300025945 | Bacteria | 2035 |
| 604 | Ga0207679_10259927 | 3300025945 | Bacteria | 1480 |
| 605 | Ga0207667_10210645 | 3300025949 | Bacteria | 1992 |
| 606 | Ga0207667_11001329 | 3300025949 | Bacteria | 823 |
| 607 | Ga0207651_10014892 | 3300025960 | Bacteria | 4503 |
| 608 | Ga0207651_10033902 | 3300025960 | Bacteria | 3299 |
| 609 | Ga0207651_10038422 | 3300025960 | Bacteria | 3146 |
| 610 | Ga0207651_10260527 | 3300025960 | Bacteria | 1423 |
| 611 | Ga0207651_10333252 | 3300025960 | Bacteria | 1272 |
| 612 | Ga0207712_10042926 | 3300025961 | Bacteria | 3117 |
| 613 | Ga0207712_10080983 | 3300025961 | Bacteria | 2363 |
| 614 | Ga0207712_10188194 | 3300025961 | Bacteria | 1627 |
| 615 | Ga0207668_10009679 | 3300025972 | Bacteria | 5788 |
| 616 | Ga0207668_10030284 | 3300025972 | Bacteria | 3555 |
| 617 | Ga0207668_10193517 | 3300025972 | Bacteria | 1614 |
| 618 | Ga0207640_10020256 | 3300025981 | Bacteria | 3948 |
| 619 | Ga0207640_10058904 | 3300025981 | Bacteria | 2532 |
| 620 | Ga0207640_10391940 | 3300025981 | Bacteria | 1128 |
| 621 | Ga0207677_10011704 | 3300026023 | Bacteria | 5010 |
| 622 | Ga0207677_10064600 | 3300026023 | Bacteria | 2550 |
| 623 | Ga0207677_10090363 | 3300026023 | Bacteria | 2225 |
| 624 | Ga0207677_10337447 | 3300026023 | Bacteria | 1258 |
| 625 | Ga0207677_10454822 | 3300026023 | Bacteria | 1098 |
| 626 | Ga0207639_10036735 | 3300026041 | Unclassified | 3632 |
| 627 | Ga0207678_10035266 | 3300026067 | Bacteria | 4356 |
| 628 | Ga0207708_10000199 | 3300026075 | Bacteria | 47758 |
| 629 | Ga0207702_10000137 | 3300026078 | Bacteria | 88042 |
| 630 | Ga0207702_10002313 | 3300026078 | Bacteria | 18218 |
| 631 | Ga0207702_10077834 | 3300026078 | Bacteria | 2869 |
| 632 | Ga0207702_10163809 | 3300026078 | Bacteria | 2032 |
| 633 | Ga0207702_10303406 | 3300026078 | Bacteria | 1516 |
| 634 | Ga0207702_10326734 | 3300026078 | Bacteria | 1462 |
| 635 | Ga0207702_10592999 | 3300026078 | Unclassified | 1087 |
| 636 | Ga0207641_10055242 | 3300026088 | Unclassified | 3372 |
| 637 | Ga0207641_10066193 | 3300026088 | Unclassified | 3093 |
| 638 | Ga0207641_10281456 | 3300026088 | Bacteria | 1564 |
| 639 | Ga0207648_10000064 | 3300026089 | Bacteria | 99090 |
| 640 | Ga0207648_10005435 | 3300026089 | Bacteria | 12838 |
| 641 | Ga0207648_10122582 | 3300026089 | Bacteria | 2286 |
| 642 | Ga0207648_10204015 | 3300026089 | Unclassified | 1754 |
| 643 | Ga0207676_10082205 | 3300026095 | Bacteria | 2619 |
| 644 | Ga0207676_10146150 | 3300026095 | Bacteria | 2031 |
| 645 | Ga0207674_10016572 | 3300026116 | Bacteria | 8059 |
| 646 | Ga0207674_10022686 | 3300026116 | Bacteria | 6738 |
| 647 | Ga0207675_100061567 | 3300026118 | Bacteria | 3503 |
| 648 | Ga0207683_10000028 | 3300026121 | Bacteria | 109908 |
| 649 | Ga0207683_10012967 | 3300026121 | Bacteria | 7116 |
| 650 | Ga0207683_10014269 | 3300026121 | Bacteria | 6769 |
| 651 | Ga0207683_10109002 | 3300026121 | Bacteria | 2478 |
| 652 | Ga0207683_10300929 | 3300026121 | Bacteria | 1468 |
| 653 | Ga0207698_10215480 | 3300026142 | Bacteria | 1731 |
| 654 | Ga0209973_1002126 | 3300027252 | Bacteria | 1817 |
| 655 | Ga0209967_1000058 | 3300027364 | Bacteria | 14445 |
| 656 | Ga0209981_1000185 | 3300027378 | Bacteria | 7697 |
| 657 | Ga0209996_1000043 | 3300027395 | Bacteria | 18481 |
| 658 | Ga0210000_1000362 | 3300027462 | Bacteria | 6410 |
| 659 | Ga0209995_1000117 | 3300027471 | Bacteria | 12499 |
| 660 | Ga0209179_1016496 | 3300027512 | Bacteria | 1386 |
| 661 | Ga0209968_1000159 | 3300027526 | Bacteria | 11811 |
| 662 | Ga0209999_1000282 | 3300027543 | Bacteria | 7500 |
| 663 | Ga0209982_1000795 | 3300027552 | Bacteria | 4087 |
| 664 | Ga0209970_1002907 | 3300027614 | Bacteria | 2888 |
| 665 | Ga0210002_1000092 | 3300027617 | Bacteria | 14134 |
| 666 | Ga0209588_1001918 | 3300027671 | Bacteria | 5564 |
| 667 | Ga0209971_1000121 | 3300027682 | Bacteria | 23135 |
| 668 | Ga0209971_1058817 | 3300027682 | Bacteria | 930 |
| 669 | Ga0209966_1000276 | 3300027695 | Bacteria | 18110 |
| 670 | Ga0209998_10000015 | 3300027717 | Bacteria | 86345 |
| 671 | Ga0209974_10000001 | 3300027876 | Bacteria | 86862 |
| 672 | Ga0207428_10000237 | 3300027907 | Bacteria | 75743 |
| 673 | Ga0207428_10036697 | 3300027907 | Bacteria | 3995 |
| 674 | Ga0207428_10120057 | 3300027907 | Bacteria | 2016 |
| 675 | Ga0268266_10047044 | 3300028379 | Bacteria | 3693 |
| 676 | Ga0268266_10091524 | 3300028379 | Bacteria | 2667 |
| 677 | Ga0268266_10272636 | 3300028379 | Bacteria | 1571 |
| 678 | Ga0268266_10731662 | 3300028379 | Bacteria | 954 |
| 679 | Ga0268265_10021702 | 3300028380 | Bacteria | 4503 |
| 680 | Ga0268265_10076558 | 3300028380 | Bacteria | 2625 |
| 681 | Ga0268264_10340025 | 3300028381 | Bacteria | 1425 |
| 682 | Ga0268264_10612036 | 3300028381 | Bacteria | 1074 |
| 683 | Ga0265326_10030582 | 3300028558 | Bacteria | 1534 |
| 684 | Ga0265319_1003474 | 3300028563 | Bacteria | 8201 |
| 685 | Ga0265338_10034702 | 3300028800 | Bacteria | 4869 |
| 686 | Ga0265338_10107225 | 3300028800 | Bacteria | 2260 |
| 687 | Ga0265338_10125037 | 3300028800 | Bacteria | 2042 |
| 688 | Ga0265338_10132461 | 3300028800 | Bacteria | 1965 |
| 689 | Ga0265338_10156753 | 3300028800 | Bacteria | 1763 |
| 690 | Ga0265338_10328794 | 3300028800 | Bacteria | 1104 |
| 691 | Ga0265324_10028559 | 3300029957 | Bacteria | 1966 |
| 692 | Ga0265762_1039079 | 3300030760 | Bacteria | 923 |
| 693 | Ga0265332_10002293 | 3300031238 | Bacteria | 9786 |
| 694 | Ga0265320_10001827 | 3300031240 | Bacteria | 15091 |
| 695 | Ga0265325_10006803 | 3300031241 | Bacteria | 6911 |
| 696 | Ga0265325_10008935 | 3300031241 | Bacteria | 5885 |
| 697 | Ga0265325_10027094 | 3300031241 | Bacteria | 3100 |
| 698 | Ga0265325_10036779 | 3300031241 | Bacteria | 2592 |
| 699 | Ga0265340_10003648 | 3300031247 | Bacteria | 8655 |
| 700 | Ga0265340_10043396 | 3300031247 | Bacteria | 2204 |
| 701 | Ga0265340_10138376 | 3300031247 | Bacteria | 1114 |
| 702 | Ga0265339_10002587 | 3300031249 | Bacteria | 12907 |
| 703 | Ga0265339_10018297 | 3300031249 | Bacteria | 4132 |
| 704 | Ga0265339_10067131 | 3300031249 | Bacteria | 1919 |
| 705 | Ga0265339_10084121 | 3300031249 | Bacteria | 1677 |
| 706 | Ga0265339_10111724 | 3300031249 | Bacteria | 1413 |
| 707 | Ga0265339_10190495 | 3300031249 | Bacteria | 1017 |
| 708 | Ga0265331_10027074 | 3300031250 | Bacteria | 2877 |
| 709 | Ga0265331_10041248 | 3300031250 | Bacteria | 2243 |
| 710 | Ga0265316_10001005 | 3300031344 | Bacteria | 30618 |
| 711 | Ga0265316_10040722 | 3300031344 | Bacteria | 3723 |
| 712 | Ga0265316_10070756 | 3300031344 | Bacteria | 2690 |
| 713 | Ga0265316_10092282 | 3300031344 | Bacteria | 2309 |
| 714 | Ga0265316_10098165 | 3300031344 | Bacteria | 2229 |
| 715 | Ga0265313_10000041 | 3300031595 | Bacteria | 119119 |
| 716 | Ga0265313_10000538 | 3300031595 | Bacteria | 39535 |
| 717 | Ga0265313_10003540 | 3300031595 | Bacteria | 12587 |
| 718 | Ga0265314_10000279 | 3300031711 | Bacteria | 74300 |
| 719 | Ga0265314_10001994 | 3300031711 | Bacteria | 21660 |
| 720 | Ga0265314_10011035 | 3300031711 | Bacteria | 7492 |
| 721 | Ga0265314_10025037 | 3300031711 | Bacteria | 4510 |
| 722 | Ga0265314_10130697 | 3300031711 | Bacteria | 1567 |
| 723 | Ga0265342_10023338 | 3300031712 | Bacteria | 3918 |
| 724 | Ga0265342_10062636 | 3300031712 | Bacteria | 2188 |
| 725 | Ga0307407_10120568 | 3300031903 | Bacteria | 1662 |
| 726 | Ga0307412_10083956 | 3300031911 | Bacteria | 2210 |
| 727 | Ga0307416_100274226 | 3300032002 | Bacteria | 1658 |
| 728 | Ga0316214_1002333 | 3300033545 | Bacteria | 2332 |
| 729 | Ga0373944_0036924 | 3300035089 | Bacteria | 1495 |
| 730 | Ga0373944_0115505 | 3300035089 | Bacteria | 920 |
| 731 | Ga0373936_0007613 | 3300035113 | Bacteria | 4070 |
| 732 | Ga0373936_0019480 | 3300035113 | Bacteria | 2629 |
| 733 | Ga0373936_0063758 | 3300035113 | Bacteria | 1509 |
| 734 | Ga0373936_0109781 | 3300035113 | Bacteria | 1170 |
| 735 | Ga0373936_0206606 | 3300035113 | Bacteria | 868 |
| 736 | Ga0373941_0036427 | 3300035115 | Unclassified | 1496 |
| 737 | Ga0373941_0054074 | 3300035115 | Bacteria | 1286 |
| 738 | Ga0373945_0000332 | 3300035116 | Bacteria | 13460 |
| 739 | Ga0373945_0068352 | 3300035116 | Bacteria | 1340 |
