F489367

General Info

Members Datasets Scaffolds Average Seq Length
1065 484 1039 146

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10083281|Ga0075368_100832812
Length 156
Sequence VIFAHPGHRSMSIEDDVALFERVPTLSLLGTAALRMLAIGSEQRDFSAGDYLFNAGDEADAGYIVQRGSFRVEDGGAEVVAGPGSLIGELALIVAMKRPSSAVALDHASVIRVARSLFQRVLESDPAAARRLRDELATRTSQLASDILMAGAKLSI

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
4 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
5 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
6 2791355199
7 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
8 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
9 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
10 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
11 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
12 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
13 2906610324
14 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
15 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
16 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
17 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
18 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
19 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
20 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
21 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
116 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
117 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
120 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
151 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
152 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
217 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
218 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
219 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
225 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
226 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
227 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
228 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
229 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
230 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
231 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
232 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
235 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
236 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
237 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
247 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
248 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
249 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
250 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
251 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
252 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
253 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
255 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
264 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
265 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
267 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
268 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
269 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
270 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
271 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
280 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
281 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
282 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
283 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
284 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
285 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
286 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
287 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
288 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
289 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
290 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
291 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
292 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
293 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
296 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
299 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
300 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
303 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
304 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
305 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
306 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
312 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
313 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
314 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
315 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
316 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
317 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
318 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
319 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
320 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
321 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
322 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
323 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
324 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
325 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
326 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
327 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
328 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
329 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
330 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
335 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
336 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
337 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
338 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
339 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
340 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
341 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
342 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
343 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
344 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
347 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
348 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
349 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
350 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
351 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
352 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
353 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
354 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
355 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
356 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
357 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
358 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
359 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
360 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
361 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
362 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
363 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
364 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
365 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
366 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
367 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
368 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
369 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
370 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
371 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
372 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
373 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
374 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
375 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
376 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
377 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
378 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
379 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
380 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
381 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
382 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
383 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
384 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
385 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
386 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
387 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
388 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
389 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
390 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
391 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
392 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
393 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
394 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
395 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
396 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
397 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
398 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
399 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
400 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
401 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
402 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
403 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
404 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
405 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
406 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
407 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
408 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
409 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
410 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
418 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
419 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
420 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
421 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
422 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
423 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
424 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
425 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
426 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
427 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
430 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
431 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
432 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
433 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
434 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
435 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
436 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
437 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
438 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
439 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
440 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
441 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
442 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
443 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
444 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
445 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
446 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
447 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
448 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
449 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
450 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
451 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
452 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
453 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
454 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
455 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
456 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
457 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
458 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
459 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
460 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
461 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
462 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
463 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
464 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
465 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
466 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
467 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
468 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
469 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
470 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
471 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
472 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
473 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
474 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
475 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
476 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
477 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
478 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
479 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
480 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
481 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
482 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
483 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
484 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 0
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.7
Nodule 2.35
Rhizoplane 7.98
Rhizosphere 76.15
Stem 0
Stem Tuber 0
Unclassified 5.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005031 3300003203 Bacteria 6140
2 JGI25165J46597_1022757 3300003214 Bacteria 817
3 JGI25404J52841_10001308 3300003659 Bacteria 4327
4 JGI25405J52794_10026811 3300003911 Bacteria 1185
5 Ga0065715_10043807 3300005293 Bacteria 1176
6 Ga0070683_100057276 3300005329 Bacteria 3620
7 Ga0070670_100476247 3300005331 Bacteria 1108
8 Ga0070677_10344105 3300005333 Bacteria 771
9 Ga0068869_100101991 3300005334 Bacteria 2171
10 Ga0068869_100229449 3300005334 Bacteria 1474
11 Ga0068869_100340376 3300005334 Bacteria 1220
12 Ga0068869_100498288 3300005334 Bacteria 1016
13 Ga0070666_10161456 3300005335 Bacteria 1566
14 Ga0070666_10488888 3300005335 Bacteria 892
15 Ga0070680_100054700 3300005336 Bacteria 3260
16 Ga0070682_100055337 3300005337 Bacteria 2492
17 Ga0068868_100019711 3300005338 Bacteria 5057
18 Ga0068868_100022147 3300005338 Bacteria 4792
19 Ga0068868_100319979 3300005338 Bacteria 1321
20 Ga0068868_100641910 3300005338 Bacteria 944
21 Ga0068868_100847586 3300005338 Bacteria 828
22 Ga0070660_100036213 3300005339 Bacteria 3736
23 Ga0070660_100406858 3300005339 Bacteria 1126
24 Ga0070689_100355605 3300005340 Bacteria 1229
25 Ga0070687_100480020 3300005343 Bacteria 833
26 Ga0070661_100039129 3300005344 Bacteria 3455
27 Ga0070661_100139697 3300005344 Bacteria 1825
28 Ga0070668_100096268 3300005347 Bacteria 2339
29 Ga0070668_100100324 3300005347 Bacteria 2293
