F489378

General Info

Members Datasets Scaffolds Average Seq Length
1065 505 1028 171

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0851689|Ga0395901_0851689_110_718
Length 202
Sequence MGRRREEGRRRPEAGARFAQGLAREVQVGVVKKANFADRFINGIEWAAAIFVGIVALNIFVNVTLRKFFSWSIPDYYDFGRMLLGILIFWGIAATSYRGGHITVDLVWTAVNGKWKRIIDVFATVVLLFVVIVQTSMLFDKVRLTYADNVQTFDLNIPTWPFYAVAWAGDVCAVILIAIRTWRLVFKPEALHDEHYDQKAME

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221658 Variovorax sp. Root411 Isolate Unclassified
8 2643221672 Variovorax sp. Root434 Isolate Unclassified
9 2738541277 Variovorax sp. GV051 Isolate Unclassified
10 2738541307 Variovorax sp. GV008 Isolate Unclassified
11 2738543013 Variovorax sp. BT01 Isolate Unclassified
12 2738543019 Variovorax sp. GV040 Isolate Unclassified
13 2791355199
14 2818991446 Variovorax sp. 1180 Isolate Unclassified
15 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
16 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
17 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
18 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
19 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
20 2885198086 Variovorax sp. 679 Isolate Unclassified
21 2885211737 Variovorax sp. 553 Isolate Unclassified
22 2899924645 Variovorax sp. 369 Isolate Unclassified
23 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
24 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
25 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
26 2928037797 Variovorax sp. 1126 Isolate Unclassified
27 2928044640 Variovorax sp. 1128 Isolate Unclassified
28 2928051484 Variovorax sp. 1133 Isolate Unclassified
29 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
30 2928070936 Variovorax gossypii 1167 Isolate Unclassified
31 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
32 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
33 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
34 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
35 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
36 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
37 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
38 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
39 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
40 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
41 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
42 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
43 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
45 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
46 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
47 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
48 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
50 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
51 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
54 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
57 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
58 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
59 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
60 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
61 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
77 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
78 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
81 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
82 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
83 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
87 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
88 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
89 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
90 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
91 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
92 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
95 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
96 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
97 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
103 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
117 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
118 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
119 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
123 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
124 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
125 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
126 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
127 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
128 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
129 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
130 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
131 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
132 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
133 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
134 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
135 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
136 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
137 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
139 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
140 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
141 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
142 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
143 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
144 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
145 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
146 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
147 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
148 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
149 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
150 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
151 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
152 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
153 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
154 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
155 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
156 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
157 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
158 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
159 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
160 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
161 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
162 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
163 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
164 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
165 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
166 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
167 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
168 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
169 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
170 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
171 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
172 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
173 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
174 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
175 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
176 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
177 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
178 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
179 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
180 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
181 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
182 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
183 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
184 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
185 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
186 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
187 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
189 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
193 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
195 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
198 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
201 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
203 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
206 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
271 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
272 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
273 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
274 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
275 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
276 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
277 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
278 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
279 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
280 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
281 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
282 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
283 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
284 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
285 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
286 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
287 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
288 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
289 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
290 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
291 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
292 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
293 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
294 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
295 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
296 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
297 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
298 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
299 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
300 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
301 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
302 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
303 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
304 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
305 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
306 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
307 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
308 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
309 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
310 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
311 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
312 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
313 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
314 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
315 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
316 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
317 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
318 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
319 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
320 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
321 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
322 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
323 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
324 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
325 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
326 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
327 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
328 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
329 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
330 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
331 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
332 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
333 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
334 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
335 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
336 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
337 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
338 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
339 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
340 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
341 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
342 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
343 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
344 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
345 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
346 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
347 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
348 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
349 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
350 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
351 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
352 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
353 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
354 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
355 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
356 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
357 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
358 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
359 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
360 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
361 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
362 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
363 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
364 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
365 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
366 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
367 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
368 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
369 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
370 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
371 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
372 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
373 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
374 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
375 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
376 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
377 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
378 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
379 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
380 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
381 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
382 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
383 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
384 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
385 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
386 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
387 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
388 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
389 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
390 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
391 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
392 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
393 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
394 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
395 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
396 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
397 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
398 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
399 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
400 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
401 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
402 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
403 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
404 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
405 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
406 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
407 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
408 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
409 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
410 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
411 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
412 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
413 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
414 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
415 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
416 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
417 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
418 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
419 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
420 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
421 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
422 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
423 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