| 740 | Ga0373953_0036289 | 3300035117 | Bacteria | 1941 |
| 741 | Ga0373954_0046397 | 3300035118 | Bacteria | 2031 |
| 742 | Ga0373943_0000199 | 3300035170 | Bacteria | 24471 |
| 743 | Ga0373943_0002028 | 3300035170 | Bacteria | 9183 |
| 744 | Ga0373943_0128623 | 3300035170 | Bacteria | 1353 |
| 745 | Ga0373946_0005157 | 3300035171 | Bacteria | 4709 |
| 746 | Ga0373955_0016668 | 3300035172 | Bacteria | 3621 |
| 747 | Ga0373955_0078934 | 3300035172 | Bacteria | 1856 |
| 748 | Ga0373955_0233341 | 3300035172 | Bacteria | 1101 |
| 749 | Ga0373961_0046248 | 3300035241 | Bacteria | 1275 |
| 750 | Ga0373924_0042554 | 3300035410 | Bacteria | 1863 |
| 751 | Ga0373931_0245128 | 3300035691 | Bacteria | 1088 |
| 752 | Ga0373935_0000576 | 3300035692 | Bacteria | 19099 |
| 753 | Ga0373935_0013158 | 3300035692 | Bacteria | 4988 |
| 754 | Ga0373927_0000041 | 3300035695 | Bacteria | 94763 |
| 755 | Ga0373927_0011500 | 3300035695 | Bacteria | 5897 |
| 756 | Ga0373927_0029951 | 3300035695 | Bacteria | 3551 |
| 757 | Ga0373927_0031439 | 3300035695 | Bacteria | 3459 |
| 758 | Ga0373927_0034939 | 3300035695 | Bacteria | 3269 |
| 759 | Ga0373933_0303648 | 3300035724 | Bacteria | 1033 |
| 760 | Ga0373947_0000315 | 3300035725 | Bacteria | 27406 |
| 761 | Ga0373947_0005539 | 3300035725 | Bacteria | 7363 |
| 762 | Ga0373947_0032219 | 3300035725 | Bacteria | 3088 |
| 763 | Ga0373937_0020834 | 3300036401 | Bacteria | 5881 |
| 764 | Ga0373937_0141860 | 3300036401 | Bacteria | 2248 |
| 765 | Ga0373925_0000923 | 3300037068 | Bacteria | 26790 |
| 766 | Ga0373925_0017680 | 3300037068 | Bacteria | 5173 |
| 767 | Ga0373925_0028976 | 3300037068 | Bacteria | 4059 |
| 768 | Ga0373925_0033468 | 3300037068 | Bacteria | 3787 |
| 769 | Ga0373925_0067964 | 3300037068 | Bacteria | 2688 |
| 770 | Ga0373925_0074635 | 3300037068 | Bacteria | 2569 |
| 771 | Ga0373925_0081650 | 3300037068 | Bacteria | 2458 |
| 772 | Ga0373925_0106103 | 3300037068 | Bacteria | 2165 |
| 773 | Ga0373925_0482248 | 3300037068 | Bacteria | 1017 |
| 774 | Ga0395899_0199313 | 3300037312 | Bacteria | 1397 |
| 775 | Ga0395900_0005333 | 3300037418 | Bacteria | 13470 |
| 776 | Ga0395898_0053512 | 3300037466 | Bacteria | 3943 |
| 777 | Ga0395898_0565966 | 3300037466 | Bacteria | 1079 |
| 778 | Ga0436364_0415091 | 3300037853 | Bacteria | 2631 |
| 779 | Ga0395901_0005469 | 3300038443 | Bacteria | 12862 |
| 780 | Ga0395901_0208906 | 3300038443 | Bacteria | 2044 |
| 781 | Ga0436365_1008487 | 3300039437 | Bacteria | 933 |
| 782 | Ga0436361_0513857 | 3300039447 | Bacteria | 3369 |
| 783 | Ga0436361_0611757 | 3300039447 | Bacteria | 1519 |
| 784 | Ga0436361_1068676 | 3300039447 | Bacteria | 2670 |
| 785 | Ga0436363_0199314 | 3300039450 | Bacteria | 9545 |
| 786 | Ga0436363_0813245 | 3300039450 | Bacteria | 1605 |
| 787 | Ga0439453_0009410 | 3300041408 | Bacteria | 1591 |
| 788 | Ga0451853_1013485 | 3300041512 | Bacteria | 1024 |
| 789 | Ga0439443_000361 | 3300042003 | Bacteria | 3844 |
| 790 | Ga0450890_004875 | 3300042127 | Bacteria | 1739 |
| 791 | Ga0451577_0018001 | 3300042876 | Bacteria | 6514 |
| 792 | Ga0451577_0034245 | 3300042876 | Bacteria | 4579 |
| 793 | Ga0466972_0060153 | 3300044658 | Bacteria | 1823 |
| 794 | Ga0453683_0427615 | 3300044673 | Bacteria | 855 |
| 795 | Ga0453684_0000001 | 3300044712 | Bacteria | 2623166 |
| 796 | Ga0466957_0307748 | 3300044842 | Bacteria | 1066 |
| 797 | Ga0451576_0007210 | 3300045051 | Bacteria | 13399 |
| 798 | Ga0451576_0197716 | 3300045051 | Bacteria | 2100 |
| 799 | Ga0451576_0347292 | 3300045051 | Unclassified | 1553 |
| 800 | Ga0466967_0023182 | 3300045976 | Bacteria | 5083 |
| 801 | Ga0495603_0287657 | 3300046455 | Unclassified | 944 |
| 802 | Ga0495591_029302 | 3300046458 | Bacteria | 1674 |
| 803 | Ga0495629_0136277 | 3300046459 | Bacteria | 1709 |
| 804 | Ga0495641_0036748 | 3300046461 | Bacteria | 2299 |
| 805 | Ga0495651_0000931 | 3300046462 | Bacteria | 22653 |
| 806 | Ga0495651_0088836 | 3300046462 | Bacteria | 2322 |
| 807 | Ga0495651_0113142 | 3300046462 | Bacteria | 2004 |
| 808 | Ga0495653_0043767 | 3300046463 | Bacteria | 3478 |
| 809 | Ga0495580_0000777 | 3300046472 | Bacteria | 27451 |
| 810 | Ga0495580_0001086 | 3300046472 | Bacteria | 23878 |
| 811 | Ga0495580_0006659 | 3300046472 | Bacteria | 9380 |
| 812 | Ga0495580_0007498 | 3300046472 | Bacteria | 8766 |
| 813 | Ga0495580_0010227 | 3300046472 | Bacteria | 7319 |
| 814 | Ga0495580_0038991 | 3300046472 | Bacteria | 3399 |
| 815 | Ga0495580_0077744 | 3300046472 | Bacteria | 2314 |
| 816 | Ga0495580_0121110 | 3300046472 | Bacteria | 1816 |
| 817 | Ga0495580_0480695 | 3300046472 | Bacteria | 831 |
| 818 | Ga0495582_0000160 | 3300046473 | Bacteria | 36317 |
| 819 | Ga0495582_0007681 | 3300046473 | Bacteria | 5960 |
| 820 | Ga0495582_0140998 | 3300046473 | Bacteria | 1366 |
| 821 | Ga0495639_0054838 | 3300046475 | Bacteria | 1817 |
| 822 | Ga0495662_0037038 | 3300046476 | Bacteria | 2355 |
| 823 | Ga0495584_0019874 | 3300046491 | Bacteria | 3412 |
| 824 | Ga0495584_0122219 | 3300046491 | Bacteria | 1319 |
| 825 | Ga0495584_0244073 | 3300046491 | Bacteria | 913 |
| 826 | Ga0495594_0191710 | 3300046499 | Bacteria | 1164 |
| 827 | Ga0495594_0288336 | 3300046499 | Unclassified | 935 |
| 828 | Ga0495608_0029063 | 3300046511 | Bacteria | 3753 |
| 829 | Ga0495618_0102017 | 3300046514 | Bacteria | 1836 |
| 830 | Ga0495630_0030906 | 3300046517 | Bacteria | 3986 |
| 831 | Ga0495630_0034839 | 3300046517 | Bacteria | 3761 |
| 832 | Ga0495644_0000571 | 3300046523 | Bacteria | 15453 |
| 833 | Ga0495666_0112174 | 3300046526 | Bacteria | 1280 |
| 834 | Ga0495652_0166198 | 3300046529 | Bacteria | 1707 |
| 835 | Ga0495665_0030232 | 3300046531 | Bacteria | 2899 |
| 836 | Ga0495665_0239741 | 3300046531 | Unclassified | 935 |
| 837 | Ga0495640_0078045 | 3300046533 | Bacteria | 2206 |
| 838 | Ga0495586_0100936 | 3300046535 | Bacteria | 1601 |
| 839 | Ga0495598_0133340 | 3300046537 | Bacteria | 854 |
| 840 | Ga0495609_0012142 | 3300046538 | Bacteria | 4088 |
| 841 | Ga0495645_0092320 | 3300046543 | Bacteria | 2162 |
| 842 | Ga0495622_0065231 | 3300046557 | Bacteria | 1683 |
| 843 | Ga0495633_0004105 | 3300046558 | Bacteria | 9395 |
| 844 | Ga0495667_0021144 | 3300046559 | Bacteria | 4389 |
| 845 | Ga0495656_0002209 | 3300046615 | Bacteria | 6427 |
| 846 | Ga0495635_0000999 | 3300046663 | Bacteria | 18684 |
| 847 | Ga0495635_0007707 | 3300046663 | Bacteria | 7512 |
| 848 | Ga0495659_0041178 | 3300046664 | Unclassified | 1649 |
| 849 | Ga0495659_0091929 | 3300046664 | Bacteria | 1166 |
| 850 | Ga0495659_0151462 | 3300046664 | Bacteria | 931 |
| 851 | Ga0495661_0044998 | 3300046665 | Bacteria | 2702 |
| 852 | Ga0495657_0189018 | 3300046675 | Bacteria | 1260 |
| 853 | Ga0495623_0151437 | 3300046679 | Bacteria | 1371 |
| 854 | Ga0495647_0032519 | 3300046681 | Bacteria | 1944 |
| 855 | Ga0495658_0009124 | 3300046683 | Bacteria | 4931 |
| 856 | Ga0495658_0074119 | 3300046683 | Bacteria | 1983 |
| 857 | Ga0495669_0197701 | 3300046684 | Bacteria | 960 |
| 858 | Ga0495624_0030749 | 3300046690 | Bacteria | 3495 |
| 859 | Ga0495670_0000669 | 3300046691 | Bacteria | 16316 |
| 860 | Ga0495670_0058565 | 3300046691 | Bacteria | 1934 |
| 861 | Ga0495581_0012313 | 3300047315 | Bacteria | 4955 |
| 862 | Ga0495581_0015188 | 3300047315 | Bacteria | 4470 |
| 863 | Ga0495581_0158946 | 3300047315 | Bacteria | 1321 |
| 864 | Ga0495581_0176531 | 3300047315 | Bacteria | 1249 |
| 865 | Ga0495604_0007298 | 3300047317 | Bacteria | 8752 |
| 866 | Ga0495604_0011241 | 3300047317 | Bacteria | 7106 |
| 867 | Ga0495636_0000210 | 3300047318 | Bacteria | 22819 |
| 868 | Ga0495674_0009183 | 3300047319 | Bacteria | 9395 |
| 869 | Ga0495674_0033153 | 3300047319 | Bacteria | 4681 |
| 870 | Ga0495674_0094639 | 3300047319 | Unclassified | 2548 |
| 871 | Ga0495674_0102516 | 3300047319 | Bacteria | 2434 |
| 872 | Ga0495676_0107817 | 3300047321 | Bacteria | 2050 |
| 873 | Ga0495680_0009787 | 3300047322 | Bacteria | 8596 |
| 874 | Ga0495680_0031551 | 3300047322 | Bacteria | 4310 |
| 875 | Ga0495687_015124 | 3300047443 | Bacteria | 3937 |
| 876 | Ga0495684_0004982 | 3300047471 | Bacteria | 10370 |
| 877 | Ga0495593_0080223 | 3300047673 | Bacteria | 1688 |