30 Ga0070668_100291344 3300005347 Bacteria 1366
31 Ga0070668_100493975 3300005347 Bacteria 1058
32 Ga0070668_100588024 3300005347 Bacteria 972
33 Ga0070668_100668867 3300005347 Bacteria 913
34 Ga0070668_101115051 3300005347 Bacteria 712
35 Ga0070668_101217857 3300005347 Bacteria 682
36 Ga0070668_101427324 3300005347 Bacteria 631
37 Ga0070669_100190221 3300005353 Bacteria 1610
38 Ga0070669_101073698 3300005353 Bacteria 693
39 Ga0070675_100283247 3300005354 Bacteria 1457
40 Ga0070675_100328839 3300005354 Bacteria 1351
41 Ga0070671_100189782 3300005355 Bacteria 1741
42 Ga0070671_100511413 3300005355 Bacteria 1033
43 Ga0070671_100575055 3300005355 Bacteria 973
44 Ga0070674_100080106 3300005356 Bacteria 2331
45 Ga0070674_100242257 3300005356 Bacteria 1412
46 Ga0070673_100075656 3300005364 Bacteria 2716
47 Ga0070673_100205132 3300005364 Bacteria 1699
48 Ga0070688_100368798 3300005365 Bacteria 1056
49 Ga0070659_100083150 3300005366 Bacteria 2558
50 Ga0070659_100090516 3300005366 Bacteria 2452
51 Ga0070659_100628436 3300005366 Bacteria 925
52 Ga0070659_100837153 3300005366 Bacteria 801
53 Ga0070667_100339874 3300005367 Bacteria 1357
54 Ga0070709_10001880 3300005434 Bacteria 11387
55 Ga0070709_10251445 3300005434 Bacteria 1274
56 Ga0070709_10558577 3300005434 Bacteria 877
57 Ga0070714_100166014 3300005435 Bacteria 2001
58 Ga0070714_100938018 3300005435 Bacteria 841
59 Ga0070713_100003661 3300005436 Bacteria 10174
60 Ga0070713_100254527 3300005436 Bacteria 1603
61 Ga0070713_100432354 3300005436 Bacteria 1234
62 Ga0070710_10001236 3300005437 Bacteria 12109
63 Ga0070710_10767458 3300005437 Bacteria 686
64 Ga0070701_10046388 3300005438 Bacteria 2234
65 Ga0070711_100000660 3300005439 Bacteria 18001
66 Ga0070694_100190827 3300005444 Bacteria 1521
67 Ga0070663_100004283 3300005455 Bacteria 8352
68 Ga0070663_100006019 3300005455 Bacteria 7261
69 Ga0070663_100041490 3300005455 Bacteria 3228
70 Ga0070663_100106616 3300005455 Bacteria 2099
71 Ga0070663_100145967 3300005455 Bacteria 1810
72 Ga0070663_100513745 3300005455 Bacteria 996
73 Ga0070678_100101607 3300005456 Bacteria 2229
74 Ga0070678_100155518 3300005456 Bacteria 1846
75 Ga0070678_100239872 3300005456 Bacteria 1515
76 Ga0070678_100463077 3300005456 Bacteria 1113
77 Ga0070662_100068881 3300005457 Bacteria 2602
78 Ga0070662_100568075 3300005457 Bacteria 952
79 Ga0070681_10041351 3300005458 Bacteria 4620
80 Ga0070685_10197790 3300005466 Bacteria 1305
81 Ga0070685_10299751 3300005466 Bacteria 1083
82 Ga0070707_100247197 3300005468 Bacteria 1736
83 Ga0070698_100250562 3300005471 Bacteria 1704
84 Ga0070698_100679092 3300005471 Bacteria 972
85 Ga0070699_100747027 3300005518 Bacteria 895
86 Ga0070679_100044363 3300005530 Bacteria 4429
87 Ga0070679_100137917 3300005530 Bacteria 2420
88 Ga0070679_101313556 3300005530 Bacteria 669
89 Ga0070684_100013455 3300005535 Bacteria 6598
90 Ga0070697_100040762 3300005536 Bacteria 3758
91 Ga0070697_100164270 3300005536 Bacteria 1877
92 Ga0068853_100012684 3300005539 Bacteria 6862
93 Ga0068853_100320184 3300005539 Bacteria 1437
94 Ga0068853_100409342 3300005539 Bacteria 1270
95 Ga0068853_100438174 3300005539 Bacteria 1228
96 Ga0070672_100111060 3300005543 Bacteria 2234
97 Ga0070686_100156329 3300005544 Bacteria 1601
98 Ga0070686_100695189 3300005544 Bacteria 810
99 Ga0070695_100460213 3300005545 Bacteria 976
100 Ga0070695_100963103 3300005545 Bacteria 692
101 Ga0070696_100326881 3300005546 Bacteria 1182
102 Ga0070696_100781622 3300005546 Bacteria 784
103 Ga0070693_100030109 3300005547 Bacteria 2966
104 Ga0070693_100820982 3300005547 Bacteria 691
105 Ga0070665_100024472 3300005548 Bacteria 6081
106 Ga0070665_100039914 3300005548 Bacteria 4719
107 Ga0070665_100171968 3300005548 Bacteria 2167
108 Ga0070665_100217866 3300005548 Bacteria 1909
109 Ga0070665_100600358 3300005548 Bacteria 1114
110 Ga0070665_100860059 3300005548 Bacteria 920
111 Ga0070665_101112290 3300005548 Bacteria 801
112 Ga0070665_101374247 3300005548 Bacteria 715
113 Ga0070704_100329757 3300005549 Bacteria 1282
114 Ga0068855_100152875 3300005563 Bacteria 2623
115 Ga0068855_100325655 3300005563 Bacteria 1697
116 Ga0068855_100805940 3300005563 Bacteria 998
117 Ga0070664_100226362 3300005564 Bacteria 1675
118 Ga0070664_101090609 3300005564 Bacteria 752
119 Ga0068857_100018485 3300005577 Bacteria 6114
120 Ga0068857_100300019 3300005577 Bacteria 1481
121 Ga0068857_100744212 3300005577 Bacteria 933
122 Ga0068854_100103682 3300005578 Bacteria 2136
123 Ga0068854_101170817 3300005578 Bacteria 688
124 Ga0068856_100187404 3300005614 Bacteria 2083
125 Ga0068856_100342633 3300005614 Bacteria 1513
126 Ga0070702_100030607 3300005615 Bacteria 2936
127 Ga0070702_100463897 3300005615 Bacteria 922
128 Ga0068852_100061074 3300005616 Bacteria 3274
129 Ga0068852_100283593 3300005616 Bacteria 1598
130 Ga0068852_100437310 3300005616 Bacteria 1293
131 Ga0068859_100143978 3300005617 Bacteria 2457
132 Ga0068859_100163963 3300005617 Bacteria 2302
133 Ga0068859_100285767 3300005617 Bacteria 1742
134 Ga0068859_100387875 3300005617 Bacteria 1492
135 Ga0068864_100215262 3300005618 Bacteria 1771
136 Ga0068864_100470018 3300005618 Bacteria 1205
137 Ga0068866_10223485 3300005718 Bacteria 1137
138 Ga0068861_100278047 3300005719 Bacteria 1440
139 Ga0068861_101297616 3300005719 Bacteria 708
140 Ga0068851_10011859 3300005834 Bacteria 4097
141 Ga0068851_10219431 3300005834 Bacteria 1068
142 Ga0068851_10387661 3300005834 Bacteria 820
143 Ga0068863_100232337 3300005841 Bacteria 1779
144 Ga0068863_100333555 3300005841 Bacteria 1474
145 Ga0068863_101461091 3300005841 Bacteria 692
146 Ga0068858_100016049 3300005842 Bacteria 7036
147 Ga0068858_100057164 3300005842 Bacteria 3605
148 Ga0068858_100425075 3300005842 Bacteria 1278
149 Ga0068858_101043936 3300005842 Bacteria 801
150 Ga0068860_100086214 3300005843 Bacteria 2988
151 Ga0068860_100326155 3300005843 Bacteria 1507
152 Ga0068862_100351637 3300005844 Bacteria 1367
153 Ga0081455_10005984 3300005937 Bacteria 13195
154 Ga0081455_10008111 3300005937 Bacteria 10962
155 Ga0081455_10011164 3300005937 Bacteria 9043
156 Ga0081455_10028676 3300005937 Bacteria 5082
157 Ga0081455_10277173 3300005937 Bacteria 1213
158 Ga0081455_10296594 3300005937 Bacteria 1162
159 Ga0081538_10031555 3300005981 Bacteria 3570
160 Ga0081540_1001950 3300005983 Bacteria 17252
161 Ga0081540_1013355 3300005983 Bacteria 5344
162 Ga0081540_1015913 3300005983 Bacteria 4740
163 Ga0081540_1022081 3300005983 Bacteria 3766
164 Ga0081540_1023147 3300005983 Bacteria 3645
165 Ga0081540_1025816 3300005983 Bacteria 3370
166 Ga0081540_1059141 3300005983 Bacteria 1842
167 Ga0081540_1080759 3300005983 Bacteria 1465
168 Ga0081540_1096413 3300005983 Bacteria 1287
169 Ga0081540_1209291 3300005983 Bacteria 703
170 Ga0081539_10001064 3300005985 Bacteria 50201
171 Ga0081539_10158403 3300005985 Bacteria 1082
172 Ga0070717_10104664 3300006028 Bacteria 2408
173 Ga0075368_10036443 3300006042 Bacteria 1922
174 Ga0075368_10083281 3300006042 Bacteria 1303
175 Ga0075363_100036055 3300006048 Bacteria 2592
176 Ga0075363_100252532 3300006048 Bacteria 1016
177 Ga0075364_10535182 3300006051 Bacteria 801
178 Ga0070715_10000108 3300006163 Bacteria 20251
179 Ga0070715_10061039 3300006163 Bacteria 1655
180 Ga0070716_100003373 3300006173 Bacteria 7517
181 Ga0070716_100081143 3300006173 Bacteria 1936
182 Ga0070716_101381619 3300006173 Bacteria 572
183 Ga0070712_100175596 3300006175 Bacteria 1666
184 Ga0075362_10110465 3300006177 Bacteria 1293
185 Ga0075362_10175531 3300006177 Bacteria 1037
186 Ga0075362_10194650 3300006177 Bacteria 985
187 Ga0075367_10019052 3300006178 Bacteria 3799
188 Ga0075367_10584169 3300006178 Bacteria 710
189 Ga0075369_10065526 3300006186 Bacteria 1592
190 Ga0075369_10091113 3300006186 Bacteria 1361
191 Ga0075369_10120898 3300006186 Bacteria 1185
192 Ga0075369_10285141 3300006186 Bacteria 770
193 Ga0075366_10263289 3300006195 Bacteria 1052
194 Ga0075366_10378298 3300006195 Bacteria 870
195 Ga0097621_100059415 3300006237 Bacteria 3130
196 Ga0097621_100356720 3300006237 Bacteria 1302
197 Ga0097621_100562793 3300006237 Bacteria 1039
198 Ga0097621_101578693 3300006237 Bacteria 623
199 Ga0075370_10101372 3300006353 Bacteria 1666
200 Ga0075370_10298076 3300006353 Bacteria 958
201 Ga0075370_10309862 3300006353 Bacteria 940
202 Ga0075370_10655801 3300006353 Bacteria 637
203 Ga0068871_100274748 3300006358 Bacteria 1472
204 Ga0068871_100697797 3300006358 Bacteria 930
205 Ga0075428_100085123 3300006844 Bacteria 3448
206 Ga0075430_100416688 3300006846 Bacteria 1109
207 Ga0075433_10113605 3300006852 Bacteria 2402
208 Ga0075434_100071865 3300006871 Bacteria 3452
209 Ga0075434_101486958 3300006871 Bacteria 687
210 Ga0068865_100137618 3300006881 Bacteria 1837
211 Ga0075436_100065143 3300006914 Bacteria 2519
212 Ga0097620_100143973 3300006931 Bacteria 2457
213 Ga0097620_100163966 3300006931 Bacteria 2302
214 Ga0097620_100285751 3300006931 Bacteria 1742
215 Ga0097620_100387894 3300006931 Bacteria 1492
216 Ga0099825_1041366 3300006941 Bacteria 1326
217 Ga0099824_1013118 3300006942 Bacteria 8741
218 Ga0099822_1000007 3300006943 Bacteria 77453
219 Ga0075435_100022140 3300007076 Bacteria 4900
220 Ga0075435_101589091 3300007076 Bacteria 574
221 Ga0099794_10003899 3300007265 Bacteria 5778
222 Ga0099794_10022739 3300007265 Bacteria 2860
223 Ga0099794_10071677 3300007265 Bacteria 1698
224 Ga0099794_10280335 3300007265 Bacteria 862
225 Ga0099795_10004002 3300007788 Bacteria 3742
226 Ga0099795_10025241 3300007788 Bacteria 1991
227 Ga0099795_10385447 3300007788 Bacteria 634
228 Ga0105250_10031767 3300009092 Bacteria 2120
229 Ga0105250_10309136 3300009092 Bacteria 685
230 Ga0105240_10013534 3300009093 Bacteria 11198
231 Ga0105240_10465454 3300009093 Bacteria 1412
232 Ga0105240_12409352 3300009093 Bacteria 545
233 Ga0105245_10305400 3300009098 Bacteria 1563
234 Ga0105245_10986325 3300009098 Bacteria 886
235 Ga0105245_11532193 3300009098 Bacteria 718
236 Ga0105245_11895014 3300009098 Bacteria 649
237 Ga0105247_10148239 3300009101 Bacteria 1544
238 Ga0105247_10231821 3300009101 Bacteria 1254
239 Ga0114129_10144590 3300009147 Bacteria 3258
240 Ga0114129_12077105 3300009147 Bacteria 686
241 Ga0105243_10340224 3300009148 Bacteria 1374
242 Ga0105243_10665406 3300009148 Bacteria 1011
243 Ga0105243_11826886 3300009148 Bacteria 639
244 Ga0105243_12315773 3300009148 Bacteria 575
245 Ga0105243_12826006 3300009148 Bacteria 526
246 Ga0105241_10241838 3300009174 Bacteria 1526
247 Ga0105241_10888921 3300009174 Bacteria 826
248 Ga0105242_10405567 3300009176 Bacteria 1273
249 Ga0105242_10689974 3300009176 Bacteria 998
250 Ga0105242_11578412 3300009176 Bacteria 689
251 Ga0105248_10403979 3300009177 Bacteria 1538
252 Ga0105237_10017081 3300009545 Bacteria 7528
253 Ga0105237_10022854 3300009545 Bacteria 6414
254 Ga0105237_10291074 3300009545 Bacteria 1636
255 Ga0105237_10437709 3300009545 Bacteria 1313
256 Ga0105237_11123598 3300009545 Bacteria 792
257 Ga0105237_11415667 3300009545 Bacteria 702
258 Ga0105238_10160027 3300009551 Bacteria 2227
259 Ga0105238_10284200 3300009551 Bacteria 1636
260 Ga0105238_10656870 3300009551 Bacteria 1059
261 Ga0105238_11001183 3300009551 Bacteria 857
262 Ga0105249_10058990 3300009553 Bacteria 3519
263 Ga0105249_11057152 3300009553 Bacteria 881
264 Ga0105249_11292009 3300009553 Bacteria 801
265 Ga0105249_11546025 3300009553 Bacteria 736
266 Ga0099796_10070681 3300010159 Bacteria 1259
267 Ga0099796_10262636 3300010159 Bacteria 721
268 Ga0099796_10288461 3300010159 Bacteria 692
269 Ga0099796_10479453 3300010159 Bacteria 556
270 Ga0105239_10031640 3300010375 Bacteria 5817
271 Ga0105239_10327997 3300010375 Bacteria 1726
272 Ga0105239_10337166 3300010375 Bacteria 1701
273 Ga0105239_10582750 3300010375 Bacteria 1275
274 Ga0105239_11077120 3300010375 Bacteria 925
275 Ga0105246_10029026 3300011119 Bacteria 3638
276 Ga0105246_10145415 3300011119 Bacteria 1788
277 Ga0105246_10617184 3300011119 Bacteria 939
278 Ga0157317_1006476 3300012475 Bacteria 818
279 Ga0157370_10057525 3300013104 Bacteria 3696
280 Ga0157370_10157802 3300013104 Bacteria 2111
281 Ga0157369_10057884 3300013105 Bacteria 4181
282 Ga0157374_10028269 3300013296 Bacteria 5066
283 Ga0157374_10036000 3300013296 Bacteria 4532
284 Ga0157374_10785472 3300013296 Bacteria 968
285 Ga0157378_10232684 3300013297 Bacteria 1757
286 Ga0157378_10254811 3300013297 Bacteria 1681
287 Ga0157378_10457022 3300013297 Bacteria 1268
288 Ga0157378_12241853 3300013297 Bacteria 597
289 Ga0163162_10043869 3300013306 Bacteria 4477
290 Ga0163162_10372823 3300013306 Bacteria 1560
291 Ga0163162_10677893 3300013306 Bacteria 1154
292 Ga0163162_10812570 3300013306 Bacteria 1052
293 Ga0163162_11198528 3300013306 Bacteria 862
294 Ga0157372_11771564 3300013307 Bacteria 710
295 Ga0157372_12521854 3300013307 Bacteria 590
296 Ga0157375_10508577 3300013308 Bacteria 1368
297 Ga0157375_12214709 3300013308 Bacteria 655
298 Ga0163163_10002009 3300014325 Bacteria 17183
299 Ga0163163_10078671 3300014325 Bacteria 3294
300 Ga0163163_10779476 3300014325 Bacteria 1019
301 Ga0157380_10644389 3300014326 Bacteria 1056
302 Ga0157380_10892325 3300014326 Bacteria 914
303 Ga0157380_10971924 3300014326 Bacteria 880
304 Ga0157377_10136398 3300014745 Bacteria 1504
305 Ga0157377_10583519 3300014745 Bacteria 795
306 Ga0157377_10909713 3300014745 Bacteria 658
307 Ga0157377_10927522 3300014745 Bacteria 653
308 Ga0157379_10018063 3300014968 Bacteria 6216
309 Ga0157379_10595404 3300014968 Bacteria 1032
310 Ga0157379_10613719 3300014968 Bacteria 1016
311 Ga0157379_11638325 3300014968 Bacteria 629
312 Ga0157379_11746039 3300014968 Bacteria 610
313 Ga0157376_10017044 3300014969 Bacteria 5532
314 Ga0157376_10138313 3300014969 Bacteria 2182
315 Ga0157376_10344822 3300014969 Bacteria 1423
316 Ga0157376_10490967 3300014969 Bacteria 1205
317 Ga0163161_10558273 3300017792 Bacteria 939
318 Ga0163161_10912093 3300017792 Bacteria 745
319 Ga0213873_10002209 3300021358 Bacteria 3344
320 Ga0213872_10070436 3300021361 Bacteria 1577
321 Ga0213872_10344068 3300021361 Bacteria 613
322 Ga0213874_10006326 3300021377 Bacteria 2802
323 Ga0213876_10005462 3300021384 Bacteria 6986
324 Ga0213876_10071525 3300021384 Bacteria 1832
325 Ga0209233_1001514 3300025261 Bacteria 9126
326 Ga0209758_1003344 3300025297 Bacteria 14725
327 Ga0209758_1015313 3300025297 Bacteria 3985
328 Ga0207697_10025606 3300025315 Bacteria 2411
329 Ga0207656_10084455 3300025321 Bacteria 1432
330 Ga0207656_10153819 3300025321 Bacteria 1091
331 Ga0207653_10054382 3300025885 Bacteria 1339
332 Ga0207682_10185059 3300025893 Bacteria 953
333 Ga0207692_10000829 3300025898 Bacteria 11083
334 Ga0207710_10336767 3300025900 Bacteria 767
335 Ga0207688_10139410 3300025901 Bacteria 1427
336 Ga0207688_10152616 3300025901 Bacteria 1365
337 Ga0207688_10167449 3300025901 Bacteria 1305
338 Ga0207688_10171453 3300025901 Bacteria 1290
339 Ga0207680_10363416 3300025903 Bacteria 1018
340 Ga0207680_10476161 3300025903 Bacteria 888
341 Ga0207647_10155427 3300025904 Bacteria 1336
342 Ga0207685_10001367 3300025905 Bacteria 5051
343 Ga0207685_10164329 3300025905 Bacteria 1016
344 Ga0207685_10199366 3300025905 Bacteria 939
345 Ga0207699_10004989 3300025906 Bacteria 6347
346 Ga0207645_10043296 3300025907 Bacteria 2881
347 Ga0207643_10273737 3300025908 Bacteria 1045
348 Ga0207705_10244175 3300025909 Bacteria 1368