424 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
425 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
426 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
427 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
428 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
429 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
430 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
431 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
432 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
433 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
434 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
435 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
436 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
437 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
438 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
439 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
444 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
445 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
446 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
447 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
448 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
449 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
451 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
452 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
453 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
454 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
455 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
456 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
457 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
458 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
459 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
460 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
461 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
462 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
463 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
464 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
465 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
466 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
467 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
468 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
469 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
470 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
471 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
472 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
473 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
474 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
475 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
476 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
477 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
478 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
479 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
480 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
481 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
482 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
483 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
484 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
485 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
486 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
487 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
488 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
489 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
490 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
491 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
492 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
493 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
494 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
495 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
496 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
497 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
498 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
499 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
500 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
501 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
502 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
503 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
504 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
505 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.52
Metatranscriptomes 0.09
Isolates 3.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.25
Nodule 0.66
Rhizoplane 5.35
Rhizosphere 65.92
Stem 0
Stem Tuber 0
Unclassified 5.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10021053 3300001979 Bacteria 2265
2 JGI24735J21928_10075636 3300002067 Bacteria 964
3 JGI25158J39367_1007100 3300002739 Bacteria 1587
4 JGI25152J39213_1008884 3300002773 Bacteria 2445
5 JGI25150J39212_1010324 3300002774 Bacteria 1739
6 JGI25150J39212_1033110 3300002774 Bacteria 703
7 JGI25159J45721_1003181 3300002987 Bacteria 5894
8 JGI25159J45721_1019013 3300002987 Bacteria 1366
9 JGI25151J46595_10026451 3300003187 Bacteria 2340
10 JGI25406J46586_10000233 3300003203 Bacteria 24719
11 JGI25406J46586_10022537 3300003203 Bacteria 2506
12 JGI25153J46596_10002553 3300003215 Bacteria 10441
13 JGI25153J46596_10030668 3300003215 Bacteria 1825
14 rootH1_10067490 3300003316 Bacteria 2077
15 JGI25160J50197_1001363 3300003354 Bacteria 12304
16 JGI25160J50197_1004644 3300003354 Bacteria 5894
17 JGI25161J50226_1002632 3300003374 Bacteria 4500
18 JGI25161J50226_1009988 3300003374 Bacteria 1304
19 JGI25404J52841_10004643 3300003659 Bacteria 2799
20 JGI25404J52841_10008463 3300003659 Bacteria 2191
21 JGI25404J52841_10012135 3300003659 Bacteria 1863
22 JGI25404J52841_10024208 3300003659 Bacteria 1309
23 JGI25404J52841_10039658 3300003659 Bacteria 997
24 JGI25404J52841_10095463 3300003659 Bacteria 622
25 Ga0055527_1007840 3300003760 Bacteria 1292
26 Ga0055535_1000181 3300003761 Bacteria 66856
27 Ga0055542_1000070 3300003762 Bacteria 147374
28 Ga0055526_1007214 3300003771 Bacteria 5835
29 Ga0055526_1008818 3300003771 Bacteria 4959
30 Ga0055537_1003344 3300003773 Bacteria 4959
31 Ga0055537_1007479 3300003773 Bacteria 2627
32 Ga0055524_1006736 3300003775 Bacteria 4959
33 Ga0055524_1009023 3300003775 Bacteria 4093
34 Ga0055536_1001696 3300003781 Bacteria 13035
35 Ga0055536_1008117 3300003781 Bacteria 4573
36 Ga0055536_1018110 3300003781 Bacteria 2271
37 Ga0055534_1001432 3300003784 Bacteria 9493
38 Ga0055534_1013581 3300003784 Bacteria 1559
39 Ga0055528_1007183 3300003790 Bacteria 4959
40 Ga0055528_1031161 3300003790 Bacteria 1394
41 Ga0055530_10000952 3300003791 Bacteria 23669
42 Ga0055530_10009915 3300003791 Bacteria 3590
43 Ga0055540_1010090 3300003792 Bacteria 3177
44 Ga0055540_1028778 3300003792 Bacteria 1309
45 Ga0055531_10002573 3300003794 Bacteria 12043
46 Ga0055531_10005367 3300003794 Bacteria 7516
47 Ga0055531_10011800 3300003794 Bacteria 4172
48 Ga0055531_10048604 3300003794 Bacteria 1142
49 JGI25405J52794_10037446 3300003911 Bacteria 1020
50 Ga0055543_1013689 3300004625 Bacteria 1597
51 Ga0055543_1014300 3300004625 Bacteria 1549
52 Ga0065165_1003666 3300005262 Bacteria 10479
53 Ga0065165_1059322 3300005262 Bacteria 1053
54 Ga0065714_10018495 3300005288 Bacteria 1921
55 Ga0065714_10019306 3300005288 Bacteria 1926
56 Ga0065714_10035760 3300005288 Bacteria 879
57 Ga0065704_10397369 3300005289 Bacteria 756
58 Ga0065715_10026993 3300005293 Bacteria 1372
59 Ga0070658_10361288 3300005327 Bacteria 1244
60 Ga0070676_10049322 3300005328 Bacteria 2464
61 Ga0070683_100071835 3300005329 Bacteria 3230
62 Ga0070690_100103269 3300005330 Bacteria 1892
63 Ga0070690_100782446 3300005330 Bacteria 739
64 Ga0070670_100062923 3300005331 Bacteria 3185
65 Ga0070670_100264917 3300005331 Bacteria 1499
66 Ga0070670_100543968 3300005331 Bacteria 1036
67 Ga0070670_101103482 3300005331 Bacteria 723
68 Ga0068869_100171337 3300005334 Bacteria 1696
69 Ga0068869_100440347 3300005334 Bacteria 1078
70 Ga0068869_100646239 3300005334 Bacteria 897
71 Ga0070680_100536919 3300005336 Bacteria 1002
72 Ga0068868_100041467 3300005338 Bacteria 3586
73 Ga0068868_100263359 3300005338 Bacteria 1454
74 Ga0068868_100307909 3300005338 Bacteria 1347
75 Ga0068868_100309493 3300005338 Bacteria 1343
76 Ga0068868_101366862 3300005338 Bacteria 660
77 Ga0070660_100015341 3300005339 Bacteria 5530
78 Ga0070660_100712685 3300005339 Bacteria 842
79 Ga0070689_100387178 3300005340 Bacteria 1179
80 Ga0070689_100932072 3300005340 Bacteria 770
81 Ga0070691_10142480 3300005341 Bacteria 1223
82 Ga0070691_10180477 3300005341 Bacteria 1099
83 Ga0070661_100042792 3300005344 Bacteria 3307
84 Ga0070661_100175100 3300005344 Bacteria 1631
85 Ga0070668_100939419 3300005347 Bacteria 775
86 Ga0070668_101002817 3300005347 Bacteria 750
87 Ga0070668_101188534 3300005347 Bacteria 691
88 Ga0070668_101335220 3300005347 Bacteria 652
89 Ga0070675_100248897 3300005354 Bacteria 1555
90 Ga0070671_100184336 3300005355 Bacteria 1768
91 Ga0070674_100007000 3300005356 Bacteria 6623
92 Ga0070674_100063913 3300005356 Bacteria 2577
93 Ga0070674_100363996 3300005356 Bacteria 1172
94 Ga0070673_100143175 3300005364 Bacteria 2019
95 Ga0070659_100146861 3300005366 Bacteria 1922
96 Ga0070659_100873808 3300005366 Bacteria 785
97 Ga0070659_101894984 3300005366 Bacteria 535
98 Ga0070667_100024212 3300005367 Bacteria 5042
99 Ga0070667_100068095 3300005367 Bacteria 3028
100 Ga0070667_100173831 3300005367 Bacteria 1902
101 Ga0070667_100190538 3300005367 Bacteria 1817
102 Ga0070667_101252488 3300005367 Bacteria 695
103 Ga0070705_100901573 3300005440 Bacteria 711
104 Ga0070700_100010807 3300005441 Bacteria 5046
105 Ga0070708_100080252 3300005445 Bacteria 2952
106 Ga0070663_100027899 3300005455 Bacteria 3838
107 Ga0070663_100040079 3300005455 Bacteria 3277
108 Ga0070663_100066018 3300005455 Bacteria 2621
109 Ga0070663_100237493 3300005455 Bacteria 1437
110 Ga0070663_100678710 3300005455 Bacteria 874
111 Ga0070678_100292937 3300005456 Bacteria 1380
112 Ga0070678_101450772 3300005456 Bacteria 642
113 Ga0070662_100037931 3300005457 Bacteria 3419
114 Ga0070662_100196401 3300005457 Bacteria 1598
115 Ga0070662_100268139 3300005457 Bacteria 1378
116 Ga0070662_100351551 3300005457 Bacteria 1207
117 Ga0070681_10153378 3300005458 Bacteria 2229
118 Ga0070681_10460834 3300005458 Bacteria 1183
119 Ga0068867_100120843 3300005459 Bacteria 2024
120 Ga0068867_100169163 3300005459 Bacteria 1730
121 Ga0068867_100171802 3300005459 Bacteria 1717
122 Ga0068867_101353323 3300005459 Bacteria 659
123 Ga0070685_10454777 3300005466 Bacteria 898
124 Ga0070706_101008265 3300005467 Bacteria 768
125 Ga0070707_100056627 3300005468 Bacteria 3760
126 Ga0070698_100301976 3300005471 Bacteria 1532
127 Ga0070679_100515236 3300005530 Bacteria 1140
128 Ga0070684_100049588 3300005535 Bacteria 3644
129 Ga0070684_100053370 3300005535 Bacteria 3518
130 Ga0070684_100520395 3300005535 Bacteria 1102
131 Ga0070697_100175946 3300005536 Bacteria 1813
132 Ga0070697_100583683 3300005536 Bacteria 982
133 Ga0068853_100070695 3300005539 Bacteria 3038
134 Ga0068853_100080072 3300005539 Bacteria 2857
135 Ga0068853_100291441 3300005539 Bacteria 1506
136 Ga0070672_100031656 3300005543 Bacteria 3984
137 Ga0070672_100047861 3300005543 Bacteria 3319
138 Ga0070672_100423690 3300005543 Bacteria 1143
139 Ga0070672_100447801 3300005543 Bacteria 1112
140 Ga0070695_101046797 3300005545 Bacteria 666
141 Ga0070665_100145695 3300005548 Bacteria 2371
142 Ga0070665_100164868 3300005548 Bacteria 2218
143 Ga0070665_100313478 3300005548 Bacteria 1573
144 Ga0070665_100904033 3300005548 Bacteria 895
145 Ga0070704_100131020 3300005549 Bacteria 1943
146 Ga0068855_100126649 3300005563 Bacteria 2920
147 Ga0068855_100335750 3300005563 Bacteria 1667
148 Ga0068855_100373254 3300005563 Bacteria 1567
149 Ga0068855_101052839 3300005563 Bacteria 852
150 Ga0070664_100277606 3300005564 Bacteria 1510
151 Ga0070664_100336963 3300005564 Bacteria 1369
152 Ga0068857_100026204 3300005577 Bacteria 5137
153 Ga0068857_100117348 3300005577 Bacteria 2395
154 Ga0068857_100535826 3300005577 Bacteria 1102
155 Ga0068857_101297358 3300005577 Bacteria 706
156 Ga0068854_100190571 3300005578 Bacteria 1606
157 Ga0068854_100209311 3300005578 Bacteria 1537
158 Ga0068854_100701308 3300005578 Bacteria 874
159 Ga0068854_101159319 3300005578 Bacteria 691
160 Ga0068856_100028388 3300005614 Bacteria 5463
161 Ga0068856_100464903 3300005614 Bacteria 1286
162 Ga0068856_100637094 3300005614 Bacteria 1087
163 Ga0068856_100697178 3300005614 Bacteria 1036
164 Ga0070702_100092435 3300005615 Bacteria 1837
165 Ga0068852_100057569 3300005616 Bacteria 3364
166 Ga0068852_100129342 3300005616 Bacteria 2323
167 Ga0068859_101139072 3300005617 Bacteria 858
168 Ga0068866_10069758 3300005718 Bacteria 1853
169 Ga0068861_100003730 3300005719 Bacteria 10161
170 Ga0068861_100265171 3300005719 Bacteria 1472
171 Ga0068861_100540060 3300005719 Bacteria 1060
172 Ga0068851_10011436 3300005834 Bacteria 4163
173 Ga0068870_10417856 3300005840 Bacteria 877
174 Ga0068870_10651351 3300005840 Bacteria 722
175 Ga0068863_100750898 3300005841 Bacteria 971
176 Ga0068858_100329235 3300005842 Bacteria 1461
177 Ga0068858_100689531 3300005842 Bacteria 994
178 Ga0068860_100022098 3300005843 Bacteria 6158
179 Ga0068860_100484213 3300005843 Bacteria 1233
180 Ga0068860_100485726 3300005843 Bacteria 1231
181 Ga0068860_100836486 3300005843 Bacteria 935
182 Ga0068862_100067403 3300005844 Bacteria 3085
183 Ga0068862_100126298 3300005844 Bacteria 2258
184 Ga0068862_100325251 3300005844 Bacteria 1420
185 Ga0068862_100727212 3300005844 Bacteria 964
186 Ga0081455_10002140 3300005937 Bacteria 23551
187 Ga0081455_10011235 3300005937 Bacteria 9010
188 Ga0081455_10020632 3300005937 Bacteria 6197
189 Ga0081455_10038013 3300005937 Bacteria 4265
190 Ga0081538_10064867 3300005981 Bacteria 2062
191 Ga0081540_1002866 3300005983 Bacteria 13942
192 Ga0081540_1018952 3300005983 Bacteria 4203
193 Ga0081540_1021799 3300005983 Bacteria 3801
194 Ga0081540_1028548 3300005983 Bacteria 3131
195 Ga0081540_1043578 3300005983 Bacteria 2300
196 Ga0081540_1072595 3300005983 Bacteria 1585
197 Ga0081540_1079257 3300005983 Bacteria 1485
198 Ga0081540_1197938 3300005983 Bacteria 734
199 Ga0081539_10000157 3300005985 Bacteria 158278
200 Ga0081539_10002599 3300005985 Bacteria 24763
201 Ga0081539_10044556 3300005985 Bacteria 2560
202 Ga0081539_10045305 3300005985 Bacteria 2531
203 Ga0070717_10994929 3300006028 Bacteria 764
204 Ga0075365_10025036 3300006038 Bacteria 3774
205 Ga0075365_10160637 3300006038 Bacteria 1565
206 Ga0075365_10296160 3300006038 Bacteria 1138
207 Ga0075365_10531405 3300006038 Bacteria 832
208 Ga0075368_10067497 3300006042 Bacteria 1440
209 Ga0075363_100133737 3300006048 Bacteria 1392
210 Ga0075363_100224768 3300006048 Bacteria 1076
211 Ga0075363_100368667 3300006048 Bacteria 840
212 Ga0075364_10128844 3300006051 Bacteria 1697
213 Ga0075364_10332774 3300006051 Bacteria 1034
214 Ga0070716_100259333 3300006173 Bacteria 1189
215 Ga0070716_100332648 3300006173 Bacteria 1069
216 Ga0070712_100178805 3300006175 Bacteria 1652
217 Ga0075362_10004627 3300006177 Bacteria 4960
218 Ga0075362_10062462 3300006177 Bacteria 1687
219 Ga0075362_10102779 3300006177 Bacteria 1338
220 Ga0075362_10131650 3300006177 Bacteria 1190
221 Ga0075362_10323123 3300006177 Bacteria 769
222 Ga0075362_10350663 3300006177 Bacteria 739
223 Ga0075367_10005584 3300006178 Bacteria 6264
224 Ga0075367_10017641 3300006178 Bacteria 3922
225 Ga0075367_10034473 3300006178 Bacteria 2924
226 Ga0075367_10046736 3300006178 Bacteria 2544
227 Ga0075367_10216360 3300006178 Bacteria 1199
228 Ga0075369_10000214 3300006186 Bacteria 17133
229 Ga0075369_10024234 3300006186 Bacteria 2513
230 Ga0075369_10201466 3300006186 Bacteria 918
231 Ga0075369_10255381 3300006186 Bacteria 814
232 Ga0075366_10001920 3300006195 Bacteria 10516
233 Ga0075366_10026156 3300006195 Bacteria 3416
234 Ga0075366_10043155 3300006195 Bacteria 2671
235 Ga0075366_10072549 3300006195 Bacteria 2051
236 Ga0075366_10093438 3300006195 Bacteria 1802
237 Ga0075366_10097484 3300006195 Bacteria 1763
238 Ga0075366_10104047 3300006195 Bacteria 1705
239 Ga0075366_10278006 3300006195 Bacteria 1023
240 Ga0075366_10559195 3300006195 Bacteria 708
241 Ga0075366_10670053 3300006195 Bacteria 644
242 Ga0097621_100111264 3300006237 Bacteria 2314
243 Ga0097621_100213605 3300006237 Bacteria 1679
244 Ga0097621_100894611 3300006237 Bacteria 827
245 Ga0097621_101323344 3300006237 Bacteria 681
246 Ga0075370_10012893 3300006353 Bacteria 4429
247 Ga0075370_10020752 3300006353 Bacteria 3594
248 Ga0075370_10021432 3300006353 Bacteria 3540
249 Ga0075370_10027627 3300006353 Bacteria 3150
250 Ga0075370_10034702 3300006353 Bacteria 2828
251 Ga0075370_10050650 3300006353 Bacteria 2355
252 Ga0075370_10061122 3300006353 Bacteria 2146
253 Ga0075370_10074703 3300006353 Bacteria 1943
254 Ga0075370_10093647 3300006353 Bacteria 1734
255 Ga0075370_10235180 3300006353 Bacteria 1084
256 Ga0075370_10308439 3300006353 Bacteria 942
257 Ga0075370_10343251 3300006353 Bacteria 891
258 Ga0068871_100295793 3300006358 Bacteria 1420
259 Ga0068871_100681498 3300006358 Bacteria 940