| 878 | Ga0495593_0171991 | 3300047673 | Bacteria | 1092 |
| 879 | Ga0495602_0107089 | 3300048088 | Bacteria | 2280 |
| 880 | Ga0495602_0161036 | 3300048088 | Bacteria | 1752 |
| 881 | Ga0496100_0027878 | 3300048903 | Bacteria | 3477 |
| 882 | Ga0496100_0331738 | 3300048903 | Unclassified | 1145 |
| 883 | Ga0496100_0333455 | 3300048903 | Bacteria | 1142 |
| 884 | Ga0496101_0034156 | 3300048904 | Bacteria | 3590 |
| 885 | Ga0496101_0142938 | 3300048904 | Bacteria | 1825 |
| 886 | Ga0496102_0009184 | 3300048905 | Bacteria | 8481 |
| 887 | Ga0496102_0136758 | 3300048905 | Bacteria | 2296 |
| 888 | Ga0496102_0175230 | 3300048905 | Bacteria | 2019 |
| 889 | Ga0496102_0247404 | 3300048905 | Bacteria | 1681 |
| 890 | Ga0496102_0311696 | 3300048905 | Bacteria | 1483 |
| 891 | Ga0496102_0569060 | 3300048905 | Bacteria | 1056 |
| 892 | Ga0496104_0012389 | 3300048907 | Bacteria | 7667 |
| 893 | Ga0496104_0080482 | 3300048907 | Bacteria | 3106 |
| 894 | Ga0496104_0152756 | 3300048907 | Bacteria | 2216 |
| 895 | Ga0496104_0234005 | 3300048907 | Unclassified | 1749 |
| 896 | Ga0496104_0593596 | 3300048907 | Bacteria | 1018 |
| 897 | Ga0496105_0185943 | 3300048908 | Bacteria | 1700 |
| 898 | Ga0496105_0217941 | 3300048908 | Bacteria | 1554 |
| 899 | Ga0496106_0011211 | 3300048909 | Bacteria | 6632 |
| 900 | Ga0496106_0138207 | 3300048909 | Bacteria | 1915 |
| 901 | Ga0496107_0006454 | 3300048910 | Bacteria | 8066 |
| 902 | Ga0496107_0134130 | 3300048910 | Bacteria | 1829 |
| 903 | Ga0496107_0365588 | 3300048910 | Bacteria | 1073 |
| 904 | Ga0496108_0076395 | 3300048911 | Unclassified | 2831 |
| 905 | Ga0496108_0376751 | 3300048911 | Bacteria | 1239 |
| 906 | Ga0496108_0767138 | 3300048911 | Unclassified | 833 |
| 907 | Ga0496109_0037919 | 3300048912 | Bacteria | 4356 |
| 908 | Ga0496109_0076350 | 3300048912 | Bacteria | 3082 |
| 909 | Ga0496109_0157111 | 3300048912 | Bacteria | 2130 |
| 910 | Ga0496110_0227330 | 3300048913 | Bacteria | 1697 |
| 911 | Ga0496110_0248365 | 3300048913 | Bacteria | 1619 |
| 912 | Ga0496111_0023234 | 3300048914 | Bacteria | 4352 |
| 913 | Ga0496111_0118631 | 3300048914 | Bacteria | 1953 |
| 914 | Ga0496112_0000541 | 3300048915 | Bacteria | 25895 |
| 915 | Ga0496112_0016070 | 3300048915 | Bacteria | 6998 |
| 916 | Ga0496112_0044633 | 3300048915 | Bacteria | 4344 |
| 917 | Ga0496112_0073939 | 3300048915 | Bacteria | 3369 |
| 918 | Ga0496112_0168860 | 3300048915 | Bacteria | 2153 |
| 919 | Ga0496112_0304726 | 3300048915 | Bacteria | 1538 |
| 920 | Ga0496113_0018963 | 3300048916 | Bacteria | 4803 |
| 921 | Ga0496113_0124477 | 3300048916 | Bacteria | 2018 |
| 922 | Ga0496113_0162927 | 3300048916 | Bacteria | 1763 |
| 923 | Ga0496114_0047135 | 3300048917 | Bacteria | 3584 |
| 924 | Ga0496115_0004910 | 3300048918 | Bacteria | 9707 |
| 925 | Ga0496115_0037936 | 3300048918 | Bacteria | 3821 |
| 926 | Ga0496115_0272729 | 3300048918 | Bacteria | 1390 |
| 927 | Ga0496117_0072205 | 3300048920 | Bacteria | 2309 |
| 928 | Ga0501290_000024 | 3300049513 | Bacteria | 20106 |
| 929 | Ga0501291_000322 | 3300049514 | Bacteria | 5911 |
| 930 | Ga0501292_000069 | 3300049515 | Bacteria | 20733 |
| 931 | Ga0501293_000195 | 3300049516 | Bacteria | 4358 |
| 932 | Ga0501294_000051 | 3300049517 | Bacteria | 12212 |
| 933 | Ga0501295_000036 | 3300049518 | Bacteria | 13372 |
| 934 | Ga0501296_000147 | 3300049519 | Bacteria | 7921 |
| 935 | Ga0501297_000004 | 3300049520 | Bacteria | 22617 |
| 936 | Ga0501298_000124 | 3300049521 | Bacteria | 9227 |
| 937 | Ga0501299_000096 | 3300049522 | Bacteria | 9832 |
| 938 | Ga0501300_000237 | 3300049523 | Bacteria | 8292 |
| 939 | Ga0501301_000323 | 3300049524 | Bacteria | 2803 |
| 940 | Ga0501302_000568 | 3300049525 | Bacteria | 1977 |
| 941 | Ga0501034_0100942 | 3300049571 | Bacteria | 2879 |
| 942 | Ga0501037_0169832 | 3300049573 | Bacteria | 1551 |
| 943 | Ga0501038_0153691 | 3300049574 | Bacteria | 1875 |
| 944 | Ga0501040_0238084 | 3300049576 | Bacteria | 1297 |
| 945 | Ga0501042_0122801 | 3300049578 | Bacteria | 1870 |
| 946 | Ga0501043_0119615 | 3300049579 | Bacteria | 2066 |
| 947 | Ga0501068_0292259 | 3300049584 | Bacteria | 1042 |
| 948 | Ga0501072_0205402 | 3300049588 | Bacteria | 1570 |
| 949 | Ga0501075_0135017 | 3300049591 | Bacteria | 1879 |
| 950 | Ga0501077_0172430 | 3300049593 | Bacteria | 1374 |
| 951 | Ga0501198_003464 | 3300049649 | Bacteria | 2157 |
| 952 | Ga0501199_001087 | 3300049650 | Bacteria | 2444 |
| 953 | Ga0501202_000224 | 3300049652 | Bacteria | 7422 |
| 954 | Ga0501207_001020 | 3300049654 | Bacteria | 3407 |
| 955 | Ga0501209_000414 | 3300049656 | Bacteria | 5189 |
| 956 | Ga0501216_000117 | 3300049660 | Bacteria | 7800 |
| 957 | Ga0501217_000129 | 3300049661 | Bacteria | 10105 |
| 958 | Ga0501228_002969 | 3300049666 | Bacteria | 1368 |
| 959 | Ga0501230_000908 | 3300049667 | Bacteria | 3321 |
| 960 | Ga0501233_000058 | 3300049668 | Bacteria | 14525 |
| 961 | Ga0501235_000042 | 3300049669 | Bacteria | 20584 |
| 962 | Ga0501236_001498 | 3300049670 | Bacteria | 2654 |
| 963 | Ga0501239_000019 | 3300049672 | Bacteria | 10329 |
| 964 | Ga0501243_000139 | 3300049675 | Bacteria | 8230 |
| 965 | Ga0501246_001510 | 3300049676 | Bacteria | 1795 |
| 966 | Ga0501247_000491 | 3300049677 | Bacteria | 3157 |
| 967 | Ga0501249_000123 | 3300049679 | Bacteria | 23882 |
| 968 | Ga0501251_000033 | 3300049681 | Bacteria | 10069 |
| 969 | Ga0501252_009782 | 3300049682 | Bacteria | 1123 |
| 970 | Ga0501253_000062 | 3300049683 | Bacteria | 7352 |
| 971 | Ga0501257_001759 | 3300049686 | Bacteria | 4515 |
| 972 | Ga0501258_000612 | 3300049687 | Bacteria | 2526 |
| 973 | Ga0501259_004607 | 3300049688 | Bacteria | 2190 |
| 974 | Ga0501260_000011 | 3300049689 | Bacteria | 13212 |
| 975 | Ga0501261_001049 | 3300049690 | Bacteria | 3387 |
| 976 | Ga0501219_001253 | 3300049703 | Bacteria | 2687 |
| 977 | Ga0501221_000074 | 3300049704 | Bacteria | 11102 |
| 978 | Ga0501225_0000250 | 3300049705 | Bacteria | 16815 |
| 979 | Ga0501245_000329 | 3300049708 | Bacteria | 5632 |
| 980 | Ga0501080_0015294 | 3300049742 | Bacteria | 7074 |
| 981 | Ga0501080_0150380 | 3300049742 | Bacteria | 2152 |
| 982 | Ga0501080_0346533 | 3300049742 | Bacteria | 1342 |
| 983 | Ga0501232_001731 | 3300049757 | Bacteria | 1787 |
| 984 | Ga0501241_015536 | 3300049758 | Bacteria | 1385 |
| 985 | Ga0501262_008828 | 3300049759 | Bacteria | 1237 |
| 986 | Ga0501264_001013 | 3300049761 | Bacteria | 3394 |
| 987 | Ga0501265_000576 | 3300049762 | Bacteria | 3932 |
| 988 | Ga0501266_000965 | 3300049763 | Bacteria | 3732 |
| 989 | Ga0501268_000667 | 3300049765 | Bacteria | 3870 |
| 990 | Ga0501269_001819 | 3300049766 | Bacteria | 2711 |
| 991 | Ga0501270_000124 | 3300049767 | Bacteria | 5974 |
| 992 | Ga0501271_000377 | 3300049768 | Bacteria | 3900 |
| 993 | Ga0501272_000316 | 3300049769 | Bacteria | 4204 |
| 994 | Ga0501273_000170 | 3300049770 | Bacteria | 4610 |
| 995 | Ga0501274_000059 | 3300049771 | Bacteria | 6090 |
| 996 | Ga0501275_001457 | 3300049772 | Bacteria | 2333 |
| 997 | Ga0501276_000237 | 3300049773 | Bacteria | 3135 |
| 998 | Ga0501278_000240 | 3300049774 | Bacteria | 4353 |
| 999 | Ga0501279_000242 | 3300049775 | Bacteria | 7468 |
| 1000 | Ga0501281_01385 | 3300049777 | Bacteria | 1912 |
| 1001 | Ga0501282_000466 | 3300049778 | Bacteria | 4812 |
| 1002 | Ga0501283_000044 | 3300049779 | Bacteria | 15150 |
| 1003 | Ga0501035_0216334 | 3300049822 | Bacteria | 1638 |
| 1004 | Ga0501035_0598673 | 3300049822 | Bacteria | 898 |
| 1005 | Ga0501044_0238336 | 3300049823 | Bacteria | 1764 |
| 1006 | Ga0501212_000262 | 3300049851 | Bacteria | 4751 |
| 1007 | Ga0501226_000232 | 3300049853 | Bacteria | 8810 |
| 1008 | nmdc:mga05p37_148110_c1 | 3300050507 | Bacteria | 2873 |
| 1009 | nmdc:mga05p37_169470_c1 | 3300050507 | Bacteria | 2664 |
| 1010 | nmdc:mga05p37_455569_c1 | 3300050507 | Bacteria | 1479 |
| 1011 | nmdc:mga09592_55239_c1 | 3300050508 | Bacteria | 3356 |
| 1012 | nmdc:mga0qj67_32131_c1 | 3300050509 | Bacteria | 4093 |
| 1013 | nmdc:mga06r32_137644_c1 | 3300050510 | Bacteria | 2417 |
| 1014 | nmdc:mga08y16_265250_c1 | 3300050511 | Bacteria | 1773 |
| 1015 | nmdc:mga08y16_73110_c1 | 3300050511 | Bacteria | 3573 |