349 Ga0207654_10269225 3300025911 Bacteria 1149
350 Ga0207654_10735191 3300025911 Bacteria 710
351 Ga0207707_10004934 3300025912 Bacteria 11734
352 Ga0207707_10105415 3300025912 Bacteria 2464
353 Ga0207695_10033471 3300025913 Bacteria 5603
354 Ga0207695_10151832 3300025913 Bacteria 2255
355 Ga0207671_10033557 3300025914 Bacteria 3817
356 Ga0207671_10045233 3300025914 Bacteria 3255
357 Ga0207671_10047548 3300025914 Bacteria 3176
358 Ga0207671_10063451 3300025914 Bacteria 2745
359 Ga0207671_10083371 3300025914 Bacteria 2400
360 Ga0207671_10543341 3300025914 Bacteria 926
361 Ga0207693_10000310 3300025915 Bacteria 45408
362 Ga0207693_10005993 3300025915 Bacteria 10080
363 Ga0207693_10036014 3300025915 Bacteria 3900
364 Ga0207693_10847462 3300025915 Bacteria 703
365 Ga0207663_10000230 3300025916 Bacteria 24696
366 Ga0207663_10009652 3300025916 Bacteria 5107
367 Ga0207663_10730238 3300025916 Bacteria 786
368 Ga0207660_10011652 3300025917 Bacteria 5733
369 Ga0207660_10064010 3300025917 Bacteria 2653
370 Ga0207662_10077673 3300025918 Bacteria 2020
371 Ga0207657_10022864 3300025919 Bacteria 5836
372 Ga0207657_10229612 3300025919 Bacteria 1484
373 Ga0207649_10101458 3300025920 Bacteria 1905
374 Ga0207649_10132939 3300025920 Bacteria 1692
375 Ga0207649_11358260 3300025920 Bacteria 562
376 Ga0207652_10002828 3300025921 Bacteria 14572
377 Ga0207652_10175637 3300025921 Bacteria 1924
378 Ga0207681_10178556 3300025923 Bacteria 1615
379 Ga0207694_10048946 3300025924 Bacteria 3271
380 Ga0207694_10199304 3300025924 Bacteria 1628
381 Ga0207694_10201814 3300025924 Bacteria 1618
382 Ga0207650_10191966 3300025925 Bacteria 1632
383 Ga0207650_10603275 3300025925 Bacteria 923
384 Ga0207659_11421753 3300025926 Bacteria 594
385 Ga0207687_10066362 3300025927 Bacteria 2565
386 Ga0207687_10294416 3300025927 Bacteria 1305
387 Ga0207687_10845203 3300025927 Bacteria 782
388 Ga0207687_11246467 3300025927 Bacteria 639
389 Ga0207700_10021866 3300025928 Bacteria 4377
390 Ga0207700_10076835 3300025928 Bacteria 2592
391 Ga0207700_10113880 3300025928 Bacteria 2181
392 Ga0207700_11027583 3300025928 Bacteria 737
393 Ga0207700_11693477 3300025928 Bacteria 558
394 Ga0207664_10001147 3300025929 Bacteria 17636
395 Ga0207664_10289562 3300025929 Bacteria 1439
396 Ga0207664_11517751 3300025929 Bacteria 592
397 Ga0207644_10105890 3300025931 Bacteria 2119
398 Ga0207644_10394385 3300025931 Bacteria 1130
399 Ga0207644_10458984 3300025931 Bacteria 1047
400 Ga0207644_11030039 3300025931 Bacteria 691
401 Ga0207690_10779457 3300025932 Bacteria 789
402 Ga0207706_10183747 3300025933 Bacteria 1836
403 Ga0207706_10422850 3300025933 Bacteria 1154
404 Ga0207669_10627604 3300025937 Bacteria 876
405 Ga0207704_10026355 3300025938 Bacteria 3188
406 Ga0207665_10003377 3300025939 Bacteria 10687
407 Ga0207665_10028331 3300025939 Bacteria 3699
408 Ga0207665_10410649 3300025939 Bacteria 1033
409 Ga0207665_10750668 3300025939 Bacteria 769
410 Ga0207665_11041790 3300025939 Bacteria 651
411 Ga0207691_10172349 3300025940 Bacteria 1894
412 Ga0207691_10579060 3300025940 Bacteria 951
413 Ga0207691_10596088 3300025940 Bacteria 935
414 Ga0207711_10108773 3300025941 Bacteria 2463
415 Ga0207689_10299334 3300025942 Bacteria 1333
416 Ga0207689_10662279 3300025942 Bacteria 880
417 Ga0207689_10667697 3300025942 Bacteria 876
418 Ga0207689_10828033 3300025942 Bacteria 781
419 Ga0207689_11011769 3300025942 Bacteria 701
420 Ga0207661_10621100 3300025944 Bacteria 992
421 Ga0207661_11140644 3300025944 Bacteria 718
422 Ga0207679_10188478 3300025945 Bacteria 1713
423 Ga0207667_10033916 3300025949 Bacteria 5484
424 Ga0207667_10046837 3300025949 Bacteria 4579
425 Ga0207667_10323540 3300025949 Bacteria 1575
426 Ga0207667_10725976 3300025949 Bacteria 994
427 Ga0207667_10736403 3300025949 Bacteria 986
428 Ga0207651_11685075 3300025960 Bacteria 571
429 Ga0207668_10084474 3300025972 Bacteria 2313
430 Ga0207668_10229600 3300025972 Bacteria 1495
431 Ga0207668_10269628 3300025972 Bacteria 1391
432 Ga0207668_11075907 3300025972 Bacteria 720
433 Ga0207668_11323720 3300025972 Bacteria 649
434 Ga0207640_10578462 3300025981 Bacteria 948
435 Ga0207658_10377977 3300025986 Bacteria 1240
436 Ga0207677_10846895 3300026023 Bacteria 821
437 Ga0207677_10950800 3300026023 Bacteria 777
438 Ga0207703_10460605 3300026035 Bacteria 1189
439 Ga0207703_10546886 3300026035 Bacteria 1091
440 Ga0207703_11102772 3300026035 Bacteria 762
441 Ga0207639_10020456 3300026041 Bacteria 4737
442 Ga0207639_10585829 3300026041 Bacteria 1027
443 Ga0207639_10804131 3300026041 Bacteria 876
444 Ga0207678_10003936 3300026067 Bacteria 13364
445 Ga0207678_10038029 3300026067 Bacteria 4184
446 Ga0207678_10060441 3300026067 Bacteria 3259
447 Ga0207678_10111318 3300026067 Bacteria 2335
448 Ga0207678_10276024 3300026067 Bacteria 1442
449 Ga0207678_10285739 3300026067 Bacteria 1416
450 Ga0207678_10801106 3300026067 Bacteria 832
451 Ga0207678_10811112 3300026067 Bacteria 826
452 Ga0207708_10150915 3300026075 Bacteria 1829
453 Ga0207702_10258568 3300026078 Bacteria 1638
454 Ga0207641_10052079 3300026088 Bacteria 3466
455 Ga0207641_10157936 3300026088 Bacteria 2059
456 Ga0207676_10118741 3300026095 Bacteria 2226
457 Ga0207676_10183336 3300026095 Bacteria 1835
458 Ga0207676_10470385 3300026095 Bacteria 1188
459 Ga0207676_10526692 3300026095 Bacteria 1126
460 Ga0207676_11857207 3300026095 Bacteria 601
461 Ga0207674_10035377 3300026116 Bacteria 5212
462 Ga0207674_10243898 3300026116 Bacteria 1744
463 Ga0207675_100150426 3300026118 Bacteria 2215
464 Ga0207675_100868222 3300026118 Bacteria 918
465 Ga0207675_101811801 3300026118 Bacteria 629
466 Ga0207683_10046557 3300026121 Bacteria 3796
467 Ga0207683_10302354 3300026121 Bacteria 1464
468 Ga0207683_10344193 3300026121 Bacteria 1368
469 Ga0207683_10377084 3300026121 Bacteria 1303
470 Ga0207698_10245737 3300026142 Bacteria 1634
471 Ga0207698_10360493 3300026142 Bacteria 1376
472 Ga0209589_1000021 3300027357 Bacteria 186431
473 Ga0209489_100028 3300027361 Bacteria 186431
474 Ga0209700_100037 3300027363 Bacteria 186431
475 Ga0209179_1021592 3300027512 Bacteria 1258
476 Ga0209179_1036546 3300027512 Bacteria 1023
477 Ga0209179_1039240 3300027512 Bacteria 993
478 Ga0209588_1009657 3300027671 Bacteria 2886
479 Ga0268266_10001190 3300028379 Bacteria 32120
480 Ga0268266_10026628 3300028379 Bacteria 4920
481 Ga0268266_10136800 3300028379 Bacteria 2195
482 Ga0268266_10177059 3300028379 Bacteria 1939
483 Ga0268266_10244142 3300028379 Bacteria 1658
484 Ga0268266_10464199 3300028379 Bacteria 1205
485 Ga0268265_10108354 3300028380 Bacteria 2261
486 Ga0268265_10673746 3300028380 Bacteria 996
487 Ga0268265_10938787 3300028380 Bacteria 851
488 Ga0268264_10838001 3300028381 Bacteria 920
489 Ga0268264_11260465 3300028381 Bacteria 749
490 Ga0265334_10011626 3300028573 Bacteria 3701
491 Ga0307517_10144360 3300028786 Bacteria 1657
492 Ga0307515_10117765 3300028794 Bacteria 3037
493 Ga0307515_10355136 3300028794 Bacteria 1110
494 Ga0307515_10536209 3300028794 Bacteria 780
495 Ga0307512_10213162 3300030522 Bacteria 1023
496 Ga0265330_10032679 3300031235 Bacteria 2331
497 Ga0265332_10032204 3300031238 Bacteria 2285
498 Ga0265331_10115739 3300031250 Bacteria 1228
499 Ga0307513_10079098 3300031456 Bacteria 3398
500 Ga0307513_10124353 3300031456 Bacteria 2539
501 Ga0307513_10289279 3300031456 Bacteria 1411
502 Ga0307513_10296134 3300031456 Bacteria 1387
503 Ga0307509_10109035 3300031507 Bacteria 2780
504 Ga0307408_100680306 3300031548 Bacteria 923
505 Ga0307408_101597115 3300031548 Bacteria 619
506 Ga0307408_101618310 3300031548 Bacteria 615
507 Ga0307408_101759614 3300031548 Bacteria 592
508 Ga0307408_101947593 3300031548 Bacteria 564
509 Ga0307508_10000002 3300031616 Bacteria 407635
510 Ga0307508_10392970 3300031616 Bacteria 978
511 Ga0307508_10616974 3300031616 Bacteria 687
512 Ga0265314_10078677 3300031711 Bacteria 2182
513 Ga0265342_10005840 3300031712 Bacteria 9294
514 Ga0307516_10026599 3300031730 Bacteria 5874
515 Ga0307516_10055776 3300031730 Bacteria 3856
516 Ga0307516_10073131 3300031730 Bacteria 3285
517 Ga0307516_10407746 3300031730 Bacteria 1018
518 Ga0307413_10061383 3300031824 Bacteria 2319
519 Ga0307406_10037569 3300031901 Bacteria 2992
520 Ga0307406_10281523 3300031901 Bacteria 1269
521 Ga0307406_10302761 3300031901 Bacteria 1229
522 Ga0307407_10388790 3300031903 Bacteria 998
523 Ga0307407_10414938 3300031903 Bacteria 969
524 Ga0307412_10156128 3300031911 Bacteria 1689
525 Ga0307412_10408085 3300031911 Bacteria 1108
526 Ga0307412_12278855 3300031911 Bacteria 505
527 Ga0307416_100466527 3300032002 Bacteria 1319
528 Ga0307416_101921018 3300032002 Bacteria 695
529 Ga0307416_102134282 3300032002 Bacteria 662
530 Ga0307414_10079957 3300032004 Bacteria 2389
531 Ga0307414_11540638 3300032004 Bacteria 619
532 Ga0307411_10175504 3300032005 Bacteria 1621
533 Ga0307415_100039787 3300032126 Bacteria 3111
534 Ga0307415_101799059 3300032126 Bacteria 593
535 Ga0307507_10334425 3300033179 Bacteria 902
536 Ga0307510_10016711 3300033180 Bacteria 8658
537 Ga0307510_10018241 3300033180 Bacteria 8262
538 Ga0307510_10090848 3300033180 Bacteria 2898
539 Ga0373930_0015324 3300034816 Bacteria 1438
540 Ga0373930_0071943 3300034816 Bacteria 787
541 Ga0373938_0089022 3300034957 Bacteria 761
542 Ga0373934_0001837 3300035086 Bacteria 7804
543 Ga0373940_0018427 3300035088 Bacteria 1752
544 Ga0373949_0160911 3300035090 Bacteria 655
545 Ga0373923_0000584 3300035111 Bacteria 9020
546 Ga0373932_0007741 3300035112 Bacteria 2564
547 Ga0373932_0040581 3300035112 Bacteria 1341
548 Ga0373936_0037608 3300035113 Bacteria 1933
549 Ga0373936_0072456 3300035113 Bacteria 1422
550 Ga0373953_0004679 3300035117 Bacteria 4382
551 Ga0373953_0005933 3300035117 Bacteria 3996
552 Ga0373953_0088641 3300035117 Bacteria 1293
553 Ga0373954_0000457 3300035118 Bacteria 15282
554 Ga0373954_0003801 3300035118 Bacteria 6446
555 Ga0373954_0314106 3300035118 Bacteria 773
556 Ga0373956_0002647 3300035119 Bacteria 7252
557 Ga0373956_0095376 3300035119 Bacteria 1375
558 Ga0373957_0004514 3300035120 Bacteria 4236
559 Ga0373957_0091627 3300035120 Bacteria 1209
560 Ga0373943_0706600 3300035170 Bacteria 597
561 Ga0373946_0157220 3300035171 Bacteria 1065
562 Ga0373946_0698539 3300035171 Bacteria 530
563 Ga0373955_0001753 3300035172 Bacteria 9318
564 Ga0373955_1037096 3300035172 Bacteria 505
565 Ga0373942_0174898 3300035207 Bacteria 701
566 Ga0373942_0261773 3300035207 Bacteria 591
567 Ga0373962_0166982 3300035242 Bacteria 729
568 Ga0373924_0000541 3300035410 Bacteria 11623
569 Ga0373931_0003137 3300035691 Bacteria 7381
570 Ga0373931_0035089 3300035691 Bacteria 2606
571 Ga0373931_0093843 3300035691 Bacteria 1677
572 Ga0373931_0208930 3300035691 Bacteria 1170
573 Ga0373935_0750917 3300035692 Bacteria 719
574 Ga0373927_0004813 3300035695 Bacteria 9384
575 Ga0373927_0068940 3300035695 Bacteria 2289
576 Ga0373927_0321833 3300035695 Bacteria 1018
577 Ga0373927_0382760 3300035695 Bacteria 928
578 Ga0373927_0944146 3300035695 Bacteria 569
579 Ga0373933_0004255 3300035724 Bacteria 7878
580 Ga0373933_0015606 3300035724 Bacteria 4236
581 Ga0373933_0413936 3300035724 Bacteria 880
582 Ga0373933_0847308 3300035724 Bacteria 602
583 Ga0373947_0018758 3300035725 Bacteria 3984
584 Ga0373947_0053711 3300035725 Bacteria 2430
585 Ga0373937_0007949 3300036401 Bacteria 9195
586 Ga0373937_0060148 3300036401 Bacteria 3491
587 Ga0373937_0413087 3300036401 Bacteria 1280
588 Ga0373925_0020848 3300037068 Bacteria 4777
589 Ga0373925_0322393 3300037068 Bacteria 1250
590 Ga0373925_0755909 3300037068 Bacteria 801
591 Ga0395898_0192439 3300037466 Bacteria 1949
592 Ga0395905_0045415 3300037471 Bacteria 4120
593 Ga0395901_0108441 3300038443 Bacteria 2915
594 Ga0436365_0147971 3300039437 Bacteria 1146
595 Ga0436365_0725440 3300039437 Bacteria 10515
596 Ga0436365_0870281 3300039437 Bacteria 1107
597 Ga0436365_1521235 3300039437 Bacteria 2773
598 Ga0436360_0049247 3300039438 Bacteria 659
599 Ga0436361_1075147 3300039447 Bacteria 1699
600 Ga0436361_1180359 3300039447 Bacteria 1703
601 Ga0436363_0125979 3300039450 Bacteria 4409
602 Ga0436363_0449948 3300039450 Bacteria 4308
603 Ga0436363_0859709 3300039450 Bacteria 1179
604 Ga0436362_0490728 3300039453 Bacteria 4488
605 Ga0439461_0215132 3300041410 Bacteria 522
606 Ga0451793_1519244 3300041452 Bacteria 601
607 Ga0451800_1461880 3300041459 Bacteria 652
608 Ga0451802_1581769 3300041460 Bacteria 877
609 Ga0451807_0100949 3300041486 Bacteria 590
610 Ga0451807_0551131 3300041486 Bacteria 1003
611 Ga0451853_0276032 3300041512 Bacteria 1558
612 Ga0451853_2010475 3300041512 Bacteria 908
613 Ga0439431_0058714 3300041997 Bacteria 1009
614 Ga0439458_0105670 3300042157 Bacteria 734
615 Ga0466969_0500927 3300044656 Bacteria 554
616 Ga0466966_0143026 3300044684 Bacteria 1461
617 Ga0466963_0195311 3300044694 Bacteria 1415
618 Ga0466964_0299525 3300044706 Bacteria 810
619 Ga0466957_0206439 3300044842 Bacteria 1292
620 Ga0466959_0095420 3300045049 Bacteria 2133
621 Ga0466959_0175405 3300045049 Bacteria 1502
622 Ga0466958_0070229 3300045836 Bacteria 2143
623 Ga0495617_115334 3300046452 Bacteria 867
624 Ga0495592_0005520 3300046454 Bacteria 9352
625 Ga0495592_0017032 3300046454 Bacteria 5516
626 Ga0495592_0548530 3300046454 Bacteria 711
627 Ga0495603_0009420 3300046455 Bacteria 5902
628 Ga0495603_0031353 3300046455 Bacteria 3200
629 Ga0495603_0032179 3300046455 Bacteria 3156
630 Ga0495603_0182138 3300046455 Bacteria 1215
631 Ga0495603_0251264 3300046455 Bacteria 1018
632 Ga0495603_0286546 3300046455 Bacteria 946
633 Ga0495590_0196847 3300046457 Bacteria 740
634 Ga0495629_0000124 3300046459 Bacteria 68796
635 Ga0495629_0019538 3300046459 Bacteria 4839
636 Ga0495629_0205127 3300046459 Bacteria 1362
637 Ga0495629_0322325 3300046459 Bacteria 1056
638 Ga0495629_0680707 3300046459 Bacteria 684
639 Ga0495638_0068701 3300046460 Bacteria 2172
640 Ga0495638_0143782 3300046460 Bacteria 1389
641 Ga0495638_0561132 3300046460 Bacteria 566
642 Ga0495641_0114432 3300046461 Bacteria 1203
643 Ga0495651_0038303 3300046462 Bacteria 3733
644 Ga0495651_0041553 3300046462 Bacteria 3571
645 Ga0495651_0048532 3300046462 Bacteria 3279
646 Ga0495653_0018700 3300046463 Bacteria 5625
647 Ga0495650_0044302 3300046471 Bacteria 1882
648 Ga0495650_0149724 3300046471 Bacteria 839
649 Ga0495580_0173040 3300046472 Bacteria 1492
650 Ga0495580_0640376 3300046472 Bacteria 700
651 Ga0495582_0216236 3300046473 Bacteria 1096
652 Ga0495605_0074128 3300046474 Bacteria 1602
653 Ga0495605_0353624 3300046474 Bacteria 616
654 Ga0495639_0010176 3300046475 Bacteria 4045
655 Ga0495639_0011821 3300046475 Bacteria 3765
656 Ga0495639_0175348 3300046475 Bacteria 1042
657 Ga0495664_0186020 3300046477 Bacteria 1259
658 Ga0495664_0552547 3300046477 Bacteria 686
659 Ga0495584_0154657 3300046491 Bacteria 1165
660 Ga0495584_0260805 3300046491 Bacteria 881
661 Ga0495584_0315505 3300046491 Bacteria 794
662 Ga0495584_0419443 3300046491 Bacteria 680
663 Ga0495585_0051609 3300046492 Bacteria 2278
664 Ga0495594_0213414 3300046499 Bacteria 1101
665 Ga0495594_0325484 3300046499 Bacteria 875
666 Ga0495594_0605335 3300046499 Bacteria 621
667 Ga0495596_0286243 3300046500 Bacteria 640
668 Ga0495607_0277858 3300046501 Bacteria 796
669 Ga0495607_0354581 3300046501 Bacteria 676
670 Ga0495583_0072582 3300046506 Bacteria 1510
671 Ga0495583_0185166 3300046506 Bacteria 851