260 Ga0075428_100074682 3300006844 Bacteria 3703
261 Ga0075428_100271762 3300006844 Bacteria 1824
262 Ga0075434_100066669 3300006871 Bacteria 3586
263 Ga0075434_100502909 3300006871 Bacteria 1233
264 Ga0075434_100757784 3300006871 Bacteria 988
265 Ga0075429_100298751 3300006880 Bacteria 1410
266 Ga0075429_100666500 3300006880 Bacteria 911
267 Ga0068865_100008038 3300006881 Bacteria 6512
268 Ga0068865_100008510 3300006881 Bacteria 6343
269 Ga0068865_100078906 3300006881 Bacteria 2357
270 Ga0097620_100295642 3300006931 Bacteria 1712
271 Ga0097620_101139045 3300006931 Bacteria 858
272 Ga0099794_10025065 3300007265 Bacteria 2743
273 Ga0099795_10011076 3300007788 Bacteria 2680
274 Ga0099795_10011242 3300007788 Bacteria 2669
275 Ga0105251_10112116 3300009011 Bacteria 1242
276 Ga0105251_10170878 3300009011 Bacteria 979
277 Ga0105244_10001808 3300009036 Bacteria 16736
278 Ga0105244_10117530 3300009036 Bacteria 1289
279 Ga0105240_10020996 3300009093 Bacteria 8692
280 Ga0105240_10033754 3300009093 Bacteria 6607
281 Ga0105240_10360192 3300009093 Bacteria 1648
282 Ga0105240_10556453 3300009093 Bacteria 1268
283 Ga0105240_10908124 3300009093 Bacteria 947
284 Ga0105245_10032198 3300009098 Bacteria 4642
285 Ga0105245_11021823 3300009098 Bacteria 871
286 Ga0105247_10159724 3300009101 Bacteria 1491
287 Ga0114129_10172553 3300009147 Bacteria 2947
288 Ga0114129_10749472 3300009147 Bacteria 1250
289 Ga0105243_10004605 3300009148 Bacteria 10871
290 Ga0105243_10123866 3300009148 Bacteria 2184
291 Ga0105243_10217937 3300009148 Bacteria 1685
292 Ga0105243_10521346 3300009148 Bacteria 1130
293 Ga0105241_10269478 3300009174 Bacteria 1450
294 Ga0105241_10355410 3300009174 Bacteria 1273
295 Ga0105241_10957463 3300009174 Bacteria 798
296 Ga0105241_11469211 3300009174 Bacteria 655
297 Ga0105242_10133944 3300009176 Bacteria 2142
298 Ga0105242_11086888 3300009176 Bacteria 813
299 Ga0105248_10137439 3300009177 Bacteria 2757
300 Ga0105248_10616910 3300009177 Bacteria 1224
301 Ga0105237_10146882 3300009545 Bacteria 2353
302 Ga0105237_10231551 3300009545 Bacteria 1848
303 Ga0105237_10284748 3300009545 Bacteria 1655
304 Ga0105237_10466298 3300009545 Bacteria 1269
305 Ga0105238_10047527 3300009551 Bacteria 4326
306 Ga0105238_10053482 3300009551 Bacteria 4057
307 Ga0105238_10133367 3300009551 Bacteria 2462
308 Ga0105238_10248355 3300009551 Bacteria 1757
309 Ga0105249_10197882 3300009553 Bacteria 1965
310 Ga0105249_10259582 3300009553 Bacteria 1726
311 Ga0105249_10260782 3300009553 Bacteria 1722
312 Ga0099796_10014598 3300010159 Bacteria 2273
313 Ga0099796_10133414 3300010159 Bacteria 965
314 Ga0105239_10096774 3300010375 Bacteria 3261
315 Ga0105239_10257650 3300010375 Bacteria 1960
316 Ga0105239_10290619 3300010375 Bacteria 1841
317 Ga0105239_11165572 3300010375 Bacteria 888
318 Ga0105246_10312740 3300011119 Bacteria 1273
319 Ga0105246_10898104 3300011119 Bacteria 794
320 Ga0105246_11046276 3300011119 Bacteria 742
321 Ga0157322_1023870 3300012490 Bacteria 609
322 Ga0157323_1012656 3300012495 Bacteria 698
323 Ga0157339_1005354 3300012505 Bacteria 1010
324 Ga0157342_1021807 3300012507 Bacteria 750
325 Ga0157316_1010668 3300012510 Bacteria 847
326 Ga0157373_10040974 3300013100 Bacteria 3313
327 Ga0157370_10018806 3300013104 Bacteria 6946
328 Ga0157370_10225228 3300013104 Bacteria 1736
329 Ga0157370_10393617 3300013104 Bacteria 1276
330 Ga0157369_10005188 3300013105 Bacteria 15228
331 Ga0157369_10067774 3300013105 Bacteria 3835
332 Ga0157369_10113059 3300013105 Bacteria 2885
333 Ga0157369_10319087 3300013105 Bacteria 1615
334 Ga0157374_10439352 3300013296 Bacteria 1305
335 Ga0157378_10181786 3300013297 Bacteria 1979
336 Ga0157378_10300338 3300013297 Bacteria 1554
337 Ga0163162_10005487 3300013306 Bacteria 12255
338 Ga0163162_10377705 3300013306 Bacteria 1550
339 Ga0163162_10426928 3300013306 Bacteria 1458
340 Ga0163162_10438690 3300013306 Bacteria 1438
341 Ga0163162_11559706 3300013306 Bacteria 753
342 Ga0157372_10060142 3300013307 Bacteria 4251
343 Ga0157372_10082216 3300013307 Bacteria 3646
344 Ga0157372_11303363 3300013307 Bacteria 838
345 Ga0157375_10358940 3300013308 Bacteria 1623
346 Ga0157375_10361348 3300013308 Bacteria 1618
347 Ga0157375_10586040 3300013308 Bacteria 1275
348 Ga0163163_10010769 3300014325 Bacteria 8250
349 Ga0163163_10334055 3300014325 Bacteria 1570
350 Ga0163163_10371961 3300014325 Bacteria 1486
351 Ga0157380_10135348 3300014326 Bacteria 2108
352 Ga0182008_10001754 3300014497 Bacteria 14232
353 Ga0182008_10001779 3300014497 Bacteria 14103
354 Ga0182008_10301146 3300014497 Bacteria 839
355 Ga0157377_10302965 3300014745 Bacteria 1055
356 Ga0157379_10067835 3300014968 Bacteria 3189
357 Ga0157379_10155995 3300014968 Bacteria 2059
358 Ga0157379_10215452 3300014968 Bacteria 1739
359 Ga0157376_10003714 3300014969 Bacteria 10547
360 Ga0157376_10491700 3300014969 Bacteria 1204
361 Ga0157376_10849912 3300014969 Bacteria 928
362 Ga0182006_1002899 3300015261 Bacteria 9108
363 Ga0182006_1028074 3300015261 Bacteria 2291
364 Ga0182007_10002457 3300015262 Bacteria 9203
365 Ga0182007_10003387 3300015262 Bacteria 7509
366 Ga0182005_1048462 3300015265 Bacteria 1154
367 Ga0183362_10001 3300015683 Bacteria 2046624
368 Ga0163161_10000554 3300017792 Bacteria 30160
369 Ga0163161_10043568 3300017792 Bacteria 3231
370 Ga0163161_10047639 3300017792 Bacteria 3094
371 Ga0206356_11249118 3300020070 Bacteria 1381
372 Ga0209436_101997 3300025208 Bacteria 6484
373 Ga0209672_102600 3300025228 Bacteria 4280
374 Ga0209147_100818 3300025229 Bacteria 14816
375 Ga0209258_100018 3300025242 Bacteria 567561
376 Ga0207425_1000579 3300025245 Bacteria 21473
377 Ga0209148_1000030 3300025254 Bacteria 567582
378 Ga0209129_1000114 3300025258 Bacteria 141791
379 Ga0209129_1001990 3300025258 Bacteria 10628
380 Ga0209129_1002798 3300025258 Bacteria 8119
381 Ga0209565_1001445 3300025263 Bacteria 10493
382 Ga0209565_1003173 3300025263 Bacteria 5462
383 Ga0209673_1000417 3300025273 Bacteria 74749
384 Ga0209673_1003002 3300025273 Bacteria 10493
385 Ga0209130_1000997 3300025284 Bacteria 22052
386 Ga0209130_1001138 3300025284 Bacteria 19478
387 Ga0209130_1002198 3300025284 Bacteria 10256
388 Ga0209130_1004584 3300025284 Bacteria 5183
389 Ga0209675_1009639 3300025291 Bacteria 3389
390 Ga0209675_1031059 3300025291 Bacteria 1266
391 Ga0209676_1000004 3300025292 Bacteria 1138360
392 Ga0209676_1000538 3300025292 Bacteria 58756
393 Ga0209676_1013442 3300025292 Bacteria 3146
394 Ga0209676_1031154 3300025292 Bacteria 1621
395 Ga0209025_1000343 3300025294 Bacteria 101870
396 Ga0209025_1004621 3300025294 Bacteria 11781
397 Ga0209025_1011201 3300025294 Bacteria 5949
398 Ga0209025_1043412 3300025294 Bacteria 1895
399 Ga0209564_1000070 3300025295 Bacteria 303126
400 Ga0209564_1000295 3300025295 Bacteria 100738
401 Ga0209564_1025311 3300025295 Bacteria 2001
402 Ga0209758_1000180 3300025297 Bacteria 141791
403 Ga0209758_1005089 3300025297 Bacteria 10410
404 Ga0209758_1020867 3300025297 Bacteria 3078
405 Ga0209758_1044076 3300025297 Bacteria 1636
406 Ga0209050_1000002 3300025298 Bacteria 1792849
407 Ga0209050_1007320 3300025298 Bacteria 6225
408 Ga0209050_1015534 3300025298 Bacteria 3188
409 Ga0209256_1000047 3300025299 Bacteria 314709
410 Ga0209256_1000157 3300025299 Bacteria 141791
411 Ga0207426_1000184 3300025302 Bacteria 154290
412 Ga0207426_1000204 3300025302 Bacteria 141791
413 Ga0209051_1000002 3300025303 Bacteria 1631846
414 Ga0209051_1000820 3300025303 Bacteria 32203
415 Ga0209051_1003554 3300025303 Bacteria 10146
416 Ga0209051_1016772 3300025303 Bacteria 3295
417 Ga0209257_1000002 3300025304 Bacteria 1767052
418 Ga0209257_1000096 3300025304 Bacteria 259390
419 Ga0209257_1000149 3300025304 Bacteria 192835
420 Ga0209257_1003517 3300025304 Bacteria 13328
421 Ga0209257_1011042 3300025304 Bacteria 4430
422 Ga0207655_1002512 3300025728 Bacteria 14781
423 Ga0207655_1135937 3300025728 Bacteria 795
424 Ga0207653_10028276 3300025885 Bacteria 1803
425 Ga0207682_10174381 3300025893 Bacteria 979
426 Ga0207642_10077529 3300025899 Bacteria 1603
427 Ga0207710_10082799 3300025900 Bacteria 1491
428 Ga0207688_10046362 3300025901 Bacteria 2427
429 Ga0207688_10433666 3300025901 Bacteria 818
430 Ga0207680_10521540 3300025903 Bacteria 847
431 Ga0207647_10224956 3300025904 Bacteria 1081
432 Ga0207645_10162232 3300025907 Bacteria 1463
433 Ga0207643_10341290 3300025908 Bacteria 939
434 Ga0207705_10018984 3300025909 Bacteria 4916
435 Ga0207705_10293441 3300025909 Bacteria 1246
436 Ga0207705_10445903 3300025909 Bacteria 1003
437 Ga0207684_10008664 3300025910 Bacteria 9031
438 Ga0207684_10880578 3300025910 Bacteria 754
439 Ga0207654_10590207 3300025911 Bacteria 792
440 Ga0207707_10000613 3300025912 Bacteria 35676
441 Ga0207695_10224579 3300025913 Bacteria 1785
442 Ga0207695_10231748 3300025913 Bacteria 1751
443 Ga0207695_10282140 3300025913 Bacteria 1555
444 Ga0207695_10439023 3300025913 Bacteria 1189
445 Ga0207671_10021771 3300025914 Bacteria 4858
446 Ga0207671_10087793 3300025914 Bacteria 2339
447 Ga0207671_10532643 3300025914 Bacteria 936
448 Ga0207663_10105327 3300025916 Bacteria 1903
449 Ga0207660_10015097 3300025917 Bacteria 5092
450 Ga0207660_10608673 3300025917 Bacteria 890
451 Ga0207657_10021660 3300025919 Bacteria 6041
452 Ga0207657_10513331 3300025919 Bacteria 938
453 Ga0207649_10090170 3300025920 Bacteria 2006
454 Ga0207649_10164082 3300025920 Bacteria 1542
455 Ga0207649_10711924 3300025920 Bacteria 779
456 Ga0207652_10023997 3300025921 Bacteria 5058
457 Ga0207652_10119188 3300025921 Bacteria 2347
458 Ga0207646_10099838 3300025922 Bacteria 2601
459 Ga0207681_11373958 3300025923 Bacteria 593
460 Ga0207694_10046553 3300025924 Bacteria 3353
461 Ga0207694_10077217 3300025924 Bacteria 2609
462 Ga0207694_10221004 3300025924 Bacteria 1545
463 Ga0207694_10264525 3300025924 Bacteria 1409
464 Ga0207694_10578726 3300025924 Bacteria 943
465 Ga0207650_10343713 3300025925 Bacteria 1226
466 Ga0207650_10424857 3300025925 Bacteria 1103
467 Ga0207659_10530613 3300025926 Bacteria 999
468 Ga0207659_10694060 3300025926 Bacteria 871
469 Ga0207687_10084331 3300025927 Bacteria 2303
470 Ga0207644_10052900 3300025931 Bacteria 2920
471 Ga0207690_10109417 3300025932 Bacteria 1988
472 Ga0207690_10259522 3300025932 Bacteria 1346
473 Ga0207690_10377018 3300025932 Bacteria 1127
474 Ga0207690_10536464 3300025932 Bacteria 950
475 Ga0207690_10719922 3300025932 Bacteria 821
476 Ga0207690_10825397 3300025932 Bacteria 767
477 Ga0207706_10113136 3300025933 Bacteria 2387
478 Ga0207706_10288281 3300025933 Bacteria 1431
479 Ga0207706_11357269 3300025933 Bacteria 585
480 Ga0207686_10085193 3300025934 Bacteria 2072
481 Ga0207686_10883532 3300025934 Bacteria 720
482 Ga0207709_10012501 3300025935 Bacteria 4675
483 Ga0207709_10102910 3300025935 Bacteria 1892
484 Ga0207670_10261547 3300025936 Bacteria 1342
485 Ga0207670_10820931 3300025936 Bacteria 775
486 Ga0207669_10039682 3300025937 Bacteria 2723
487 Ga0207669_10530855 3300025937 Bacteria 946
488 Ga0207704_10026450 3300025938 Bacteria 3184
489 Ga0207704_10103145 3300025938 Bacteria 1907
490 Ga0207704_10182716 3300025938 Bacteria 1517
491 Ga0207691_10586937 3300025940 Bacteria 944
492 Ga0207691_10871044 3300025940 Bacteria 755
493 Ga0207689_10111455 3300025942 Bacteria 2249
494 Ga0207689_10267866 3300025942 Bacteria 1414
495 Ga0207661_10039366 3300025944 Bacteria 3710
496 Ga0207661_10279575 3300025944 Bacteria 1491
497 Ga0207679_10037172 3300025945 Bacteria 3459
498 Ga0207679_10058416 3300025945 Bacteria 2858
499 Ga0207679_10333550 3300025945 Bacteria 1317
500 Ga0207667_10028504 3300025949 Bacteria 6065
501 Ga0207667_10109036 3300025949 Bacteria 2856
502 Ga0207667_10444399 3300025949 Bacteria 1318
503 Ga0207651_10102168 3300025960 Bacteria 2130
504 Ga0207651_10359083 3300025960 Bacteria 1229
505 Ga0207712_10137505 3300025961 Bacteria 1870
506 Ga0207712_10262372 3300025961 Bacteria 1402
507 Ga0207712_10265375 3300025961 Bacteria 1394
508 Ga0207668_10025674 3300025972 Bacteria 3815
509 Ga0207668_10269689 3300025972 Bacteria 1391
510 Ga0207668_10717025 3300025972 Bacteria 880
511 Ga0207640_10039886 3300025981 Bacteria 2975
512 Ga0207640_10156521 3300025981 Bacteria 1680
513 Ga0207640_10234272 3300025981 Bacteria 1414
514 Ga0207640_10637684 3300025981 Bacteria 906
515 Ga0207658_10088692 3300025986 Bacteria 2392
516 Ga0207658_10239814 3300025986 Bacteria 1535
517 Ga0207658_10254518 3300025986 Bacteria 1494
518 Ga0207658_10602331 3300025986 Bacteria 987
519 Ga0207658_10804100 3300025986 Bacteria 854
520 Ga0207677_10037687 3300026023 Bacteria 3162
521 Ga0207677_10120554 3300026023 Bacteria 1972
522 Ga0207703_10329839 3300026035 Bacteria 1399
523 Ga0207703_10559626 3300026035 Bacteria 1079
524 Ga0207703_10572846 3300026035 Bacteria 1066
525 Ga0207639_10018068 3300026041 Bacteria 5005
526 Ga0207639_10056817 3300026041 Bacteria 3001
527 Ga0207639_10119099 3300026041 Bacteria 2166
528 Ga0207678_10051459 3300026067 Bacteria 3556
529 Ga0207678_10063191 3300026067 Bacteria 3181
530 Ga0207678_10084486 3300026067 Bacteria 2715
531 Ga0207678_10085166 3300026067 Bacteria 2702
532 Ga0207678_10127217 3300026067 Bacteria 2173
533 Ga0207678_10350281 3300026067 Bacteria 1273
534 Ga0207708_10017331 3300026075 Bacteria 5421
535 Ga0207708_10085748 3300026075 Bacteria 2423
536 Ga0207702_11423424 3300026078 Bacteria 687
537 Ga0207641_10614958 3300026088 Bacteria 1065
538 Ga0207641_10622035 3300026088 Bacteria 1059
539 Ga0207641_10774829 3300026088 Bacteria 948
540 Ga0207648_10006213 3300026089 Bacteria 11904
541 Ga0207648_10059935 3300026089 Bacteria 3319
542 Ga0207648_10126250 3300026089 Bacteria 2250
543 Ga0207648_10218714 3300026089 Bacteria 1693
544 Ga0207676_10037774 3300026095 Bacteria 3682
545 Ga0207674_10102413 3300026116 Bacteria 2843
546 Ga0207674_10135758 3300026116 Bacteria 2422
547 Ga0207674_10138132 3300026116 Bacteria 2398
548 Ga0207674_10270306 3300026116 Bacteria 1647
549 Ga0207674_10424457 3300026116 Bacteria 1285
550 Ga0207674_10618827 3300026116 Bacteria 1046
551 Ga0207675_100015760 3300026118 Bacteria 7048
552 Ga0207675_100148877 3300026118 Bacteria 2227
553 Ga0207675_100294218 3300026118 Bacteria 1580
554 Ga0207675_100983785 3300026118 Bacteria 862
555 Ga0207683_10070377 3300026121 Bacteria 3091
556 Ga0207683_10154825 3300026121 Bacteria 2070
557 Ga0207683_10362082 3300026121 Bacteria 1332
558 Ga0207683_10454574 3300026121 Bacteria 1181
559 Ga0207698_10171166 3300026142 Bacteria 1912
560 Ga0207698_10348204 3300026142 Bacteria 1398
561 Ga0207698_11204436 3300026142 Bacteria 771
562 Ga0209588_1021371 3300027671 Bacteria 2033
563 Ga0268266_10003191 3300028379 Bacteria 16594
564 Ga0268266_10018212 3300028379 Bacteria 5987
565 Ga0268266_10088853 3300028379 Bacteria 2704
566 Ga0268266_10299308 3300028379 Bacteria 1500
567 Ga0268266_10679708 3300028379 Bacteria 991
568 Ga0268266_10695368 3300028379 Bacteria 980
569 Ga0268265_10119385 3300028380 Bacteria 2169
570 Ga0268265_10448564 3300028380 Bacteria 1204
571 Ga0268265_10644054 3300028380 Bacteria 1018
572 Ga0268265_10823801 3300028380 Bacteria 906
573 Ga0268264_10650633 3300028381 Bacteria 1043
574 Ga0265337_1016314 3300028556 Bacteria 2404
575 Ga0307517_10010277 3300028786 Bacteria 13120
576 Ga0307517_10248972 3300028786 Bacteria 1045
577 Ga0307515_10351259 3300028794 Bacteria 1121
578 Ga0307515_10428172 3300028794 Bacteria 942
579 Ga0307515_10499810 3300028794 Bacteria 827
580 Ga0265338_10159825 3300028800 Bacteria 1741
581 Ga0307512_10251225 3300030522 Bacteria 881
582 Ga0316182_1331932 3300030745 Bacteria 2043
583 Ga0265330_10022510 3300031235 Bacteria 2867
584 Ga0265325_10027929 3300031241 Bacteria 3046
585 Ga0265325_10031667 3300031241 Bacteria 2828
586 Ga0265325_10294432 3300031241 Bacteria 726
587 Ga0265339_10009653 3300031249 Bacteria 6042
588 Ga0265327_10000851 3300031251 Bacteria 45640
589 Ga0265316_10037388 3300031344 Bacteria 3918
590 Ga0265316_10081542 3300031344 Bacteria 2480
591 Ga0265316_10090976 3300031344 Bacteria 2328
592 Ga0307513_10134134 3300031456 Bacteria 2415
593 Ga0307513_10270685 3300031456 Bacteria 1482
594 Ga0307513_10400042 3300031456 Bacteria 1108
595 Ga0307509_10086316 3300031507 Bacteria 3227
596 Ga0307408_100426605 3300031548 Bacteria 1145
597 Ga0265313_10000062 3300031595 Bacteria 106169
598 Ga0265313_10001372 3300031595 Bacteria 22859
599 Ga0265313_10024898 3300031595 Bacteria 3185
600 Ga0265313_10061361 3300031595 Bacteria 1760
601 Ga0265313_10067779 3300031595 Bacteria 1650
602 Ga0307508_10357034 3300031616 Bacteria 1053
603 Ga0307514_10485766 3300031649 Bacteria 593
604 Ga0265314_10001182 3300031711 Bacteria 29977
605 Ga0265314_10003622 3300031711 Bacteria 14859
606 Ga0265314_10281468 3300031711 Bacteria 941
607 Ga0307516_10001245 3300031730 Bacteria 35441
608 Ga0307516_10044179 3300031730 Bacteria 4410
609 Ga0307516_10175345 3300031730 Bacteria 1881
610 Ga0307516_10369622 3300031730 Bacteria 1097
611 Ga0307516_10880179 3300031730 Bacteria 561
612 Ga0307405_10245328 3300031731 Bacteria 1329
613 Ga0307410_10520184 3300031852 Bacteria 982
614 Ga0307410_11448420 3300031852 Bacteria 604
615 Ga0307406_10437707 3300031901 Bacteria 1046
616 Ga0307406_10445914 3300031901 Bacteria 1037
617 Ga0307406_10880113 3300031901 Bacteria 761
618 Ga0307407_10083432 3300031903 Bacteria 1939