| 1016 | nmdc:mga08y16_9680_c1 | 3300050511 | Bacteria | 10118 |
| 1017 | nmdc:mga0n895_10165_c1 | 3300050512 | Bacteria | 8288 |
| 1018 | nmdc:mga0n895_237_c1 | 3300050512 | Bacteria | 34922 |
| 1019 | nmdc:mga0n895_246155_c1 | 3300050512 | Unclassified | 1814 |
| 1020 | nmdc:mga0n895_27111_c1 | 3300050512 | Bacteria | 5438 |
| 1021 | nmdc:mga0n895_288700_c1 | 3300050512 | Bacteria | 1663 |
| 1022 | nmdc:mga0n895_421815_c1 | 3300050512 | Unclassified | 1349 |
| 1023 | nmdc:mga0n895_508781_c1 | 3300050512 | Bacteria | 1213 |
| 1024 | nmdc:mga0rr50_23495_c1 | 3300050513 | Bacteria | 4252 |
| 1025 | nmdc:mga0rr50_290877_c1 | 3300050513 | Bacteria | 1365 |
| 1026 | nmdc:mga0rr50_33452_c1 | 3300050513 | Bacteria | 3673 |
| 1027 | nmdc:mga0rr50_440306_c1 | 3300050513 | Bacteria | 1104 |
| 1028 | nmdc:mga0rr50_683_c1 | 3300050513 | Bacteria | 18182 |
| 1029 | nmdc:mga08x19_2178_c1 | 3300050514 | Bacteria | 11961 |
| 1030 | nmdc:mga08x19_46398_c1 | 3300050514 | Bacteria | 2779 |
| 1031 | nmdc:mga08x19_79619_c1 | 3300050514 | Bacteria | 2149 |
| 1032 | nmdc:mga0a205_11604_c2 | 3300050515 | Bacteria | 7513 |
| 1033 | nmdc:mga0a205_221_c2 | 3300050515 | Bacteria | 25103 |
| 1034 | nmdc:mga0a205_66075_c1 | 3300050515 | Bacteria | 3495 |
| 1035 | Ga0495601_0016711 | 3300053077 | Bacteria | 4448 |
| 1036 | Ga0495601_0033186 | 3300053077 | Bacteria | 3216 |
| 1037 | Ga0495601_0086020 | 3300053077 | Bacteria | 2020 |
| 1038 | Ga0495612_0009036 | 3300053078 | Bacteria | 4041 |
| 1039 | Ga0495655_0036023 | 3300053083 | Bacteria | 1235 |
| 1040 | Ga0495595_0000785 | 3300053084 | Bacteria | 12062 |
| 1041 | Ga0495595_0000854 | 3300053084 | Bacteria | 11671 |
| 1042 | Ga0495619_0000760 | 3300053085 | Bacteria | 21033 |
| 1043 | Ga0495619_0001740 | 3300053085 | Bacteria | 14448 |
| 1044 | Ga0495619_0056370 | 3300053085 | Bacteria | 2605 |
| 1045 | Ga0500644_0000301 | 3300053088 | Bacteria | 26471 |
| 1046 | Ga0500651_0058533 | 3300053093 | Bacteria | 2410 |
| 1047 | Ga0500650_0016745 | 3300053098 | Bacteria | 3150 |
| 1048 | Ga0500595_000144 | 3300053119 | Bacteria | 46478 |
| 1049 | Ga0500652_009445 | 3300053131 | Bacteria | 3299 |
| 1050 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 1051 | Ga0500616_0002829 | 3300053153 | Bacteria | 13952 |
| 1052 | Ga0500645_000946 | 3300053730 | Bacteria | 16529 |
| 1053 | Ga0530510_0053716 | 3300061734 | Bacteria | 2911 |
| 1054 | Ga0530510_0291320 | 3300061734 | Bacteria | 1220 |
| 1055 | 2509077788 | 2508501114 | Bacteria | 7082538 |
| 1056 | 2517566873 | 2517487022 | Bacteria | 7227575 |
| 1057 | 2643988902 | 2643221595 | Bacteria | 6565519 |
| 1058 | 2644154815 | 2643221627 | Bacteria | 6761570 |
| 1059 | 2692320437 | 2690316117 | Bacteria | 6800650 |
| 1060 | 2774872764 | 2773857925 | Bacteria | 6472445 |
| 1061 | 2776261782 | 2775506901 | Bacteria | 9631051 |
| 1062 | 2835313346 | 2835312727 | Bacteria | 7413381 |
| 1063 | 2847423884 | 2847417321 | Bacteria | 6913799 |
| 1064 | 2856318128 | 2856314179 | Bacteria | 6477897 |
| 1065 | 2879088833 | 2879083081 | Bacteria | 8587928 |
| 1066 | 2882458120 | 2882456835 | Bacteria | 6863978 |
| 1067 | 2894239401 | 2894232714 | Bacteria | 8834183 |
| 1068 | 2920822563 | 2920822456 | Bacteria | 6897201 |
| 1069 | Ga0070709_10081884 | |||
| 1070 | SwRhRL2b_contig_510538 | |||
| 1071 | JGI24737J22298_10023517 | |||
| 1072 | rootH1_10051132 | |||
| 1073 | rootL2_10095643 | |||
| 1074 | JGI26145J50221_1000614 | |||
| 1075 | JGI26132J50249_100881 | |||
| 1076 | Ga0065712_10073914 | |||
| 1077 | Ga0065712_10074092 | |||
| 1078 | Ga0065712_10075782 | |||
| 1079 | Ga0065712_10189403 | |||
| 1080 | Ga0065715_10028470 | |||
| 1081 | Ga0065715_10042363 | |||
| 1082 | Ga0065715_10140639 | |||
| 1083 | Ga0065707_10002075 | |||
| 1084 | Ga0065707_10004588 | |||
| 1085 | Ga0065707_10347868 | |||
| 1086 | Ga0070658_10032203 | |||
| 1087 | Ga0070658_10582653 | |||
| 1088 | Ga0070676_10003201 | |||
| 1089 | Ga0070676_10056770 | |||
| 1090 | Ga0070676_10061182 | |||
| 1091 | Ga0070676_10139867 | |||
| 1092 | Ga0070683_100076215 | |||
| 1093 | Ga0070683_100079552 | |||
| 1094 | Ga0070683_100295306 | |||
| 1095 | Ga0070683_100654781 | |||
| 1096 | Ga0070690_100093389 | |||
| 1097 | Ga0070670_100015769 | |||
| 1098 | Ga0070670_100133826 | |||
| 1099 | Ga0070670_100437573 | |||
| 1100 | Ga0070677_10003217 | |||
| 1101 | Ga0070677_10078348 | |||
| 1102 | Ga0070666_10080586 | |||
| 1103 | Ga0070666_10086370 | |||
| 1104 | Ga0070666_10174751 | |||
| 1105 | Ga0070680_100000167 | |||
| 1106 | Ga0070680_100198990 | |||
| 1107 | Ga0070680_100282865 | |||
| 1108 | Ga0070682_100058029 | |||
| 1109 | Ga0070682_100418227 | |||
| 1110 | Ga0068868_100119755 | |||
| 1111 | Ga0068868_100339077 | |||
| 1112 | Ga0070660_100121957 | |||
| 1113 | Ga0070660_100130154 | |||
| 1114 | Ga0070689_100028747 | |||
| 1115 | Ga0070689_100038912 | |||
| 1116 | Ga0070689_100045684 | |||
| 1117 | Ga0070689_100288962 | |||
| 1118 | Ga0070691_10058410 | |||
| 1119 | Ga0070691_10142696 | |||
| 1120 | Ga0070687_100000971 | |||
| 1121 | Ga0070687_100003161 | |||
| 1122 | Ga0070687_100100358 | |||
| 1123 | Ga0070661_100010642 | |||
| 1124 | Ga0070661_100095197 | |||
| 1125 | Ga0070661_100645116 | |||
| 1126 | Ga0070668_100019705 | |||
| 1127 | Ga0070668_100042798 | |||
| 1128 | Ga0070668_100044752 | |||
| 1129 | Ga0070668_100165816 | |||
| 1130 | Ga0070668_100313903 | |||
| 1131 | Ga0070669_100002728 | |||
| 1132 | Ga0070675_100025100 | |||
| 1133 | Ga0070675_100046201 | |||
| 1134 | Ga0070675_100070042 | |||
| 1135 | Ga0070675_100132259 | |||
| 1136 | Ga0070675_100207968 | |||
| 1137 | Ga0070675_100211794 | |||
| 1138 | Ga0070675_100493744 | |||
| 1139 | Ga0070671_100014818 | |||
| 1140 | Ga0070671_100015101 | |||
| 1141 | Ga0070671_100110023 | |||
| 1142 | Ga0070671_100263125 | |||
| 1143 | Ga0070671_100511864 | |||
| 1144 | Ga0070671_100583664 | |||
| 1145 | Ga0070674_100000385 | |||
| 1146 | Ga0070674_100001895 | |||
| 1147 | Ga0070674_100078859 | |||
| 1148 | Ga0070674_100180017 | |||
| 1149 | Ga0070673_100007148 | |||
| 1150 | Ga0070673_100007562 | |||
| 1151 | Ga0070673_100036588 | |||
| 1152 | Ga0070673_100127557 | |||
| 1153 | Ga0070673_100206753 | |||
| 1154 | Ga0070673_100290350 | |||
| 1155 | Ga0070688_100011471 | |||
| 1156 | Ga0070688_100027570 | |||
| 1157 | Ga0070688_100135804 | |||
| 1158 | Ga0070659_100004159 | |||
| 1159 | Ga0070659_100027270 | |||
| 1160 | Ga0070659_100042201 | |||
| 1161 | Ga0070667_100077349 | |||
| 1162 | Ga0070667_100080903 | |||
| 1163 | Ga0070667_100161058 | |||
| 1164 | Ga0070709_10011001 | |||
| 1165 | Ga0070709_10029691 | |||
| 1166 | Ga0070709_10034393 | |||
| 1167 | Ga0070709_10292828 | |||
| 1168 | Ga0070709_10401858 | |||
| 1169 | Ga0070714_100071808 | |||
| 1170 | Ga0070714_100095456 | |||
| 1171 | Ga0070714_100112466 | |||
| 1172 | Ga0070714_100119069 | |||
| 1173 | Ga0070714_100196016 | |||
| 1174 | Ga0070714_100212954 | |||
| 1175 | Ga0070714_100256501 | |||
| 1176 | Ga0070714_100470019 | |||
| 1177 | Ga0070713_100000084 | |||
| 1178 | Ga0070713_100002024 | |||
| 1179 | Ga0070713_100006573 | |||
| 1180 | Ga0070713_100028305 | |||
| 1181 | Ga0070713_100029007 | |||
| 1182 | Ga0070713_100029331 | |||
| 1183 | Ga0070713_100030673 | |||
| 1184 | Ga0070713_100086436 | |||
| 1185 | Ga0070713_100095905 | |||
| 1186 | Ga0070713_100438091 | |||
| 1187 | Ga0070710_10021880 | |||
| 1188 | Ga0070710_10063306 | |||
| 1189 | Ga0070710_10081138 | |||
| 1190 | Ga0070710_10109883 | |||
| 1191 | Ga0070710_10205031 | |||
| 1192 | Ga0070711_100012633 | |||
| 1193 | Ga0070711_100024494 | |||
| 1194 | Ga0070711_100028675 | |||
| 1195 | Ga0070711_100034503 | |||
| 1196 | Ga0070711_100052699 | |||
| 1197 | Ga0070711_100090239 | |||
| 1198 | Ga0070711_100180687 | |||
| 1199 | Ga0070711_100319002 | |||
| 1200 | Ga0070711_100372581 | |||
| 1201 | Ga0070711_100437066 | |||
| 1202 | Ga0070705_100089202 | |||
| 1203 | Ga0070705_100096901 | |||
| 1204 | Ga0070705_100104837 | |||
| 1205 | Ga0070705_100509165 | |||
| 1206 | Ga0070700_100044965 | |||
| 1207 | Ga0070694_100036313 | |||
| 1208 | Ga0070708_100011000 | |||
| 1209 | Ga0070708_100031125 | |||
| 1210 | Ga0070708_100077831 | |||
| 1211 | Ga0070708_100105638 | |||