672 Ga0495606_0111682 3300046507 Bacteria 1648
673 Ga0495606_0442193 3300046507 Bacteria 668
674 Ga0495608_0002253 3300046511 Bacteria 13922
675 Ga0495608_0018263 3300046511 Bacteria 4839
676 Ga0495608_0709897 3300046511 Bacteria 598
677 Ga0495616_0159601 3300046513 Bacteria 1015
678 Ga0495616_0171049 3300046513 Bacteria 971
679 Ga0495616_0373556 3300046513 Bacteria 590
680 Ga0495618_0008644 3300046514 Bacteria 6154
681 Ga0495618_0434356 3300046514 Bacteria 799
682 Ga0495618_0527281 3300046514 Bacteria 709
683 Ga0495620_0219096 3300046515 Bacteria 729
684 Ga0495620_0308263 3300046515 Bacteria 601
685 Ga0495628_0010523 3300046516 Bacteria 7852
686 Ga0495628_0213293 3300046516 Bacteria 1451
687 Ga0495628_0806211 3300046516 Bacteria 657
688 Ga0495630_0423003 3300046517 Bacteria 1021
689 Ga0495630_0491654 3300046517 Bacteria 941
690 Ga0495631_0042150 3300046518 Bacteria 2017
691 Ga0495631_0114330 3300046518 Bacteria 1160
692 Ga0495631_0126228 3300046518 Bacteria 1100
693 Ga0495632_0028862 3300046519 Bacteria 2894
694 Ga0495632_0167360 3300046519 Bacteria 1011
695 Ga0495632_0269147 3300046519 Bacteria 760
696 Ga0495643_0440432 3300046522 Bacteria 569
697 Ga0495644_0067837 3300046523 Bacteria 1340
698 Ga0495644_0125454 3300046523 Bacteria 977
699 Ga0495644_0146613 3300046523 Bacteria 902
700 Ga0495648_0312553 3300046524 Bacteria 732
701 Ga0495663_0063724 3300046525 Bacteria 1162
702 Ga0495663_0335989 3300046525 Bacteria 548
703 Ga0495642_0043703 3300046528 Bacteria 1828
704 Ga0495642_0389011 3300046528 Bacteria 614
705 Ga0495652_0021486 3300046529 Bacteria 5736
706 Ga0495652_0034509 3300046529 Bacteria 4408
707 Ga0495652_0791622 3300046529 Bacteria 632
708 Ga0495665_0557993 3300046531 Bacteria 574
709 Ga0495640_0020098 3300046533 Bacteria 4920
710 Ga0495640_0035828 3300046533 Bacteria 3510
711 Ga0495640_0187493 3300046533 Bacteria 1316
712 Ga0495587_0015106 3300046536 Bacteria 4825
713 Ga0495587_0019403 3300046536 Bacteria 4207
714 Ga0495587_0789730 3300046536 Bacteria 519
715 Ga0495598_0023551 3300046537 Bacteria 1659
716 Ga0495598_0053990 3300046537 Bacteria 1219
717 Ga0495598_0121980 3300046537 Bacteria 884
718 Ga0495609_0133827 3300046538 Bacteria 1060
719 Ga0495609_0152655 3300046538 Bacteria 982
720 Ga0495609_0246544 3300046538 Bacteria 736
721 Ga0495621_0058368 3300046539 Bacteria 1395
722 Ga0495597_0063414 3300046542 Bacteria 1606
723 Ga0495645_0016860 3300046543 Bacteria 5228
724 Ga0495645_0074551 3300046543 Bacteria 2443
725 Ga0495622_0015732 3300046557 Bacteria 3518
726 Ga0495622_0145857 3300046557 Bacteria 1073
727 Ga0495622_0464518 3300046557 Bacteria 542
728 Ga0495633_0040434 3300046558 Bacteria 2221
729 Ga0495633_0106287 3300046558 Bacteria 1302
730 Ga0495633_0460207 3300046558 Bacteria 574
731 Ga0495667_0000551 3300046559 Bacteria 23946
732 Ga0495667_0060348 3300046559 Bacteria 2487
733 Ga0495656_0070007 3300046615 Bacteria 1555
734 Ga0495656_0239937 3300046615 Bacteria 912
735 Ga0495656_0461313 3300046615 Bacteria 670
736 Ga0495668_0114918 3300046616 Bacteria 1472
737 Ga0495668_0140491 3300046616 Bacteria 1321
738 Ga0495668_0603323 3300046616 Bacteria 606
739 Ga0495668_0647449 3300046616 Bacteria 584
740 Ga0495634_0230125 3300046642 Bacteria 1141
741 Ga0495611_0047537 3300046648 Bacteria 1926
742 Ga0495611_0325785 3300046648 Bacteria 706
743 Ga0495611_0594766 3300046648 Bacteria 500
744 Ga0495625_0234883 3300046660 Bacteria 1196
745 Ga0495625_0381302 3300046660 Bacteria 884
746 Ga0495625_0383761 3300046660 Bacteria 881
747 Ga0495635_0001218 3300046663 Bacteria 17215
748 Ga0495635_0023042 3300046663 Bacteria 4340
749 Ga0495635_0388050 3300046663 Bacteria 929
750 Ga0495659_0006041 3300046664 Bacteria 3828
751 Ga0495659_0110783 3300046664 Bacteria 1072
752 Ga0495661_0249435 3300046665 Bacteria 907
753 Ga0495661_0295438 3300046665 Bacteria 812
754 Ga0495588_0008572 3300046674 Bacteria 4696
755 Ga0495588_0545353 3300046674 Bacteria 608
756 Ga0495657_0019076 3300046675 Bacteria 4953
757 Ga0495657_0131203 3300046675 Bacteria 1569
758 Ga0495599_0009152 3300046678 Bacteria 6041
759 Ga0495599_0125057 3300046678 Bacteria 1598
760 Ga0495599_0545752 3300046678 Bacteria 679
761 Ga0495623_0016600 3300046679 Bacteria 4755
762 Ga0495623_0022621 3300046679 Bacteria 4058
763 Ga0495646_0000643 3300046680 Bacteria 19081
764 Ga0495658_0154848 3300046683 Bacteria 1410
765 Ga0495658_0403890 3300046683 Bacteria 871
766 Ga0495669_0020635 3300046684 Bacteria 2853
767 Ga0495669_0144646 3300046684 Bacteria 1123
768 Ga0495669_0333092 3300046684 Bacteria 733
769 Ga0495669_0359936 3300046684 Bacteria 703
770 Ga0495669_0432748 3300046684 Bacteria 638
771 Ga0495613_0045757 3300046689 Bacteria 3236
772 Ga0495624_0062626 3300046690 Bacteria 2327
773 Ga0495624_0126692 3300046690 Bacteria 1567
774 Ga0495624_0434046 3300046690 Bacteria 787
775 Ga0495624_0674831 3300046690 Bacteria 614
776 Ga0495670_0080754 3300046691 Bacteria 1656
777 Ga0495670_0116066 3300046691 Bacteria 1388
778 Ga0495670_0239019 3300046691 Bacteria 967
779 Ga0495671_0420378 3300046692 Bacteria 639
780 Ga0495671_0435417 3300046692 Bacteria 627
781 Ga0495649_0351810 3300046694 Bacteria 744
782 Ga0495649_0440068 3300046694 Bacteria 652
783 Ga0495649_0603714 3300046694 Bacteria 541
784 Ga0495589_0100555 3300046794 Bacteria 1399
785 Ga0495589_0140556 3300046794 Bacteria 1156
786 Ga0495600_0001007 3300046809 Bacteria 15210
787 Ga0495600_0204018 3300046809 Bacteria 1269
788 Ga0495600_0266369 3300046809 Bacteria 1087
789 Ga0495660_0509809 3300046810 Bacteria 513
790 Ga0495581_0045989 3300047315 Bacteria 2523
791 Ga0495604_0015936 3300047317 Bacteria 6000
792 Ga0495604_0023465 3300047317 Bacteria 4921
793 Ga0495604_0625893 3300047317 Bacteria 688
794 Ga0495636_0129366 3300047318 Bacteria 1122
795 Ga0495636_0620928 3300047318 Bacteria 529
796 Ga0495674_0003683 3300047319 Bacteria 14908
797 Ga0495674_0114961 3300047319 Bacteria 2278
798 Ga0495672_0037809 3300047320 Bacteria 2950
799 Ga0495672_0170661 3300047320 Bacteria 1110
800 Ga0495672_0416072 3300047320 Bacteria 612
801 Ga0495676_0042130 3300047321 Bacteria 3751
802 Ga0495676_0130352 3300047321 Bacteria 1816
803 Ga0495680_0001909 3300047322 Bacteria 21876
804 Ga0495680_0046311 3300047322 Bacteria 3429
805 Ga0495683_0224830 3300047323 Bacteria 835
806 Ga0495675_0001972 3300047444 Bacteria 12248
807 Ga0495675_0011175 3300047444 Bacteria 5630
808 Ga0495677_0106209 3300047445 Bacteria 1065
809 Ga0495679_127596 3300047446 Bacteria 692
810 Ga0495673_0028030 3300047469 Bacteria 2672
811 Ga0495673_0030851 3300047469 Bacteria 2514
812 Ga0495681_0192030 3300047470 Bacteria 833
813 Ga0495684_0000313 3300047471 Bacteria 39705
814 Ga0495684_0035943 3300047471 Bacteria 3798
815 Ga0495686_0075038 3300047472 Bacteria 2074
816 Ga0495686_0335243 3300047472 Bacteria 826
817 Ga0495686_0634235 3300047472 Bacteria 550
818 Ga0495593_0001524 3300047673 Bacteria 13627
819 Ga0495593_0128564 3300047673 Bacteria 1287
820 Ga0495602_0050780 3300048088 Bacteria 3702
821 Ga0495602_0059972 3300048088 Bacteria 3318
822 Ga0495614_0024394 3300048089 Bacteria 2611
823 Ga0495615_0206356 3300048090 Bacteria 608
824 Ga0495626_0104917 3300048091 Bacteria 1229
825 Ga0495626_0200604 3300048091 Bacteria 818
826 Ga0496100_0087995 3300048903 Bacteria 2113
827 Ga0496100_0139318 3300048903 Bacteria 1717
828 Ga0496101_0027335 3300048904 Bacteria 3974
829 Ga0496101_0046806 3300048904 Bacteria 3103
830 Ga0496102_0011927 3300048905 Bacteria 7505
831 Ga0496102_0049981 3300048905 Bacteria 3806
832 Ga0496102_0123428 3300048905 Bacteria 2420
833 Ga0496102_0165118 3300048905 Bacteria 2083
834 Ga0496102_0223293 3300048905 Bacteria 1776
835 Ga0496103_0041533 3300048906 Bacteria 2827
836 Ga0496103_0359980 3300048906 Bacteria 935
837 Ga0496103_0580446 3300048906 Bacteria 715
838 Ga0496104_0049045 3300048907 Bacteria 3982
839 Ga0496104_0059609 3300048907 Bacteria 3613
840 Ga0496104_0104080 3300048907 Bacteria 2719
841 Ga0496104_0234039 3300048907 Bacteria 1749
842 Ga0496105_0085784 3300048908 Bacteria 2602
843 Ga0496105_0110428 3300048908 Bacteria 2270
844 Ga0496105_0275606 3300048908 Bacteria 1357
845 Ga0496105_0413318 3300048908 Bacteria 1069
846 Ga0496105_0535321 3300048908 Bacteria 916
847 Ga0496105_0598519 3300048908 Bacteria 856
848 Ga0496105_0803467 3300048908 Bacteria 715
849 Ga0496106_0037784 3300048909 Bacteria 3612
850 Ga0496106_0052259 3300048909 Bacteria 3082
851 Ga0496106_0294060 3300048909 Bacteria 1302
852 Ga0496106_0627129 3300048909 Bacteria 860
853 Ga0496106_0877008 3300048909 Bacteria 709
854 Ga0496106_1091148 3300048909 Bacteria 626
855 Ga0496107_0002944 3300048910 Bacteria 11270
856 Ga0496107_0012539 3300048910 Bacteria 5917
857 Ga0496107_0288009 3300048910 Bacteria 1222
858 Ga0496107_0415006 3300048910 Bacteria 1001
859 Ga0496107_0815124 3300048910 Bacteria 683
860 Ga0496108_0050424 3300048911 Bacteria 3484
861 Ga0496108_0102539 3300048911 Bacteria 2441
862 Ga0496108_0117623 3300048911 Bacteria 2277
863 Ga0496108_0852630 3300048911 Bacteria 784
864 Ga0496109_0009866 3300048912 Bacteria 8152
865 Ga0496109_0035253 3300048912 Bacteria 4512
866 Ga0496109_0050985 3300048912 Bacteria 3769
867 Ga0496109_0721443 3300048912 Bacteria 934
868 Ga0496110_0122513 3300048913 Bacteria 2344
869 Ga0496110_0165944 3300048913 Bacteria 2002
870 Ga0496110_0248028 3300048913 Bacteria 1620
871 Ga0496110_0355700 3300048913 Bacteria 1334
872 Ga0496110_0491122 3300048913 Bacteria 1118
873 Ga0496110_0665390 3300048913 Bacteria 942
874 Ga0496110_1106760 3300048913 Bacteria 700
875 Ga0496110_1140543 3300048913 Bacteria 688
876 Ga0496111_0050121 3300048914 Bacteria 3010
877 Ga0496111_0050303 3300048914 Bacteria 3006
878 Ga0496111_0145014 3300048914 Bacteria 1760
879 Ga0496111_0155083 3300048914 Bacteria 1699
880 Ga0496111_0260027 3300048914 Bacteria 1288
881 Ga0496111_0548895 3300048914 Bacteria 848
882 Ga0496111_0880681 3300048914 Bacteria 645
883 Ga0496112_0001974 3300048915 Bacteria 16209
884 Ga0496112_0014051 3300048915 Bacteria 7412
885 Ga0496112_0028765 3300048915 Bacteria 5368
886 Ga0496112_0186304 3300048915 Bacteria 2038
887 Ga0496112_0219897 3300048915 Bacteria 1855
888 Ga0496112_0237027 3300048915 Bacteria 1778
889 Ga0496113_0013547 3300048916 Bacteria 5531
890 Ga0496113_0050127 3300048916 Bacteria 3111
891 Ga0496113_0251019 3300048916 Bacteria 1412
892 Ga0496113_0274424 3300048916 Bacteria 1348
893 Ga0496114_0080131 3300048917 Bacteria 2757
894 Ga0496114_0932388 3300048917 Bacteria 750
895 Ga0496114_1593423 3300048917 Bacteria 541
896 Ga0496115_0003266 3300048918 Bacteria 11628
897 Ga0496115_0032667 3300048918 Bacteria 4106
898 Ga0496115_0193576 3300048918 Bacteria 1680
899 Ga0496115_0223229 3300048918 Bacteria 1555
900 Ga0496115_0256728 3300048918 Bacteria 1438
901 Ga0496115_0260811 3300048918 Bacteria 1425
902 Ga0496115_0268189 3300048918 Bacteria 1403
903 Ga0496115_0853393 3300048918 Bacteria 705
904 Ga0496115_0937074 3300048918 Bacteria 666
905 Ga0496116_0323335 3300048919 Bacteria 721
906 Ga0496117_0195191 3300048920 Bacteria 1149
907 Ga0496117_0356569 3300048920 Bacteria 753
908 Ga0496117_0406694 3300048920 Bacteria 685
909 Ga0496119_0139958 3300048922 Bacteria 1308
910 Ga0496119_0176977 3300048922 Bacteria 1122
911 Ga0496119_0306434 3300048922 Bacteria 781
912 Ga0496119_0420303 3300048922 Bacteria 635
913 Ga0496121_0039609 3300048924 Bacteria 4148
914 Ga0496121_0086669 3300048924 Bacteria 2460
915 Ga0496121_0100066 3300048924 Bacteria 2238
916 Ga0496121_0147348 3300048924 Bacteria 1737
917 Ga0496121_0214125 3300048924 Bacteria 1362
918 Ga0496124_0671010 3300048927 Bacteria 662
919 Ga0496125_0130928 3300048928 Bacteria 1766
920 Ga0496126_0007843 3300048929 Bacteria 11636
921 Ga0496126_0030834 3300048929 Bacteria 5075
922 Ga0496126_0031354 3300048929 Bacteria 5024
923 Ga0496126_0121393 3300048929 Bacteria 2265
924 Ga0496126_0166479 3300048929 Bacteria 1881
925 Ga0496126_0407442 3300048929 Bacteria 1101
926 Ga0496126_0452718 3300048929 Bacteria 1033
927 Ga0496126_0722205 3300048929 Bacteria 772
928 Ga0495682_0155730 3300049460 Bacteria 814
929 Ga0501032_0019827 3300049569 Bacteria 4695
930 Ga0501032_0227629 3300049569 Bacteria 1212
931 Ga0501032_0664431 3300049569 Bacteria 661
932 Ga0501034_0697001 3300049571 Bacteria 914
933 Ga0501034_0776041 3300049571 Bacteria 852
934 Ga0501036_0103183 3300049572 Bacteria 2412
935 Ga0501037_0580240 3300049573 Bacteria 754
936 Ga0501038_0083459 3300049574 Bacteria 2689
937 Ga0501038_0531410 3300049574 Bacteria 896
938 Ga0501039_0193009 3300049575 Bacteria 1601
939 Ga0501039_0244298 3300049575 Bacteria 1411
940 Ga0501047_0124847 3300049581 Bacteria 2454
941 Ga0501047_1158453 3300049581 Bacteria 586
942 Ga0501067_0080761 3300049583 Bacteria 1802
943 Ga0501067_0110475 3300049583 Bacteria 1528
944 Ga0501068_0036146 3300049584 Bacteria 2952
945 Ga0501068_0345611 3300049584 Bacteria 956
946 Ga0501069_0023410 3300049585 Bacteria 3368
947 Ga0501069_0258501 3300049585 Bacteria 1016
948 Ga0501072_0444037 3300049588 Bacteria 1027
949 Ga0501073_0063515 3300049589 Bacteria 2575
950 Ga0501076_0260681 3300049592 Bacteria 1419
951 Ga0501079_0822338 3300049741 Bacteria 731
952 Ga0501080_0234585 3300049742 Bacteria 1676
953 Ga0501081_0603531 3300049743 Bacteria 822
954 Ga0501083_0036945 3300049744 Bacteria 3328
955 Ga0501035_0044770 3300049822 Bacteria 3983
956 Ga0501035_0152365 3300049822 Bacteria 2005
957 Ga0501044_0130692 3300049823 Bacteria 2505
958 Ga0501045_0005982 3300049824 Bacteria 8415
959 Ga0501045_1376484 3300049824 Bacteria 513
960 nmdc:mga03683_203155_c1 3300050489 Bacteria 910
961 nmdc:mga03683_221246_c1 3300050489 Bacteria 873
962 nmdc:mga03683_26211_c1 3300050489 Bacteria 2298
963 nmdc:mga03n38_25130_c1 3300050490 Bacteria 2442
964 nmdc:mga03n38_253802_c1 3300050490 Bacteria 930
965 nmdc:mga00v17_388333_c1 3300050491 Bacteria 907
966 nmdc:mga00v17_75943_c1 3300050491 Bacteria 2090
967 nmdc:mga00v17_85112_c1 3300050491 Bacteria 1980
968 nmdc:mga0yw44_216206_c1 3300050492 Bacteria 1269
969 nmdc:mga0yw44_415260_c1 3300050492 Bacteria 911
970 nmdc:mga0yw44_55596_c1 3300050492 Bacteria 2409
971 nmdc:mga0yw44_800725_c1 3300050492 Bacteria 640
972 nmdc:mga0k408_139477_c1 3300050493 Bacteria 1442
973 nmdc:mga06z11_189952_c1 3300050494 Bacteria 1189
974 nmdc:mga06z11_312960_c1 3300050494 Bacteria 935
975 nmdc:mga06z11_33726_c1 3300050494 Bacteria 2507
976 nmdc:mga06z11_635642_c1 3300050494 Bacteria 650
977 nmdc:mga07m45_19967_c1 3300050496 Bacteria 3636
978 nmdc:mga07m45_38992_c1 3300050496 Bacteria 2654
979 nmdc:mga07m45_55869_c1 3300050496 Bacteria 2231
980 nmdc:mga05p37_102181_c1 3300050507 Bacteria 3530
981 nmdc:mga0qj67_533055_c1 3300050509 Bacteria 942
982 nmdc:mga08y16_15164_c1 3300050511 Bacteria 8103
983 nmdc:mga0n895_69515_c1 3300050512 Bacteria 3489
984 nmdc:mga0rr50_179637_c1 3300050513 Bacteria 1729
985 nmdc:mga0rr50_308324_c2 3300050513 Bacteria 1012
986 nmdc:mga08x19_140497_c1 3300050514 Bacteria 1631
987 nmdc:mga0a205_134118_c1 3300050515 Bacteria 2018
988 nmdc:mga0sz30_21935_c1 3300050516 Bacteria 2589
989 nmdc:mga0sz30_255674_c1 3300050516 Bacteria 780
990 nmdc:mga0sz30_48450_c1 3300050516 Bacteria 1798
991 Ga0495601_0054219 3300053077 Bacteria 2536
992 Ga0495601_0311791 3300053077 Bacteria 1025
993 Ga0495612_0016378 3300053078 Bacteria 2971
994 Ga0500610_0117724 3300053079 Bacteria 1361