619 Ga0307412_10195692 3300031911 Bacteria 1532
620 Ga0307412_10550504 3300031911 Bacteria 969
621 Ga0307412_11326897 3300031911 Bacteria 648
622 Ga0307416_100028565 3300032002 Bacteria 4150
623 Ga0307416_100287321 3300032002 Bacteria 1626
624 Ga0307416_100850581 3300032002 Bacteria 1010
625 Ga0307416_101678654 3300032002 Bacteria 740
626 Ga0307415_100637705 3300032126 Bacteria 953
627 Ga0307510_10182663 3300033180 Bacteria 1658
628 Ga0373926_0037109 3300035083 Bacteria 1733
629 Ga0373936_0133317 3300035113 Bacteria 1069
630 Ga0373939_0001277 3300035114 Bacteria 6131
631 Ga0373957_0024419 3300035120 Bacteria 2171
632 Ga0373943_0073263 3300035170 Bacteria 1739
633 Ga0373943_0196570 3300035170 Bacteria 1115
634 Ga0373955_0030881 3300035172 Bacteria 2802
635 Ga0373931_0217856 3300035691 Bacteria 1148
636 Ga0373931_0248904 3300035691 Bacteria 1080
637 Ga0373927_0005689 3300035695 Bacteria 8558
638 Ga0373927_0028642 3300035695 Bacteria 3633
639 Ga0373927_0382120 3300035695 Bacteria 929
640 Ga0373927_0620632 3300035695 Bacteria 715
641 Ga0373933_0219872 3300035724 Bacteria 1218
642 Ga0373947_0017691 3300035725 Bacteria 4101
643 Ga0373947_0172392 3300035725 Bacteria 1405
644 Ga0373947_0199112 3300035725 Bacteria 1310
645 Ga0373947_0409925 3300035725 Bacteria 915
646 Ga0373937_0002154 3300036401 Bacteria 16484
647 Ga0373925_0005806 3300037068 Bacteria 9168
648 Ga0373925_0329269 3300037068 Bacteria 1237
649 Ga0373925_1123280 3300037068 Bacteria 646
650 Ga0395899_0002741 3300037312 Bacteria 14203
651 Ga0395899_0038874 3300037312 Bacteria 3563
652 Ga0395899_0060710 3300037312 Bacteria 2785
653 Ga0395900_0009354 3300037418 Bacteria 10048
654 Ga0395900_0056282 3300037418 Bacteria 4048
655 Ga0395900_0107563 3300037418 Bacteria 2865
656 Ga0395900_0890065 3300037418 Bacteria 814
657 Ga0395898_0148039 3300037466 Bacteria 2247
658 Ga0395905_0039610 3300037471 Bacteria 4421
659 Ga0395905_0413336 3300037471 Bacteria 1244
660 Ga0395905_0528220 3300037471 Bacteria 1080
661 Ga0395901_0042375 3300038443 Bacteria 4719
662 Ga0395901_0065280 3300038443 Bacteria 3789
663 Ga0395901_0114966 3300038443 Bacteria 2826
664 Ga0395901_0487733 3300038443 Bacteria 1256
665 Ga0395901_0851689 3300038443 Bacteria 897
666 Ga0436365_0805345 3300039437 Bacteria 806
667 Ga0436360_0035685 3300039438 Bacteria 1004
668 Ga0439465_0142733 3300041413 Bacteria 851
669 Ga0451795_0193704 3300041456 Bacteria 764
670 Ga0451807_0994696 3300041486 Bacteria 835
671 Ga0451841_0333288 3300041498 Bacteria 1100
672 Ga0451851_0341021 3300041507 Bacteria 765
673 Ga0439463_100494 3300042016 Bacteria 746
674 Ga0439458_0005013 3300042157 Bacteria 2995
675 Ga0451577_0111006 3300042876 Bacteria 2453
676 Ga0451577_0474877 3300042876 Bacteria 1135
677 Ga0466961_0269194 3300044693 Bacteria 1044
678 Ga0453684_0003325 3300044712 Bacteria 36528
679 Ga0453684_0755369 3300044712 Bacteria 1052
680 Ga0466968_0081706 3300044735 Bacteria 1421
681 Ga0466957_0452003 3300044842 Bacteria 885
682 Ga0466959_0359736 3300045049 Bacteria 992
683 Ga0451576_0302630 3300045051 Bacteria 1673
684 Ga0495617_116035 3300046452 Bacteria 864
685 Ga0495627_004050 3300046453 Bacteria 6247
686 Ga0495627_031474 3300046453 Bacteria 1675
687 Ga0495592_0001467 3300046454 Bacteria 16409
688 Ga0495592_0645095 3300046454 Bacteria 642
689 Ga0495603_0125073 3300046455 Bacteria 1498
690 Ga0495603_0274344 3300046455 Bacteria 970
691 Ga0495603_0748615 3300046455 Bacteria 558
692 Ga0495590_0015626 3300046457 Bacteria 2751
693 Ga0495590_0049279 3300046457 Bacteria 1470
694 Ga0495629_0070519 3300046459 Bacteria 2438
695 Ga0495629_0204200 3300046459 Bacteria 1366
696 Ga0495629_0500577 3300046459 Bacteria 819
697 Ga0495638_0024829 3300046460 Bacteria 3902
698 Ga0495641_0209408 3300046461 Bacteria 874
699 Ga0495641_0328875 3300046461 Bacteria 690
700 Ga0495651_0054642 3300046462 Bacteria 3070
701 Ga0495651_0156551 3300046462 Bacteria 1637
702 Ga0495653_0325123 3300046463 Bacteria 996
703 Ga0495650_0021840 3300046471 Bacteria 3080
704 Ga0495650_0053026 3300046471 Bacteria 1662
705 Ga0495650_0079742 3300046471 Bacteria 1265
706 Ga0495580_0276651 3300046472 Bacteria 1146
707 Ga0495580_0490489 3300046472 Bacteria 821
708 Ga0495582_0077374 3300046473 Bacteria 1845
709 Ga0495605_0204643 3300046474 Bacteria 859
710 Ga0495639_0008572 3300046475 Bacteria 4385
711 Ga0495639_0320209 3300046475 Bacteria 775
712 Ga0495585_0143880 3300046492 Bacteria 1247
713 Ga0495594_0206013 3300046499 Bacteria 1121
714 Ga0495594_0219945 3300046499 Bacteria 1083
715 Ga0495607_0055080 3300046501 Bacteria 2289
716 Ga0495606_0011174 3300046507 Bacteria 7350
717 Ga0495606_0114549 3300046507 Bacteria 1622
718 Ga0495606_0314392 3300046507 Bacteria 844
719 Ga0495610_0099080 3300046512 Bacteria 1308
720 Ga0495616_0005361 3300046513 Bacteria 7910
721 Ga0495620_0039477 3300046515 Bacteria 2085
722 Ga0495620_0145618 3300046515 Bacteria 925
723 Ga0495628_0003085 3300046516 Bacteria 14924
724 Ga0495628_0233259 3300046516 Bacteria 1379
725 Ga0495630_0096508 3300046517 Bacteria 2235
726 Ga0495630_0406428 3300046517 Bacteria 1043
727 Ga0495631_0000271 3300046518 Bacteria 36193
728 Ga0495632_0002822 3300046519 Bacteria 12862
729 Ga0495632_0074542 3300046519 Bacteria 1625
730 Ga0495644_0034321 3300046523 Bacteria 1915
731 Ga0495648_0328056 3300046524 Bacteria 707
732 Ga0495663_0013380 3300046525 Bacteria 2294
733 Ga0495663_0301502 3300046525 Bacteria 577
734 Ga0495666_0301960 3300046526 Bacteria 724
735 Ga0495642_0069068 3300046528 Bacteria 1475
736 Ga0495652_0002252 3300046529 Bacteria 20162
737 Ga0495654_0012115 3300046530 Bacteria 4642
738 Ga0495654_0204965 3300046530 Bacteria 842
739 Ga0495654_0270648 3300046530 Bacteria 702
740 Ga0495640_0271894 3300046533 Bacteria 1057
741 Ga0495586_0055750 3300046535 Bacteria 2142
742 Ga0495587_0401068 3300046536 Bacteria 762
743 Ga0495598_0116840 3300046537 Bacteria 900
744 Ga0495609_0043971 3300046538 Bacteria 2004
745 Ga0495609_0255209 3300046538 Bacteria 721
746 Ga0495621_0025169 3300046539 Bacteria 1997
747 Ga0495621_0252931 3300046539 Bacteria 720
748 Ga0495621_0385596 3300046539 Bacteria 592
749 Ga0495597_0034401 3300046542 Bacteria 2290
750 Ga0495645_0000223 3300046543 Bacteria 40729
751 Ga0495645_0079139 3300046543 Bacteria 2362
752 Ga0495622_0095768 3300046557 Bacteria 1362
753 Ga0495622_0163802 3300046557 Bacteria 1002
754 Ga0495622_0337975 3300046557 Bacteria 653
755 Ga0495633_0252472 3300046558 Bacteria 805
756 Ga0495633_0271883 3300046558 Bacteria 771
757 Ga0495667_0080383 3300046559 Bacteria 2119
758 Ga0495656_0006560 3300046615 Bacteria 4088
759 Ga0495656_0007454 3300046615 Bacteria 3865
760 Ga0495656_0066211 3300046615 Bacteria 1591
761 Ga0495656_0583482 3300046615 Bacteria 597
762 Ga0495668_0043443 3300046616 Bacteria 2500
763 Ga0495668_0134784 3300046616 Bacteria 1351
764 Ga0495668_0280810 3300046616 Bacteria 912
765 Ga0495668_0340212 3300046616 Bacteria 823
766 Ga0495634_0143811 3300046642 Bacteria 1512
767 Ga0495634_0374191 3300046642 Bacteria 850
768 Ga0495611_0171757 3300046648 Bacteria 1013
769 Ga0495625_0104617 3300046660 Bacteria 1940
770 Ga0495625_0148767 3300046660 Bacteria 1575
771 Ga0495625_0336795 3300046660 Bacteria 957
772 Ga0495625_0377979 3300046660 Bacteria 889
773 Ga0495635_0087265 3300046663 Bacteria 2135
774 Ga0495659_0009998 3300046664 Bacteria 3036
775 Ga0495659_0277614 3300046664 Bacteria 703
776 Ga0495661_0103581 3300046665 Bacteria 1597
777 Ga0495661_0297927 3300046665 Bacteria 808
778 Ga0495588_0178527 3300046674 Bacteria 1122
779 Ga0495588_0203667 3300046674 Bacteria 1045
780 Ga0495588_0297053 3300046674 Bacteria 851
781 Ga0495657_0403820 3300046675 Bacteria 804
782 Ga0495599_0001359 3300046678 Bacteria 13977
783 Ga0495623_0006317 3300046679 Bacteria 7704
784 Ga0495646_0461471 3300046680 Bacteria 655
785 Ga0495658_0232273 3300046683 Bacteria 1157
786 Ga0495658_0385180 3300046683 Bacteria 893
787 Ga0495669_0220294 3300046684 Bacteria 909
788 Ga0495669_0279449 3300046684 Bacteria 803
789 Ga0495613_0150544 3300046689 Bacteria 1660
790 Ga0495613_0337159 3300046689 Bacteria 1038
791 Ga0495624_0179967 3300046690 Bacteria 1289
792 Ga0495670_0039435 3300046691 Bacteria 2356
793 Ga0495670_0115351 3300046691 Bacteria 1392
794 Ga0495670_0185694 3300046691 Bacteria 1099
795 Ga0495671_0001942 3300046692 Bacteria 13261
796 Ga0495649_0003779 3300046694 Bacteria 10042
797 Ga0495589_0188912 3300046794 Bacteria 975
798 Ga0495660_0011983 3300046810 Bacteria 5029
799 Ga0495660_0069559 3300046810 Bacteria 1871
800 Ga0495581_0477963 3300047315 Bacteria 725
801 Ga0495604_0001128 3300047317 Bacteria 22177
802 Ga0495636_0051155 3300047318 Bacteria 1731
803 Ga0495636_0065206 3300047318 Bacteria 1547
804 Ga0495674_0668443 3300047319 Bacteria 818
805 Ga0495672_0014087 3300047320 Bacteria 5489
806 Ga0495676_0059100 3300047321 Bacteria 3013
807 Ga0495676_0324590 3300047321 Bacteria 1033
808 Ga0495687_000454 3300047443 Bacteria 50500
809 Ga0495687_003986 3300047443 Bacteria 10282
810 Ga0495687_007598 3300047443 Bacteria 6350
811 Ga0495675_0577708 3300047444 Bacteria 639
812 Ga0495677_0109037 3300047445 Bacteria 1052
813 Ga0495673_0145614 3300047469 Bacteria 920
814 Ga0495681_0144134 3300047470 Bacteria 1004
815 Ga0495681_0166736 3300047470 Bacteria 914
816 Ga0495686_0096145 3300047472 Bacteria 1793
817 Ga0495686_0247005 3300047472 Bacteria 1004
818 Ga0495593_0019013 3300047673 Bacteria 3855
819 Ga0495593_0072165 3300047673 Bacteria 1793
820 Ga0495602_0471732 3300048088 Bacteria 882
821 Ga0495614_0062248 3300048089 Bacteria 1603
822 Ga0495615_0000971 3300048090 Bacteria 4074
823 Ga0495615_0038722 3300048090 Bacteria 1180
824 Ga0496100_0021706 3300048903 Bacteria 3872
825 Ga0496101_0006611 3300048904 Bacteria 7470
826 Ga0496101_0014125 3300048904 Bacteria 5362
827 Ga0496101_0372094 3300048904 Bacteria 1124
828 Ga0496101_1153634 3300048904 Bacteria 608
829 Ga0496102_0018035 3300048905 Bacteria 6194
830 Ga0496102_0144286 3300048905 Bacteria 2233
831 Ga0496102_0368963 3300048905 Bacteria 1351
832 Ga0496102_0426939 3300048905 Bacteria 1245
833 Ga0496102_0440083 3300048905 Bacteria 1223
834 Ga0496103_0050404 3300048906 Bacteria 2575
835 Ga0496103_0395196 3300048906 Bacteria 888
836 Ga0496104_0000537 3300048907 Bacteria 32588
837 Ga0496104_0004825 3300048907 Bacteria 11751
838 Ga0496104_0011832 3300048907 Bacteria 7830
839 Ga0496104_0636087 3300048907 Bacteria 976
840 Ga0496105_0014924 3300048908 Bacteria 6184
841 Ga0496105_0040565 3300048908 Bacteria 3838
842 Ga0496105_0056143 3300048908 Bacteria 3251
843 Ga0496106_0226243 3300048909 Bacteria 1492
844 Ga0496106_0284724 3300048909 Bacteria 1324
845 Ga0496106_0312225 3300048909 Bacteria 1261
846 Ga0496107_0039012 3300048910 Bacteria 3407
847 Ga0496107_0293698 3300048910 Bacteria 1210
848 Ga0496107_0850197 3300048910 Bacteria 667
849 Ga0496108_0066093 3300048911 Bacteria 3049
850 Ga0496108_0081616 3300048911 Bacteria 2740
851 Ga0496108_0150792 3300048911 Bacteria 2006
852 Ga0496108_0861720 3300048911 Bacteria 779
853 Ga0496108_1474605 3300048911 Bacteria 567
854 Ga0496109_0087720 3300048912 Bacteria 2874
855 Ga0496109_0391540 3300048912 Bacteria 1313
856 Ga0496110_0058046 3300048913 Bacteria 3408
857 Ga0496110_0400131 3300048913 Bacteria 1252
858 Ga0496110_0490069 3300048913 Bacteria 1119
859 Ga0496110_0496476 3300048913 Bacteria 1111
860 Ga0496111_0036982 3300048914 Bacteria 3492
861 Ga0496111_0045794 3300048914 Bacteria 3148
862 Ga0496111_0112765 3300048914 Bacteria 2003
863 Ga0496111_0201283 3300048914 Bacteria 1480
864 Ga0496111_0272830 3300048914 Bacteria 1255
865 Ga0496111_0433882 3300048914 Bacteria 970
866 Ga0496112_0000035 3300048915 Bacteria 106983
867 Ga0496112_0296964 3300048915 Bacteria 1561
868 Ga0496112_0686115 3300048915 Bacteria 952
869 Ga0496112_0862064 3300048915 Bacteria 829
870 Ga0496113_0045494 3300048916 Bacteria 3256
871 Ga0496114_0170792 3300048917 Bacteria 1895
872 Ga0496114_0391617 3300048917 Bacteria 1230
873 Ga0496114_0507988 3300048917 Bacteria 1066
874 Ga0496115_0265483 3300048918 Bacteria 1411
875 Ga0496115_0431840 3300048918 Bacteria 1066
876 Ga0496116_0025379 3300048919 Bacteria 4358
877 Ga0496117_0022719 3300048920 Bacteria 5023
878 Ga0496117_0193301 3300048920 Bacteria 1156
879 Ga0496118_0017843 3300048921 Bacteria 6438
880 Ga0496118_0195702 3300048921 Bacteria 1204
881 Ga0496119_0101374 3300048922 Bacteria 1616
882 Ga0496121_0030123 3300048924 Bacteria 4992
883 Ga0496121_0045922 3300048924 Bacteria 3746
884 Ga0496121_0342173 3300048924 Bacteria 999
885 Ga0496121_0516092 3300048924 Bacteria 755
886 Ga0496122_0014937 3300048925 Bacteria 7471
887 Ga0496122_0075668 3300048925 Bacteria 2373
888 Ga0496122_0164552 3300048925 Bacteria 1347
889 Ga0496123_0041873 3300048926 Bacteria 3169
890 Ga0496123_0154698 3300048926 Bacteria 1231
891 Ga0496124_0011741 3300048927 Bacteria 8736
892 Ga0496125_0050182 3300048928 Bacteria 3457
893 Ga0496125_0258353 3300048928 Bacteria 1093
894 Ga0496126_0003472 3300048929 Bacteria 19892
895 Ga0496126_0052471 3300048929 Bacteria 3705
896 Ga0496126_0169399 3300048929 Bacteria 1862
897 Ga0495682_0071438 3300049460 Bacteria 1249
898 Ga0501034_0087141 3300049571 Bacteria 3122
899 Ga0501039_0132296 3300049575 Bacteria 1958
900 Ga0501043_0232610 3300049579 Bacteria 1423
901 Ga0501048_0619211 3300049582 Bacteria 777
902 Ga0501067_0331420 3300049583 Bacteria 848
903 Ga0501069_0153590 3300049585 Bacteria 1324
904 Ga0501075_0741675 3300049591 Bacteria 748
905 Ga0501076_0522117 3300049592 Bacteria 979
906 Ga0501079_0102231 3300049741 Bacteria 2223
907 Ga0501080_0062757 3300049742 Bacteria 3458
908 Ga0501080_1201459 3300049742 Bacteria 652
909 Ga0501035_0302515 3300049822 Bacteria 1347
910 Ga0501044_0270157 3300049823 Bacteria 1636
911 nmdc:mga03683_20442_c1 3300050489 Bacteria 2540
912 nmdc:mga03683_23202_c1 3300050489 Bacteria 2414
913 nmdc:mga03683_269461_c1 3300050489 Bacteria 794
914 nmdc:mga03683_371901_c1 3300050489 Bacteria 679
915 nmdc:mga03683_99957_c1 3300050489 Bacteria 774
916 nmdc:mga03n38_20900_c1 3300050490 Bacteria 2626
917 nmdc:mga03n38_3607_c1 3300050490 Bacteria 5004
918 nmdc:mga03n38_723420_c1 3300050490 Bacteria 575
919 nmdc:mga00v17_256487_c1 3300050491 Bacteria 1134
920 nmdc:mga00v17_261525_c1 3300050491 Bacteria 1123
921 nmdc:mga0yw44_128590_c1 3300050492 Bacteria 1638
922 nmdc:mga0yw44_47856_c1 3300050492 Bacteria 2576
923 nmdc:mga0yw44_606624_c1 3300050492 Bacteria 744
924 nmdc:mga0yw44_67988_c1 3300050492 Bacteria 2203
925 nmdc:mga0yw44_731544_c1 3300050492 Bacteria 672
926 nmdc:mga0yw44_90214_c1 3300050492 Bacteria 1936
927 nmdc:mga0k408_155748_c1 3300050493 Bacteria 1361
928 nmdc:mga0k408_203237_c1 3300050493 Bacteria 1183
929 nmdc:mga0k408_238751_c1 3300050493 Bacteria 1085
930 nmdc:mga0k408_2540_c1 3300050493 Bacteria 9702
931 nmdc:mga0k408_276333_c1 3300050493 Bacteria 1003
932 nmdc:mga0k408_59463_c1 3300050493 Bacteria 2220
933 nmdc:mga0k408_62427_c1 3300050493 Bacteria 2167
934 nmdc:mga0k408_68971_c1 3300050493 Bacteria 2063
935 nmdc:mga06z11_112438_c1 3300050494 Bacteria 1510
936 nmdc:mga06z11_124950_c1 3300050494 Bacteria 1439
937 nmdc:mga06z11_177704_c1 3300050494 Bacteria 1226
938 nmdc:mga06z11_195557_c1 3300050494 Bacteria 1172
939 nmdc:mga04h51_72127_c1 3300050495 Bacteria 1208
940 nmdc:mga07m45_12108_c1 3300050496 Bacteria 4552
941 nmdc:mga07m45_13479_c1 3300050496 Bacteria 4339
942 nmdc:mga07m45_15545_c1 3300050496 Bacteria 4064
943 nmdc:mga07m45_210824_c1 3300050496 Bacteria 1130
944 nmdc:mga07m45_217611_c1 3300050496 Bacteria 1111
945 nmdc:mga07m45_24491_c1 3300050496 Bacteria 3307
946 nmdc:mga07m45_384765_c1 3300050496 Bacteria 815
947 nmdc:mga07m45_59332_c1 3300050496 Bacteria 2165
948 nmdc:mga07m45_6630_c1 3300050496 Bacteria 5869
949 nmdc:mga07m45_69720_c1 3300050496 Bacteria 1999
950 nmdc:mga07m45_76360_c1 3300050496 Bacteria 1910
951 nmdc:mga07m45_76816_c1 3300050496 Bacteria 1904
952 nmdc:mga07m45_85945_c2 3300050496 Bacteria 1337
953 nmdc:mga07m45_94757_c1 3300050496 Bacteria 1712
954 nmdc:mga07m45_98007_c1 3300050496 Bacteria 1683
955 nmdc:mga05p37_1181895_c1 3300050507 Bacteria 792
956 nmdc:mga05p37_299011_c1 3300050507 Bacteria 1913
957 nmdc:mga0qj67_313310_c1 3300050509 Bacteria 1270
958 nmdc:mga0qj67_48786_c1 3300050509 Bacteria 3345
959 nmdc:mga06r32_292876_c1 3300050510 Bacteria 1614
960 nmdc:mga08y16_266904_c1 3300050511 Bacteria 1767
961 nmdc:mga08y16_472713_c1 3300050511 Bacteria 1276
962 nmdc:mga08y16_547556_c1 3300050511 Bacteria 1171
963 nmdc:mga0n895_247511_c1 3300050512 Bacteria 1809
964 nmdc:mga0n895_811229_c1 3300050512 Bacteria 926
965 nmdc:mga0rr50_617544_c1 3300050513 Bacteria 924
966 nmdc:mga0a205_92616_c1 3300050515 Bacteria 2920
967 nmdc:mga0sz30_26942_c1 3300050516 Bacteria 2359
968 nmdc:mga0sz30_343609_c1 3300050516 Bacteria 667
969 nmdc:mga0sz30_86946_c1 3300050516 Bacteria 1357
970 nmdc:mga0sz30_95_c1 3300050516 Bacteria 33938
971 Ga0495601_0000048 3300053077 Bacteria 69310
972 Ga0495601_0013653 3300053077 Bacteria 4885
973 Ga0500610_0012836 3300053079 Bacteria 3874
974 Ga0500610_0013055 3300053079 Bacteria 3849
975 Ga0495655_0073347 3300053083 Bacteria 962
976 Ga0495655_0222123 3300053083 Bacteria 626
977 Ga0495595_0001916 3300053084 Bacteria 8078
978 Ga0495619_0051116 3300053085 Bacteria 2730