| 1212 | Ga0070708_100190968 | |||
| 1213 | Ga0070708_100279465 | |||
| 1214 | Ga0070663_100077985 | |||
| 1215 | Ga0070663_100192482 | |||
| 1216 | Ga0070678_100003379 | |||
| 1217 | Ga0070678_100022634 | |||
| 1218 | Ga0070678_100048545 | |||
| 1219 | Ga0070678_100476614 | |||
| 1220 | Ga0070662_100000649 | |||
| 1221 | Ga0070662_100171046 | |||
| 1222 | Ga0070662_100314978 | |||
| 1223 | Ga0070662_100432539 | |||
| 1224 | Ga0070681_10008068 | |||
| 1225 | Ga0070681_10014788 | |||
| 1226 | Ga0070681_10104124 | |||
| 1227 | Ga0070681_10182844 | |||
| 1228 | Ga0070681_10345875 | |||
| 1229 | Ga0070681_10502648 | |||
| 1230 | Ga0068867_100006869 | |||
| 1231 | Ga0068867_100074517 | |||
| 1232 | Ga0070685_10051874 | |||
| 1233 | Ga0070706_100000072 | |||
| 1234 | Ga0070706_100015531 | |||
| 1235 | Ga0070706_100021589 | |||
| 1236 | Ga0070706_100061960 | |||
| 1237 | Ga0070706_100196623 | |||
| 1238 | Ga0070706_100205592 | |||
| 1239 | Ga0070706_100215066 | |||
| 1240 | Ga0070707_100001205 | |||
| 1241 | Ga0070707_100009587 | |||
| 1242 | Ga0070707_100010644 | |||
| 1243 | Ga0070707_100196271 | |||
| 1244 | Ga0070707_100329923 | |||
| 1245 | Ga0070698_100007279 | |||
| 1246 | Ga0070698_100037594 | |||
| 1247 | Ga0070698_100134167 | |||
| 1248 | Ga0070698_100224697 | |||
| 1249 | Ga0070699_100004356 | |||
| 1250 | Ga0070699_100005682 | |||
| 1251 | Ga0070699_100006883 | |||
| 1252 | Ga0070699_100046134 | |||
| 1253 | Ga0070699_100168462 | |||
| 1254 | Ga0070699_100215513 | |||
| 1255 | Ga0070679_100028867 | |||
| 1256 | Ga0070679_100039953 | |||
| 1257 | Ga0070679_100097630 | |||
| 1258 | Ga0070679_100105508 | |||
| 1259 | Ga0070679_100154858 | |||
| 1260 | Ga0070679_100630759 | |||
| 1261 | Ga0070684_100293881 | |||
| 1262 | Ga0070684_100441881 | |||
| 1263 | Ga0070684_100565985 | |||
| 1264 | Ga0070697_100000113 | |||
| 1265 | Ga0070697_100001895 | |||
| 1266 | Ga0070697_100003932 | |||
| 1267 | Ga0070697_100024116 | |||
| 1268 | Ga0070697_100034025 | |||
| 1269 | Ga0070697_100083096 | |||
| 1270 | Ga0070697_100099882 | |||
| 1271 | Ga0070697_100106261 | |||
| 1272 | Ga0070697_100140650 | |||
| 1273 | Ga0070697_100158636 | |||
| 1274 | Ga0070697_100395608 | |||
| 1275 | Ga0070697_100496256 | |||
| 1276 | Ga0070697_100719700 | |||
| 1277 | Ga0070672_100003922 | |||
| 1278 | Ga0070672_100011647 | |||
| 1279 | Ga0070672_100059204 | |||
| 1280 | Ga0070672_100100272 | |||
| 1281 | Ga0070672_100189597 | |||
| 1282 | Ga0070686_100002480 | |||
| 1283 | Ga0070686_100133026 | |||
| 1284 | Ga0070686_100504344 | |||
| 1285 | Ga0070695_100040020 | |||
| 1286 | Ga0070695_100044557 | |||
| 1287 | Ga0070696_100022055 | |||
| 1288 | Ga0070696_100026183 | |||
| 1289 | Ga0070696_100185202 | |||
| 1290 | Ga0070693_100080754 | |||
| 1291 | Ga0070665_100049286 | |||
| 1292 | Ga0070665_100099430 | |||
| 1293 | Ga0070665_100129865 | |||
| 1294 | Ga0070665_100195255 | |||
| 1295 | Ga0070665_100293203 | |||
| 1296 | Ga0070704_100020423 | |||
| 1297 | Ga0070704_100022697 | |||
| 1298 | Ga0070704_100131276 | |||
| 1299 | Ga0070704_100305713 | |||
| 1300 | Ga0070704_100512451 | |||
| 1301 | Ga0068855_100164779 | |||
| 1302 | Ga0068855_100224487 | |||
| 1303 | Ga0068855_100405617 | |||
| 1304 | Ga0070664_100013086 | |||
| 1305 | Ga0068857_100013918 | |||
| 1306 | Ga0068857_100070415 | |||
| 1307 | Ga0068857_100079273 | |||
| 1308 | Ga0068854_100032206 | |||
| 1309 | Ga0068854_100095806 | |||
| 1310 | Ga0068854_100110612 | |||
| 1311 | Ga0068856_100000755 | |||
| 1312 | Ga0068856_100004317 | |||
| 1313 | Ga0068856_100198027 | |||
| 1314 | Ga0068856_100320199 | |||
| 1315 | Ga0068856_100489945 | |||
| 1316 | Ga0068856_100510735 | |||
| 1317 | Ga0070702_100248015 | |||
| 1318 | Ga0068859_100710636 | |||
| 1319 | Ga0068859_100965094 | |||
| 1320 | Ga0068864_100085454 | |||
| 1321 | Ga0068864_100153317 | |||
| 1322 | Ga0068866_10070469 | |||
| 1323 | Ga0068861_100041952 | |||
| 1324 | Ga0068870_10007417 | |||
| 1325 | Ga0068863_100150975 | |||
| 1326 | Ga0068863_100280048 | |||
| 1327 | Ga0068858_100443499 | |||
| 1328 | Ga0068858_100765182 | |||
| 1329 | Ga0068860_100017560 | |||
| 1330 | Ga0068860_100061892 | |||
| 1331 | Ga0068860_100351291 | |||
| 1332 | Ga0068860_100454300 | |||
| 1333 | Ga0068862_100046907 | |||
| 1334 | Ga0081539_10063094 | |||
| 1335 | Ga0070717_10001346 | |||
| 1336 | Ga0070717_10005388 | |||
| 1337 | Ga0070717_10028889 | |||
| 1338 | Ga0070717_10036469 | |||
| 1339 | Ga0070717_10127444 | |||
| 1340 | Ga0070717_10223172 | |||
| 1341 | Ga0070717_10253844 | |||
| 1342 | Ga0070717_10305741 | |||
| 1343 | Ga0070717_10329370 | |||
| 1344 | Ga0070717_10371879 | |||
| 1345 | Ga0075432_10001294 | |||
| 1346 | Ga0070715_10016525 | |||
| 1347 | Ga0070715_10062330 | |||
| 1348 | Ga0070716_100000274 | |||
| 1349 | Ga0070716_100019584 | |||
| 1350 | Ga0070716_100052972 | |||
| 1351 | Ga0070716_100138986 | |||
| 1352 | Ga0070716_100148151 | |||
| 1353 | Ga0070716_100364917 | |||
| 1354 | Ga0070716_100592064 | |||
| 1355 | Ga0070712_100000106 | |||
| 1356 | Ga0070712_100004726 | |||
| 1357 | Ga0070712_100008733 | |||
| 1358 | Ga0070712_100024347 | |||
| 1359 | Ga0070712_100176607 | |||
| 1360 | Ga0070712_100236060 | |||
| 1361 | Ga0075427_10003926 | |||
| 1362 | Ga0097621_100001385 | |||
| 1363 | Ga0097621_100009158 | |||
| 1364 | Ga0097621_100017018 | |||
| 1365 | Ga0097621_100020222 | |||
| 1366 | Ga0097621_100056388 | |||
| 1367 | Ga0097621_100575347 | |||
| 1368 | Ga0068871_100009154 | |||
| 1369 | Ga0068871_100010844 | |||
| 1370 | Ga0068871_100113889 | |||
| 1371 | Ga0075428_100013513 | |||
| 1372 | Ga0075428_100018113 | |||
| 1373 | Ga0075430_100008311 | |||
| 1374 | Ga0075431_100070518 | |||
| 1375 | Ga0075433_10000913 | |||
| 1376 | Ga0075433_10014277 | |||
| 1377 | Ga0075433_10125800 | |||
| 1378 | Ga0075434_100000253 | |||
| 1379 | Ga0075434_100019249 | |||
| 1380 | Ga0075434_100019639 | |||
| 1381 | Ga0075434_100234340 | |||
| 1382 | Ga0075434_100519001 | |||
| 1383 | Ga0075434_100965503 | |||
| 1384 | Ga0068865_100004508 | |||
| 1385 | Ga0068865_100021768 | |||
| 1386 | Ga0075436_100026097 | |||
| 1387 | Ga0075436_100041976 | |||
| 1388 | Ga0097620_100710719 | |||
| 1389 | Ga0097620_100965147 | |||
| 1390 | Ga0075435_100000234 | |||
| 1391 | Ga0075435_100001191 | |||
| 1392 | Ga0075435_100053921 | |||
| 1393 | Ga0075435_100308659 | |||
| 1394 | Ga0099794_10018509 | |||
| 1395 | Ga0099794_10154215 | |||
| 1396 | Ga0099795_10019095 | |||
| 1397 | Ga0099795_10020654 | |||
| 1398 | Ga0105240_10021993 | |||
| 1399 | Ga0105240_10039955 | |||
| 1400 | Ga0105240_10067425 | |||
| 1401 | Ga0105240_10397616 | |||
| 1402 | Ga0105240_10496370 | |||
| 1403 | Ga0111539_10062241 | |||
| 1404 | Ga0111539_10062696 | |||
| 1405 | Ga0111539_10118643 | |||
| 1406 | Ga0111539_10511603 | |||
| 1407 | Ga0111539_10513411 | |||
| 1408 | Ga0111539_10725872 | |||
| 1409 | Ga0111539_10976792 | |||
| 1410 | Ga0105245_10006914 | |||
| 1411 | Ga0105245_10008205 | |||
| 1412 | Ga0105245_10008208 | |||
| 1413 | Ga0105245_10482715 | |||
| 1414 | Ga0105247_10321326 | |||
| 1415 | Ga0105247_10527773 | |||
| 1416 | Ga0114129_10017199 | |||
| 1417 | Ga0114129_10024476 | |||
| 1418 | Ga0114129_10114977 | |||
| 1419 | Ga0114129_10270845 | |||
| 1420 | Ga0114129_10489715 | |||
| 1421 | Ga0105243_10000414 | |||
| 1422 | Ga0105241_10138141 | |||
| 1423 | Ga0105241_10172763 | |||
| 1424 | Ga0105241_10631788 | |||
| 1425 | Ga0105242_10005509 | |||
| 1426 | Ga0105242_10111522 | |||
| 1427 | Ga0105242_10559993 | |||
| 1428 | Ga0105242_10696010 | |||
| 1429 | Ga0105248_10042569 | |||
| 1430 | Ga0105237_10011974 | |||
| 1431 | Ga0105237_10229475 | |||
| 1432 | Ga0105237_10347353 | |||
| 1433 | Ga0105238_10173474 | |||
| 1434 | Ga0105249_10003933 | |||
| 1435 | Ga0105249_10873438 | |||
| 1436 | Ga0099796_10006841 | |||
| 1437 | Ga0099796_10025714 | |||
| 1438 | Ga0099796_10087847 | |||
| 1439 | Ga0105239_10113753 | |||
| 1440 | Ga0105239_10115581 | |||
| 1441 | Ga0105239_10549006 | |||
| 1442 | Ga0105246_10000130 | |||
| 1443 | Ga0105246_10159389 | |||
| 1444 | Ga0105246_10211157 | |||
| 1445 | Ga0157373_10003878 | |||
| 1446 | Ga0157373_10028714 | |||
| 1447 | Ga0157371_10019095 | |||
| 1448 | Ga0157371_10157736 | |||