995 Ga0500635_0153508 3300053080 Bacteria 880
996 Ga0495655_0051461 3300053083 Bacteria 1092
997 Ga0495655_0178933 3300053083 Bacteria 683
998 Ga0495595_0000445 3300053084 Bacteria 15683
999 Ga0495595_0054813 3300053084 Bacteria 1854
1000 Ga0495619_0001995 3300053085 Bacteria 13585
1001 Ga0495619_0084768 3300053085 Bacteria 2139
1002 Ga0500643_027818 3300053087 Bacteria 1753
1003 Ga0500581_258691 3300053089 Bacteria 724
1004 Ga0500646_0279689 3300053090 Bacteria 594
1005 Ga0500650_0212604 3300053098 Bacteria 878
1006 Ga0500650_0250963 3300053098 Bacteria 794
1007 Ga0500554_003817 3300053102 Bacteria 3121
1008 Ga0500554_017215 3300053102 Bacteria 1927
1009 Ga0500582_161701 3300053114 Bacteria 770
1010 Ga0500592_043676 3300053116 Bacteria 726
1011 Ga0500595_000477 3300053119 Bacteria 24734
1012 Ga0500595_028055 3300053119 Bacteria 1921
1013 Ga0500617_206272 3300053124 Bacteria 715
1014 Ga0500621_175371 3300053126 Bacteria 782
1015 Ga0500658_0297115 3300053134 Bacteria 742
1016 Ga0500658_0317980 3300053134 Bacteria 715
1017 Ga0500588_0114309 3300053146 Bacteria 945
1018 Ga0500589_064971 3300053147 Bacteria 1664
1019 Ga0500589_133161 3300053147 Bacteria 1035
1020 Ga0500589_206025 3300053147 Bacteria 751
1021 Ga0500589_266318 3300053147 Bacteria 621
1022 Ga0500590_335920 3300053148 Bacteria 548
1023 Ga0500603_028836 3300053150 Bacteria 1419
1024 Ga0500622_0051250 3300053156 Bacteria 2125
1025 Ga0500627_0145273 3300053158 Bacteria 1071
1026 Ga0500633_0146917 3300053160 Bacteria 883
1027 Ga0500634_0208305 3300053161 Bacteria 851
1028 Ga0500638_011253 3300053162 Bacteria 3961
1029 Ga0500636_0070176 3300053177 Bacteria 2033
1030 Ga0500637_0010152 3300053178 Bacteria 4822
1031 Ga0500637_0011408 3300053178 Bacteria 4594
1032 Ga0500645_159327 3300053730 Bacteria 619
1033 Ga0500609_015338 3300053731 Bacteria 1037
1034 Ga0501084_0309355 3300054114 Bacteria 1334
1035 Ga0500661_002168 3300055283 Bacteria 3704
1036 Ga0501082_0988906 3300060353 Bacteria 736
1037 Ga0501082_1215592 3300060353 Bacteria 658
1038 Ga0530510_0616412 3300061734 Bacteria 826
1039 Ga0530510_0853936 3300061734 Bacteria 695

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0045757 Ga0495613_0045757_27_395 122
2 3300048913 Ga0496110_0355700 Ga0496110_0355700_917_1285 122
3 3300046531 Ga0495665_0557993 Ga0495665_0557993_151_534 127
4 3300048913 Ga0496110_0665390 Ga0496110_0665390_50_433 127
5 iso_pu_bacteria 2667528175 2671122457 127
6 iso_pu_bacteria 2728368998 2728755000 127
7 3300047446 Ga0495679_127596 Ga0495679_127596_17_403 128
8 3300053090 Ga0500646_0279689 Ga0500646_0279689_11_397 128
9 3300048913 Ga0496110_1140543 Ga0496110_1140543_275_673 130
10 3300003214 JGI25165J46597_1022757 JGI25165J46597_10227571 131
11 3300025261 Ga0209233_1001514 Ga0209233_10015144 131
12 3300046459 Ga0495629_0680707 Ga0495629_0680707_271_666 131
13 iso_pu_bacteria 2513237098 2513674579 142
14 iso_pu_bacteria 2513237101 2513695121 142
15 iso_pu_bacteria 2721755755 2723841652 142
16 iso_pu_bacteria 2791355199 2793081066 142
17 iso_pu_bacteria 2874604998 2874608055 142
18 iso_pu_bacteria 2876808645 2876815495 142
19 iso_pu_bacteria 2879110137 2879112180 142
20 iso_pu_bacteria 2889033259 2889035480 142
21 iso_pu_bacteria 2903748898 2903751484 142
22 iso_pu_bacteria 2903768456 2903771850 142
23 iso_pu_bacteria 2906610324 2906613884 142
24 iso_pu_bacteria 2908739725 2908747454 142
25 iso_pu_bacteria 2922361189 2922363991 142
26 iso_pu_bacteria 2922386360 2922392575 142
27 iso_pu_bacteria 2935630451 2935636530 142
28 iso_pu_bacteria 2941507105 2941513165 142
29 iso_pu_bacteria 2941515067 2941521180 142
30 iso_pu_bacteria 2941523033 2941528883 142
31 iso_pu_bacteria 3005474847 3005475073 142
32 iso_pu_bacteria 8006964411 8006967466 142
33 iso_pu_bacteria 8006984368 8006990931 142
34 iso_pu_bacteria 8006994254 8006996502 142
35 iso_pu_bacteria 8019565922 8019572492 142
36 iso_pu_bacteria 8056673599 8056675752 142
37 3300003659 JGI25404J52841_10001308 JGI25404J52841_100013084 146
38 3300005293 Ga0065715_10043807 Ga0065715_100438072 146
39 3300005331 Ga0070670_100476247 Ga0070670_1004762471 146
40 3300005333 Ga0070677_10344105 Ga0070677_103441052 146
41 3300005334 Ga0068869_100101991 Ga0068869_1001019913 146
42 3300005334 Ga0068869_100229449 Ga0068869_1002294491 146
43 3300005334 Ga0068869_100340376 Ga0068869_1003403761 146
44 3300005334 Ga0068869_100498288 Ga0068869_1004982882 146
45 3300005335 Ga0070666_10161456 Ga0070666_101614562 146
46 3300005335 Ga0070666_10488888 Ga0070666_104888882 146
47 3300005336 Ga0070680_100054700 Ga0070680_1000547002 146
48 3300005337 Ga0070682_100055337 Ga0070682_1000553372 146
49 3300005338 Ga0068868_100019711 Ga0068868_1000197112 146
50 3300005338 Ga0068868_100022147 Ga0068868_1000221473 146
51 3300005338 Ga0068868_100319979 Ga0068868_1003199792 146
52 3300005338 Ga0068868_100641910 Ga0068868_1006419101 146
53 3300005338 Ga0068868_100847586 Ga0068868_1008475862 146
54 3300005339 Ga0070660_100406858 Ga0070660_1004068582 146
55 3300005340 Ga0070689_100355605 Ga0070689_1003556051 146
56 3300005343 Ga0070687_100480020 Ga0070687_1004800201 146
57 3300005344 Ga0070661_100039129 Ga0070661_1000391292 146
58 3300005344 Ga0070661_100139697 Ga0070661_1001396972 146
59 3300005347 Ga0070668_100096268 Ga0070668_1000962682 146
60 3300005347 Ga0070668_100100324 Ga0070668_1001003242 146
61 3300005347 Ga0070668_100291344 Ga0070668_1002913441 146
62 3300005347 Ga0070668_100493975 Ga0070668_1004939752 146
63 3300005347 Ga0070668_100588024 Ga0070668_1005880242 146
64 3300005347 Ga0070668_100668867 Ga0070668_1006688671 146
65 3300005347 Ga0070668_101115051 Ga0070668_1011150512 146
66 3300005347 Ga0070668_101217857 Ga0070668_1012178571 146
67 3300005347 Ga0070668_101427324 Ga0070668_1014273241 146
68 3300005353 Ga0070669_100190221 Ga0070669_1001902212 146
69 3300005353 Ga0070669_101073698 Ga0070669_1010736981 146
70 3300005354 Ga0070675_100328839 Ga0070675_1003288392 146
71 3300005355 Ga0070671_100189782 Ga0070671_1001897822 146
72 3300005355 Ga0070671_100511413 Ga0070671_1005114132 146
73 3300005355 Ga0070671_100575055 Ga0070671_1005750552 146
74 3300005356 Ga0070674_100080106 Ga0070674_1000801063 146
75 3300005356 Ga0070674_100242257 Ga0070674_1002422572 146
76 3300005364 Ga0070673_100075656 Ga0070673_1000756562 146
77 3300005364 Ga0070673_100205132 Ga0070673_1002051322 146
78 3300005365 Ga0070688_100368798 Ga0070688_1003687981 146
79 3300005366 Ga0070659_100083150 Ga0070659_1000831502 146
80 3300005366 Ga0070659_100628436 Ga0070659_1006284362 146
81 3300005366 Ga0070659_100837153 Ga0070659_1008371531 146
82 3300005367 Ga0070667_100339874 Ga0070667_1003398742 146
83 3300005434 Ga0070709_10558577 Ga0070709_105585772 146
84 3300005436 Ga0070713_100254527 Ga0070713_1002545272 146
85 3300005436 Ga0070713_100432354 Ga0070713_1004323542 146
86 3300005437 Ga0070710_10767458 Ga0070710_107674582 146
87 3300005438 Ga0070701_10046388 Ga0070701_100463883 146
88 3300005444 Ga0070694_100190827 Ga0070694_1001908272 146
89 3300005455 Ga0070663_100004283 Ga0070663_1000042838 146
90 3300005455 Ga0070663_100006019 Ga0070663_1000060192 146
91 3300005455 Ga0070663_100041490 Ga0070663_1000414903 146
92 3300005455 Ga0070663_100106616 Ga0070663_1001066162 146
93 3300005455 Ga0070663_100145967 Ga0070663_1001459671 146
94 3300005455 Ga0070663_100513745 Ga0070663_1005137452 146
95 3300005456 Ga0070678_100101607 Ga0070678_1001016073 146
96 3300005456 Ga0070678_100155518 Ga0070678_1001555182 146
97 3300005456 Ga0070678_100239872 Ga0070678_1002398722 146
98 3300005456 Ga0070678_100463077 Ga0070678_1004630772 146
99 3300005457 Ga0070662_100068881 Ga0070662_1000688812 146
100 3300005457 Ga0070662_100568075 Ga0070662_1005680751 146
101 3300005458 Ga0070681_10041351 Ga0070681_100413513 146
102 3300005466 Ga0070685_10197790 Ga0070685_101977902 146
103 3300005466 Ga0070685_10299751 Ga0070685_102997512 146
104 3300005471 Ga0070698_100250562 Ga0070698_1002505622 146
105 3300005471 Ga0070698_100679092 Ga0070698_1006790922 146
106 3300005518 Ga0070699_100747027 Ga0070699_1007470271 146
107 3300005530 Ga0070679_100044363 Ga0070679_1000443632 146
108 3300005530 Ga0070679_101313556 Ga0070679_1013135561 146
109 3300005539 Ga0068853_100320184 Ga0068853_1003201842 146
110 3300005539 Ga0068853_100409342 Ga0068853_1004093421 146
111 3300005539 Ga0068853_100438174 Ga0068853_1004381742 146
112 3300005543 Ga0070672_100111060 Ga0070672_1001110602 146
113 3300005544 Ga0070686_100156329 Ga0070686_1001563292 146
114 3300005544 Ga0070686_100695189 Ga0070686_1006951891 146
115 3300005545 Ga0070695_100460213 Ga0070695_1004602132 146
116 3300005546 Ga0070696_100326881 Ga0070696_1003268812 146
117 3300005546 Ga0070696_100781622 Ga0070696_1007816221 146
118 3300005547 Ga0070693_100030109 Ga0070693_1000301094 146
119 3300005548 Ga0070665_100024472 Ga0070665_1000244725 146
120 3300005548 Ga0070665_100039914 Ga0070665_1000399144 146
121 3300005548 Ga0070665_100171968 Ga0070665_1001719681 146
122 3300005548 Ga0070665_100217866 Ga0070665_1002178662 146
123 3300005548 Ga0070665_100860059 Ga0070665_1008600592 146
124 3300005548 Ga0070665_101112290 Ga0070665_1011122901 146
125 3300005548 Ga0070665_101374247 Ga0070665_1013742472 146
126 3300005549 Ga0070704_100329757 Ga0070704_1003297572 146
127 3300005563 Ga0068855_100152875 Ga0068855_1001528752 146
128 3300005563 Ga0068855_100325655 Ga0068855_1003256553 146
129 3300005564 Ga0070664_100226362 Ga0070664_1002263622 146
130 3300005564 Ga0070664_101090609 Ga0070664_1010906091 146
131 3300005577 Ga0068857_100300019 Ga0068857_1003000192 146
132 3300005577 Ga0068857_100744212 Ga0068857_1007442122 146
133 3300005578 Ga0068854_100103682 Ga0068854_1001036822 146
134 3300005578 Ga0068854_101170817 Ga0068854_1011708171 146
135 3300005614 Ga0068856_100187404 Ga0068856_1001874043 146
136 3300005614 Ga0068856_100342633 Ga0068856_1003426332 146
137 3300005615 Ga0070702_100030607 Ga0070702_1000306074 146
138 3300005615 Ga0070702_100463897 Ga0070702_1004638972 146
139 3300005616 Ga0068852_100061074 Ga0068852_1000610743 146
140 3300005616 Ga0068852_100283593 Ga0068852_1002835932 146
141 3300005616 Ga0068852_100437310 Ga0068852_1004373102 146
142 3300005617 Ga0068859_100143978 Ga0068859_1001439783 146
143 3300005617 Ga0068859_100163963 Ga0068859_1001639634 146
144 3300005617 Ga0068859_100285767 Ga0068859_1002857672 146
145 3300005617 Ga0068859_100387875 Ga0068859_1003878752 146
146 3300005618 Ga0068864_100215262 Ga0068864_1002152621 146
147 3300005618 Ga0068864_100470018 Ga0068864_1004700182 146
148 3300005718 Ga0068866_10223485 Ga0068866_102234852 146
149 3300005719 Ga0068861_100278047 Ga0068861_1002780472 146
150 3300005834 Ga0068851_10219431 Ga0068851_102194312 146
151 3300005834 Ga0068851_10387661 Ga0068851_103876612 146
152 3300005841 Ga0068863_100232337 Ga0068863_1002323373 146
153 3300005841 Ga0068863_100333555 Ga0068863_1003335552 146
154 3300005842 Ga0068858_100016049 Ga0068858_1000160493 146
155 3300005842 Ga0068858_100057164 Ga0068858_1000571644 146
156 3300005842 Ga0068858_100425075 Ga0068858_1004250751 146
157 3300005842 Ga0068858_101043936 Ga0068858_1010439362 146
158 3300005843 Ga0068860_100086214 Ga0068860_1000862142 146
159 3300005843 Ga0068860_100326155 Ga0068860_1003261552 146
160 3300005844 Ga0068862_100351637 Ga0068862_1003516372 146
161 3300005937 Ga0081455_10005984 Ga0081455_100059846 146
162 3300005937 Ga0081455_10028676 Ga0081455_100286764 146
163 3300005981 Ga0081538_10031555 Ga0081538_100315553 146
164 3300005983 Ga0081540_1001950 Ga0081540_10019507 146
165 3300005983 Ga0081540_1015913 Ga0081540_10159134 146
166 3300006042 Ga0075368_10036443 Ga0075368_100364433 146
167 3300006042 Ga0075368_10083281 Ga0075368_100832812 146
168 3300006048 Ga0075363_100036055 Ga0075363_1000360553 146
169 3300006048 Ga0075363_100252532 Ga0075363_1002525322 146
170 3300006173 Ga0070716_100081143 Ga0070716_1000811432 146
171 3300006173 Ga0070716_101381619 Ga0070716_1013816191 146
172 3300006177 Ga0075362_10110465 Ga0075362_101104652 146
173 3300006177 Ga0075362_10175531 Ga0075362_101755312 146
174 3300006177 Ga0075362_10194650 Ga0075362_101946502 146
175 3300006178 Ga0075367_10019052 Ga0075367_100190525 146
176 3300006186 Ga0075369_10065526 Ga0075369_100655262 146
177 3300006186 Ga0075369_10091113 Ga0075369_100911132 146
178 3300006186 Ga0075369_10120898 Ga0075369_101208982 146
179 3300006186 Ga0075369_10285141 Ga0075369_102851412 146
180 3300006195 Ga0075366_10263289 Ga0075366_102632892 146
181 3300006195 Ga0075366_10378298 Ga0075366_103782982 146
182 3300006237 Ga0097621_100059415 Ga0097621_1000594153 146
183 3300006237 Ga0097621_100356720 Ga0097621_1003567202 146
184 3300006237 Ga0097621_100562793 Ga0097621_1005627932 146
185 3300006237 Ga0097621_101578693 Ga0097621_1015786932 146
186 3300006353 Ga0075370_10101372 Ga0075370_101013722 146
187 3300006353 Ga0075370_10298076 Ga0075370_102980762 146
188 3300006353 Ga0075370_10309862 Ga0075370_103098622 146
189 3300006358 Ga0068871_100274748 Ga0068871_1002747482 146
190 3300006358 Ga0068871_100697797 Ga0068871_1006977972 146
191 3300006844 Ga0075428_100085123 Ga0075428_1000851234 146
192 3300006846 Ga0075430_100416688 Ga0075430_1004166882 146
193 3300006852 Ga0075433_10113605 Ga0075433_101136053 146
194 3300006881 Ga0068865_100137618 Ga0068865_1001376183 146
195 3300006931 Ga0097620_100143973 Ga0097620_1001439733 146
196 3300006931 Ga0097620_100163966 Ga0097620_1001639664 146
197 3300006931 Ga0097620_100285751 Ga0097620_1002857514 146
198 3300006931 Ga0097620_100387894 Ga0097620_1003878942 146
199 3300006941 Ga0099825_1041366 Ga0099825_10413662 146
200 3300006942 Ga0099824_1013118 Ga0099824_10131182 146
201 3300006943 Ga0099822_1000007 Ga0099822_10000077 146
202 3300009092 Ga0105250_10031767 Ga0105250_100317673 146
203 3300009092 Ga0105250_10309136 Ga0105250_103091362 146
204 3300009093 Ga0105240_10465454 Ga0105240_104654542 146
205 3300009093 Ga0105240_12409352 Ga0105240_124093521 146
206 3300009098 Ga0105245_10305400 Ga0105245_103054002 146
207 3300009098 Ga0105245_10986325 Ga0105245_109863252 146
208 3300009098 Ga0105245_11895014 Ga0105245_118950141 146
209 3300009101 Ga0105247_10148239 Ga0105247_101482392 146
210 3300009101 Ga0105247_10231821 Ga0105247_102318212 146
211 3300009147 Ga0114129_10144590 Ga0114129_101445904 146
212 3300009148 Ga0105243_10340224 Ga0105243_103402242 146
213 3300009148 Ga0105243_10665406 Ga0105243_106654062 146
214 3300009148 Ga0105243_12315773 Ga0105243_123157731 146
215 3300009148 Ga0105243_12826006 Ga0105243_128260061 146
216 3300009174 Ga0105241_10241838 Ga0105241_102418382 146
217 3300009174 Ga0105241_10888921 Ga0105241_108889212 146
218 3300009176 Ga0105242_10405567 Ga0105242_104055672 146
219 3300009176 Ga0105242_10689974 Ga0105242_106899742 146
220 3300009176 Ga0105242_11578412 Ga0105242_115784122 146
221 3300009177 Ga0105248_10403979 Ga0105248_104039791 146
222 3300009545 Ga0105237_10022854 Ga0105237_100228543 146
223 3300009545 Ga0105237_10291074 Ga0105237_102910742 146
224 3300009545 Ga0105237_10437709 Ga0105237_104377092 146
225 3300009545 Ga0105237_11123598 Ga0105237_111235981 146
226 3300009545 Ga0105237_11415667 Ga0105237_114156671 146
227 3300009551 Ga0105238_10160027 Ga0105238_101600273 146
228 3300009551 Ga0105238_10656870 Ga0105238_106568702 146