979 Ga0495619_0088889 3300053085 Bacteria 2090
980 Ga0495619_0310887 3300053085 Bacteria 1091
981 Ga0500643_001860 3300053087 Bacteria 11508
982 Ga0500644_0106454 3300053088 Bacteria 1074
983 Ga0500646_0260617 3300053090 Bacteria 613
984 Ga0500651_0000071 3300053093 Bacteria 66345
985 Ga0500566_0023831 3300053094 Bacteria 3594
986 Ga0500566_0068470 3300053094 Bacteria 1996
987 Ga0500641_0116669 3300053096 Bacteria 1150
988 Ga0500641_0140205 3300053096 Bacteria 1044
989 Ga0500641_0170957 3300053096 Bacteria 935
990 Ga0500555_056513 3300053103 Bacteria 1064
991 Ga0500571_000033 3300053110 Bacteria 44174
992 Ga0500572_012363 3300053111 Bacteria 2091
993 Ga0500593_000083 3300053117 Bacteria 34404
994 Ga0500594_0000739 3300053118 Bacteria 6940
995 Ga0500594_0107477 3300053118 Bacteria 865
996 Ga0500595_000333 3300053119 Bacteria 30925
997 Ga0500607_000789 3300053121 Bacteria 30582
998 Ga0500607_054964 3300053121 Bacteria 2106
999 Ga0500608_006602 3300053122 Bacteria 4734
1000 Ga0500608_258868 3300053122 Bacteria 673
1001 Ga0500626_010098 3300053128 Bacteria 3951
1002 Ga0500655_000311 3300053133 Bacteria 11006
1003 Ga0500655_020268 3300053133 Bacteria 1241
1004 Ga0500658_0000163 3300053134 Bacteria 32020
1005 Ga0500658_0000277 3300053134 Bacteria 23365
1006 Ga0500658_0281944 3300053134 Bacteria 764
1007 Ga0500559_0005246 3300053136 Bacteria 5974
1008 Ga0500561_0129143 3300053137 Bacteria 776
1009 Ga0500568_0003208 3300053139 Bacteria 9288
1010 Ga0500568_0012568 3300053139 Bacteria 3887
1011 Ga0500574_002832 3300053141 Bacteria 2946
1012 Ga0500603_000540 3300053150 Bacteria 9573
1013 Ga0500616_0051330 3300053153 Bacteria 2173
1014 Ga0500627_0002100 3300053158 Bacteria 5778
1015 Ga0500627_0313020 3300053158 Bacteria 683
1016 Ga0500633_0088609 3300053160 Bacteria 1128
1017 Ga0500633_0209149 3300053160 Bacteria 730
1018 Ga0500634_0019369 3300053161 Bacteria 3666
1019 Ga0500634_0031309 3300053161 Bacteria 2901
1020 Ga0500634_0089711 3300053161 Bacteria 1564
1021 Ga0500638_000857 3300053162 Bacteria 8514
1022 Ga0500638_007384 3300053162 Bacteria 4593
1023 Ga0500636_0025244 3300053177 Bacteria 3511
1024 Ga0500637_0000060 3300053178 Bacteria 38881
1025 Ga0500645_086401 3300053730 Bacteria 892
1026 Ga0500565_028234 3300053734 Bacteria 722
1027 Ga0500661_003670 3300055283 Bacteria 2884
1028 Ga0500661_023727 3300055283 Bacteria 1086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0003325 Ga0453684_0003325_10304_10846 156
2 3300009093 Ga0105240_10556453 Ga0105240_105564532 160
3 3300048911 Ga0496108_0861720 Ga0496108_0861720_114_695 161
4 3300045049 Ga0466959_0359736 Ga0466959_0359736_317_841 162
5 iso_pu_bacteria 2513020051 2513227876 162
6 iso_pu_bacteria 2599185214 2599625146 162
7 iso_pu_bacteria 2599185226 2599673402 162
8 iso_pu_bacteria 2599185227 2599683072 162
9 iso_pu_bacteria 2599185229 2599695010 162
10 iso_pu_bacteria 2643221658 2644328409 162
11 iso_pu_bacteria 2738541277 2738722484 162
12 iso_pu_bacteria 2738543019 2739283055 162
13 iso_pu_bacteria 2818991446 2819600736 162
14 iso_pu_bacteria 2899924645 2899931712 162
15 iso_pu_bacteria 2928037797 2928043094 162
16 iso_pu_bacteria 2928044640 2928050247 162
17 iso_pu_bacteria 2928051484 2928056726 162
18 3300005840 Ga0068870_10417856 Ga0068870_104178562 163
19 3300006173 Ga0070716_100332648 Ga0070716_1003326482 163
20 3300007788 Ga0099795_10011076 Ga0099795_100110761 163
21 3300009174 Ga0105241_11469211 Ga0105241_114692111 163
22 3300009553 Ga0105249_10260782 Ga0105249_102607822 163
23 3300010159 Ga0099796_10014598 Ga0099796_100145982 163
24 3300012490 Ga0157322_1023870 Ga0157322_10238701 163
25 3300012495 Ga0157323_1012656 Ga0157323_10126562 163
26 3300013307 Ga0157372_11303363 Ga0157372_113033631 163
27 3300013308 Ga0157375_10358940 Ga0157375_103589402 163
28 3300025916 Ga0207663_10105327 Ga0207663_101053272 163
29 3300035083 Ga0373926_0037109 Ga0373926_0037109_1049_1543 163
30 3300035725 Ga0373947_0409925 Ga0373947_0409925_184_678 163
31 3300046455 Ga0495603_0274344 Ga0495603_0274344_410_904 163
32 3300046462 Ga0495651_0156551 Ga0495651_0156551_611_1102 163
33 3300046473 Ga0495582_0077374 Ga0495582_0077374_1002_1496 163
34 3300046475 Ga0495639_0320209 Ga0495639_0320209_59_553 163
35 3300046537 Ga0495598_0116840 Ga0495598_0116840_263_757 163
36 3300046539 Ga0495621_0252931 Ga0495621_0252931_203_697 163
37 3300046615 Ga0495656_0583482 Ga0495656_0583482_26_520 163
38 3300046674 Ga0495588_0297053 Ga0495588_0297053_140_634 163
39 3300046683 Ga0495658_0385180 Ga0495658_0385180_303_797 163
40 3300046684 Ga0495669_0279449 Ga0495669_0279449_256_750 163
41 3300047320 Ga0495672_0014087 Ga0495672_0014087_3001_3495 163
42 3300048904 Ga0496101_1153634 Ga0496101_1153634_69_563 163
43 3300048917 Ga0496114_0170792 Ga0496114_0170792_705_1199 163
44 3300048921 Ga0496118_0195702 Ga0496118_0195702_594_1088 163
45 3300053134 Ga0500658_0281944 Ga0500658_0281944_41_535 163
46 3300002067 JGI24735J21928_10075636 JGI24735J21928_100756362 164
47 3300005289 Ga0065704_10397369 Ga0065704_103973691 164
48 3300005293 Ga0065715_10026993 Ga0065715_100269932 164
49 3300005336 Ga0070680_100536919 Ga0070680_1005369192 164
50 3300005341 Ga0070691_10142480 Ga0070691_101424802 164
51 3300005344 Ga0070661_100042792 Ga0070661_1000427923 164
52 3300005457 Ga0070662_100351551 Ga0070662_1003515512 164
53 3300005530 Ga0070679_100515236 Ga0070679_1005152362 164
54 3300005535 Ga0070684_100049588 Ga0070684_1000495883 164
55 3300005539 Ga0068853_100291441 Ga0068853_1002914412 164
56 3300005563 Ga0068855_100335750 Ga0068855_1003357502 164
57 3300005563 Ga0068855_101052839 Ga0068855_1010528392 164
58 3300005564 Ga0070664_100336963 Ga0070664_1003369632 164
59 3300005577 Ga0068857_100117348 Ga0068857_1001173482 164
60 3300005614 Ga0068856_100028388 Ga0068856_1000283884 164
61 3300005616 Ga0068852_100129342 Ga0068852_1001293423 164
62 3300006186 Ga0075369_10000214 Ga0075369_100002142 164
63 3300006844 Ga0075428_100271762 Ga0075428_1002717622 164
64 3300006871 Ga0075434_100066669 Ga0075434_1000666694 164
65 3300006880 Ga0075429_100298751 Ga0075429_1002987512 164
66 3300009174 Ga0105241_10355410 Ga0105241_103554102 164
67 3300009545 Ga0105237_10146882 Ga0105237_101468823 164
68 3300009551 Ga0105238_10053482 Ga0105238_100534822 164
69 3300009553 Ga0105249_10197882 Ga0105249_101978822 164
70 3300010159 Ga0099796_10133414 Ga0099796_101334141 164
71 3300011119 Ga0105246_11046276 Ga0105246_110462762 164
72 3300013105 Ga0157369_10113059 Ga0157369_101130593 164
73 3300013296 Ga0157374_10439352 Ga0157374_104393521 164
74 3300013307 Ga0157372_10082216 Ga0157372_100822164 164
75 3300025294 Ga0209025_1000343 Ga0209025_100034382 164
76 3300025904 Ga0207647_10224956 Ga0207647_102249562 164
77 3300025913 Ga0207695_10439023 Ga0207695_104390232 164
78 3300025914 Ga0207671_10532643 Ga0207671_105326432 164
79 3300025917 Ga0207660_10608673 Ga0207660_106086732 164
80 3300025920 Ga0207649_10090170 Ga0207649_100901702 164
81 3300025921 Ga0207652_10119188 Ga0207652_101191883 164
82 3300025924 Ga0207694_10221004 Ga0207694_102210042 164
83 3300025926 Ga0207659_10694060 Ga0207659_106940602 164
84 3300025932 Ga0207690_10536464 Ga0207690_105364642 164
85 3300025944 Ga0207661_10279575 Ga0207661_102795752 164
86 3300025945 Ga0207679_10037172 Ga0207679_100371723 164
87 3300025949 Ga0207667_10444399 Ga0207667_104443992 164
88 3300025961 Ga0207712_10262372 Ga0207712_102623722 164
89 3300025981 Ga0207640_10039886 Ga0207640_100398863 164
90 3300026041 Ga0207639_10119099 Ga0207639_101190992 164
91 3300026116 Ga0207674_10138132 Ga0207674_101381322 164
92 3300031241 Ga0265325_10294432 Ga0265325_102944322 164
93 3300037312 Ga0395899_0060710 Ga0395899_0060710_1131_1631 164
94 3300037418 Ga0395900_0009354 Ga0395900_0009354_4531_5031 164
95 3300038443 Ga0395901_0042375 Ga0395901_0042375_2775_3275 164
96 3300041507 Ga0451851_0341021 Ga0451851_0341021_55_555 164
97 3300042876 Ga0451577_0474877 Ga0451577_0474877_166_708 164
98 3300044712 Ga0453684_0755369 Ga0453684_0755369_239_781 164
99 3300050489 nmdc:mga03683_23202_c1 nmdc:mga03683_23202_c1_1248_1751 164
100 3300050496 nmdc:mga07m45_76816_c1 nmdc:mga07m45_76816_c1_761_1264 164
101 3300050515 nmdc:mga0a205_92616_c1 nmdc:mga0a205_92616_c1_1374_1874 164
102 3300050516 nmdc:mga0sz30_95_c1 nmdc:mga0sz30_95_c1_14171_14674 164
103 3300053083 Ga0495655_0222123 Ga0495655_0222123_96_599 164
104 iso_pu_bacteria 2513237101 2513694709 164
105 iso_pu_bacteria 2791355199 2793077976 164
106 iso_pu_bacteria 2874604998 2874610157 164
107 iso_pu_bacteria 2922361189 2922366747 164
108 iso_pu_bacteria 2922386360 2922389350 164
109 iso_pu_bacteria 8006984368 8006993171 164
110 iso_pu_bacteria 8056673599 8056678196 164
111 3300005347 Ga0070668_101188534 Ga0070668_1011885341 165
112 3300006353 Ga0075370_10308439 Ga0075370_103084391 165
113 3300035725 Ga0373947_0172392 Ga0373947_0172392_656_1162 165
114 3300037068 Ga0373925_1123280 Ga0373925_1123280_52_558 165
115 3300046459 Ga0495629_0070519 Ga0495629_0070519_18_515 165
116 3300046507 Ga0495606_0011174 Ga0495606_0011174_1866_2363 165
117 3300046533 Ga0495640_0271894 Ga0495640_0271894_509_1015 165
118 3300046557 Ga0495622_0337975 Ga0495622_0337975_77_574 165
119 3300046689 Ga0495613_0150544 Ga0495613_0150544_12_509 165
120 3300047673 Ga0495593_0072165 Ga0495593_0072165_1253_1750 165
121 3300048913 Ga0496110_0400131 Ga0496110_0400131_23_529 165
122 3300048914 Ga0496111_0272830 Ga0496111_0272830_661_1167 165
123 3300050490 nmdc:mga03n38_723420_c1 nmdc:mga03n38_723420_c1_58_564 165
124 iso_pu_bacteria 2876808645 2876815712 165
125 iso_pu_bacteria 2879110137 2879117033 165
126 3300002739 JGI25158J39367_1007100 JGI25158J39367_10071002 166
127 3300002774 JGI25150J39212_1010324 JGI25150J39212_10103242 166
128 3300002987 JGI25159J45721_1003181 JGI25159J45721_10031815 166
129 3300003215 JGI25153J46596_10002553 JGI25153J46596_100025531 166
130 3300003354 JGI25160J50197_1004644 JGI25160J50197_10046445 166
131 3300003374 JGI25161J50226_1009988 JGI25161J50226_10099882 166
132 3300003771 Ga0055526_1008818 Ga0055526_10088185 166
133 3300003773 Ga0055537_1003344 Ga0055537_10033445 166
134 3300003775 Ga0055524_1006736 Ga0055524_10067365 166
135 3300003784 Ga0055534_1013581 Ga0055534_10135812 166
136 3300003790 Ga0055528_1007183 Ga0055528_10071835 166
137 3300003794 Ga0055531_10048604 Ga0055531_100486041 166
138 3300004625 Ga0055543_1013689 Ga0055543_10136892 166
139 3300005262 Ga0065165_1003666 Ga0065165_10036668 166
140 3300005288 Ga0065714_10035760 Ga0065714_100357602 166
141 3300005334 Ga0068869_100171337 Ga0068869_1001713372 166
142 3300005577 Ga0068857_100535826 Ga0068857_1005358262 166
143 3300005937 Ga0081455_10002140 Ga0081455_100021402 166
144 3300006048 Ga0075363_100368667 Ga0075363_1003686671 166
145 3300009011 Ga0105251_10112116 Ga0105251_101121162 166
146 3300009036 Ga0105244_10001808 Ga0105244_100018084 166
147 3300009036 Ga0105244_10117530 Ga0105244_101175302 166
148 3300009093 Ga0105240_10360192 Ga0105240_103601922 166
149 3300009148 Ga0105243_10004605 Ga0105243_100046057 166
150 3300009174 Ga0105241_10269478 Ga0105241_102694782 166
151 3300009176 Ga0105242_11086888 Ga0105242_110868881 166
152 3300009545 Ga0105237_10466298 Ga0105237_104662982 166
153 3300009551 Ga0105238_10248355 Ga0105238_102483552 166
154 3300012505 Ga0157339_1005354 Ga0157339_10053541 166
155 3300013100 Ga0157373_10040974 Ga0157373_100409743 166
156 3300013105 Ga0157369_10005188 Ga0157369_100051882 166
157 3300013105 Ga0157369_10319087 Ga0157369_103190872 166
158 3300013297 Ga0157378_10300338 Ga0157378_103003382 166
159 3300013307 Ga0157372_10060142 Ga0157372_100601425 166
160 3300014497 Ga0182008_10001754 Ga0182008_100017542 166
161 3300014497 Ga0182008_10001779 Ga0182008_100017799 166
162 3300014969 Ga0157376_10491700 Ga0157376_104917002 166
163 3300015261 Ga0182006_1002899 Ga0182006_10028995 166
164 3300015261 Ga0182006_1028074 Ga0182006_10280742 166
165 3300015262 Ga0182007_10002457 Ga0182007_100024577 166
166 3300015262 Ga0182007_10003387 Ga0182007_100033874 166
167 3300025208 Ga0209436_101997 Ga0209436_1019972 166
168 3300025245 Ga0207425_1000579 Ga0207425_10005799 166
169 3300025258 Ga0209129_1000114 Ga0209129_100011481 166
170 3300025258 Ga0209129_1001990 Ga0209129_10019902 166
171 3300025263 Ga0209565_1001445 Ga0209565_10014458 166
172 3300025273 Ga0209673_1003002 Ga0209673_10030028 166
173 3300025284 Ga0209130_1001138 Ga0209130_100113810 166
174 3300025292 Ga0209676_1031154 Ga0209676_10311542 166
175 3300025294 Ga0209025_1004621 Ga0209025_10046219 166
176 3300025295 Ga0209564_1000295 Ga0209564_10002954 166
177 3300025297 Ga0209758_1000180 Ga0209758_100018081 166
178 3300025297 Ga0209758_1044076 Ga0209758_10440762 166
179 3300025298 Ga0209050_1015534 Ga0209050_10155342 166
180 3300025299 Ga0209256_1000157 Ga0209256_100015738 166
181 3300025302 Ga0207426_1000204 Ga0207426_100020438 166
182 3300025303 Ga0209051_1016772 Ga0209051_10167723 166
183 3300025304 Ga0209257_1003517 Ga0209257_100351710 166
184 3300035170 Ga0373943_0196570 Ga0373943_0196570_328_828 166
185 3300035725 Ga0373947_0199112 Ga0373947_0199112_231_737 166
186 3300041498 Ga0451841_0333288 Ga0451841_0333288_206_706 166
187 3300046453 Ga0495627_004050 Ga0495627_004050_4683_5183 166
188 3300046454 Ga0495592_0645095 Ga0495592_0645095_125_625 166
189 3300046460 Ga0495638_0024829 Ga0495638_0024829_611_1111 166
190 3300046472 Ga0495580_0276651 Ga0495580_0276651_28_537 166
191 3300046512 Ga0495610_0099080 Ga0495610_0099080_91_591 166
192 3300046513 Ga0495616_0005361 Ga0495616_0005361_3874_4374 166
193 3300046518 Ga0495631_0000271 Ga0495631_0000271_12874_13374 166
194 3300046530 Ga0495654_0012115 Ga0495654_0012115_3285_3785 166
195 3300046536 Ga0495587_0401068 Ga0495587_0401068_70_570 166
196 3300046539 Ga0495621_0025169 Ga0495621_0025169_15_515 166
197 3300046616 Ga0495668_0043443 Ga0495668_0043443_1905_2405 166
198 3300046642 Ga0495634_0374191 Ga0495634_0374191_309_809 166
199 3300046660 Ga0495625_0104617 Ga0495625_0104617_900_1400 166
200 3300046663 Ga0495635_0087265 Ga0495635_0087265_1184_1684 166
201 3300046674 Ga0495588_0203667 Ga0495588_0203667_530_1030 166
202 3300046690 Ga0495624_0179967 Ga0495624_0179967_661_1161 166
203 3300046692 Ga0495671_0001942 Ga0495671_0001942_1296_1796 166
204 3300046810 Ga0495660_0069559 Ga0495660_0069559_892_1392 166
205 3300047321 Ga0495676_0059100 Ga0495676_0059100_1661_2161 166
206 3300047470 Ga0495681_0166736 Ga0495681_0166736_133_633 166
207 3300047673 Ga0495593_0019013 Ga0495593_0019013_2180_2680 166
208 3300048089 Ga0495614_0062248 Ga0495614_0062248_576_1076 166
209 3300048904 Ga0496101_0006611 Ga0496101_0006611_2074_2574 166
210 3300048905 Ga0496102_0144286 Ga0496102_0144286_1559_2059 166
211 3300048907 Ga0496104_0011832 Ga0496104_0011832_2384_2893 166
212 3300048911 Ga0496108_0066093 Ga0496108_0066093_2318_2827 166
213 3300048916 Ga0496113_0045494 Ga0496113_0045494_1620_2129 166
214 3300048919 Ga0496116_0025379 Ga0496116_0025379_2699_3199 166
215 3300048920 Ga0496117_0022719 Ga0496117_0022719_4193_4693 166
216 3300048920 Ga0496117_0193301 Ga0496117_0193301_219_719 166
217 3300048921 Ga0496118_0017843 Ga0496118_0017843_4900_5400 166
218 3300048922 Ga0496119_0101374 Ga0496119_0101374_481_981 166
219 3300048924 Ga0496121_0030123 Ga0496121_0030123_4212_4712 166
220 3300048925 Ga0496122_0075668 Ga0496122_0075668_663_1163 166
221 3300048925 Ga0496122_0164552 Ga0496122_0164552_476_976 166
222 3300048926 Ga0496123_0041873 Ga0496123_0041873_2463_2963 166
223 3300048927 Ga0496124_0011741 Ga0496124_0011741_3405_3905 166
224 3300048928 Ga0496125_0050182 Ga0496125_0050182_1898_2398 166
225 3300048928 Ga0496125_0258353 Ga0496125_0258353_148_648 166
226 3300048929 Ga0496126_0052471 Ga0496126_0052471_849_1349 166
227 3300049582 Ga0501048_0619211 Ga0501048_0619211_23_529 166
228 3300050496 nmdc:mga07m45_59332_c1 nmdc:mga07m45_59332_c1_314_814 166
229 3300050496 nmdc:mga07m45_6630_c1 nmdc:mga07m45_6630_c1_5343_5843 166
230 3300050496 nmdc:mga07m45_94757_c1 nmdc:mga07m45_94757_c1_483_983 166
231 3300050513 nmdc:mga0rr50_617544_c1 nmdc:mga0rr50_617544_c1_380_889 166
232 3300050516 nmdc:mga0sz30_343609_c1 nmdc:mga0sz30_343609_c1_34_534 166
233 3300053079 Ga0500610_0013055 Ga0500610_0013055_3257_3757 166
234 3300053083 Ga0495655_0073347 Ga0495655_0073347_169_669 166
235 3300053087 Ga0500643_001860 Ga0500643_001860_9673_10173 166
236 3300053093 Ga0500651_0000071 Ga0500651_0000071_57284_57784 166
237 3300053094 Ga0500566_0023831 Ga0500566_0023831_832_1332 166
238 3300053096 Ga0500641_0116669 Ga0500641_0116669_395_895 166
239 3300053110 Ga0500571_000033 Ga0500571_000033_30495_30995 166
240 3300053117 Ga0500593_000083 Ga0500593_000083_22410_22910 166
241 3300053118 Ga0500594_0000739 Ga0500594_0000739_4052_4552 166
242 3300053121 Ga0500607_000789 Ga0500607_000789_5802_6302 166
243 3300053122 Ga0500608_006602 Ga0500608_006602_3125_3625 166
244 3300053122 Ga0500608_258868 Ga0500608_258868_126_626 166
245 3300053128 Ga0500626_010098 Ga0500626_010098_641_1141 166
246 3300053133 Ga0500655_000311 Ga0500655_000311_4219_4719 166
247 3300053134 Ga0500658_0000163 Ga0500658_0000163_11999_12499 166
248 3300053134 Ga0500658_0000277 Ga0500658_0000277_9393_9893 166