| 1449 | Ga0157370_10027500 | |||
| 1450 | Ga0157370_10043493 | |||
| 1451 | Ga0157370_10204582 | |||
| 1452 | Ga0157369_10009595 | |||
| 1453 | Ga0157369_10088489 | |||
| 1454 | Ga0157369_10188680 | |||
| 1455 | Ga0157369_10459371 | |||
| 1456 | Ga0157369_10552930 | |||
| 1457 | Ga0157374_10000068 | |||
| 1458 | Ga0157374_10004858 | |||
| 1459 | Ga0157374_10015477 | |||
| 1460 | Ga0157374_10140802 | |||
| 1461 | Ga0157374_10322630 | |||
| 1462 | Ga0157378_10002374 | |||
| 1463 | Ga0157378_10003652 | |||
| 1464 | Ga0157378_10072539 | |||
| 1465 | Ga0157378_10239427 | |||
| 1466 | Ga0157378_10327168 | |||
| 1467 | Ga0157378_10363890 | |||
| 1468 | Ga0157378_10487893 | |||
| 1469 | Ga0163162_10003595 | |||
| 1470 | Ga0163162_10117183 | |||
| 1471 | Ga0163162_10185584 | |||
| 1472 | Ga0163162_10906082 | |||
| 1473 | Ga0157372_10004816 | |||
| 1474 | Ga0157372_10006638 | |||
| 1475 | Ga0157372_10011099 | |||
| 1476 | Ga0157372_10013707 | |||
| 1477 | Ga0157372_10018858 | |||
| 1478 | Ga0157372_10022540 | |||
| 1479 | Ga0157372_10162946 | |||
| 1480 | Ga0157372_10251333 | |||
| 1481 | Ga0157372_10440517 | |||
| 1482 | Ga0157375_10002248 | |||
| 1483 | Ga0157375_10043724 | |||
| 1484 | Ga0157375_10072099 | |||
| 1485 | Ga0157375_10260513 | |||
| 1486 | Ga0157375_10280219 | |||
| 1487 | Ga0157375_10444360 | |||
| 1488 | Ga0157375_11287844 | |||
| 1489 | Ga0163163_10057762 | |||
| 1490 | Ga0163163_10085528 | |||
| 1491 | Ga0163163_10257064 | |||
| 1492 | Ga0163163_10335189 | |||
| 1493 | Ga0157380_10038409 | |||
| 1494 | Ga0182008_10080573 | |||
| 1495 | Ga0157377_10005381 | |||
| 1496 | Ga0157379_10027874 | |||
| 1497 | Ga0157379_10046103 | |||
| 1498 | Ga0157376_10001790 | |||
| 1499 | Ga0157376_10002339 | |||
| 1500 | Ga0157376_10014931 | |||
| 1501 | Ga0157376_10130612 | |||
| 1502 | Ga0157376_10991132 | |||
| 1503 | Ga0182006_1008826 | |||
| 1504 | Ga0182006_1057475 | |||
| 1505 | Ga0182007_10006678 | |||
| 1506 | Ga0182005_1039451 | |||
| 1507 | Ga0163161_10063788 | |||
| 1508 | Ga0163161_10147410 | |||
| 1509 | Ga0206356_11396592 | |||
| 1510 | Ga0213872_10084408 | |||
| 1511 | Ga0213876_10046543 | |||
| 1512 | Ga0207666_1029196 | |||
| 1513 | Ga0207697_10000465 | |||
| 1514 | Ga0207697_10006542 | |||
| 1515 | Ga0207697_10014431 | |||
| 1516 | Ga0207682_10008155 | |||
| 1517 | Ga0207682_10033499 | |||
| 1518 | Ga0207692_10015719 | |||
| 1519 | Ga0207692_10025075 | |||
| 1520 | Ga0207692_10166737 | |||
| 1521 | Ga0207642_10062879 | |||
| 1522 | Ga0207642_10217441 | |||
| 1523 | Ga0207688_10001108 | |||
| 1524 | Ga0207688_10001495 | |||
| 1525 | Ga0207688_10034388 | |||
| 1526 | Ga0207688_10035459 | |||
| 1527 | Ga0207688_10126338 | |||
| 1528 | Ga0207680_10021953 | |||
| 1529 | Ga0207680_10205787 | |||
| 1530 | Ga0207647_10202087 | |||
| 1531 | Ga0207699_10000756 | |||
| 1532 | Ga0207699_10029346 | |||
| 1533 | Ga0207699_10062799 | |||
| 1534 | Ga0207699_10078612 | |||
| 1535 | Ga0207645_10000012 | |||
| 1536 | Ga0207645_10002843 | |||
| 1537 | Ga0207645_10118907 | |||
| 1538 | Ga0207645_10298811 | |||
| 1539 | Ga0207643_10011714 | |||
| 1540 | Ga0207705_10123098 | |||
| 1541 | Ga0207684_10038482 | |||
| 1542 | Ga0207684_10053255 | |||
| 1543 | Ga0207684_10192263 | |||
| 1544 | Ga0207654_10020414 | |||
| 1545 | Ga0207707_10014117 | |||
| 1546 | Ga0207707_10051140 | |||
| 1547 | Ga0207707_10060653 | |||
| 1548 | Ga0207695_10007980 | |||
| 1549 | Ga0207695_10017288 | |||
| 1550 | Ga0207695_10027313 | |||
| 1551 | Ga0207695_10197137 | |||
| 1552 | Ga0207671_10032357 | |||
| 1553 | Ga0207671_10207703 | |||
| 1554 | Ga0207693_10000033 | |||
| 1555 | Ga0207693_10008418 | |||
| 1556 | Ga0207693_10008661 | |||
| 1557 | Ga0207693_10012562 | |||
| 1558 | Ga0207693_10018610 | |||
| 1559 | Ga0207693_10179322 | |||
| 1560 | Ga0207693_10425485 | |||
| 1561 | Ga0207663_10011327 | |||
| 1562 | Ga0207663_10017700 | |||
| 1563 | Ga0207663_10037325 | |||
| 1564 | Ga0207663_10068994 | |||
| 1565 | Ga0207663_10159346 | |||
| 1566 | Ga0207663_10198015 | |||
| 1567 | Ga0207663_10512979 | |||
| 1568 | Ga0207660_10020529 | |||
| 1569 | Ga0207660_10031923 | |||
| 1570 | Ga0207660_10049922 | |||
| 1571 | Ga0207660_10059616 | |||
| 1572 | Ga0207660_10179995 | |||
| 1573 | Ga0207660_10279031 | |||
| 1574 | Ga0207662_10000967 | |||
| 1575 | Ga0207662_10016291 | |||
| 1576 | Ga0207657_10005628 | |||
| 1577 | Ga0207657_10044352 | |||
| 1578 | Ga0207657_10093755 | |||
| 1579 | Ga0207657_10148702 | |||
| 1580 | Ga0207649_10052791 | |||
| 1581 | Ga0207652_10008847 | |||
| 1582 | Ga0207652_10051815 | |||
| 1583 | Ga0207652_10063841 | |||
| 1584 | Ga0207652_10121725 | |||
| 1585 | Ga0207652_10254960 | |||
| 1586 | Ga0207652_10334022 | |||
| 1587 | Ga0207652_10696971 | |||
| 1588 | Ga0207646_10002936 | |||
| 1589 | Ga0207646_10040006 | |||
| 1590 | Ga0207646_10174121 | |||
| 1591 | Ga0207646_10195392 | |||
| 1592 | Ga0207646_10586852 | |||
| 1593 | Ga0207681_10016862 | |||
| 1594 | Ga0207681_10057151 | |||
| 1595 | Ga0207650_10038372 | |||
| 1596 | Ga0207650_10244445 | |||
| 1597 | Ga0207659_10004515 | |||
| 1598 | Ga0207659_10026996 | |||
| 1599 | Ga0207659_10034581 | |||
| 1600 | Ga0207659_10064578 | |||
| 1601 | Ga0207659_10129473 | |||
| 1602 | Ga0207659_10320807 | |||
| 1603 | Ga0207687_10011501 | |||
| 1604 | Ga0207687_10022484 | |||
| 1605 | Ga0207687_10305823 | |||
| 1606 | Ga0207700_10000902 | |||
| 1607 | Ga0207700_10009675 | |||
| 1608 | Ga0207700_10013431 | |||
| 1609 | Ga0207700_10016833 | |||
| 1610 | Ga0207700_10033007 | |||
| 1611 | Ga0207700_10035245 | |||
| 1612 | Ga0207700_10042396 | |||
| 1613 | Ga0207700_10045699 | |||
| 1614 | Ga0207700_10054135 | |||
| 1615 | Ga0207700_10116301 | |||
| 1616 | Ga0207700_10188026 | |||
| 1617 | Ga0207700_10210597 | |||
| 1618 | Ga0207700_10821464 | |||
| 1619 | Ga0207664_10000097 | |||
| 1620 | Ga0207664_10081918 | |||
| 1621 | Ga0207664_10121407 | |||
| 1622 | Ga0207664_10139134 | |||
| 1623 | Ga0207664_10192361 | |||
| 1624 | Ga0207664_10238151 | |||
| 1625 | Ga0207664_10506177 | |||
| 1626 | Ga0207644_10010293 | |||
| 1627 | Ga0207644_10011125 | |||
| 1628 | Ga0207644_10075836 | |||
| 1629 | Ga0207644_10102781 | |||
| 1630 | Ga0207644_10118296 | |||
| 1631 | Ga0207644_10289089 | |||
| 1632 | Ga0207644_10586288 | |||
| 1633 | Ga0207690_10038078 | |||
| 1634 | Ga0207690_10182791 | |||
| 1635 | Ga0207706_10002781 | |||
| 1636 | Ga0207706_10032159 | |||
| 1637 | Ga0207706_10125657 | |||
| 1638 | Ga0207706_10176569 | |||
| 1639 | Ga0207706_10237179 | |||
| 1640 | Ga0207706_10296370 | |||
| 1641 | Ga0207686_10035362 | |||
| 1642 | Ga0207686_10106991 | |||
| 1643 | Ga0207686_10279144 | |||
| 1644 | Ga0207709_10017882 | |||
| 1645 | Ga0207670_10004496 | |||
| 1646 | Ga0207670_10032753 | |||
| 1647 | Ga0207670_10317871 | |||
| 1648 | Ga0207669_10006395 | |||
| 1649 | Ga0207669_10015129 | |||
| 1650 | Ga0207669_10124918 | |||
| 1651 | Ga0207669_10269063 | |||
| 1652 | Ga0207704_10001929 | |||
| 1653 | Ga0207704_10014560 | |||
| 1654 | Ga0207665_10000176 | |||
| 1655 | Ga0207665_10007817 | |||
| 1656 | Ga0207665_10017360 | |||
| 1657 | Ga0207665_10048055 | |||
| 1658 | Ga0207665_10057546 | |||
| 1659 | Ga0207665_10092172 | |||
| 1660 | Ga0207665_10177803 | |||
| 1661 | Ga0207665_10526265 | |||
| 1662 | Ga0207691_10000097 | |||
| 1663 | Ga0207691_10000155 | |||
| 1664 | Ga0207691_10020569 | |||
| 1665 | Ga0207691_10029883 | |||
| 1666 | Ga0207691_10189891 | |||
| 1667 | Ga0207661_10105275 | |||
| 1668 | Ga0207661_10587956 | |||
| 1669 | Ga0207679_10003563 | |||
| 1670 | Ga0207679_10004282 | |||
| 1671 | Ga0207679_10127698 | |||
| 1672 | Ga0207679_10259927 | |||
| 1673 | Ga0207667_10210645 | |||
| 1674 | Ga0207667_11001329 | |||
| 1675 | Ga0207651_10014892 | |||
| 1676 | Ga0207651_10033902 | |||
| 1677 | Ga0207651_10038422 | |||
| 1678 | Ga0207651_10260527 | |||
| 1679 | Ga0207651_10333252 | |||
| 1680 | Ga0207712_10042926 | |||
| 1681 | Ga0207712_10080983 | |||
| 1682 | Ga0207712_10188194 | |||
| 1683 | Ga0207668_10009679 | |||
| 1684 | Ga0207668_10030284 | |||
| 1685 | Ga0207668_10193517 | |||
| 1686 | Ga0207640_10020256 | |||
| 1687 | Ga0207640_10058904 | |||
| 1688 | Ga0207640_10391940 | |||
| 1689 | Ga0207677_10011704 | |||