229 3300009551 Ga0105238_11001183 Ga0105238_110011831 146
230 3300009553 Ga0105249_10058990 Ga0105249_100589902 146
231 3300009553 Ga0105249_11292009 Ga0105249_112920091 146
232 3300009553 Ga0105249_11546025 Ga0105249_115460251 146
233 3300010159 Ga0099796_10288461 Ga0099796_102884611 146
234 3300010159 Ga0099796_10479453 Ga0099796_104794531 146
235 3300010375 Ga0105239_10327997 Ga0105239_103279972 146
236 3300010375 Ga0105239_10337166 Ga0105239_103371662 146
237 3300010375 Ga0105239_10582750 Ga0105239_105827502 146
238 3300011119 Ga0105246_10029026 Ga0105246_100290262 146
239 3300011119 Ga0105246_10145415 Ga0105246_101454153 146
240 3300011119 Ga0105246_10617184 Ga0105246_106171842 146
241 3300012475 Ga0157317_1006476 Ga0157317_10064761 146
242 3300013104 Ga0157370_10057525 Ga0157370_100575253 146
243 3300013296 Ga0157374_10028269 Ga0157374_100282694 146
244 3300013296 Ga0157374_10036000 Ga0157374_100360004 146
245 3300013297 Ga0157378_10232684 Ga0157378_102326842 146
246 3300013297 Ga0157378_10254811 Ga0157378_102548112 146
247 3300013297 Ga0157378_10457022 Ga0157378_104570221 146
248 3300013297 Ga0157378_12241853 Ga0157378_122418531 146
249 3300013306 Ga0163162_10043869 Ga0163162_100438693 146
250 3300013306 Ga0163162_10372823 Ga0163162_103728231 146
251 3300013306 Ga0163162_10677893 Ga0163162_106778932 146
252 3300013306 Ga0163162_11198528 Ga0163162_111985281 146
253 3300013307 Ga0157372_11771564 Ga0157372_117715642 146
254 3300013307 Ga0157372_12521854 Ga0157372_125218542 146
255 3300013308 Ga0157375_10508577 Ga0157375_105085772 146
256 3300013308 Ga0157375_12214709 Ga0157375_122147091 146
257 3300014325 Ga0163163_10002009 Ga0163163_100020097 146
258 3300014325 Ga0163163_10078671 Ga0163163_100786712 146
259 3300014325 Ga0163163_10779476 Ga0163163_107794762 146
260 3300014326 Ga0157380_10644389 Ga0157380_106443892 146
261 3300014326 Ga0157380_10892325 Ga0157380_108923252 146
262 3300014745 Ga0157377_10136398 Ga0157377_101363982 146
263 3300014745 Ga0157377_10583519 Ga0157377_105835192 146
264 3300014745 Ga0157377_10927522 Ga0157377_109275222 146
265 3300014968 Ga0157379_10018063 Ga0157379_100180632 146
266 3300014968 Ga0157379_10595404 Ga0157379_105954042 146
267 3300014968 Ga0157379_10613719 Ga0157379_106137191 146
268 3300014968 Ga0157379_11638325 Ga0157379_116383251 146
269 3300014968 Ga0157379_11746039 Ga0157379_117460391 146
270 3300014969 Ga0157376_10017044 Ga0157376_100170441 146
271 3300014969 Ga0157376_10138313 Ga0157376_101383132 146
272 3300014969 Ga0157376_10344822 Ga0157376_103448222 146
273 3300014969 Ga0157376_10490967 Ga0157376_104909672 146
274 3300017792 Ga0163161_10558273 Ga0163161_105582732 146
275 3300017792 Ga0163161_10912093 Ga0163161_109120931 146
276 3300021358 Ga0213873_10002209 Ga0213873_100022095 146
277 3300021361 Ga0213872_10070436 Ga0213872_100704362 146
278 3300025297 Ga0209758_1003344 Ga0209758_10033447 146
279 3300025297 Ga0209758_1015313 Ga0209758_10153134 146
280 3300025315 Ga0207697_10025606 Ga0207697_100256063 146
281 3300025321 Ga0207656_10153819 Ga0207656_101538192 146
282 3300025885 Ga0207653_10054382 Ga0207653_100543822 146
283 3300025900 Ga0207710_10336767 Ga0207710_103367671 146
284 3300025901 Ga0207688_10139410 Ga0207688_101394102 146
285 3300025901 Ga0207688_10152616 Ga0207688_101526162 146
286 3300025901 Ga0207688_10167449 Ga0207688_101674492 146
287 3300025903 Ga0207680_10363416 Ga0207680_103634161 146
288 3300025903 Ga0207680_10476161 Ga0207680_104761612 146
289 3300025904 Ga0207647_10155427 Ga0207647_101554271 146
290 3300025905 Ga0207685_10199366 Ga0207685_101993662 146
291 3300025907 Ga0207645_10043296 Ga0207645_100432962 146
292 3300025908 Ga0207643_10273737 Ga0207643_102737372 146
293 3300025909 Ga0207705_10244175 Ga0207705_102441752 146
294 3300025911 Ga0207654_10269225 Ga0207654_102692252 146
295 3300025911 Ga0207654_10735191 Ga0207654_107351911 146
296 3300025912 Ga0207707_10105415 Ga0207707_101054152 146
297 3300025913 Ga0207695_10151832 Ga0207695_101518322 146
298 3300025914 Ga0207671_10045233 Ga0207671_100452334 146
299 3300025914 Ga0207671_10063451 Ga0207671_100634515 146
300 3300025914 Ga0207671_10083371 Ga0207671_100833712 146
301 3300025914 Ga0207671_10543341 Ga0207671_105433412 146
302 3300025915 Ga0207693_10005993 Ga0207693_100059935 146
303 3300025915 Ga0207693_10036014 Ga0207693_100360142 146
304 3300025915 Ga0207693_10847462 Ga0207693_108474621 146
305 3300025916 Ga0207663_10009652 Ga0207663_100096523 146
306 3300025916 Ga0207663_10730238 Ga0207663_107302382 146
307 3300025917 Ga0207660_10064010 Ga0207660_100640102 146
308 3300025918 Ga0207662_10077673 Ga0207662_100776732 146
309 3300025919 Ga0207657_10229612 Ga0207657_102296122 146
310 3300025920 Ga0207649_10132939 Ga0207649_101329392 146
311 3300025920 Ga0207649_11358260 Ga0207649_113582601 146
312 3300025921 Ga0207652_10175637 Ga0207652_101756372 146
313 3300025923 Ga0207681_10178556 Ga0207681_101785562 146
314 3300025924 Ga0207694_10201814 Ga0207694_102018142 146
315 3300025925 Ga0207650_10191966 Ga0207650_101919662 146
316 3300025925 Ga0207650_10603275 Ga0207650_106032751 146
317 3300025926 Ga0207659_11421753 Ga0207659_114217531 146
318 3300025927 Ga0207687_10066362 Ga0207687_100663623 146
319 3300025927 Ga0207687_10294416 Ga0207687_102944162 146
320 3300025927 Ga0207687_10845203 Ga0207687_108452032 146
321 3300025927 Ga0207687_11246467 Ga0207687_112464672 146
322 3300025928 Ga0207700_10076835 Ga0207700_100768353 146
323 3300025931 Ga0207644_10105890 Ga0207644_101058903 146
324 3300025931 Ga0207644_10394385 Ga0207644_103943852 146
325 3300025931 Ga0207644_10458984 Ga0207644_104589842 146
326 3300025931 Ga0207644_11030039 Ga0207644_110300392 146
327 3300025933 Ga0207706_10183747 Ga0207706_101837472 146
328 3300025933 Ga0207706_10422850 Ga0207706_104228502 146
329 3300025937 Ga0207669_10627604 Ga0207669_106276041 146
330 3300025938 Ga0207704_10026355 Ga0207704_100263554 146
331 3300025939 Ga0207665_10410649 Ga0207665_104106491 146
332 3300025939 Ga0207665_10750668 Ga0207665_107506682 146
333 3300025939 Ga0207665_11041790 Ga0207665_110417902 146
334 3300025940 Ga0207691_10172349 Ga0207691_101723492 146
335 3300025940 Ga0207691_10579060 Ga0207691_105790602 146
336 3300025940 Ga0207691_10596088 Ga0207691_105960882 146
337 3300025941 Ga0207711_10108773 Ga0207711_101087732 146
338 3300025942 Ga0207689_10299334 Ga0207689_102993342 146
339 3300025942 Ga0207689_10662279 Ga0207689_106622792 146
340 3300025942 Ga0207689_10667697 Ga0207689_106676972 146
341 3300025942 Ga0207689_10828033 Ga0207689_108280332 146
342 3300025942 Ga0207689_11011769 Ga0207689_110117691 146
343 3300025944 Ga0207661_11140644 Ga0207661_111406442 146
344 3300025945 Ga0207679_10188478 Ga0207679_101884782 146
345 3300025949 Ga0207667_10033916 Ga0207667_100339164 146
346 3300025949 Ga0207667_10725976 Ga0207667_107259762 146
347 3300025949 Ga0207667_10736403 Ga0207667_107364031 146
348 3300025960 Ga0207651_11685075 Ga0207651_116850751 146
349 3300025972 Ga0207668_10084474 Ga0207668_100844744 146
350 3300025972 Ga0207668_10229600 Ga0207668_102296002 146
351 3300025972 Ga0207668_10269628 Ga0207668_102696281 146
352 3300025972 Ga0207668_11075907 Ga0207668_110759071 146
353 3300025972 Ga0207668_11323720 Ga0207668_113237202 146
354 3300025981 Ga0207640_10578462 Ga0207640_105784622 146
355 3300025986 Ga0207658_10377977 Ga0207658_103779772 146
356 3300026023 Ga0207677_10846895 Ga0207677_108468952 146
357 3300026023 Ga0207677_10950800 Ga0207677_109508002 146
358 3300026035 Ga0207703_10460605 Ga0207703_104606052 146
359 3300026035 Ga0207703_10546886 Ga0207703_105468862 146
360 3300026035 Ga0207703_11102772 Ga0207703_111027722 146
361 3300026041 Ga0207639_10585829 Ga0207639_105858291 146
362 3300026041 Ga0207639_10804131 Ga0207639_108041312 146
363 3300026067 Ga0207678_10003936 Ga0207678_100039362 146
364 3300026067 Ga0207678_10038029 Ga0207678_100380292 146
365 3300026067 Ga0207678_10060441 Ga0207678_100604414 146
366 3300026067 Ga0207678_10111318 Ga0207678_101113182 146
367 3300026067 Ga0207678_10276024 Ga0207678_102760242 146
368 3300026067 Ga0207678_10285739 Ga0207678_102857392 146
369 3300026067 Ga0207678_10801106 Ga0207678_108011061 146
370 3300026067 Ga0207678_10811112 Ga0207678_108111122 146
371 3300026075 Ga0207708_10150915 Ga0207708_101509151 146
372 3300026078 Ga0207702_10258568 Ga0207702_102585682 146
373 3300026088 Ga0207641_10052079 Ga0207641_100520794 146
374 3300026088 Ga0207641_10157936 Ga0207641_101579361 146
375 3300026095 Ga0207676_10118741 Ga0207676_101187414 146
376 3300026095 Ga0207676_10183336 Ga0207676_101833362 146
377 3300026095 Ga0207676_10470385 Ga0207676_104703852 146
378 3300026095 Ga0207676_10526692 Ga0207676_105266922 146
379 3300026095 Ga0207676_11857207 Ga0207676_118572071 146
380 3300026116 Ga0207674_10243898 Ga0207674_102438982 146
381 3300026118 Ga0207675_100150426 Ga0207675_1001504263 146
382 3300026118 Ga0207675_100868222 Ga0207675_1008682222 146
383 3300026121 Ga0207683_10046557 Ga0207683_100465574 146
384 3300026121 Ga0207683_10302354 Ga0207683_103023542 146
385 3300026121 Ga0207683_10344193 Ga0207683_103441932 146
386 3300026121 Ga0207683_10377084 Ga0207683_103770842 146
387 3300026142 Ga0207698_10245737 Ga0207698_102457372 146
388 3300026142 Ga0207698_10360493 Ga0207698_103604931 146
389 3300027357 Ga0209589_1000021 Ga0209589_1000021111 146
390 3300027361 Ga0209489_100028 Ga0209489_100028111 146
391 3300027363 Ga0209700_100037 Ga0209700_100037111 146
392 3300028379 Ga0268266_10001190 Ga0268266_1000119030 146
393 3300028379 Ga0268266_10026628 Ga0268266_100266286 146
394 3300028379 Ga0268266_10136800 Ga0268266_101368002 146
395 3300028379 Ga0268266_10177059 Ga0268266_101770592 146
396 3300028379 Ga0268266_10244142 Ga0268266_102441422 146
397 3300028379 Ga0268266_10464199 Ga0268266_104641992 146
398 3300028380 Ga0268265_10108354 Ga0268265_101083542 146
399 3300028380 Ga0268265_10673746 Ga0268265_106737462 146
400 3300028380 Ga0268265_10938787 Ga0268265_109387872 146
401 3300028381 Ga0268264_10838001 Ga0268264_108380012 146
402 3300028381 Ga0268264_11260465 Ga0268264_112604651 146
403 3300028786 Ga0307517_10144360 Ga0307517_101443602 146
404 3300028794 Ga0307515_10117765 Ga0307515_101177652 146
405 3300028794 Ga0307515_10355136 Ga0307515_103551361 146
406 3300028794 Ga0307515_10536209 Ga0307515_105362092 146
407 3300030522 Ga0307512_10213162 Ga0307512_102131622 146
408 3300031250 Ga0265331_10115739 Ga0265331_101157391 146
409 3300031456 Ga0307513_10079098 Ga0307513_100790983 146
410 3300031456 Ga0307513_10124353 Ga0307513_101243533 146
411 3300031456 Ga0307513_10289279 Ga0307513_102892791 146
412 3300031456 Ga0307513_10296134 Ga0307513_102961342 146
413 3300031507 Ga0307509_10109035 Ga0307509_101090353 146
414 3300031548 Ga0307408_100680306 Ga0307408_1006803062 146
415 3300031548 Ga0307408_101597115 Ga0307408_1015971151 146
416 3300031548 Ga0307408_101618310 Ga0307408_1016183102 146
417 3300031548 Ga0307408_101759614 Ga0307408_1017596141 146
418 3300031548 Ga0307408_101947593 Ga0307408_1019475931 146
419 3300031616 Ga0307508_10392970 Ga0307508_103929702 146
420 3300031616 Ga0307508_10616974 Ga0307508_106169741 146
421 3300031711 Ga0265314_10078677 Ga0265314_100786772 146
422 3300031712 Ga0265342_10005840 Ga0265342_100058407 146
423 3300031730 Ga0307516_10026599 Ga0307516_100265996 146
424 3300031730 Ga0307516_10055776 Ga0307516_100557762 146
425 3300031730 Ga0307516_10073131 Ga0307516_100731312 146
426 3300031730 Ga0307516_10407746 Ga0307516_104077462 146
427 3300031824 Ga0307413_10061383 Ga0307413_100613833 146
428 3300031901 Ga0307406_10037569 Ga0307406_100375694 146
429 3300031901 Ga0307406_10281523 Ga0307406_102815232 146
430 3300031901 Ga0307406_10302761 Ga0307406_103027612 146
431 3300031903 Ga0307407_10388790 Ga0307407_103887901 146
432 3300031903 Ga0307407_10414938 Ga0307407_104149382 146
433 3300031911 Ga0307412_10156128 Ga0307412_101561282 146
434 3300031911 Ga0307412_10408085 Ga0307412_104080852 146
435 3300031911 Ga0307412_12278855 Ga0307412_122788551 146
436 3300032002 Ga0307416_100466527 Ga0307416_1004665272 146
437 3300032002 Ga0307416_101921018 Ga0307416_1019210182 146
438 3300032002 Ga0307416_102134282 Ga0307416_1021342822 146
439 3300032004 Ga0307414_10079957 Ga0307414_100799572 146
440 3300032004 Ga0307414_11540638 Ga0307414_115406381 146
441 3300032005 Ga0307411_10175504 Ga0307411_101755042 146
442 3300032126 Ga0307415_100039787 Ga0307415_1000397873 146
443 3300033179 Ga0307507_10334425 Ga0307507_103344251 146
444 3300033180 Ga0307510_10016711 Ga0307510_100167118 146
445 3300033180 Ga0307510_10018241 Ga0307510_100182417 146
446 3300034816 Ga0373930_0015324 Ga0373930_0015324_166_606 146
447 3300034957 Ga0373938_0089022 Ga0373938_0089022_118_558 146
448 3300035088 Ga0373940_0018427 Ga0373940_0018427_967_1407 146
449 3300035090 Ga0373949_0160911 Ga0373949_0160911_197_637 146
450 3300035112 Ga0373932_0007741 Ga0373932_0007741_418_858 146
451 3300035113 Ga0373936_0037608 Ga0373936_0037608_862_1302 146
452 3300035117 Ga0373953_0088641 Ga0373953_0088641_108_548 146
453 3300035170 Ga0373943_0706600 Ga0373943_0706600_92_532 146
454 3300035171 Ga0373946_0157220 Ga0373946_0157220_30_470 146
455 3300035172 Ga0373955_1037096 Ga0373955_1037096_34_474 146
456 3300035691 Ga0373931_0003137 Ga0373931_0003137_2473_2913 146
457 3300035691 Ga0373931_0093843 Ga0373931_0093843_22_462 146
458 3300035691 Ga0373931_0208930 Ga0373931_0208930_672_1112 146
459 3300035692 Ga0373935_0750917 Ga0373935_0750917_40_480 146
460 3300035695 Ga0373927_0068940 Ga0373927_0068940_246_686 146
461 3300035695 Ga0373927_0321833 Ga0373927_0321833_501_941 146
462 3300035695 Ga0373927_0382760 Ga0373927_0382760_354_794 146
463 3300035725 Ga0373947_0053711 Ga0373947_0053711_523_963 146
464 3300037068 Ga0373925_0020848 Ga0373925_0020848_2789_3232 146
465 3300037068 Ga0373925_0322393 Ga0373925_0322393_697_1137 146
466 3300037068 Ga0373925_0755909 Ga0373925_0755909_120_560 146
467 3300037466 Ga0395898_0192439 Ga0395898_0192439_970_1410 146
468 3300037471 Ga0395905_0045415 Ga0395905_0045415_3041_3481 146
469 3300038443 Ga0395901_0108441 Ga0395901_0108441_1402_1842 146
470 3300039447 Ga0436361_1180359 Ga0436361_1180359_746_1186 146
471 3300039453 Ga0436362_0490728 Ga0436362_0490728_28_468 146
472 3300041410 Ga0439461_0215132 Ga0439461_0215132_51_491 146
473 3300041452 Ga0451793_1519244 Ga0451793_1519244_96_536 146
474 3300041459 Ga0451800_1461880 Ga0451800_1461880_109_549 146
475 3300041460 Ga0451802_1581769 Ga0451802_1581769_98_538 146
476 3300041486 Ga0451807_0100949 Ga0451807_0100949_11_451 146
477 3300041486 Ga0451807_0551131 Ga0451807_0551131_301_741 146
478 3300041512 Ga0451853_0276032 Ga0451853_0276032_441_881 146
479 3300041512 Ga0451853_2010475 Ga0451853_2010475_416_856 146
480 3300041997 Ga0439431_0058714 Ga0439431_0058714_166_606 146
481 3300042157 Ga0439458_0105670 Ga0439458_0105670_110_550 146
482 3300044656 Ga0466969_0500927 Ga0466969_0500927_35_475 146
483 3300044684 Ga0466966_0143026 Ga0466966_0143026_889_1329 146
484 3300045049 Ga0466959_0095420 Ga0466959_0095420_878_1318 146
485 3300045049 Ga0466959_0175405 Ga0466959_0175405_274_714 146
486 3300046452 Ga0495617_115334 Ga0495617_115334_195_635 146
487 3300046454 Ga0495592_0548530 Ga0495592_0548530_122_562 146
488 3300046455 Ga0495603_0031353 Ga0495603_0031353_282_722 146