249 3300053136 Ga0500559_0005246 Ga0500559_0005246_2144_2644 166
250 3300053137 Ga0500561_0129143 Ga0500561_0129143_89_589 166
251 3300053139 Ga0500568_0003208 Ga0500568_0003208_4904_5404 166
252 3300053141 Ga0500574_002832 Ga0500574_002832_415_915 166
253 3300053153 Ga0500616_0051330 Ga0500616_0051330_1176_1676 166
254 3300053158 Ga0500627_0002100 Ga0500627_0002100_1951_2451 166
255 3300053160 Ga0500633_0088609 Ga0500633_0088609_539_1039 166
256 3300053161 Ga0500634_0019369 Ga0500634_0019369_2584_3084 166
257 3300053161 Ga0500634_0031309 Ga0500634_0031309_2289_2789 166
258 3300053162 Ga0500638_000857 Ga0500638_000857_3667_4167 166
259 3300053177 Ga0500636_0025244 Ga0500636_0025244_368_868 166
260 3300053730 Ga0500645_086401 Ga0500645_086401_187_687 166
261 3300053734 Ga0500565_028234 Ga0500565_028234_51_551 166
262 3300003203 JGI25406J46586_10000233 JGI25406J46586_1000023312 167
263 3300003203 JGI25406J46586_10022537 JGI25406J46586_100225371 167
264 3300003659 JGI25404J52841_10004643 JGI25404J52841_100046432 167
265 3300003659 JGI25404J52841_10008463 JGI25404J52841_100084632 167
266 3300003659 JGI25404J52841_10012135 JGI25404J52841_100121352 167
267 3300003659 JGI25404J52841_10024208 JGI25404J52841_100242081 167
268 3300003659 JGI25404J52841_10039658 JGI25404J52841_100396582 167
269 3300003659 JGI25404J52841_10095463 JGI25404J52841_100954631 167
270 3300003911 JGI25405J52794_10037446 JGI25405J52794_100374462 167
271 3300005328 Ga0070676_10049322 Ga0070676_100493224 167
272 3300005329 Ga0070683_100071835 Ga0070683_1000718353 167
273 3300005330 Ga0070690_100103269 Ga0070690_1001032691 167
274 3300005331 Ga0070670_100264917 Ga0070670_1002649172 167
275 3300005331 Ga0070670_101103482 Ga0070670_1011034821 167
276 3300005334 Ga0068869_100646239 Ga0068869_1006462392 167
277 3300005338 Ga0068868_100041467 Ga0068868_1000414672 167
278 3300005338 Ga0068868_100263359 Ga0068868_1002633592 167
279 3300005338 Ga0068868_100307909 Ga0068868_1003079092 167
280 3300005338 Ga0068868_101366862 Ga0068868_1013668621 167
281 3300005339 Ga0070660_100015341 Ga0070660_1000153413 167
282 3300005340 Ga0070689_100387178 Ga0070689_1003871782 167
283 3300005341 Ga0070691_10180477 Ga0070691_101804772 167
284 3300005344 Ga0070661_100175100 Ga0070661_1001751002 167
285 3300005347 Ga0070668_101002817 Ga0070668_1010028171 167
286 3300005347 Ga0070668_101335220 Ga0070668_1013352201 167
287 3300005356 Ga0070674_100007000 Ga0070674_1000070006 167
288 3300005356 Ga0070674_100363996 Ga0070674_1003639962 167
289 3300005364 Ga0070673_100143175 Ga0070673_1001431752 167
290 3300005366 Ga0070659_101894984 Ga0070659_1018949841 167
291 3300005367 Ga0070667_100173831 Ga0070667_1001738312 167
292 3300005367 Ga0070667_101252488 Ga0070667_1012524881 167
293 3300005440 Ga0070705_100901573 Ga0070705_1009015731 167
294 3300005445 Ga0070708_100080252 Ga0070708_1000802523 167
295 3300005455 Ga0070663_100027899 Ga0070663_1000278994 167
296 3300005455 Ga0070663_100237493 Ga0070663_1002374932 167
297 3300005456 Ga0070678_100292937 Ga0070678_1002929372 167
298 3300005456 Ga0070678_101450772 Ga0070678_1014507721 167
299 3300005458 Ga0070681_10153378 Ga0070681_101533782 167
300 3300005458 Ga0070681_10460834 Ga0070681_104608341 167
301 3300005459 Ga0068867_100120843 Ga0068867_1001208432 167
302 3300005459 Ga0068867_101353323 Ga0068867_1013533231 167
303 3300005467 Ga0070706_101008265 Ga0070706_1010082651 167
304 3300005471 Ga0070698_100301976 Ga0070698_1003019761 167
305 3300005535 Ga0070684_100053370 Ga0070684_1000533702 167
306 3300005535 Ga0070684_100520395 Ga0070684_1005203952 167
307 3300005536 Ga0070697_100175946 Ga0070697_1001759462 167
308 3300005536 Ga0070697_100583683 Ga0070697_1005836832 167
309 3300005539 Ga0068853_100080072 Ga0068853_1000800722 167
310 3300005543 Ga0070672_100047861 Ga0070672_1000478612 167
311 3300005543 Ga0070672_100423690 Ga0070672_1004236902 167
312 3300005545 Ga0070695_101046797 Ga0070695_1010467971 167
313 3300005548 Ga0070665_100145695 Ga0070665_1001456954 167
314 3300005548 Ga0070665_100164868 Ga0070665_1001648683 167
315 3300005549 Ga0070704_100131020 Ga0070704_1001310202 167
316 3300005564 Ga0070664_100277606 Ga0070664_1002776062 167
317 3300005577 Ga0068857_100026204 Ga0068857_1000262042 167
318 3300005578 Ga0068854_100701308 Ga0068854_1007013082 167
319 3300005614 Ga0068856_100637094 Ga0068856_1006370942 167
320 3300005615 Ga0070702_100092435 Ga0070702_1000924352 167
321 3300005616 Ga0068852_100057569 Ga0068852_1000575692 167
322 3300005617 Ga0068859_101139072 Ga0068859_1011390722 167
323 3300005719 Ga0068861_100265171 Ga0068861_1002651712 167
324 3300005719 Ga0068861_100540060 Ga0068861_1005400601 167
325 3300005834 Ga0068851_10011436 Ga0068851_100114365 167
326 3300005840 Ga0068870_10651351 Ga0068870_106513512 167
327 3300005841 Ga0068863_100750898 Ga0068863_1007508982 167
328 3300005842 Ga0068858_100689531 Ga0068858_1006895312 167
329 3300005843 Ga0068860_100484213 Ga0068860_1004842132 167
330 3300005843 Ga0068860_100485726 Ga0068860_1004857261 167
331 3300005844 Ga0068862_100067403 Ga0068862_1000674033 167
332 3300005844 Ga0068862_100126298 Ga0068862_1001262982 167
333 3300005844 Ga0068862_100325251 Ga0068862_1003252512 167
334 3300005937 Ga0081455_10011235 Ga0081455_100112358 167
335 3300005937 Ga0081455_10020632 Ga0081455_100206326 167
336 3300005937 Ga0081455_10038013 Ga0081455_100380132 167
337 3300005981 Ga0081538_10064867 Ga0081538_100648672 167
338 3300005983 Ga0081540_1002866 Ga0081540_100286611 167
339 3300005983 Ga0081540_1018952 Ga0081540_10189524 167
340 3300005983 Ga0081540_1021799 Ga0081540_10217992 167
341 3300005983 Ga0081540_1043578 Ga0081540_10435782 167
342 3300005983 Ga0081540_1072595 Ga0081540_10725951 167
343 3300005983 Ga0081540_1079257 Ga0081540_10792571 167
344 3300005983 Ga0081540_1197938 Ga0081540_11979382 167
345 3300005985 Ga0081539_10000157 Ga0081539_1000015759 167
346 3300005985 Ga0081539_10002599 Ga0081539_1000259918 167
347 3300005985 Ga0081539_10044556 Ga0081539_100445563 167
348 3300005985 Ga0081539_10045305 Ga0081539_100453052 167
349 3300006028 Ga0070717_10994929 Ga0070717_109949292 167
350 3300006038 Ga0075365_10160637 Ga0075365_101606372 167
351 3300006038 Ga0075365_10296160 Ga0075365_102961602 167
352 3300006042 Ga0075368_10067497 Ga0075368_100674972 167
353 3300006048 Ga0075363_100133737 Ga0075363_1001337372 167
354 3300006173 Ga0070716_100259333 Ga0070716_1002593332 167
355 3300006175 Ga0070712_100178805 Ga0070712_1001788052 167
356 3300006177 Ga0075362_10062462 Ga0075362_100624622 167
357 3300006177 Ga0075362_10350663 Ga0075362_103506631 167
358 3300006178 Ga0075367_10005584 Ga0075367_100055846 167
359 3300006186 Ga0075369_10201466 Ga0075369_102014662 167
360 3300006195 Ga0075366_10097484 Ga0075366_100974842 167
361 3300006195 Ga0075366_10559195 Ga0075366_105591951 167
362 3300006195 Ga0075366_10670053 Ga0075366_106700531 167
363 3300006237 Ga0097621_100111264 Ga0097621_1001112643 167
364 3300006237 Ga0097621_100894611 Ga0097621_1008946112 167
365 3300006237 Ga0097621_101323344 Ga0097621_1013233442 167
366 3300006353 Ga0075370_10061122 Ga0075370_100611222 167
367 3300006353 Ga0075370_10343251 Ga0075370_103432512 167
368 3300006358 Ga0068871_100681498 Ga0068871_1006814982 167
369 3300006844 Ga0075428_100074682 Ga0075428_1000746824 167
370 3300006871 Ga0075434_100757784 Ga0075434_1007577842 167
371 3300006880 Ga0075429_100666500 Ga0075429_1006665002 167
372 3300006881 Ga0068865_100008510 Ga0068865_1000085107 167
373 3300006881 Ga0068865_100078906 Ga0068865_1000789062 167
374 3300006931 Ga0097620_101139045 Ga0097620_1011390452 167
375 3300007265 Ga0099794_10025065 Ga0099794_100250652 167
376 3300007788 Ga0099795_10011242 Ga0099795_100112422 167
377 3300009011 Ga0105251_10170878 Ga0105251_101708783 167
378 3300009093 Ga0105240_10033754 Ga0105240_100337545 167
379 3300009147 Ga0114129_10172553 Ga0114129_101725534 167
380 3300009147 Ga0114129_10749472 Ga0114129_107494721 167
381 3300009148 Ga0105243_10123866 Ga0105243_101238662 167
382 3300009148 Ga0105243_10217937 Ga0105243_102179372 167
383 3300009176 Ga0105242_10133944 Ga0105242_101339443 167
384 3300009177 Ga0105248_10616910 Ga0105248_106169102 167
385 3300009551 Ga0105238_10047527 Ga0105238_100475272 167
386 3300009551 Ga0105238_10133367 Ga0105238_101333672 167
387 3300010375 Ga0105239_10096774 Ga0105239_100967742 167
388 3300010375 Ga0105239_10257650 Ga0105239_102576502 167
389 3300010375 Ga0105239_11165572 Ga0105239_111655722 167
390 3300012507 Ga0157342_1021807 Ga0157342_10218072 167
391 3300012510 Ga0157316_1010668 Ga0157316_10106682 167
392 3300013104 Ga0157370_10393617 Ga0157370_103936172 167
393 3300013105 Ga0157369_10067774 Ga0157369_100677742 167
394 3300013297 Ga0157378_10181786 Ga0157378_101817862 167
395 3300013306 Ga0163162_10426928 Ga0163162_104269282 167
396 3300013306 Ga0163162_11559706 Ga0163162_115597062 167
397 3300013308 Ga0157375_10586040 Ga0157375_105860402 167
398 3300014325 Ga0163163_10010769 Ga0163163_100107691 167
399 3300014325 Ga0163163_10371961 Ga0163163_103719612 167
400 3300014326 Ga0157380_10135348 Ga0157380_101353482 167
401 3300014745 Ga0157377_10302965 Ga0157377_103029652 167
402 3300025297 Ga0209758_1020867 Ga0209758_10208673 167
403 3300025885 Ga0207653_10028276 Ga0207653_100282762 167
404 3300025899 Ga0207642_10077529 Ga0207642_100775292 167
405 3300025900 Ga0207710_10082799 Ga0207710_100827992 167
406 3300025901 Ga0207688_10046362 Ga0207688_100463623 167
407 3300025901 Ga0207688_10433666 Ga0207688_104336662 167
408 3300025903 Ga0207680_10521540 Ga0207680_105215402 167
409 3300025907 Ga0207645_10162232 Ga0207645_101622322 167
410 3300025908 Ga0207643_10341290 Ga0207643_103412902 167
411 3300025909 Ga0207705_10018984 Ga0207705_100189842 167
412 3300025910 Ga0207684_10880578 Ga0207684_108805781 167
413 3300025912 Ga0207707_10000613 Ga0207707_1000061329 167
414 3300025913 Ga0207695_10224579 Ga0207695_102245792 167
415 3300025914 Ga0207671_10087793 Ga0207671_100877932 167
416 3300025917 Ga0207660_10015097 Ga0207660_100150972 167
417 3300025919 Ga0207657_10021660 Ga0207657_100216606 167
418 3300025920 Ga0207649_10164082 Ga0207649_101640822 167
419 3300025920 Ga0207649_10711924 Ga0207649_107119242 167
420 3300025921 Ga0207652_10023997 Ga0207652_100239972 167
421 3300025924 Ga0207694_10077217 Ga0207694_100772172 167
422 3300025924 Ga0207694_10264525 Ga0207694_102645252 167
423 3300025924 Ga0207694_10578726 Ga0207694_105787262 167
424 3300025925 Ga0207650_10343713 Ga0207650_103437132 167
425 3300025925 Ga0207650_10424857 Ga0207650_104248572 167
426 3300025927 Ga0207687_10084331 Ga0207687_100843313 167
427 3300025932 Ga0207690_10377018 Ga0207690_103770182 167
428 3300025932 Ga0207690_10825397 Ga0207690_108253972 167
429 3300025933 Ga0207706_11357269 Ga0207706_113572691 167
430 3300025934 Ga0207686_10883532 Ga0207686_108835321 167
431 3300025935 Ga0207709_10102910 Ga0207709_101029102 167
432 3300025936 Ga0207670_10261547 Ga0207670_102615471 167
433 3300025937 Ga0207669_10039682 Ga0207669_100396822 167
434 3300025937 Ga0207669_10530855 Ga0207669_105308551 167
435 3300025938 Ga0207704_10103145 Ga0207704_101031452 167
436 3300025938 Ga0207704_10182716 Ga0207704_101827162 167
437 3300025940 Ga0207691_10586937 Ga0207691_105869371 167
438 3300025944 Ga0207661_10039366 Ga0207661_100393664 167
439 3300025949 Ga0207667_10028504 Ga0207667_100285045 167
440 3300025960 Ga0207651_10102168 Ga0207651_101021682 167
441 3300025972 Ga0207668_10025674 Ga0207668_100256743 167
442 3300025981 Ga0207640_10637684 Ga0207640_106376842 167
443 3300026023 Ga0207677_10037687 Ga0207677_100376872 167
444 3300026041 Ga0207639_10018068 Ga0207639_100180682 167
445 3300026041 Ga0207639_10056817 Ga0207639_100568172 167
446 3300026067 Ga0207678_10063191 Ga0207678_100631913 167
447 3300026067 Ga0207678_10084486 Ga0207678_100844863 167
448 3300026067 Ga0207678_10085166 Ga0207678_100851662 167
449 3300026067 Ga0207678_10350281 Ga0207678_103502811 167
450 3300026075 Ga0207708_10085748 Ga0207708_100857483 167
451 3300026078 Ga0207702_11423424 Ga0207702_114234241 167
452 3300026088 Ga0207641_10614958 Ga0207641_106149582 167
453 3300026088 Ga0207641_10774829 Ga0207641_107748292 167
454 3300026089 Ga0207648_10059935 Ga0207648_100599352 167
455 3300026116 Ga0207674_10135758 Ga0207674_101357582 167
456 3300026118 Ga0207675_100148877 Ga0207675_1001488772 167
457 3300026118 Ga0207675_100294218 Ga0207675_1002942182 167
458 3300026121 Ga0207683_10154825 Ga0207683_101548252 167
459 3300026121 Ga0207683_10362082 Ga0207683_103620822 167
460 3300026121 Ga0207683_10454574 Ga0207683_104545742 167
461 3300026142 Ga0207698_11204436 Ga0207698_112044361 167
462 3300027671 Ga0209588_1021371 Ga0209588_10213712 167
463 3300028379 Ga0268266_10003191 Ga0268266_1000319113 167
464 3300028379 Ga0268266_10018212 Ga0268266_100182125 167
465 3300028379 Ga0268266_10088853 Ga0268266_100888533 167
466 3300028379 Ga0268266_10679708 Ga0268266_106797082 167
467 3300028380 Ga0268265_10119385 Ga0268265_101193851 167
468 3300028381 Ga0268264_10650633 Ga0268264_106506332 167
469 3300028786 Ga0307517_10010277 Ga0307517_1001027714 167
470 3300028794 Ga0307515_10351259 Ga0307515_103512592 167
471 3300028794 Ga0307515_10428172 Ga0307515_104281722 167
472 3300031241 Ga0265325_10027929 Ga0265325_100279294 167
473 3300031241 Ga0265325_10031667 Ga0265325_100316674 167
474 3300031249 Ga0265339_10009653 Ga0265339_100096536 167
475 3300031344 Ga0265316_10081542 Ga0265316_100815422 167
476 3300031344 Ga0265316_10090976 Ga0265316_100909764 167
477 3300031456 Ga0307513_10134134 Ga0307513_101341343 167
478 3300031456 Ga0307513_10270685 Ga0307513_102706852 167
479 3300031507 Ga0307509_10086316 Ga0307509_100863162 167
480 3300031548 Ga0307408_100426605 Ga0307408_1004266052 167
481 3300031595 Ga0265313_10000062 Ga0265313_1000006251 167
482 3300031595 Ga0265313_10001372 Ga0265313_100013725 167
483 3300031595 Ga0265313_10061361 Ga0265313_100613612 167
484 3300031595 Ga0265313_10067779 Ga0265313_100677792 167
485 3300031616 Ga0307508_10357034 Ga0307508_103570341 167
486 3300031649 Ga0307514_10485766 Ga0307514_104857661 167
487 3300031730 Ga0307516_10175345 Ga0307516_101753451 167
488 3300031730 Ga0307516_10369622 Ga0307516_103696222 167
489 3300031730 Ga0307516_10880179 Ga0307516_108801791 167
490 3300031731 Ga0307405_10245328 Ga0307405_102453282 167
491 3300031852 Ga0307410_10520184 Ga0307410_105201841 167
492 3300031852 Ga0307410_11448420 Ga0307410_114484201 167
493 3300031901 Ga0307406_10437707 Ga0307406_104377072 167
494 3300031901 Ga0307406_10445914 Ga0307406_104459142 167
495 3300031901 Ga0307406_10880113 Ga0307406_108801131 167
496 3300031903 Ga0307407_10083432 Ga0307407_100834322 167
497 3300031911 Ga0307412_10550504 Ga0307412_105505042 167
498 3300031911 Ga0307412_11326897 Ga0307412_113268972 167
499 3300032002 Ga0307416_100287321 Ga0307416_1002873212 167
500 3300032002 Ga0307416_100850581 Ga0307416_1008505812 167
501 3300032002 Ga0307416_101678654 Ga0307416_1016786541 167
502 3300032126 Ga0307415_100637705 Ga0307415_1006377052 167
503 3300033180 Ga0307510_10182663 Ga0307510_101826632 167
504 3300035114 Ga0373939_0001277 Ga0373939_0001277_38_547 167
505 3300035691 Ga0373931_0217856 Ga0373931_0217856_287_796 167
506 3300035691 Ga0373931_0248904 Ga0373931_0248904_35_541 167
507 3300035695 Ga0373927_0005689 Ga0373927_0005689_6634_7140 167
508 3300041413 Ga0439465_0142733 Ga0439465_0142733_76_585 167
509 3300041456 Ga0451795_0193704 Ga0451795_0193704_83_592 167
510 3300042016 Ga0439463_100494 Ga0439463_100494_178_687 167
511 3300042157 Ga0439458_0005013 Ga0439458_0005013_2020_2529 167
512 3300046452 Ga0495617_116035 Ga0495617_116035_305_814 167
513 3300046455 Ga0495603_0125073 Ga0495603_0125073_719_1228 167
514 3300046455 Ga0495603_0748615 Ga0495603_0748615_11_520 167
515 3300046457 Ga0495590_0049279 Ga0495590_0049279_40_549 167
516 3300046459 Ga0495629_0500577 Ga0495629_0500577_222_731 167
517 3300046461 Ga0495641_0328875 Ga0495641_0328875_129_638 167
518 3300046471 Ga0495650_0053026 Ga0495650_0053026_110_619 167
519 3300046471 Ga0495650_0079742 Ga0495650_0079742_187_696 167
520 3300046492 Ga0495585_0143880 Ga0495585_0143880_690_1199 167
521 3300046499 Ga0495594_0206013 Ga0495594_0206013_280_789 167
522 3300046501 Ga0495607_0055080 Ga0495607_0055080_856_1365 167
523 3300046507 Ga0495606_0314392 Ga0495606_0314392_25_534 167
524 3300046515 Ga0495620_0145618 Ga0495620_0145618_56_565 167
525 3300046517 Ga0495630_0406428 Ga0495630_0406428_465_971 167
526 3300046519 Ga0495632_0074542 Ga0495632_0074542_549_1058 167
527 3300046523 Ga0495644_0034321 Ga0495644_0034321_881_1390 167
528 3300046525 Ga0495663_0301502 Ga0495663_0301502_50_559 167
529 3300046526 Ga0495666_0301960 Ga0495666_0301960_39_548 167
530 3300046528 Ga0495642_0069068 Ga0495642_0069068_680_1189 167
531 3300046530 Ga0495654_0204965 Ga0495654_0204965_58_567 167
532 3300046538 Ga0495609_0043971 Ga0495609_0043971_1136_1645 167
533 3300046538 Ga0495609_0255209 Ga0495609_0255209_85_594 167
534 3300046539 Ga0495621_0385596 Ga0495621_0385596_43_552 167
535 3300046557 Ga0495622_0095768 Ga0495622_0095768_12_521 167
536 3300046557 Ga0495622_0163802 Ga0495622_0163802_100_609 167