| 1690 | Ga0207677_10064600 | |||
| 1691 | Ga0207677_10090363 | |||
| 1692 | Ga0207677_10337447 | |||
| 1693 | Ga0207677_10454822 | |||
| 1694 | Ga0207639_10036735 | |||
| 1695 | Ga0207678_10035266 | |||
| 1696 | Ga0207708_10000199 | |||
| 1697 | Ga0207702_10000137 | |||
| 1698 | Ga0207702_10002313 | |||
| 1699 | Ga0207702_10077834 | |||
| 1700 | Ga0207702_10163809 | |||
| 1701 | Ga0207702_10303406 | |||
| 1702 | Ga0207702_10326734 | |||
| 1703 | Ga0207702_10592999 | |||
| 1704 | Ga0207641_10055242 | |||
| 1705 | Ga0207641_10066193 | |||
| 1706 | Ga0207641_10281456 | |||
| 1707 | Ga0207648_10000064 | |||
| 1708 | Ga0207648_10005435 | |||
| 1709 | Ga0207648_10122582 | |||
| 1710 | Ga0207648_10204015 | |||
| 1711 | Ga0207676_10082205 | |||
| 1712 | Ga0207676_10146150 | |||
| 1713 | Ga0207674_10016572 | |||
| 1714 | Ga0207674_10022686 | |||
| 1715 | Ga0207675_100061567 | |||
| 1716 | Ga0207683_10000028 | |||
| 1717 | Ga0207683_10012967 | |||
| 1718 | Ga0207683_10014269 | |||
| 1719 | Ga0207683_10109002 | |||
| 1720 | Ga0207683_10300929 | |||
| 1721 | Ga0207698_10215480 | |||
| 1722 | Ga0209973_1002126 | |||
| 1723 | Ga0209967_1000058 | |||
| 1724 | Ga0209981_1000185 | |||
| 1725 | Ga0209996_1000043 | |||
| 1726 | Ga0210000_1000362 | |||
| 1727 | Ga0209995_1000117 | |||
| 1728 | Ga0209179_1016496 | |||
| 1729 | Ga0209968_1000159 | |||
| 1730 | Ga0209999_1000282 | |||
| 1731 | Ga0209982_1000795 | |||
| 1732 | Ga0209970_1002907 | |||
| 1733 | Ga0210002_1000092 | |||
| 1734 | Ga0209588_1001918 | |||
| 1735 | Ga0209971_1000121 | |||
| 1736 | Ga0209971_1058817 | |||
| 1737 | Ga0209966_1000276 | |||
| 1738 | Ga0209998_10000015 | |||
| 1739 | Ga0209974_10000001 | |||
| 1740 | Ga0207428_10000237 | |||
| 1741 | Ga0207428_10036697 | |||
| 1742 | Ga0207428_10120057 | |||
| 1743 | Ga0268266_10047044 | |||
| 1744 | Ga0268266_10091524 | |||
| 1745 | Ga0268266_10272636 | |||
| 1746 | Ga0268266_10731662 | |||
| 1747 | Ga0268265_10021702 | |||
| 1748 | Ga0268265_10076558 | |||
| 1749 | Ga0268264_10340025 | |||
| 1750 | Ga0268264_10612036 | |||
| 1751 | Ga0265326_10030582 | |||
| 1752 | Ga0265319_1003474 | |||
| 1753 | Ga0265338_10034702 | |||
| 1754 | Ga0265338_10107225 | |||
| 1755 | Ga0265338_10125037 | |||
| 1756 | Ga0265338_10132461 | |||
| 1757 | Ga0265338_10156753 | |||
| 1758 | Ga0265338_10328794 | |||
| 1759 | Ga0265324_10028559 | |||
| 1760 | Ga0265762_1039079 | |||
| 1761 | Ga0265332_10002293 | |||
| 1762 | Ga0265320_10001827 | |||
| 1763 | Ga0265325_10006803 | |||
| 1764 | Ga0265325_10008935 | |||
| 1765 | Ga0265325_10027094 | |||
| 1766 | Ga0265325_10036779 | |||
| 1767 | Ga0265340_10003648 | |||
| 1768 | Ga0265340_10043396 | |||
| 1769 | Ga0265340_10138376 | |||
| 1770 | Ga0265339_10002587 | |||
| 1771 | Ga0265339_10018297 | |||
| 1772 | Ga0265339_10067131 | |||
| 1773 | Ga0265339_10084121 | |||
| 1774 | Ga0265339_10111724 | |||
| 1775 | Ga0265339_10190495 | |||
| 1776 | Ga0265331_10027074 | |||
| 1777 | Ga0265331_10041248 | |||
| 1778 | Ga0265316_10001005 | |||
| 1779 | Ga0265316_10040722 | |||
| 1780 | Ga0265316_10070756 | |||
| 1781 | Ga0265316_10092282 | |||
| 1782 | Ga0265316_10098165 | |||
| 1783 | Ga0265313_10000041 | |||
| 1784 | Ga0265313_10000538 | |||
| 1785 | Ga0265313_10003540 | |||
| 1786 | Ga0265314_10000279 | |||
| 1787 | Ga0265314_10001994 | |||
| 1788 | Ga0265314_10011035 | |||
| 1789 | Ga0265314_10025037 | |||
| 1790 | Ga0265314_10130697 | |||
| 1791 | Ga0265342_10023338 | |||
| 1792 | Ga0265342_10062636 | |||
| 1793 | Ga0307407_10120568 | |||
| 1794 | Ga0307412_10083956 | |||
| 1795 | Ga0307416_100274226 | |||
| 1796 | Ga0316214_1002333 | |||
| 1797 | Ga0373944_0036924 | |||
| 1798 | Ga0373944_0115505 | |||
| 1799 | Ga0373936_0007613 | |||
| 1800 | Ga0373936_0019480 | |||
| 1801 | Ga0373936_0063758 | |||
| 1802 | Ga0373936_0109781 | |||
| 1803 | Ga0373936_0206606 | |||
| 1804 | Ga0373941_0036427 | |||
| 1805 | Ga0373941_0054074 | |||
| 1806 | Ga0373945_0000332 | |||
| 1807 | Ga0373945_0068352 | |||
| 1808 | Ga0373953_0036289 | |||
| 1809 | Ga0373954_0046397 | |||
| 1810 | Ga0373943_0000199 | |||
| 1811 | Ga0373943_0002028 | |||
| 1812 | Ga0373943_0128623 | |||
| 1813 | Ga0373946_0005157 | |||
| 1814 | Ga0373955_0016668 | |||
| 1815 | Ga0373955_0078934 | |||
| 1816 | Ga0373955_0233341 | |||
| 1817 | Ga0373961_0046248 | |||
| 1818 | Ga0373924_0042554 | |||
| 1819 | Ga0373931_0245128 | |||
| 1820 | Ga0373935_0000576 | |||
| 1821 | Ga0373935_0013158 | |||
| 1822 | Ga0373927_0000041 | |||
| 1823 | Ga0373927_0011500 | |||
| 1824 | Ga0373927_0029951 | |||
| 1825 | Ga0373927_0031439 | |||
| 1826 | Ga0373927_0034939 | |||
| 1827 | Ga0373933_0303648 | |||
| 1828 | Ga0373947_0000315 | |||
| 1829 | Ga0373947_0005539 | |||
| 1830 | Ga0373947_0032219 | |||
| 1831 | Ga0373937_0020834 | |||
| 1832 | Ga0373937_0141860 | |||
| 1833 | Ga0373925_0000923 | |||
| 1834 | Ga0373925_0017680 | |||
| 1835 | Ga0373925_0028976 | |||
| 1836 | Ga0373925_0033468 | |||
| 1837 | Ga0373925_0067964 | |||
| 1838 | Ga0373925_0074635 | |||
| 1839 | Ga0373925_0081650 | |||
| 1840 | Ga0373925_0106103 | |||
| 1841 | Ga0373925_0482248 | |||
| 1842 | Ga0395899_0199313 | |||
| 1843 | Ga0395900_0005333 | |||
| 1844 | Ga0395898_0053512 | |||
| 1845 | Ga0395898_0565966 | |||
| 1846 | Ga0436364_0415091 | |||
| 1847 | Ga0395901_0005469 | |||
| 1848 | Ga0395901_0208906 | |||
| 1849 | Ga0436365_1008487 | |||
| 1850 | Ga0436361_0513857 | |||
| 1851 | Ga0436361_0611757 | |||
| 1852 | Ga0436361_1068676 | |||
| 1853 | Ga0436363_0199314 | |||
| 1854 | Ga0436363_0813245 | |||
| 1855 | Ga0439453_0009410 | |||
| 1856 | Ga0451853_1013485 | |||
| 1857 | Ga0439443_000361 | |||
| 1858 | Ga0450890_004875 | |||
| 1859 | Ga0451577_0018001 | |||
| 1860 | Ga0451577_0034245 | |||
| 1861 | Ga0466972_0060153 | |||
| 1862 | Ga0453683_0427615 | |||
| 1863 | Ga0453684_0000001 | |||
| 1864 | Ga0466957_0307748 | |||
| 1865 | Ga0451576_0007210 | |||
| 1866 | Ga0451576_0197716 | |||
| 1867 | Ga0451576_0347292 | |||
| 1868 | Ga0466967_0023182 | |||
| 1869 | Ga0495603_0287657 | |||
| 1870 | Ga0495591_029302 | |||
| 1871 | Ga0495629_0136277 | |||
| 1872 | Ga0495641_0036748 | |||
| 1873 | Ga0495651_0000931 | |||
| 1874 | Ga0495651_0088836 | |||
| 1875 | Ga0495651_0113142 | |||
| 1876 | Ga0495653_0043767 | |||
| 1877 | Ga0495580_0000777 | |||
| 1878 | Ga0495580_0001086 | |||
| 1879 | Ga0495580_0006659 | |||
| 1880 | Ga0495580_0007498 | |||
| 1881 | Ga0495580_0010227 | |||
| 1882 | Ga0495580_0038991 | |||
| 1883 | Ga0495580_0077744 | |||
| 1884 | Ga0495580_0121110 | |||
| 1885 | Ga0495580_0480695 | |||
| 1886 | Ga0495582_0000160 | |||
| 1887 | Ga0495582_0007681 | |||
| 1888 | Ga0495582_0140998 | |||
| 1889 | Ga0495639_0054838 | |||
| 1890 | Ga0495662_0037038 | |||
| 1891 | Ga0495584_0019874 | |||
| 1892 | Ga0495584_0122219 | |||
| 1893 | Ga0495584_0244073 | |||
| 1894 | Ga0495594_0191710 | |||
| 1895 | Ga0495594_0288336 | |||
| 1896 | Ga0495608_0029063 | |||
| 1897 | Ga0495618_0102017 | |||
| 1898 | Ga0495630_0030906 | |||
| 1899 | Ga0495630_0034839 | |||
| 1900 | Ga0495644_0000571 | |||
| 1901 | Ga0495666_0112174 | |||
| 1902 | Ga0495652_0166198 | |||
| 1903 | Ga0495665_0030232 | |||
| 1904 | Ga0495665_0239741 | |||
| 1905 | Ga0495640_0078045 | |||
| 1906 | Ga0495586_0100936 | |||
| 1907 | Ga0495598_0133340 | |||
| 1908 | Ga0495609_0012142 | |||
| 1909 | Ga0495645_0092320 | |||
| 1910 | Ga0495622_0065231 | |||
| 1911 | Ga0495633_0004105 | |||
| 1912 | Ga0495667_0021144 | |||
| 1913 | Ga0495656_0002209 | |||
| 1914 | Ga0495635_0000999 | |||
| 1915 | Ga0495635_0007707 | |||
| 1916 | Ga0495659_0041178 | |||
| 1917 | Ga0495659_0091929 | |||
| 1918 | Ga0495659_0151462 | |||
| 1919 | Ga0495661_0044998 | |||
| 1920 | Ga0495657_0189018 | |||
| 1921 | Ga0495623_0151437 | |||
| 1922 | Ga0495647_0032519 | |||
| 1923 | Ga0495658_0009124 | |||
| 1924 | Ga0495658_0074119 | |||
| 1925 | Ga0495669_0197701 | |||
| 1926 | Ga0495624_0030749 | |||
| 1927 | Ga0495670_0000669 | |||
| 1928 | Ga0495670_0058565 | |||
| 1929 | Ga0495581_0012313 | |||
| 1930 | Ga0495581_0015188 | |||
| 1931 | Ga0495581_0158946 | |||
| 1932 | Ga0495581_0176531 | |||
| 1933 | Ga0495604_0007298 | |||
| 1934 | Ga0495604_0011241 | |||