489 3300046455 Ga0495603_0182138 Ga0495603_0182138_67_507 146
490 3300046455 Ga0495603_0251264 Ga0495603_0251264_374_814 146
491 3300046455 Ga0495603_0286546 Ga0495603_0286546_282_722 146
492 3300046457 Ga0495590_0196847 Ga0495590_0196847_165_605 146
493 3300046459 Ga0495629_0205127 Ga0495629_0205127_491_931 146
494 3300046459 Ga0495629_0322325 Ga0495629_0322325_437_877 146
495 3300046460 Ga0495638_0068701 Ga0495638_0068701_1288_1728 146
496 3300046460 Ga0495638_0143782 Ga0495638_0143782_217_657 146
497 3300046460 Ga0495638_0561132 Ga0495638_0561132_89_529 146
498 3300046461 Ga0495641_0114432 Ga0495641_0114432_25_465 146
499 3300046462 Ga0495651_0048532 Ga0495651_0048532_2553_2993 146
500 3300046471 Ga0495650_0044302 Ga0495650_0044302_38_478 146
501 3300046471 Ga0495650_0149724 Ga0495650_0149724_334_774 146
502 3300046472 Ga0495580_0640376 Ga0495580_0640376_250_690 146
503 3300046473 Ga0495582_0216236 Ga0495582_0216236_188_628 146
504 3300046474 Ga0495605_0074128 Ga0495605_0074128_405_845 146
505 3300046474 Ga0495605_0353624 Ga0495605_0353624_106_546 146
506 3300046475 Ga0495639_0011821 Ga0495639_0011821_232_672 146
507 3300046477 Ga0495664_0552547 Ga0495664_0552547_159_599 146
508 3300046491 Ga0495584_0154657 Ga0495584_0154657_479_919 146
509 3300046491 Ga0495584_0260805 Ga0495584_0260805_350_790 146
510 3300046491 Ga0495584_0315505 Ga0495584_0315505_14_454 146
511 3300046491 Ga0495584_0419443 Ga0495584_0419443_204_644 146
512 3300046492 Ga0495585_0051609 Ga0495585_0051609_1326_1766 146
513 3300046499 Ga0495594_0213414 Ga0495594_0213414_279_719 146
514 3300046499 Ga0495594_0325484 Ga0495594_0325484_31_471 146
515 3300046499 Ga0495594_0605335 Ga0495594_0605335_70_510 146
516 3300046500 Ga0495596_0286243 Ga0495596_0286243_56_496 146
517 3300046501 Ga0495607_0277858 Ga0495607_0277858_188_628 146
518 3300046501 Ga0495607_0354581 Ga0495607_0354581_67_507 146
519 3300046506 Ga0495583_0072582 Ga0495583_0072582_345_785 146
520 3300046506 Ga0495583_0185166 Ga0495583_0185166_182_622 146
521 3300046507 Ga0495606_0442193 Ga0495606_0442193_28_468 146
522 3300046511 Ga0495608_0709897 Ga0495608_0709897_124_564 146
523 3300046513 Ga0495616_0159601 Ga0495616_0159601_77_517 146
524 3300046513 Ga0495616_0171049 Ga0495616_0171049_99_539 146
525 3300046514 Ga0495618_0434356 Ga0495618_0434356_178_618 146
526 3300046515 Ga0495620_0219096 Ga0495620_0219096_172_612 146
527 3300046515 Ga0495620_0308263 Ga0495620_0308263_107_547 146
528 3300046516 Ga0495628_0806211 Ga0495628_0806211_167_607 146
529 3300046517 Ga0495630_0423003 Ga0495630_0423003_89_529 146
530 3300046518 Ga0495631_0042150 Ga0495631_0042150_1286_1726 146
531 3300046518 Ga0495631_0114330 Ga0495631_0114330_234_674 146
532 3300046518 Ga0495631_0126228 Ga0495631_0126228_490_930 146
533 3300046519 Ga0495632_0028862 Ga0495632_0028862_83_523 146
534 3300046519 Ga0495632_0269147 Ga0495632_0269147_300_740 146
535 3300046522 Ga0495643_0440432 Ga0495643_0440432_50_490 146
536 3300046523 Ga0495644_0067837 Ga0495644_0067837_619_1059 146
537 3300046523 Ga0495644_0125454 Ga0495644_0125454_153_593 146
538 3300046523 Ga0495644_0146613 Ga0495644_0146613_91_531 146
539 3300046524 Ga0495648_0312553 Ga0495648_0312553_193_633 146
540 3300046525 Ga0495663_0063724 Ga0495663_0063724_448_888 146
541 3300046528 Ga0495642_0043703 Ga0495642_0043703_689_1129 146
542 3300046528 Ga0495642_0389011 Ga0495642_0389011_91_531 146
543 3300046529 Ga0495652_0791622 Ga0495652_0791622_19_459 146
544 3300046533 Ga0495640_0187493 Ga0495640_0187493_564_1004 146
545 3300046536 Ga0495587_0789730 Ga0495587_0789730_25_465 146
546 3300046537 Ga0495598_0023551 Ga0495598_0023551_710_1150 146
547 3300046537 Ga0495598_0053990 Ga0495598_0053990_583_1023 146
548 3300046537 Ga0495598_0121980 Ga0495598_0121980_168_608 146
549 3300046538 Ga0495609_0133827 Ga0495609_0133827_360_800 146
550 3300046538 Ga0495609_0152655 Ga0495609_0152655_242_682 146
551 3300046538 Ga0495609_0246544 Ga0495609_0246544_282_722 146
552 3300046539 Ga0495621_0058368 Ga0495621_0058368_118_558 146
553 3300046542 Ga0495597_0063414 Ga0495597_0063414_178_624 146
554 3300046557 Ga0495622_0015732 Ga0495622_0015732_3038_3478 146
555 3300046557 Ga0495622_0464518 Ga0495622_0464518_91_531 146
556 3300046558 Ga0495633_0040434 Ga0495633_0040434_338_778 146
557 3300046558 Ga0495633_0106287 Ga0495633_0106287_94_534 146
558 3300046558 Ga0495633_0460207 Ga0495633_0460207_71_511 146
559 3300046615 Ga0495656_0070007 Ga0495656_0070007_982_1422 146
560 3300046615 Ga0495656_0239937 Ga0495656_0239937_141_581 146
561 3300046615 Ga0495656_0461313 Ga0495656_0461313_157_597 146
562 3300046616 Ga0495668_0114918 Ga0495668_0114918_487_927 146
563 3300046616 Ga0495668_0140491 Ga0495668_0140491_27_467 146
564 3300046616 Ga0495668_0603323 Ga0495668_0603323_49_489 146
565 3300046616 Ga0495668_0647449 Ga0495668_0647449_23_463 146
566 3300046642 Ga0495634_0230125 Ga0495634_0230125_225_665 146
567 3300046648 Ga0495611_0047537 Ga0495611_0047537_47_487 146
568 3300046648 Ga0495611_0325785 Ga0495611_0325785_45_485 146
569 3300046648 Ga0495611_0594766 Ga0495611_0594766_45_485 146
570 3300046660 Ga0495625_0234883 Ga0495625_0234883_744_1184 146
571 3300046660 Ga0495625_0381302 Ga0495625_0381302_290_730 146
572 3300046660 Ga0495625_0383761 Ga0495625_0383761_422_862 146
573 3300046663 Ga0495635_0388050 Ga0495635_0388050_212_652 146
574 3300046664 Ga0495659_0006041 Ga0495659_0006041_266_706 146
575 3300046664 Ga0495659_0110783 Ga0495659_0110783_172_612 146
576 3300046665 Ga0495661_0249435 Ga0495661_0249435_335_775 146
577 3300046665 Ga0495661_0295438 Ga0495661_0295438_56_496 146
578 3300046674 Ga0495588_0008572 Ga0495588_0008572_143_583 146
579 3300046674 Ga0495588_0545353 Ga0495588_0545353_25_465 146
580 3300046678 Ga0495599_0545752 Ga0495599_0545752_126_566 146
581 3300046683 Ga0495658_0154848 Ga0495658_0154848_288_728 146
582 3300046684 Ga0495669_0020635 Ga0495669_0020635_560_1000 146
583 3300046684 Ga0495669_0333092 Ga0495669_0333092_61_501 146
584 3300046684 Ga0495669_0359936 Ga0495669_0359936_199_639 146
585 3300046684 Ga0495669_0432748 Ga0495669_0432748_184_624 146
586 3300046690 Ga0495624_0126692 Ga0495624_0126692_1030_1470 146
587 3300046690 Ga0495624_0434046 Ga0495624_0434046_252_692 146
588 3300046690 Ga0495624_0674831 Ga0495624_0674831_59_499 146
589 3300046691 Ga0495670_0080754 Ga0495670_0080754_369_809 146
590 3300046691 Ga0495670_0116066 Ga0495670_0116066_499_939 146
591 3300046691 Ga0495670_0239019 Ga0495670_0239019_334_774 146
592 3300046692 Ga0495671_0420378 Ga0495671_0420378_92_532 146
593 3300046692 Ga0495671_0435417 Ga0495671_0435417_48_488 146
594 3300046694 Ga0495649_0351810 Ga0495649_0351810_177_617 146
595 3300046694 Ga0495649_0440068 Ga0495649_0440068_70_510 146
596 3300046694 Ga0495649_0603714 Ga0495649_0603714_37_477 146
597 3300046794 Ga0495589_0100555 Ga0495589_0100555_659_1099 146
598 3300046794 Ga0495589_0140556 Ga0495589_0140556_637_1077 146
599 3300046809 Ga0495600_0204018 Ga0495600_0204018_691_1131 146
600 3300046810 Ga0495660_0509809 Ga0495660_0509809_19_459 146
601 3300047317 Ga0495604_0625893 Ga0495604_0625893_230_670 146
602 3300047318 Ga0495636_0129366 Ga0495636_0129366_428_868 146
603 3300047318 Ga0495636_0620928 Ga0495636_0620928_56_496 146
604 3300047320 Ga0495672_0037809 Ga0495672_0037809_1323_1763 146
605 3300047320 Ga0495672_0170661 Ga0495672_0170661_40_480 146
606 3300047320 Ga0495672_0416072 Ga0495672_0416072_124_564 146
607 3300047321 Ga0495676_0042130 Ga0495676_0042130_1387_1827 146
608 3300047323 Ga0495683_0224830 Ga0495683_0224830_378_818 146
609 3300047445 Ga0495677_0106209 Ga0495677_0106209_254_694 146
610 3300047469 Ga0495673_0028030 Ga0495673_0028030_32_472 146
611 3300047469 Ga0495673_0030851 Ga0495673_0030851_335_775 146
612 3300047470 Ga0495681_0192030 Ga0495681_0192030_12_452 146
613 3300047472 Ga0495686_0075038 Ga0495686_0075038_232_672 146
614 3300047472 Ga0495686_0335243 Ga0495686_0335243_276_716 146
615 3300047472 Ga0495686_0634235 Ga0495686_0634235_23_463 146
616 3300047673 Ga0495593_0128564 Ga0495593_0128564_729_1169 146
617 3300048089 Ga0495614_0024394 Ga0495614_0024394_511_957 146
618 3300048090 Ga0495615_0206356 Ga0495615_0206356_137_577 146
619 3300048091 Ga0495626_0104917 Ga0495626_0104917_222_662 146
620 3300048091 Ga0495626_0200604 Ga0495626_0200604_233_673 146
621 3300048903 Ga0496100_0087995 Ga0496100_0087995_857_1297 146
622 3300048903 Ga0496100_0139318 Ga0496100_0139318_1250_1690 146
623 3300048904 Ga0496101_0027335 Ga0496101_0027335_2344_2784 146
624 3300048904 Ga0496101_0046806 Ga0496101_0046806_821_1261 146
625 3300048905 Ga0496102_0011927 Ga0496102_0011927_5482_5922 146
626 3300048905 Ga0496102_0049981 Ga0496102_0049981_833_1273 146
627 3300048905 Ga0496102_0123428 Ga0496102_0123428_553_993 146
628 3300048905 Ga0496102_0165118 Ga0496102_0165118_1472_1912 146
629 3300048905 Ga0496102_0223293 Ga0496102_0223293_702_1142 146
630 3300048906 Ga0496103_0041533 Ga0496103_0041533_873_1313 146
631 3300048906 Ga0496103_0359980 Ga0496103_0359980_103_543 146
632 3300048906 Ga0496103_0580446 Ga0496103_0580446_19_459 146
633 3300048907 Ga0496104_0049045 Ga0496104_0049045_748_1188 146
634 3300048907 Ga0496104_0059609 Ga0496104_0059609_2716_3156 146
635 3300048907 Ga0496104_0104080 Ga0496104_0104080_2017_2457 146
636 3300048907 Ga0496104_0234039 Ga0496104_0234039_1270_1710 146
637 3300048908 Ga0496105_0085784 Ga0496105_0085784_485_925 146
638 3300048908 Ga0496105_0110428 Ga0496105_0110428_1194_1634 146
639 3300048908 Ga0496105_0275606 Ga0496105_0275606_99_539 146
640 3300048908 Ga0496105_0413318 Ga0496105_0413318_76_516 146
641 3300048908 Ga0496105_0535321 Ga0496105_0535321_167_607 146
642 3300048908 Ga0496105_0598519 Ga0496105_0598519_276_716 146
643 3300048908 Ga0496105_0803467 Ga0496105_0803467_147_587 146
644 3300048909 Ga0496106_0037784 Ga0496106_0037784_2085_2525 146
645 3300048909 Ga0496106_0052259 Ga0496106_0052259_1751_2191 146
646 3300048909 Ga0496106_0627129 Ga0496106_0627129_37_477 146
647 3300048909 Ga0496106_0877008 Ga0496106_0877008_243_683 146
648 3300048909 Ga0496106_1091148 Ga0496106_1091148_22_462 146
649 3300048910 Ga0496107_0002944 Ga0496107_0002944_8948_9388 146
650 3300048910 Ga0496107_0012539 Ga0496107_0012539_153_593 146
651 3300048910 Ga0496107_0288009 Ga0496107_0288009_19_459 146
652 3300048910 Ga0496107_0415006 Ga0496107_0415006_101_541 146
653 3300048910 Ga0496107_0815124 Ga0496107_0815124_220_660 146
654 3300048911 Ga0496108_0050424 Ga0496108_0050424_511_951 146
655 3300048911 Ga0496108_0102539 Ga0496108_0102539_800_1240 146
656 3300048911 Ga0496108_0117623 Ga0496108_0117623_1525_1965 146
657 3300048912 Ga0496109_0009866 Ga0496109_0009866_6157_6597 146
658 3300048912 Ga0496109_0035253 Ga0496109_0035253_2883_3323 146
659 3300048912 Ga0496109_0050985 Ga0496109_0050985_1352_1792 146
660 3300048912 Ga0496109_0721443 Ga0496109_0721443_238_678 146
661 3300048913 Ga0496110_0165944 Ga0496110_0165944_480_920 146
662 3300048913 Ga0496110_0248028 Ga0496110_0248028_56_496 146
663 3300048913 Ga0496110_0491122 Ga0496110_0491122_37_477 146
664 3300048913 Ga0496110_1106760 Ga0496110_1106760_246_686 146
665 3300048914 Ga0496111_0050121 Ga0496111_0050121_1883_2323 146
666 3300048914 Ga0496111_0050303 Ga0496111_0050303_1896_2336 146
667 3300048914 Ga0496111_0260027 Ga0496111_0260027_273_713 146
668 3300048914 Ga0496111_0880681 Ga0496111_0880681_177_617 146
669 3300048915 Ga0496112_0014051 Ga0496112_0014051_2109_2549 146
670 3300048915 Ga0496112_0028765 Ga0496112_0028765_1983_2423 146
671 3300048915 Ga0496112_0219897 Ga0496112_0219897_1378_1818 146
672 3300048916 Ga0496113_0013547 Ga0496113_0013547_4673_5113 146
673 3300048916 Ga0496113_0050127 Ga0496113_0050127_464_904 146
674 3300048916 Ga0496113_0251019 Ga0496113_0251019_253_693 146
675 3300048917 Ga0496114_0080131 Ga0496114_0080131_1469_1909 146
676 3300048917 Ga0496114_0932388 Ga0496114_0932388_246_686 146
677 3300048918 Ga0496115_0003266 Ga0496115_0003266_3121_3561 146
678 3300048918 Ga0496115_0032667 Ga0496115_0032667_2205_2645 146
679 3300048918 Ga0496115_0193576 Ga0496115_0193576_939_1379 146
680 3300048918 Ga0496115_0853393 Ga0496115_0853393_191_631 146
681 3300048919 Ga0496116_0323335 Ga0496116_0323335_234_674 146
682 3300048920 Ga0496117_0195191 Ga0496117_0195191_590_1030 146
683 3300048920 Ga0496117_0356569 Ga0496117_0356569_97_537 146
684 3300048920 Ga0496117_0406694 Ga0496117_0406694_197_637 146
685 3300048922 Ga0496119_0139958 Ga0496119_0139958_51_491 146
686 3300048922 Ga0496119_0176977 Ga0496119_0176977_493_933 146
687 3300048922 Ga0496119_0306434 Ga0496119_0306434_145_585 146
688 3300048922 Ga0496119_0420303 Ga0496119_0420303_47_487 146
689 3300048924 Ga0496121_0039609 Ga0496121_0039609_2764_3204 146
690 3300048924 Ga0496121_0086669 Ga0496121_0086669_1449_1889 146
691 3300048924 Ga0496121_0100066 Ga0496121_0100066_798_1238 146
692 3300048924 Ga0496121_0147348 Ga0496121_0147348_400_840 146
693 3300048924 Ga0496121_0214125 Ga0496121_0214125_23_463 146
694 3300048927 Ga0496124_0671010 Ga0496124_0671010_29_469 146
695 3300048928 Ga0496125_0130928 Ga0496125_0130928_930_1370 146
696 3300048929 Ga0496126_0007843 Ga0496126_0007843_9010_9450 146
697 3300048929 Ga0496126_0030834 Ga0496126_0030834_1656_2096 146
698 3300048929 Ga0496126_0031354 Ga0496126_0031354_4120_4560 146
699 3300048929 Ga0496126_0121393 Ga0496126_0121393_1240_1680 146
700 3300048929 Ga0496126_0166479 Ga0496126_0166479_346_786 146
701 3300048929 Ga0496126_0407442 Ga0496126_0407442_615_1055 146
702 3300048929 Ga0496126_0452718 Ga0496126_0452718_38_478 146
703 3300048929 Ga0496126_0722205 Ga0496126_0722205_123_563 146
704 3300049460 Ga0495682_0155730 Ga0495682_0155730_67_507 146
705 3300049583 Ga0501067_0110475 Ga0501067_0110475_998_1438 146
706 3300049584 Ga0501068_0345611 Ga0501068_0345611_237_677 146
707 3300049585 Ga0501069_0258501 Ga0501069_0258501_308_748 146
708 3300049741 Ga0501079_0822338 Ga0501079_0822338_34_474 146
709 3300050489 nmdc:mga03683_203155_c1 nmdc:mga03683_203155_c1_247_687 146
710 3300050489 nmdc:mga03683_221246_c1 nmdc:mga03683_221246_c1_214_654 146
711 3300050489 nmdc:mga03683_26211_c1 nmdc:mga03683_26211_c1_260_700 146
712 3300050490 nmdc:mga03n38_25130_c1 nmdc:mga03n38_25130_c1_1479_1919 146
713 3300050490 nmdc:mga03n38_253802_c1 nmdc:mga03n38_253802_c1_38_478 146
714 3300050491 nmdc:mga00v17_75943_c1 nmdc:mga00v17_75943_c1_1280_1720 146
715 3300050491 nmdc:mga00v17_85112_c1 nmdc:mga00v17_85112_c1_978_1418 146
716 3300050492 nmdc:mga0yw44_216206_c1 nmdc:mga0yw44_216206_c1_761_1201 146
717 3300050492 nmdc:mga0yw44_415260_c1 nmdc:mga0yw44_415260_c1_336_776 146
718 3300050492 nmdc:mga0yw44_55596_c1 nmdc:mga0yw44_55596_c1_1517_1957 146
719 3300050492 nmdc:mga0yw44_800725_c1 nmdc:mga0yw44_800725_c1_147_587 146
720 3300050493 nmdc:mga0k408_139477_c1 nmdc:mga0k408_139477_c1_789_1229 146
721 3300050494 nmdc:mga06z11_189952_c1 nmdc:mga06z11_189952_c1_30_470 146
722 3300050494 nmdc:mga06z11_312960_c1 nmdc:mga06z11_312960_c1_407_847 146
723 3300050494 nmdc:mga06z11_33726_c1 nmdc:mga06z11_33726_c1_882_1322 146
724 3300050494 nmdc:mga06z11_635642_c1 nmdc:mga06z11_635642_c1_180_620 146
725 3300050496 nmdc:mga07m45_19967_c1 nmdc:mga07m45_19967_c1_2774_3214 146
726 3300050496 nmdc:mga07m45_38992_c1 nmdc:mga07m45_38992_c1_973_1413 146