537 3300046558 Ga0495633_0271883 Ga0495633_0271883_135_644 167
538 3300046615 Ga0495656_0006560 Ga0495656_0006560_1624_2133 167
539 3300046616 Ga0495668_0134784 Ga0495668_0134784_356_865 167
540 3300046648 Ga0495611_0171757 Ga0495611_0171757_130_639 167
541 3300046660 Ga0495625_0336795 Ga0495625_0336795_98_607 167
542 3300046660 Ga0495625_0377979 Ga0495625_0377979_102_611 167
543 3300046664 Ga0495659_0277614 Ga0495659_0277614_153_662 167
544 3300046665 Ga0495661_0103581 Ga0495661_0103581_658_1167 167
545 3300046674 Ga0495588_0178527 Ga0495588_0178527_570_1079 167
546 3300046684 Ga0495669_0220294 Ga0495669_0220294_298_807 167
547 3300046691 Ga0495670_0115351 Ga0495670_0115351_847_1356 167
548 3300046794 Ga0495589_0188912 Ga0495589_0188912_397_906 167
549 3300047315 Ga0495581_0477963 Ga0495581_0477963_112_621 167
550 3300047318 Ga0495636_0051155 Ga0495636_0051155_24_533 167
551 3300047319 Ga0495674_0668443 Ga0495674_0668443_93_602 167
552 3300047445 Ga0495677_0109037 Ga0495677_0109037_469_978 167
553 3300047469 Ga0495673_0145614 Ga0495673_0145614_322_831 167
554 3300047470 Ga0495681_0144134 Ga0495681_0144134_56_565 167
555 3300047472 Ga0495686_0096145 Ga0495686_0096145_872_1381 167
556 3300047472 Ga0495686_0247005 Ga0495686_0247005_85_594 167
557 3300048904 Ga0496101_0372094 Ga0496101_0372094_454_963 167
558 3300048905 Ga0496102_0368963 Ga0496102_0368963_486_995 167
559 3300048906 Ga0496103_0395196 Ga0496103_0395196_188_697 167
560 3300048907 Ga0496104_0636087 Ga0496104_0636087_35_541 167
561 3300048908 Ga0496105_0056143 Ga0496105_0056143_713_1219 167
562 3300048909 Ga0496106_0226243 Ga0496106_0226243_376_885 167
563 3300048910 Ga0496107_0850197 Ga0496107_0850197_109_618 167
564 3300048911 Ga0496108_0150792 Ga0496108_0150792_968_1474 167
565 3300048913 Ga0496110_0496476 Ga0496110_0496476_100_609 167
566 3300048914 Ga0496111_0112765 Ga0496111_0112765_233_739 167
567 3300048915 Ga0496112_0000035 Ga0496112_0000035_66990_67499 167
568 3300048915 Ga0496112_0686115 Ga0496112_0686115_299_805 167
569 3300048918 Ga0496115_0265483 Ga0496115_0265483_179_685 167
570 3300048924 Ga0496121_0516092 Ga0496121_0516092_215_724 167
571 3300049460 Ga0495682_0071438 Ga0495682_0071438_428_937 167
572 3300049583 Ga0501067_0331420 Ga0501067_0331420_76_585 167
573 3300049585 Ga0501069_0153590 Ga0501069_0153590_129_638 167
574 3300049591 Ga0501075_0741675 Ga0501075_0741675_94_603 167
575 3300050489 nmdc:mga03683_269461_c1 nmdc:mga03683_269461_c1_30_539 167
576 3300050489 nmdc:mga03683_371901_c1 nmdc:mga03683_371901_c1_110_619 167
577 3300050490 nmdc:mga03n38_3607_c1 nmdc:mga03n38_3607_c1_2836_3345 167
578 3300050491 nmdc:mga00v17_261525_c1 nmdc:mga00v17_261525_c1_578_1087 167
579 3300050492 nmdc:mga0yw44_128590_c1 nmdc:mga0yw44_128590_c1_938_1447 167
580 3300050492 nmdc:mga0yw44_606624_c1 nmdc:mga0yw44_606624_c1_29_538 167
581 3300050492 nmdc:mga0yw44_731544_c1 nmdc:mga0yw44_731544_c1_94_603 167
582 3300050492 nmdc:mga0yw44_90214_c1 nmdc:mga0yw44_90214_c1_559_1068 167
583 3300050496 nmdc:mga07m45_210824_c1 nmdc:mga07m45_210824_c1_248_757 167
584 3300050496 nmdc:mga07m45_85945_c2 nmdc:mga07m45_85945_c2_792_1301 167
585 3300050507 nmdc:mga05p37_1181895_c1 nmdc:mga05p37_1181895_c1_94_603 167
586 3300050507 nmdc:mga05p37_299011_c1 nmdc:mga05p37_299011_c1_1135_1644 167
587 3300050509 nmdc:mga0qj67_313310_c1 nmdc:mga0qj67_313310_c1_160_669 167
588 3300050511 nmdc:mga08y16_266904_c1 nmdc:mga08y16_266904_c1_1073_1582 167
589 3300050511 nmdc:mga08y16_547556_c1 nmdc:mga08y16_547556_c1_159_668 167
590 3300050512 nmdc:mga0n895_811229_c1 nmdc:mga0n895_811229_c1_370_879 167
591 3300050516 nmdc:mga0sz30_86946_c1 nmdc:mga0sz30_86946_c1_87_596 167
592 3300053088 Ga0500644_0106454 Ga0500644_0106454_356_865 167
593 3300053090 Ga0500646_0260617 Ga0500646_0260617_39_548 167
594 3300053094 Ga0500566_0068470 Ga0500566_0068470_1055_1564 167
595 3300053096 Ga0500641_0140205 Ga0500641_0140205_375_884 167
596 3300053096 Ga0500641_0170957 Ga0500641_0170957_51_560 167
597 3300053103 Ga0500555_056513 Ga0500555_056513_431_940 167
598 3300053118 Ga0500594_0107477 Ga0500594_0107477_277_786 167
599 3300053119 Ga0500595_000333 Ga0500595_000333_7887_8396 167
600 3300053133 Ga0500655_020268 Ga0500655_020268_201_710 167
601 3300053150 Ga0500603_000540 Ga0500603_000540_426_935 167
602 3300053158 Ga0500627_0313020 Ga0500627_0313020_46_555 167
603 3300053160 Ga0500633_0209149 Ga0500633_0209149_77_586 167
604 3300053161 Ga0500634_0089711 Ga0500634_0089711_891_1400 167
605 3300053162 Ga0500638_007384 Ga0500638_007384_132_641 167
606 3300053178 Ga0500637_0000060 Ga0500637_0000060_15563_16072 167
607 3300055283 Ga0500661_003670 Ga0500661_003670_89_598 167
608 iso_pu_bacteria 2928064002 2928068814 167
609 3300005366 Ga0070659_100873808 Ga0070659_1008738082 168
610 3300005466 Ga0070685_10454777 Ga0070685_104547772 168
611 3300005844 Ga0068862_100727212 Ga0068862_1007272122 168
612 3300005983 Ga0081540_1028548 Ga0081540_10285482 168
613 3300006195 Ga0075366_10104047 Ga0075366_101040472 168
614 3300009101 Ga0105247_10159724 Ga0105247_101597242 168
615 3300011119 Ga0105246_10898104 Ga0105246_108981041 168
616 3300026116 Ga0207674_10424457 Ga0207674_104244572 168
617 3300028379 Ga0268266_10299308 Ga0268266_102993082 168
618 3300028380 Ga0268265_10823801 Ga0268265_108238012 168
619 3300031344 Ga0265316_10037388 Ga0265316_100373882 168
620 3300031595 Ga0265313_10024898 Ga0265313_100248983 168
621 3300031711 Ga0265314_10001182 Ga0265314_100011827 168
622 3300035113 Ga0373936_0133317 Ga0373936_0133317_375_887 168
623 3300035695 Ga0373927_0028642 Ga0373927_0028642_1842_2354 168
624 3300037068 Ga0373925_0329269 Ga0373925_0329269_103_615 168
625 3300039438 Ga0436360_0035685 Ga0436360_0035685_346_858 168
626 3300046474 Ga0495605_0204643 Ga0495605_0204643_82_594 168
627 3300046664 Ga0495659_0009998 Ga0495659_0009998_2110_2622 168
628 3300048911 Ga0496108_1474605 Ga0496108_1474605_12_530 168
629 3300048914 Ga0496111_0433882 Ga0496111_0433882_286_831 168
630 3300050511 nmdc:mga08y16_472713_c1 nmdc:mga08y16_472713_c1_615_1133 168
631 3300005543 Ga0070672_100447801 Ga0070672_1004478012 169
632 3300006177 Ga0075362_10323123 Ga0075362_103231231 169
633 3300006178 Ga0075367_10017641 Ga0075367_100176412 169
634 3300006195 Ga0075366_10001920 Ga0075366_100019205 169
635 3300006195 Ga0075366_10093438 Ga0075366_100934382 169
636 3300006353 Ga0075370_10050650 Ga0075370_100506502 169
637 3300006353 Ga0075370_10093647 Ga0075370_100936472 169
638 3300014325 Ga0163163_10334055 Ga0163163_103340552 169
639 3300014497 Ga0182008_10301146 Ga0182008_103011462 169
640 3300028379 Ga0268266_10695368 Ga0268266_106953682 169
641 3300035695 Ga0373927_0620632 Ga0373927_0620632_36_554 169
642 3300048909 Ga0496106_0312225 Ga0496106_0312225_126_701 169
643 3300048910 Ga0496107_0293698 Ga0496107_0293698_619_1194 169
644 3300048911 Ga0496108_0081616 Ga0496108_0081616_1899_2474 169
645 3300048912 Ga0496109_0391540 Ga0496109_0391540_390_965 169
646 3300048914 Ga0496111_0201283 Ga0496111_0201283_444_1019 169
647 3300048915 Ga0496112_0296964 Ga0496112_0296964_360_935 169
648 3300048924 Ga0496121_0342173 Ga0496121_0342173_313_888 169
649 3300048929 Ga0496126_0169399 Ga0496126_0169399_672_1247 169
650 3300050489 nmdc:mga03683_99957_c1 nmdc:mga03683_99957_c1_200_709 169
651 3300050490 nmdc:mga03n38_20900_c1 nmdc:mga03n38_20900_c1_1919_2428 169
652 3300050492 nmdc:mga0yw44_47856_c1 nmdc:mga0yw44_47856_c1_609_1184 169
653 3300050492 nmdc:mga0yw44_67988_c1 nmdc:mga0yw44_67988_c1_1297_1818 169
654 3300050493 nmdc:mga0k408_2540_c1 nmdc:mga0k408_2540_c1_5163_5672 169
655 3300050493 nmdc:mga0k408_276333_c1 nmdc:mga0k408_276333_c1_400_975 169
656 3300050493 nmdc:mga0k408_59463_c1 nmdc:mga0k408_59463_c1_697_1218 169
657 3300050494 nmdc:mga06z11_112438_c1 nmdc:mga06z11_112438_c1_813_1322 169
658 3300050494 nmdc:mga06z11_177704_c1 nmdc:mga06z11_177704_c1_232_753 169
659 3300050495 nmdc:mga04h51_72127_c1 nmdc:mga04h51_72127_c1_390_965 169
660 3300050496 nmdc:mga07m45_15545_c1 nmdc:mga07m45_15545_c1_2478_2987 169
661 3300050496 nmdc:mga07m45_76360_c1 nmdc:mga07m45_76360_c1_1107_1628 169
662 3300050496 nmdc:mga07m45_98007_c1 nmdc:mga07m45_98007_c1_173_748 169
663 3300050512 nmdc:mga0n895_247511_c1 nmdc:mga0n895_247511_c1_1031_1606 169
664 3300050516 nmdc:mga0sz30_26942_c1 nmdc:mga0sz30_26942_c1_435_1010 169
665 3300053085 Ga0495619_0088889 Ga0495619_0088889_1157_1675 169
666 3300005340 Ga0070689_100932072 Ga0070689_1009320721 170
667 3300006051 Ga0075364_10332774 Ga0075364_103327742 170
668 3300025936 Ga0207670_10820931 Ga0207670_108209311 170
669 3300030522 Ga0307512_10251225 Ga0307512_102512252 170
670 3300031911 Ga0307412_10195692 Ga0307412_101956922 170
671 3300046535 Ga0495586_0055750 Ga0495586_0055750_1277_1795 170
672 3300048088 Ga0495602_0471732 Ga0495602_0471732_243_755 170
673 iso_pu_bacteria 2643221672 2644397478 170
674 iso_pu_bacteria 2738541307 2738885414 170
675 iso_pu_bacteria 2831265667 2831267318 170
676 iso_pu_bacteria 2838054893 2838060295 170
677 iso_pu_bacteria 2885198086 2885198400 170
678 iso_pu_bacteria 2885211737 2885212220 170
679 iso_pu_bacteria 2904541872 2904547522 170
680 iso_pu_bacteria 2928070936 2928075767 170
681 iso_pu_bacteria 2928084124 2928090314 170
682 iso_pu_bacteria 2929160207 2929164976 170
683 iso_pu_bacteria 2945909444 2945910393 170
684 iso_pu_bacteria 2945984333 2945987558 170
685 iso_pu_bacteria 2954767861 2954771109 170
686 3300003316 rootH1_10067490 rootH1_100674903 171
687 3300003760 Ga0055527_1007840 Ga0055527_10078402 171
688 3300003761 Ga0055535_1000181 Ga0055535_100018118 171
689 3300003762 Ga0055542_1000070 Ga0055542_100007037 171
690 3300005331 Ga0070670_100062923 Ga0070670_1000629233 171
691 3300005355 Ga0070671_100184336 Ga0070671_1001843362 171
692 3300005614 Ga0068856_100464903 Ga0068856_1004649031 171
693 3300005614 Ga0068856_100697178 Ga0068856_1006971782 171
694 3300005842 Ga0068858_100329235 Ga0068858_1003292352 171
695 3300005843 Ga0068860_100836486 Ga0068860_1008364862 171
696 3300006038 Ga0075365_10025036 Ga0075365_100250363 171
697 3300006178 Ga0075367_10216360 Ga0075367_102163602 171
698 3300006195 Ga0075366_10278006 Ga0075366_102780062 171
699 3300006353 Ga0075370_10074703 Ga0075370_100747031 171
700 3300009098 Ga0105245_10032198 Ga0105245_100321985 171
701 3300009545 Ga0105237_10284748 Ga0105237_102847482 171
702 3300011119 Ga0105246_10312740 Ga0105246_103127401 171
703 3300013306 Ga0163162_10438690 Ga0163162_104386901 171
704 3300013308 Ga0157375_10361348 Ga0157375_103613482 171
705 3300014968 Ga0157379_10067835 Ga0157379_100678353 171
706 3300025228 Ga0209672_102600 Ga0209672_1026003 171
707 3300025229 Ga0209147_100818 Ga0209147_10081811 171
708 3300025242 Ga0209258_100018 Ga0209258_100018477 171
709 3300025254 Ga0209148_1000030 Ga0209148_1000030477 171
710 3300025304 Ga0209257_1000096 Ga0209257_10000966 171
711 3300025914 Ga0207671_10021771 Ga0207671_100217712 171
712 3300025923 Ga0207681_11373958 Ga0207681_113739581 171
713 3300025931 Ga0207644_10052900 Ga0207644_100529003 171
714 3300025961 Ga0207712_10265375 Ga0207712_102653752 171
715 3300026035 Ga0207703_10329839 Ga0207703_103298392 171
716 3300026095 Ga0207676_10037774 Ga0207676_100377742 171
717 3300028556 Ga0265337_1016314 Ga0265337_10163144 171
718 3300028800 Ga0265338_10159825 Ga0265338_101598251 171
719 3300031235 Ga0265330_10022510 Ga0265330_100225102 171
720 3300031711 Ga0265314_10003622 Ga0265314_100036223 171
721 3300031711 Ga0265314_10281468 Ga0265314_102814682 171
722 3300035120 Ga0373957_0024419 Ga0373957_0024419_670_1236 171
723 3300035170 Ga0373943_0073263 Ga0373943_0073263_784_1350 171
724 3300035172 Ga0373955_0030881 Ga0373955_0030881_83_649 171
725 3300035724 Ga0373933_0219872 Ga0373933_0219872_470_1036 171
726 3300036401 Ga0373937_0002154 Ga0373937_0002154_1868_2434 171
727 3300037418 Ga0395900_0890065 Ga0395900_0890065_225_740 171
728 3300037471 Ga0395905_0039610 Ga0395905_0039610_3868_4383 171
729 3300038443 Ga0395901_0487733 Ga0395901_0487733_318_833 171
730 3300041486 Ga0451807_0994696 Ga0451807_0994696_95_610 171
731 3300046454 Ga0495592_0001467 Ga0495592_0001467_7992_8558 171
732 3300046461 Ga0495641_0209408 Ga0495641_0209408_59_625 171
733 3300046462 Ga0495651_0054642 Ga0495651_0054642_887_1453 171
734 3300046516 Ga0495628_0003085 Ga0495628_0003085_12594_13160 171
735 3300046529 Ga0495652_0002252 Ga0495652_0002252_5453_6019 171
736 3300046543 Ga0495645_0000223 Ga0495645_0000223_13105_13671 171
737 3300046559 Ga0495667_0080383 Ga0495667_0080383_877_1443 171
738 3300046616 Ga0495668_0340212 Ga0495668_0340212_17_532 171
739 3300046678 Ga0495599_0001359 Ga0495599_0001359_839_1405 171
740 3300046679 Ga0495623_0006317 Ga0495623_0006317_5044_5610 171
741 3300047317 Ga0495604_0001128 Ga0495604_0001128_7292_7858 171
742 3300048907 Ga0496104_0000537 Ga0496104_0000537_3667_4233 171
743 3300048908 Ga0496105_0014924 Ga0496105_0014924_4447_5013 171
744 3300048917 Ga0496114_0507988 Ga0496114_0507988_130_696 171
745 3300048918 Ga0496115_0431840 Ga0496115_0431840_471_1031 171
746 3300048924 Ga0496121_0045922 Ga0496121_0045922_410_970 171
747 3300048929 Ga0496126_0003472 Ga0496126_0003472_7585_8145 171
748 3300049575 Ga0501039_0132296 Ga0501039_0132296_191_712 171
749 3300050493 nmdc:mga0k408_238751_c1 nmdc:mga0k408_238751_c1_225_746 171
750 3300050494 nmdc:mga06z11_195557_c1 nmdc:mga06z11_195557_c1_508_1029 171
751 3300050496 nmdc:mga07m45_217611_c1 nmdc:mga07m45_217611_c1_276_836 171
752 3300050496 nmdc:mga07m45_24491_c1 nmdc:mga07m45_24491_c1_1968_2528 171
753 3300050496 nmdc:mga07m45_69720_c1 nmdc:mga07m45_69720_c1_50_610 171
754 3300053077 Ga0495601_0000048 Ga0495601_0000048_6419_6985 171
755 3300053084 Ga0495595_0001916 Ga0495595_0001916_63_629 171
756 3300053085 Ga0495619_0051116 Ga0495619_0051116_1154_1720 171
757 3300005334 Ga0068869_100440347 Ga0068869_1004403472 172
758 3300005338 Ga0068868_100309493 Ga0068868_1003094932 172
759 3300005354 Ga0070675_100248897 Ga0070675_1002488972 172
760 3300005356 Ga0070674_100063913 Ga0070674_1000639132 172
761 3300005367 Ga0070667_100190538 Ga0070667_1001905382 172
762 3300005455 Ga0070663_100066018 Ga0070663_1000660181 172
763 3300005457 Ga0070662_100037931 Ga0070662_1000379311 172
764 3300005459 Ga0068867_100171802 Ga0068867_1001718022 172
765 3300005548 Ga0070665_100904033 Ga0070665_1009040332 172
766 3300005563 Ga0068855_100373254 Ga0068855_1003732542 172
767 3300005577 Ga0068857_101297358 Ga0068857_1012973582 172
768 3300005578 Ga0068854_101159319 Ga0068854_1011593191 172
769 3300005718 Ga0068866_10069758 Ga0068866_100697582 172
770 3300006038 Ga0075365_10531405 Ga0075365_105314051 172
771 3300006051 Ga0075364_10128844 Ga0075364_101288442 172
772 3300006177 Ga0075362_10004627 Ga0075362_100046272 172
773 3300006177 Ga0075362_10131650 Ga0075362_101316501 172
774 3300006178 Ga0075367_10034473 Ga0075367_100344732 172
775 3300006186 Ga0075369_10024234 Ga0075369_100242343 172
776 3300006195 Ga0075366_10043155 Ga0075366_100431552 172
777 3300006353 Ga0075370_10021432 Ga0075370_100214322 172
778 3300006353 Ga0075370_10027627 Ga0075370_100276272 172
779 3300009093 Ga0105240_10020996 Ga0105240_100209962 172
780 3300009093 Ga0105240_10908124 Ga0105240_109081242 172
781 3300009148 Ga0105243_10521346 Ga0105243_105213462 172
782 3300009174 Ga0105241_10957463 Ga0105241_109574632 172
783 3300009545 Ga0105237_10231551 Ga0105237_102315512 172
784 3300010375 Ga0105239_10290619 Ga0105239_102906192 172
785 3300013104 Ga0157370_10225228 Ga0157370_102252282 172
786 3300014969 Ga0157376_10003714 Ga0157376_100037145 172
787 3300020070 Ga0206356_11249118 Ga0206356_112491182 172
788 3300025909 Ga0207705_10293441 Ga0207705_102934412 172
789 3300025913 Ga0207695_10231748 Ga0207695_102317482 172
790 3300025926 Ga0207659_10530613 Ga0207659_105306132 172
791 3300025932 Ga0207690_10719922 Ga0207690_107199222 172
792 3300025933 Ga0207706_10288281 Ga0207706_102882812 172
793 3300025945 Ga0207679_10333550 Ga0207679_103335502 172
794 3300025960 Ga0207651_10359083 Ga0207651_103590832 172
795 3300025972 Ga0207668_10269689 Ga0207668_102696892 172
796 3300025981 Ga0207640_10234272 Ga0207640_102342721 172
797 3300025986 Ga0207658_10239814 Ga0207658_102398142 172
798 3300026023 Ga0207677_10120554 Ga0207677_101205542 172
799 3300026067 Ga0207678_10127217 Ga0207678_101272172 172
800 3300026089 Ga0207648_10126250 Ga0207648_101262502 172
801 3300026089 Ga0207648_10218714 Ga0207648_102187142 172
802 3300026116 Ga0207674_10102413 Ga0207674_101024134 172
803 3300026116 Ga0207674_10618827 Ga0207674_106188271 172
804 3300026118 Ga0207675_100983785 Ga0207675_1009837852 172
805 3300026142 Ga0207698_10171166 Ga0207698_101711662 172
806 3300028786 Ga0307517_10248972 Ga0307517_102489722 172
807 3300031730 Ga0307516_10044179 Ga0307516_100441795 172
808 3300035725 Ga0373947_0017691 Ga0373947_0017691_520_1092 172
809 3300037312 Ga0395899_0002741 Ga0395899_0002741_10253_10771 172
810 3300037312 Ga0395899_0038874 Ga0395899_0038874_2784_3302 172
811 3300037418 Ga0395900_0056282 Ga0395900_0056282_1453_1971 172
812 3300037466 Ga0395898_0148039 Ga0395898_0148039_654_1172 172
813 3300037471 Ga0395905_0528220 Ga0395905_0528220_336_854 172
814 3300038443 Ga0395901_0065280 Ga0395901_0065280_1625_2143 172