| 1935 | Ga0495636_0000210 | |||
| 1936 | Ga0495674_0009183 | |||
| 1937 | Ga0495674_0033153 | |||
| 1938 | Ga0495674_0094639 | |||
| 1939 | Ga0495674_0102516 | |||
| 1940 | Ga0495676_0107817 | |||
| 1941 | Ga0495680_0009787 | |||
| 1942 | Ga0495680_0031551 | |||
| 1943 | Ga0495687_015124 | |||
| 1944 | Ga0495684_0004982 | |||
| 1945 | Ga0495593_0080223 | |||
| 1946 | Ga0495593_0171991 | |||
| 1947 | Ga0495602_0107089 | |||
| 1948 | Ga0495602_0161036 | |||
| 1949 | Ga0496100_0027878 | |||
| 1950 | Ga0496100_0331738 | |||
| 1951 | Ga0496100_0333455 | |||
| 1952 | Ga0496101_0034156 | |||
| 1953 | Ga0496101_0142938 | |||
| 1954 | Ga0496102_0009184 | |||
| 1955 | Ga0496102_0136758 | |||
| 1956 | Ga0496102_0175230 | |||
| 1957 | Ga0496102_0247404 | |||
| 1958 | Ga0496102_0311696 | |||
| 1959 | Ga0496102_0569060 | |||
| 1960 | Ga0496104_0012389 | |||
| 1961 | Ga0496104_0080482 | |||
| 1962 | Ga0496104_0152756 | |||
| 1963 | Ga0496104_0234005 | |||
| 1964 | Ga0496104_0593596 | |||
| 1965 | Ga0496105_0185943 | |||
| 1966 | Ga0496105_0217941 | |||
| 1967 | Ga0496106_0011211 | |||
| 1968 | Ga0496106_0138207 | |||
| 1969 | Ga0496107_0006454 | |||
| 1970 | Ga0496107_0134130 | |||
| 1971 | Ga0496107_0365588 | |||
| 1972 | Ga0496108_0076395 | |||
| 1973 | Ga0496108_0376751 | |||
| 1974 | Ga0496108_0767138 | |||
| 1975 | Ga0496109_0037919 | |||
| 1976 | Ga0496109_0076350 | |||
| 1977 | Ga0496109_0157111 | |||
| 1978 | Ga0496110_0227330 | |||
| 1979 | Ga0496110_0248365 | |||
| 1980 | Ga0496111_0023234 | |||
| 1981 | Ga0496111_0118631 | |||
| 1982 | Ga0496112_0000541 | |||
| 1983 | Ga0496112_0016070 | |||
| 1984 | Ga0496112_0044633 | |||
| 1985 | Ga0496112_0073939 | |||
| 1986 | Ga0496112_0168860 | |||
| 1987 | Ga0496112_0304726 | |||
| 1988 | Ga0496113_0018963 | |||
| 1989 | Ga0496113_0124477 | |||
| 1990 | Ga0496113_0162927 | |||
| 1991 | Ga0496114_0047135 | |||
| 1992 | Ga0496115_0004910 | |||
| 1993 | Ga0496115_0037936 | |||
| 1994 | Ga0496115_0272729 | |||
| 1995 | Ga0496117_0072205 | |||
| 1996 | Ga0501290_000024 | |||
| 1997 | Ga0501291_000322 | |||
| 1998 | Ga0501292_000069 | |||
| 1999 | Ga0501293_000195 | |||
| 2000 | Ga0501294_000051 | |||
| 2001 | Ga0501295_000036 | |||
| 2002 | Ga0501296_000147 | |||
| 2003 | Ga0501297_000004 | |||
| 2004 | Ga0501298_000124 | |||
| 2005 | Ga0501299_000096 | |||
| 2006 | Ga0501300_000237 | |||
| 2007 | Ga0501301_000323 | |||
| 2008 | Ga0501302_000568 | |||
| 2009 | Ga0501034_0100942 | |||
| 2010 | Ga0501037_0169832 | |||
| 2011 | Ga0501038_0153691 | |||
| 2012 | Ga0501040_0238084 | |||
| 2013 | Ga0501042_0122801 | |||
| 2014 | Ga0501043_0119615 | |||
| 2015 | Ga0501068_0292259 | |||
| 2016 | Ga0501072_0205402 | |||
| 2017 | Ga0501075_0135017 | |||
| 2018 | Ga0501077_0172430 | |||
| 2019 | Ga0501198_003464 | |||
| 2020 | Ga0501199_001087 | |||
| 2021 | Ga0501202_000224 | |||
| 2022 | Ga0501207_001020 | |||
| 2023 | Ga0501209_000414 | |||
| 2024 | Ga0501216_000117 | |||
| 2025 | Ga0501217_000129 | |||
| 2026 | Ga0501228_002969 | |||
| 2027 | Ga0501230_000908 | |||
| 2028 | Ga0501233_000058 | |||
| 2029 | Ga0501235_000042 | |||
| 2030 | Ga0501236_001498 | |||
| 2031 | Ga0501239_000019 | |||
| 2032 | Ga0501243_000139 | |||
| 2033 | Ga0501246_001510 | |||
| 2034 | Ga0501247_000491 | |||
| 2035 | Ga0501249_000123 | |||
| 2036 | Ga0501251_000033 | |||
| 2037 | Ga0501252_009782 | |||
| 2038 | Ga0501253_000062 | |||
| 2039 | Ga0501257_001759 | |||
| 2040 | Ga0501258_000612 | |||
| 2041 | Ga0501259_004607 | |||
| 2042 | Ga0501260_000011 | |||
| 2043 | Ga0501261_001049 | |||
| 2044 | Ga0501219_001253 | |||
| 2045 | Ga0501221_000074 | |||
| 2046 | Ga0501225_0000250 | |||
| 2047 | Ga0501245_000329 | |||
| 2048 | Ga0501080_0015294 | |||
| 2049 | Ga0501080_0150380 | |||
| 2050 | Ga0501080_0346533 | |||
| 2051 | Ga0501232_001731 | |||
| 2052 | Ga0501241_015536 | |||
| 2053 | Ga0501262_008828 | |||
| 2054 | Ga0501264_001013 | |||
| 2055 | Ga0501265_000576 | |||
| 2056 | Ga0501266_000965 | |||
| 2057 | Ga0501268_000667 | |||
| 2058 | Ga0501269_001819 | |||
| 2059 | Ga0501270_000124 | |||
| 2060 | Ga0501271_000377 | |||
| 2061 | Ga0501272_000316 | |||
| 2062 | Ga0501273_000170 | |||
| 2063 | Ga0501274_000059 | |||
| 2064 | Ga0501275_001457 | |||
| 2065 | Ga0501276_000237 | |||
| 2066 | Ga0501278_000240 | |||
| 2067 | Ga0501279_000242 | |||
| 2068 | Ga0501281_01385 | |||
| 2069 | Ga0501282_000466 | |||
| 2070 | Ga0501283_000044 | |||
| 2071 | Ga0501035_0216334 | |||
| 2072 | Ga0501035_0598673 | |||
| 2073 | Ga0501044_0238336 | |||
| 2074 | Ga0501212_000262 | |||
| 2075 | Ga0501226_000232 | |||
| 2076 | nmdc:mga05p37_148110_c1 | |||
| 2077 | nmdc:mga05p37_169470_c1 | |||
| 2078 | nmdc:mga05p37_455569_c1 | |||
| 2079 | nmdc:mga09592_55239_c1 | |||
| 2080 | nmdc:mga0qj67_32131_c1 | |||
| 2081 | nmdc:mga06r32_137644_c1 | |||
| 2082 | nmdc:mga08y16_265250_c1 | |||
| 2083 | nmdc:mga08y16_73110_c1 | |||
| 2084 | nmdc:mga08y16_9680_c1 | |||
| 2085 | nmdc:mga0n895_10165_c1 | |||
| 2086 | nmdc:mga0n895_237_c1 | |||
| 2087 | nmdc:mga0n895_246155_c1 | |||
| 2088 | nmdc:mga0n895_27111_c1 | |||
| 2089 | nmdc:mga0n895_288700_c1 | |||
| 2090 | nmdc:mga0n895_421815_c1 | |||
| 2091 | nmdc:mga0n895_508781_c1 | |||
| 2092 | nmdc:mga0rr50_23495_c1 | |||
| 2093 | nmdc:mga0rr50_290877_c1 | |||
| 2094 | nmdc:mga0rr50_33452_c1 | |||
| 2095 | nmdc:mga0rr50_440306_c1 | |||
| 2096 | nmdc:mga0rr50_683_c1 | |||
| 2097 | nmdc:mga08x19_2178_c1 | |||
| 2098 | nmdc:mga08x19_46398_c1 | |||
| 2099 | nmdc:mga08x19_79619_c1 | |||
| 2100 | nmdc:mga0a205_11604_c2 | |||
| 2101 | nmdc:mga0a205_221_c2 | |||
| 2102 | nmdc:mga0a205_66075_c1 | |||
| 2103 | Ga0495601_0016711 | |||
| 2104 | Ga0495601_0033186 | |||
| 2105 | Ga0495601_0086020 | |||
| 2106 | Ga0495612_0009036 | |||
| 2107 | Ga0495655_0036023 | |||
| 2108 | Ga0495595_0000785 | |||
| 2109 | Ga0495595_0000854 | |||
| 2110 | Ga0495619_0000760 | |||
| 2111 | Ga0495619_0001740 | |||
| 2112 | Ga0495619_0056370 | |||
| 2113 | Ga0500644_0000301 | |||
| 2114 | Ga0500651_0058533 | |||
| 2115 | Ga0500650_0016745 | |||
| 2116 | Ga0500595_000144 | |||
| 2117 | Ga0500652_009445 | |||
| 2118 | Ga0500616_0000006 | |||
| 2119 | Ga0500616_0002829 | |||
| 2120 | Ga0500645_000946 | |||
| 2121 | Ga0530510_0053716 | |||
| 2122 | Ga0530510_0291320 | |||
| 2123 | 2509077788 | |||
| 2124 | 2517566873 | |||
| 2125 | 2643988902 | |||
| 2126 | 2644154815 | |||
| 2127 | 2692320437 | |||
| 2128 | 2774872764 | |||
| 2129 | 2776261782 | |||
| 2130 | 2835313346 | |||
| 2131 | 2847423884 | |||
| 2132 | 2856318128 | |||
| 2133 | 2879088833 | |||
| 2134 | 2882458120 | |||
| 2135 | 2894239401 | |||
| 2136 | 2920822563 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
110
289
0.9
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.8255 | 47 | 242 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.8107 | 47 | 242 |
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.7881 | 5 | 246 |
| 8hpr-assembly1.cif.gz_B | lpqy-sugabc in state 4 | 0.7875 | 35 | 226 |
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.7847 | 47 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57856_64_258_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9514 | 45 | 240 | 1.10.3720.10 |
| af_Q47539_71_268_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9472 | 44 | 242 | 1.10.3720.10 |
| af_P75851_53_247_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9434 | 43 | 239 | 1.10.3720.10 |
| af_P14176_140_330_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.943 | 47 | 240 | 1.10.3720.10 |
| af_Q2FVG9_10_202_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9425 | 47 | 241 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V2SJV8-F1-model_v4 | ABC transporter permease | 0.98 | 2 | 250 |
GO:0005886
GO:0055085 |
| AF-M2PV85-F1-model_v4 | ABC-type sulfate transporter, permease protein | 0.9799 | 2 | 247 |
GO:0005886
GO:0055085 |
| AF-A0A1H0C808-F1-model_v4 | NitT/TauT family transport system permease protein | 0.9747 | 2 | 251 |
GO:0005886
GO:0055085 |
| AF-A0A1Q5MD89-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.974 | 2 | 249 |
GO:0005886
GO:0055085 |
| AF-A0A6G3PLZ5-F1-model_v4 | ABC transporter permease | 0.972 | 2 | 248 |
GO:0005886
GO:0055085 |