815 3300038443 Ga0395901_0114966 Ga0395901_0114966_280_798 172
816 3300044693 Ga0466961_0269194 Ga0466961_0269194_77_595 172
817 3300044842 Ga0466957_0452003 Ga0466957_0452003_77_595 172
818 3300046457 Ga0495590_0015626 Ga0495590_0015626_1146_1664 172
819 3300046459 Ga0495629_0204200 Ga0495629_0204200_481_1053 172
820 3300046472 Ga0495580_0490489 Ga0495580_0490489_182_754 172
821 3300046499 Ga0495594_0219945 Ga0495594_0219945_237_809 172
822 3300046516 Ga0495628_0233259 Ga0495628_0233259_192_710 172
823 3300046517 Ga0495630_0096508 Ga0495630_0096508_1093_1665 172
824 3300046519 Ga0495632_0002822 Ga0495632_0002822_11401_11919 172
825 3300046530 Ga0495654_0270648 Ga0495654_0270648_70_588 172
826 3300046542 Ga0495597_0034401 Ga0495597_0034401_271_789 172
827 3300046616 Ga0495668_0280810 Ga0495668_0280810_319_837 172
828 3300046642 Ga0495634_0143811 Ga0495634_0143811_173_745 172
829 3300046660 Ga0495625_0148767 Ga0495625_0148767_330_848 172
830 3300046694 Ga0495649_0003779 Ga0495649_0003779_6145_6663 172
831 3300046810 Ga0495660_0011983 Ga0495660_0011983_426_944 172
832 3300047321 Ga0495676_0324590 Ga0495676_0324590_150_668 172
833 3300047443 Ga0495687_000454 Ga0495687_000454_22137_22655 172
834 3300047443 Ga0495687_003986 Ga0495687_003986_8455_8973 172
835 3300047443 Ga0495687_007598 Ga0495687_007598_1310_1828 172
836 3300049592 Ga0501076_0522117 Ga0501076_0522117_48_587 172
837 3300049741 Ga0501079_0102231 Ga0501079_0102231_607_1146 172
838 3300049742 Ga0501080_1201459 Ga0501080_1201459_69_608 172
839 3300050489 nmdc:mga03683_20442_c1 nmdc:mga03683_20442_c1_498_1022 172
840 3300050491 nmdc:mga00v17_256487_c1 nmdc:mga00v17_256487_c1_423_947 172
841 3300050493 nmdc:mga0k408_155748_c1 nmdc:mga0k408_155748_c1_566_1093 172
842 3300050493 nmdc:mga0k408_203237_c1 nmdc:mga0k408_203237_c1_64_588 172
843 3300050496 nmdc:mga07m45_12108_c1 nmdc:mga07m45_12108_c1_3370_3891 172
844 3300050496 nmdc:mga07m45_13479_c1 nmdc:mga07m45_13479_c1_3317_3835 172
845 3300050496 nmdc:mga07m45_384765_c1 nmdc:mga07m45_384765_c1_181_705 172
846 3300050509 nmdc:mga0qj67_48786_c1 nmdc:mga0qj67_48786_c1_792_1382 172
847 3300050510 nmdc:mga06r32_292876_c1 nmdc:mga06r32_292876_c1_797_1336 172
848 3300053077 Ga0495601_0013653 Ga0495601_0013653_4250_4822 172
849 3300053139 Ga0500568_0012568 Ga0500568_0012568_162_680 172
850 3300005327 Ga0070658_10361288 Ga0070658_103612882 173
851 3300005330 Ga0070690_100782446 Ga0070690_1007824462 173
852 3300005468 Ga0070707_100056627 Ga0070707_1000566272 173
853 3300006178 Ga0075367_10046736 Ga0075367_100467363 173
854 3300006195 Ga0075366_10026156 Ga0075366_100261564 173
855 3300006353 Ga0075370_10235180 Ga0075370_102351802 173
856 3300006931 Ga0097620_100295642 Ga0097620_1002956422 173
857 3300025910 Ga0207684_10008664 Ga0207684_100086647 173
858 3300025922 Ga0207646_10099838 Ga0207646_100998382 173
859 3300025972 Ga0207668_10717025 Ga0207668_107170252 173
860 3300042876 Ga0451577_0111006 Ga0451577_0111006_1215_1736 173
861 3300044735 Ga0466968_0081706 Ga0466968_0081706_70_618 173
862 3300045051 Ga0451576_0302630 Ga0451576_0302630_1057_1578 173
863 3300048905 Ga0496102_0426939 Ga0496102_0426939_687_1208 173
864 3300049571 Ga0501034_0087141 Ga0501034_0087141_202_735 173
865 3300049579 Ga0501043_0232610 Ga0501043_0232610_366_899 173
866 3300049742 Ga0501080_0062757 Ga0501080_0062757_2784_3317 173
867 3300049822 Ga0501035_0302515 Ga0501035_0302515_561_1094 173
868 3300049823 Ga0501044_0270157 Ga0501044_0270157_17_550 173
869 3300050493 nmdc:mga0k408_68971_c1 nmdc:mga0k408_68971_c1_161_703 173
870 3300050494 nmdc:mga06z11_124950_c1 nmdc:mga06z11_124950_c1_701_1243 173
871 3300001979 JGI24740J21852_10021053 JGI24740J21852_100210532 174
872 3300002773 JGI25152J39213_1008884 JGI25152J39213_10088842 174
873 3300002774 JGI25150J39212_1033110 JGI25150J39212_10331102 174
874 3300002987 JGI25159J45721_1019013 JGI25159J45721_10190132 174
875 3300003187 JGI25151J46595_10026451 JGI25151J46595_100264512 174
876 3300003215 JGI25153J46596_10030668 JGI25153J46596_100306681 174
877 3300003354 JGI25160J50197_1001363 JGI25160J50197_10013632 174
878 3300003374 JGI25161J50226_1002632 JGI25161J50226_10026321 174
879 3300003771 Ga0055526_1007214 Ga0055526_10072146 174
880 3300003773 Ga0055537_1007479 Ga0055537_10074793 174
881 3300003775 Ga0055524_1009023 Ga0055524_10090231 174
882 3300003781 Ga0055536_1001696 Ga0055536_100169611 174
883 3300003781 Ga0055536_1008117 Ga0055536_10081172 174
884 3300003781 Ga0055536_1018110 Ga0055536_10181102 174
885 3300003784 Ga0055534_1001432 Ga0055534_10014325 174
886 3300003790 Ga0055528_1031161 Ga0055528_10311612 174
887 3300003791 Ga0055530_10000952 Ga0055530_100009522 174
888 3300003791 Ga0055530_10009915 Ga0055530_100099154 174
889 3300003792 Ga0055540_1010090 Ga0055540_10100903 174
890 3300003792 Ga0055540_1028778 Ga0055540_10287782 174
891 3300003794 Ga0055531_10002573 Ga0055531_1000257311 174
892 3300003794 Ga0055531_10005367 Ga0055531_100053673 174
893 3300003794 Ga0055531_10011800 Ga0055531_100118004 174
894 3300004625 Ga0055543_1014300 Ga0055543_10143002 174
895 3300005262 Ga0065165_1059322 Ga0065165_10593222 174
896 3300005288 Ga0065714_10018495 Ga0065714_100184952 174
897 3300005288 Ga0065714_10019306 Ga0065714_100193062 174
898 3300005331 Ga0070670_100543968 Ga0070670_1005439681 174
899 3300005339 Ga0070660_100712685 Ga0070660_1007126852 174
900 3300005347 Ga0070668_100939419 Ga0070668_1009394192 174
901 3300005366 Ga0070659_100146861 Ga0070659_1001468612 174
902 3300005367 Ga0070667_100024212 Ga0070667_1000242124 174
903 3300005367 Ga0070667_100068095 Ga0070667_1000680953 174
904 3300005441 Ga0070700_100010807 Ga0070700_1000108072 174
905 3300005455 Ga0070663_100040079 Ga0070663_1000400791 174
906 3300005455 Ga0070663_100678710 Ga0070663_1006787101 174
907 3300005457 Ga0070662_100196401 Ga0070662_1001964012 174
908 3300005457 Ga0070662_100268139 Ga0070662_1002681392 174
909 3300005459 Ga0068867_100169163 Ga0068867_1001691633 174
910 3300005539 Ga0068853_100070695 Ga0068853_1000706952 174
911 3300005543 Ga0070672_100031656 Ga0070672_1000316562 174
912 3300005548 Ga0070665_100313478 Ga0070665_1003134782 174
913 3300005563 Ga0068855_100126649 Ga0068855_1001266492 174
914 3300005578 Ga0068854_100190571 Ga0068854_1001905712 174
915 3300005578 Ga0068854_100209311 Ga0068854_1002093112 174
916 3300005719 Ga0068861_100003730 Ga0068861_1000037307 174
917 3300005843 Ga0068860_100022098 Ga0068860_1000220988 174
918 3300006048 Ga0075363_100224768 Ga0075363_1002247682 174
919 3300006177 Ga0075362_10102779 Ga0075362_101027792 174
920 3300006186 Ga0075369_10255381 Ga0075369_102553812 174
921 3300006195 Ga0075366_10072549 Ga0075366_100725492 174
922 3300006237 Ga0097621_100213605 Ga0097621_1002136052 174
923 3300006353 Ga0075370_10012893 Ga0075370_100128934 174
924 3300006353 Ga0075370_10020752 Ga0075370_100207524 174
925 3300006353 Ga0075370_10034702 Ga0075370_100347022 174
926 3300006358 Ga0068871_100295793 Ga0068871_1002957932 174
927 3300006871 Ga0075434_100502909 Ga0075434_1005029092 174
928 3300006881 Ga0068865_100008038 Ga0068865_1000080388 174
929 3300009098 Ga0105245_11021823 Ga0105245_110218231 174
930 3300009177 Ga0105248_10137439 Ga0105248_101374394 174
931 3300009553 Ga0105249_10259582 Ga0105249_102595822 174
932 3300013104 Ga0157370_10018806 Ga0157370_100188062 174
933 3300013306 Ga0163162_10005487 Ga0163162_1000548711 174
934 3300013306 Ga0163162_10377705 Ga0163162_103777052 174
935 3300014968 Ga0157379_10155995 Ga0157379_101559952 174
936 3300014968 Ga0157379_10215452 Ga0157379_102154522 174
937 3300014969 Ga0157376_10849912 Ga0157376_108499121 174
938 3300015265 Ga0182005_1048462 Ga0182005_10484622 174
939 3300015683 Ga0183362_10001 Ga0183362_10001280 174
940 3300017792 Ga0163161_10000554 Ga0163161_100005548 174
941 3300017792 Ga0163161_10043568 Ga0163161_100435683 174
942 3300017792 Ga0163161_10047639 Ga0163161_100476393 174
943 3300025258 Ga0209129_1002798 Ga0209129_10027982 174
944 3300025263 Ga0209565_1003173 Ga0209565_10031735 174
945 3300025273 Ga0209673_1000417 Ga0209673_100041755 174
946 3300025284 Ga0209130_1000997 Ga0209130_100099712 174
947 3300025284 Ga0209130_1002198 Ga0209130_10021985 174
948 3300025284 Ga0209130_1004584 Ga0209130_10045843 174
949 3300025291 Ga0209675_1009639 Ga0209675_10096394 174
950 3300025291 Ga0209675_1031059 Ga0209675_10310592 174
951 3300025292 Ga0209676_1000004 Ga0209676_1000004605 174
952 3300025292 Ga0209676_1000538 Ga0209676_100053840 174
953 3300025292 Ga0209676_1013442 Ga0209676_10134423 174
954 3300025294 Ga0209025_1011201 Ga0209025_10112014 174
955 3300025294 Ga0209025_1043412 Ga0209025_10434122 174
956 3300025295 Ga0209564_1000070 Ga0209564_100007036 174
957 3300025295 Ga0209564_1025311 Ga0209564_10253112 174
958 3300025297 Ga0209758_1005089 Ga0209758_10050899 174
959 3300025298 Ga0209050_1000002 Ga0209050_10000021115 174
960 3300025298 Ga0209050_1007320 Ga0209050_10073205 174
961 3300025299 Ga0209256_1000047 Ga0209256_100004748 174
962 3300025302 Ga0207426_1000184 Ga0207426_100018448 174
963 3300025303 Ga0209051_1000002 Ga0209051_1000002884 174
964 3300025303 Ga0209051_1000820 Ga0209051_100082010 174
965 3300025303 Ga0209051_1003554 Ga0209051_10035546 174
966 3300025304 Ga0209257_1000002 Ga0209257_10000021025 174
967 3300025304 Ga0209257_1000149 Ga0209257_100014981 174
968 3300025304 Ga0209257_1011042 Ga0209257_10110423 174
969 3300025728 Ga0207655_1002512 Ga0207655_10025129 174
970 3300025728 Ga0207655_1135937 Ga0207655_11359371 174
971 3300025893 Ga0207682_10174381 Ga0207682_101743812 174
972 3300025909 Ga0207705_10445903 Ga0207705_104459032 174
973 3300025911 Ga0207654_10590207 Ga0207654_105902072 174
974 3300025913 Ga0207695_10282140 Ga0207695_102821402 174
975 3300025919 Ga0207657_10513331 Ga0207657_105133311 174
976 3300025924 Ga0207694_10046553 Ga0207694_100465533 174
977 3300025932 Ga0207690_10109417 Ga0207690_101094172 174
978 3300025932 Ga0207690_10259522 Ga0207690_102595222 174
979 3300025933 Ga0207706_10113136 Ga0207706_101131362 174
980 3300025934 Ga0207686_10085193 Ga0207686_100851932 174
981 3300025935 Ga0207709_10012501 Ga0207709_100125015 174
982 3300025938 Ga0207704_10026450 Ga0207704_100264501 174
983 3300025940 Ga0207691_10871044 Ga0207691_108710442 174
984 3300025942 Ga0207689_10111455 Ga0207689_101114552 174
985 3300025942 Ga0207689_10267866 Ga0207689_102678662 174
986 3300025945 Ga0207679_10058416 Ga0207679_100584163 174
987 3300025949 Ga0207667_10109036 Ga0207667_101090362 174
988 3300025961 Ga0207712_10137505 Ga0207712_101375052 174
989 3300025981 Ga0207640_10156521 Ga0207640_101565212 174
990 3300025986 Ga0207658_10088692 Ga0207658_100886922 174
991 3300025986 Ga0207658_10254518 Ga0207658_102545181 174
992 3300025986 Ga0207658_10602331 Ga0207658_106023312 174
993 3300025986 Ga0207658_10804100 Ga0207658_108041001 174
994 3300026035 Ga0207703_10559626 Ga0207703_105596262 174
995 3300026035 Ga0207703_10572846 Ga0207703_105728462 174
996 3300026067 Ga0207678_10051459 Ga0207678_100514593 174
997 3300026075 Ga0207708_10017331 Ga0207708_100173312 174
998 3300026088 Ga0207641_10622035 Ga0207641_106220352 174
999 3300026089 Ga0207648_10006213 Ga0207648_100062133 174
1000 3300026116 Ga0207674_10270306 Ga0207674_102703062 174
1001 3300026118 Ga0207675_100015760 Ga0207675_1000157602 174
1002 3300026121 Ga0207683_10070377 Ga0207683_100703773 174
1003 3300026142 Ga0207698_10348204 Ga0207698_103482042 174
1004 3300028380 Ga0268265_10448564 Ga0268265_104485641 174
1005 3300028380 Ga0268265_10644054 Ga0268265_106440542 174
1006 3300028794 Ga0307515_10499810 Ga0307515_104998101 174
1007 3300030745 Ga0316182_1331932 Ga0316182_13319321 174
1008 3300031251 Ga0265327_10000851 Ga0265327_1000085112 174
1009 3300031456 Ga0307513_10400042 Ga0307513_104000422 174
1010 3300031730 Ga0307516_10001245 Ga0307516_1000124529 174
1011 3300032002 Ga0307416_100028565 Ga0307416_1000285656 174
1012 3300035695 Ga0373927_0382120 Ga0373927_0382120_230_814 174
1013 3300037068 Ga0373925_0005806 Ga0373925_0005806_6094_6630 174
1014 3300037418 Ga0395900_0107563 Ga0395900_0107563_983_1507 174
1015 3300037471 Ga0395905_0413336 Ga0395905_0413336_490_1014 174
1016 3300038443 Ga0395901_0851689 Ga0395901_0851689_110_718 174
1017 3300039437 Ga0436365_0805345 Ga0436365_0805345_125_664 174
1018 3300046453 Ga0495627_031474 Ga0495627_031474_11_535 174
1019 3300046463 Ga0495653_0325123 Ga0495653_0325123_293_817 174
1020 3300046471 Ga0495650_0021840 Ga0495650_0021840_187_711 174
1021 3300046475 Ga0495639_0008572 Ga0495639_0008572_2120_2644 174
1022 3300046507 Ga0495606_0114549 Ga0495606_0114549_223_747 174
1023 3300046515 Ga0495620_0039477 Ga0495620_0039477_1383_1907 174
1024 3300046524 Ga0495648_0328056 Ga0495648_0328056_91_615 174
1025 3300046525 Ga0495663_0013380 Ga0495663_0013380_581_1105 174
1026 3300046543 Ga0495645_0079139 Ga0495645_0079139_844_1386 174
1027 3300046558 Ga0495633_0252472 Ga0495633_0252472_79_603 174
1028 3300046615 Ga0495656_0007454 Ga0495656_0007454_1743_2267 174
1029 3300046615 Ga0495656_0066211 Ga0495656_0066211_382_906 174
1030 3300046665 Ga0495661_0297927 Ga0495661_0297927_13_537 174
1031 3300046675 Ga0495657_0403820 Ga0495657_0403820_203_745 174
1032 3300046680 Ga0495646_0461471 Ga0495646_0461471_38_562 174
1033 3300046683 Ga0495658_0232273 Ga0495658_0232273_544_1068 174
1034 3300046689 Ga0495613_0337159 Ga0495613_0337159_96_629 174
1035 3300046691 Ga0495670_0039435 Ga0495670_0039435_645_1169 174
1036 3300046691 Ga0495670_0185694 Ga0495670_0185694_274_798 174
1037 3300047318 Ga0495636_0065206 Ga0495636_0065206_378_920 174
1038 3300047444 Ga0495675_0577708 Ga0495675_0577708_90_614 174
1039 3300048090 Ga0495615_0000971 Ga0495615_0000971_1124_1666 174
1040 3300048090 Ga0495615_0038722 Ga0495615_0038722_423_947 174
1041 3300048903 Ga0496100_0021706 Ga0496100_0021706_1740_2264 174
1042 3300048904 Ga0496101_0014125 Ga0496101_0014125_2346_2870 174
1043 3300048905 Ga0496102_0018035 Ga0496102_0018035_637_1161 174
1044 3300048905 Ga0496102_0440083 Ga0496102_0440083_48_632 174
1045 3300048906 Ga0496103_0050404 Ga0496103_0050404_1585_2109 174
1046 3300048907 Ga0496104_0004825 Ga0496104_0004825_1026_1550 174
1047 3300048908 Ga0496105_0040565 Ga0496105_0040565_2667_3191 174
1048 3300048909 Ga0496106_0284724 Ga0496106_0284724_618_1142 174
1049 3300048910 Ga0496107_0039012 Ga0496107_0039012_165_689 174
1050 3300048912 Ga0496109_0087720 Ga0496109_0087720_1979_2503 174
1051 3300048913 Ga0496110_0058046 Ga0496110_0058046_1885_2469 174
1052 3300048913 Ga0496110_0490069 Ga0496110_0490069_45_569 174
1053 3300048914 Ga0496111_0036982 Ga0496111_0036982_2302_2826 174
1054 3300048914 Ga0496111_0045794 Ga0496111_0045794_215_799 174
1055 3300048915 Ga0496112_0862064 Ga0496112_0862064_108_632 174
1056 3300048917 Ga0496114_0391617 Ga0496114_0391617_481_1005 174
1057 3300048925 Ga0496122_0014937 Ga0496122_0014937_6021_6545 174
1058 3300048926 Ga0496123_0154698 Ga0496123_0154698_208_732 174
1059 3300050493 nmdc:mga0k408_62427_c1 nmdc:mga0k408_62427_c1_144_686 174
1060 3300053079 Ga0500610_0012836 Ga0500610_0012836_3282_3806 174
1061 3300053085 Ga0495619_0310887 Ga0495619_0310887_196_729 174
1062 3300053111 Ga0500572_012363 Ga0500572_012363_1455_1979 174
1063 3300053121 Ga0500607_054964 Ga0500607_054964_1207_1731 174
1064 3300055283 Ga0500661_023727 Ga0500661_023727_415_939 174
1065 iso_pu_bacteria 2738543013 2739251984 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

55

187

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ceo-assembly1.cif.gz_c yeast rna polymerase ii transcription pre-initiation complex with core mediator and the +1 nucleosome 0.669 83 172
6z1u-assembly1.cif.gz_M bovine atp synthase f1c8-peripheral stalk domain, state 3 0.6557 86 158
5m48-assembly1.cif.gz_A-2 coiled coil domain of rtt103p 0.6534 83 173
6zik-assembly1.cif.gz_O bovine atp synthase rotor domain, state 3 0.643 89 159
7tkh-assembly1.cif.gz_6 yeast atp synthase state 2catalytic(b) with 10 mm atp backbone model 0.6373 78 158
ID Description Score Start End Superfamily
af_Q9NP81_58_171_1.10.287.40 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.8044 87 156 1.10.287.40
af_O17010_2_324_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7381 89 157 1.20.1070.10
af_E1JIB0_51_138_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.7252 59 155 1.20.120.350
af_Q2RA30_2_105_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7056 58 154 1.20.58.90
af_E1JIB0_51_138_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.7031 59 155 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A3L9Y3L5-F1-model_v4 TRAP transporter small permease protein 0.8581 8 157 GO:0005886
GO:0015740
GO:0022857
AF-A0A839V8E0-F1-model_v4 TRAP transporter small permease protein 0.8469 14 161 GO:0005886
GO:0015740
GO:0022857
AF-A0A1F4F3F3-F1-model_v4 TRAP transporter small permease protein 0.8346 10 158 GO:0005886
GO:0022857
AF-A0A1X7PQV7-F1-model_v4 TRAP transporter small permease protein 0.833 9 157 GO:0005886
GO:0015740
GO:0022857
AF-A0A6N9T5E4-F1-model_v4 TRAP transporter small permease protein 0.8326 10 160 GO:0005886
GO:0015740
GO:0022857

Feature Viewer

pLDDT pTM Quality
71.86 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map