727 3300050496 nmdc:mga07m45_55869_c1 nmdc:mga07m45_55869_c1_91_531 146
728 3300050507 nmdc:mga05p37_102181_c1 nmdc:mga05p37_102181_c1_2714_3154 146
729 3300050509 nmdc:mga0qj67_533055_c1 nmdc:mga0qj67_533055_c1_473_913 146
730 3300050511 nmdc:mga08y16_15164_c1 nmdc:mga08y16_15164_c1_3177_3617 146
731 3300050515 nmdc:mga0a205_134118_c1 nmdc:mga0a205_134118_c1_1477_1917 146
732 3300050516 nmdc:mga0sz30_21935_c1 nmdc:mga0sz30_21935_c1_1716_2156 146
733 3300050516 nmdc:mga0sz30_255674_c1 nmdc:mga0sz30_255674_c1_147_587 146
734 3300050516 nmdc:mga0sz30_48450_c1 nmdc:mga0sz30_48450_c1_1304_1744 146
735 3300053077 Ga0495601_0311791 Ga0495601_0311791_293_733 146
736 3300053079 Ga0500610_0117724 Ga0500610_0117724_261_701 146
737 3300053080 Ga0500635_0153508 Ga0500635_0153508_202_642 146
738 3300053083 Ga0495655_0051461 Ga0495655_0051461_435_875 146
739 3300053085 Ga0495619_0084768 Ga0495619_0084768_710_1150 146
740 3300053087 Ga0500643_027818 Ga0500643_027818_581_1021 146
741 3300053089 Ga0500581_258691 Ga0500581_258691_15_455 146
742 3300053098 Ga0500650_0212604 Ga0500650_0212604_131_571 146
743 3300053098 Ga0500650_0250963 Ga0500650_0250963_116_556 146
744 3300053102 Ga0500554_017215 Ga0500554_017215_1311_1751 146
745 3300053114 Ga0500582_161701 Ga0500582_161701_165_605 146
746 3300053116 Ga0500592_043676 Ga0500592_043676_59_499 146
747 3300053119 Ga0500595_000477 Ga0500595_000477_3720_4160 146
748 3300053119 Ga0500595_028055 Ga0500595_028055_1311_1751 146
749 3300053124 Ga0500617_206272 Ga0500617_206272_258_698 146
750 3300053126 Ga0500621_175371 Ga0500621_175371_196_636 146
751 3300053134 Ga0500658_0297115 Ga0500658_0297115_287_727 146
752 3300053134 Ga0500658_0317980 Ga0500658_0317980_203_643 146
753 3300053146 Ga0500588_0114309 Ga0500588_0114309_370_810 146
754 3300053147 Ga0500589_064971 Ga0500589_064971_392_832 146
755 3300053147 Ga0500589_133161 Ga0500589_133161_197_637 146
756 3300053147 Ga0500589_206025 Ga0500589_206025_254_694 146
757 3300053147 Ga0500589_266318 Ga0500589_266318_91_531 146
758 3300053148 Ga0500590_335920 Ga0500590_335920_21_461 146
759 3300053156 Ga0500622_0051250 Ga0500622_0051250_494_934 146
760 3300053158 Ga0500627_0145273 Ga0500627_0145273_63_503 146
761 3300053160 Ga0500633_0146917 Ga0500633_0146917_13_453 146
762 3300053161 Ga0500634_0208305 Ga0500634_0208305_168_608 146
763 3300053162 Ga0500638_011253 Ga0500638_011253_2736_3176 146
764 3300053177 Ga0500636_0070176 Ga0500636_0070176_315_755 146
765 3300053178 Ga0500637_0010152 Ga0500637_0010152_2314_2754 146
766 3300053730 Ga0500645_159327 Ga0500645_159327_26_466 146
767 3300053731 Ga0500609_015338 Ga0500609_015338_120_560 146
768 3300055283 Ga0500661_002168 Ga0500661_002168_973_1413 146
769 3300060353 Ga0501082_0988906 Ga0501082_0988906_82_522 146
770 3300061734 Ga0530510_0616412 Ga0530510_0616412_331_771 146
771 3300061734 Ga0530510_0853936 Ga0530510_0853936_86_526 146
772 3300003203 JGI25406J46586_10005031 JGI25406J46586_100050315 147
773 3300003911 JGI25405J52794_10026811 JGI25405J52794_100268112 147
774 3300005329 Ga0070683_100057276 Ga0070683_1000572764 147
775 3300005339 Ga0070660_100036213 Ga0070660_1000362135 147
776 3300005354 Ga0070675_100283247 Ga0070675_1002832471 147
777 3300005366 Ga0070659_100090516 Ga0070659_1000905163 147
778 3300005434 Ga0070709_10001880 Ga0070709_100018806 147
779 3300005434 Ga0070709_10251445 Ga0070709_102514451 147
780 3300005435 Ga0070714_100166014 Ga0070714_1001660142 147
781 3300005435 Ga0070714_100938018 Ga0070714_1009380182 147
782 3300005436 Ga0070713_100003661 Ga0070713_1000036619 147
783 3300005437 Ga0070710_10001236 Ga0070710_100012363 147
784 3300005439 Ga0070711_100000660 Ga0070711_10000066013 147
785 3300005468 Ga0070707_100247197 Ga0070707_1002471972 147
786 3300005530 Ga0070679_100137917 Ga0070679_1001379172 147
787 3300005535 Ga0070684_100013455 Ga0070684_1000134552 147
788 3300005536 Ga0070697_100040762 Ga0070697_1000407624 147
789 3300005536 Ga0070697_100164270 Ga0070697_1001642701 147
790 3300005539 Ga0068853_100012684 Ga0068853_1000126846 147
791 3300005545 Ga0070695_100963103 Ga0070695_1009631031 147
792 3300005547 Ga0070693_100820982 Ga0070693_1008209821 147
793 3300005548 Ga0070665_100600358 Ga0070665_1006003582 147
794 3300005563 Ga0068855_100805940 Ga0068855_1008059402 147
795 3300005577 Ga0068857_100018485 Ga0068857_1000184852 147
796 3300005719 Ga0068861_101297616 Ga0068861_1012976161 147
797 3300005834 Ga0068851_10011859 Ga0068851_100118593 147
798 3300005841 Ga0068863_101461091 Ga0068863_1014610911 147
799 3300005937 Ga0081455_10008111 Ga0081455_100081114 147
800 3300005937 Ga0081455_10011164 Ga0081455_100111647 147
801 3300005937 Ga0081455_10277173 Ga0081455_102771731 147
802 3300005937 Ga0081455_10296594 Ga0081455_102965941 147
803 3300005983 Ga0081540_1013355 Ga0081540_10133552 147
804 3300005983 Ga0081540_1022081 Ga0081540_10220815 147
805 3300005983 Ga0081540_1023147 Ga0081540_10231476 147
806 3300005983 Ga0081540_1025816 Ga0081540_10258165 147
807 3300005983 Ga0081540_1059141 Ga0081540_10591412 147
808 3300005983 Ga0081540_1080759 Ga0081540_10807592 147
809 3300005983 Ga0081540_1096413 Ga0081540_10964131 147
810 3300005983 Ga0081540_1209291 Ga0081540_12092911 147
811 3300005985 Ga0081539_10001064 Ga0081539_100010647 147
812 3300005985 Ga0081539_10158403 Ga0081539_101584032 147
813 3300006028 Ga0070717_10104664 Ga0070717_101046642 147
814 3300006051 Ga0075364_10535182 Ga0075364_105351822 147
815 3300006163 Ga0070715_10000108 Ga0070715_1000010810 147
816 3300006163 Ga0070715_10061039 Ga0070715_100610392 147
817 3300006173 Ga0070716_100003373 Ga0070716_1000033735 147
818 3300006175 Ga0070712_100175596 Ga0070712_1001755963 147
819 3300006178 Ga0075367_10584169 Ga0075367_105841692 147
820 3300006353 Ga0075370_10655801 Ga0075370_106558011 147
821 3300006871 Ga0075434_100071865 Ga0075434_1000718653 147
822 3300006871 Ga0075434_101486958 Ga0075434_1014869582 147
823 3300006914 Ga0075436_100065143 Ga0075436_1000651431 147
824 3300007076 Ga0075435_100022140 Ga0075435_1000221401 147
825 3300007076 Ga0075435_101589091 Ga0075435_1015890911 147
826 3300007265 Ga0099794_10003899 Ga0099794_100038994 147
827 3300007265 Ga0099794_10022739 Ga0099794_100227392 147
828 3300007265 Ga0099794_10071677 Ga0099794_100716772 147
829 3300007265 Ga0099794_10280335 Ga0099794_102803352 147
830 3300007788 Ga0099795_10004002 Ga0099795_100040022 147
831 3300007788 Ga0099795_10025241 Ga0099795_100252412 147
832 3300007788 Ga0099795_10385447 Ga0099795_103854471 147
833 3300009093 Ga0105240_10013534 Ga0105240_100135345 147
834 3300009098 Ga0105245_11532193 Ga0105245_115321931 147
835 3300009147 Ga0114129_12077105 Ga0114129_120771051 147
836 3300009148 Ga0105243_11826886 Ga0105243_118268861 147
837 3300009545 Ga0105237_10017081 Ga0105237_100170816 147
838 3300009551 Ga0105238_10284200 Ga0105238_102842002 147
839 3300009553 Ga0105249_11057152 Ga0105249_110571521 147
840 3300010159 Ga0099796_10070681 Ga0099796_100706813 147
841 3300010159 Ga0099796_10262636 Ga0099796_102626362 147
842 3300010375 Ga0105239_10031640 Ga0105239_100316405 147
843 3300010375 Ga0105239_11077120 Ga0105239_110771202 147
844 3300013104 Ga0157370_10157802 Ga0157370_101578023 147
845 3300013105 Ga0157369_10057884 Ga0157369_100578842 147
846 3300013296 Ga0157374_10785472 Ga0157374_107854722 147
847 3300013306 Ga0163162_10812570 Ga0163162_108125702 147
848 3300014326 Ga0157380_10971924 Ga0157380_109719242 147
849 3300014745 Ga0157377_10909713 Ga0157377_109097131 147
850 3300021361 Ga0213872_10344068 Ga0213872_103440681 147
851 3300021377 Ga0213874_10006326 Ga0213874_100063262 147
852 3300021384 Ga0213876_10005462 Ga0213876_100054623 147
853 3300021384 Ga0213876_10071525 Ga0213876_100715253 147
854 3300025321 Ga0207656_10084455 Ga0207656_100844551 147
855 3300025893 Ga0207682_10185059 Ga0207682_101850592 147
856 3300025898 Ga0207692_10000829 Ga0207692_100008296 147
857 3300025901 Ga0207688_10171453 Ga0207688_101714532 147
858 3300025905 Ga0207685_10001367 Ga0207685_100013672 147
859 3300025905 Ga0207685_10164329 Ga0207685_101643292 147
860 3300025906 Ga0207699_10004989 Ga0207699_100049894 147
861 3300025912 Ga0207707_10004934 Ga0207707_100049347 147
862 3300025913 Ga0207695_10033471 Ga0207695_100334714 147
863 3300025914 Ga0207671_10033557 Ga0207671_100335574 147
864 3300025914 Ga0207671_10047548 Ga0207671_100475482 147
865 3300025915 Ga0207693_10000310 Ga0207693_1000031027 147
866 3300025916 Ga0207663_10000230 Ga0207663_1000023017 147
867 3300025917 Ga0207660_10011652 Ga0207660_100116523 147
868 3300025919 Ga0207657_10022864 Ga0207657_100228642 147
869 3300025920 Ga0207649_10101458 Ga0207649_101014582 147
870 3300025921 Ga0207652_10002828 Ga0207652_100028288 147
871 3300025924 Ga0207694_10048946 Ga0207694_100489463 147
872 3300025924 Ga0207694_10199304 Ga0207694_101993041 147
873 3300025928 Ga0207700_10021866 Ga0207700_100218662 147
874 3300025928 Ga0207700_10113880 Ga0207700_101138802 147
875 3300025928 Ga0207700_11027583 Ga0207700_110275832 147
876 3300025928 Ga0207700_11693477 Ga0207700_116934771 147
877 3300025929 Ga0207664_10001147 Ga0207664_1000114710 147
878 3300025929 Ga0207664_10289562 Ga0207664_102895622 147
879 3300025929 Ga0207664_11517751 Ga0207664_115177511 147
880 3300025932 Ga0207690_10779457 Ga0207690_107794571 147
881 3300025939 Ga0207665_10003377 Ga0207665_100033775 147
882 3300025939 Ga0207665_10028331 Ga0207665_100283315 147
883 3300025944 Ga0207661_10621100 Ga0207661_106211001 147
884 3300025949 Ga0207667_10046837 Ga0207667_100468372 147
885 3300025949 Ga0207667_10323540 Ga0207667_103235402 147
886 3300026041 Ga0207639_10020456 Ga0207639_100204565 147
887 3300026116 Ga0207674_10035377 Ga0207674_100353776 147
888 3300026118 Ga0207675_101811801 Ga0207675_1018118011 147
889 3300027512 Ga0209179_1021592 Ga0209179_10215921 147
890 3300027512 Ga0209179_1036546 Ga0209179_10365461 147
891 3300027512 Ga0209179_1039240 Ga0209179_10392401 147
892 3300027671 Ga0209588_1009657 Ga0209588_10096573 147
893 3300028573 Ga0265334_10011626 Ga0265334_100116265 147
894 3300031235 Ga0265330_10032679 Ga0265330_100326794 147
895 3300031238 Ga0265332_10032204 Ga0265332_100322042 147
896 3300031616 Ga0307508_10000002 Ga0307508_1000000234 147
897 3300032126 Ga0307415_101799059 Ga0307415_1017990591 147
898 3300033180 Ga0307510_10090848 Ga0307510_100908484 147
899 3300034816 Ga0373930_0071943 Ga0373930_0071943_201_644 147
900 3300035086 Ga0373934_0001837 Ga0373934_0001837_3786_4229 147
901 3300035111 Ga0373923_0000584 Ga0373923_0000584_2496_2939 147
902 3300035112 Ga0373932_0040581 Ga0373932_0040581_869_1312 147
903 3300035113 Ga0373936_0072456 Ga0373936_0072456_73_516 147
904 3300035117 Ga0373953_0004679 Ga0373953_0004679_621_1064 147
905 3300035117 Ga0373953_0005933 Ga0373953_0005933_1291_1734 147
906 3300035118 Ga0373954_0000457 Ga0373954_0000457_9927_10370 147
907 3300035118 Ga0373954_0003801 Ga0373954_0003801_1533_1976 147
908 3300035118 Ga0373954_0314106 Ga0373954_0314106_176_619 147
909 3300035119 Ga0373956_0002647 Ga0373956_0002647_5170_5613 147
910 3300035119 Ga0373956_0095376 Ga0373956_0095376_136_579 147
911 3300035120 Ga0373957_0004514 Ga0373957_0004514_3359_3802 147
912 3300035120 Ga0373957_0091627 Ga0373957_0091627_582_1025 147
913 3300035171 Ga0373946_0698539 Ga0373946_0698539_11_454 147
914 3300035172 Ga0373955_0001753 Ga0373955_0001753_3745_4188 147
915 3300035207 Ga0373942_0174898 Ga0373942_0174898_13_456 147
916 3300035207 Ga0373942_0261773 Ga0373942_0261773_14_457 147
917 3300035242 Ga0373962_0166982 Ga0373962_0166982_222_665 147
918 3300035410 Ga0373924_0000541 Ga0373924_0000541_3427_3870 147
919 3300035691 Ga0373931_0035089 Ga0373931_0035089_1211_1654 147
920 3300035695 Ga0373927_0004813 Ga0373927_0004813_8156_8599 147
921 3300035695 Ga0373927_0944146 Ga0373927_0944146_71_514 147
922 3300035724 Ga0373933_0004255 Ga0373933_0004255_4636_5079 147
923 3300035724 Ga0373933_0015606 Ga0373933_0015606_395_838 147
924 3300035724 Ga0373933_0413936 Ga0373933_0413936_150_593 147
925 3300035724 Ga0373933_0847308 Ga0373933_0847308_114_557 147
926 3300035725 Ga0373947_0018758 Ga0373947_0018758_107_550 147
927 3300036401 Ga0373937_0007949 Ga0373937_0007949_6116_6559 147
928 3300036401 Ga0373937_0060148 Ga0373937_0060148_21_464 147
929 3300036401 Ga0373937_0413087 Ga0373937_0413087_175_618 147
930 3300039437 Ga0436365_0147971 Ga0436365_0147971_635_1078 147
931 3300039437 Ga0436365_0725440 Ga0436365_0725440_5928_6371 147
932 3300039437 Ga0436365_0870281 Ga0436365_0870281_633_1076 147
933 3300039437 Ga0436365_1521235 Ga0436365_1521235_1962_2405 147
934 3300039438 Ga0436360_0049247 Ga0436360_0049247_99_542 147
935 3300039447 Ga0436361_1075147 Ga0436361_1075147_404_847 147
936 3300039450 Ga0436363_0125979 Ga0436363_0125979_921_1364 147
937 3300039450 Ga0436363_0449948 Ga0436363_0449948_2048_2491 147
938 3300039450 Ga0436363_0859709 Ga0436363_0859709_492_935 147
939 3300044694 Ga0466963_0195311 Ga0466963_0195311_505_948 147
940 3300044706 Ga0466964_0299525 Ga0466964_0299525_106_549 147
941 3300044842 Ga0466957_0206439 Ga0466957_0206439_584_1027 147
942 3300045836 Ga0466958_0070229 Ga0466958_0070229_450_893 147
943 3300046454 Ga0495592_0005520 Ga0495592_0005520_6414_6857 147
944 3300046454 Ga0495592_0017032 Ga0495592_0017032_4718_5161 147
945 3300046455 Ga0495603_0009420 Ga0495603_0009420_4527_4970 147
946 3300046455 Ga0495603_0032179 Ga0495603_0032179_1562_2005 147
947 3300046459 Ga0495629_0000124 Ga0495629_0000124_56746_57189 147
948 3300046459 Ga0495629_0019538 Ga0495629_0019538_1861_2304 147
949 3300046462 Ga0495651_0038303 Ga0495651_0038303_1064_1507 147
950 3300046462 Ga0495651_0041553 Ga0495651_0041553_174_617 147
951 3300046463 Ga0495653_0018700 Ga0495653_0018700_102_545 147
952 3300046472 Ga0495580_0173040 Ga0495580_0173040_176_619 147
953 3300046475 Ga0495639_0010176 Ga0495639_0010176_656_1099 147
954 3300046475 Ga0495639_0175348 Ga0495639_0175348_124_567 147
955 3300046477 Ga0495664_0186020 Ga0495664_0186020_53_496 147
956 3300046507 Ga0495606_0111682 Ga0495606_0111682_68_511 147
957 3300046511 Ga0495608_0002253 Ga0495608_0002253_1441_1884 147
958 3300046511 Ga0495608_0018263 Ga0495608_0018263_140_583 147
959 3300046513 Ga0495616_0373556 Ga0495616_0373556_128_571 147
960 3300046514 Ga0495618_0008644 Ga0495618_0008644_3201_3644 147
961 3300046514 Ga0495618_0527281 Ga0495618_0527281_63_506 147
962 3300046516 Ga0495628_0010523 Ga0495628_0010523_3840_4283 147
963 3300046516 Ga0495628_0213293 Ga0495628_0213293_859_1302 147
964 3300046517 Ga0495630_0491654 Ga0495630_0491654_470_913 147
965 3300046519 Ga0495632_0167360 Ga0495632_0167360_319_762 147
966 3300046525 Ga0495663_0335989 Ga0495663_0335989_30_473 147
967 3300046529 Ga0495652_0021486 Ga0495652_0021486_3517_3960 147
968 3300046529 Ga0495652_0034509 Ga0495652_0034509_279_722 147
969 3300046533 Ga0495640_0020098 Ga0495640_0020098_2303_2746 147
970 3300046533 Ga0495640_0035828 Ga0495640_0035828_2413_2856 147
971 3300046536 Ga0495587_0015106 Ga0495587_0015106_936_1379 147
972 3300046536 Ga0495587_0019403 Ga0495587_0019403_3432_3875 147
973 3300046543 Ga0495645_0016860 Ga0495645_0016860_4708_5151 147
974 3300046543 Ga0495645_0074551 Ga0495645_0074551_1886_2329 147
975 3300046557 Ga0495622_0145857 Ga0495622_0145857_95_538 147
976 3300046559 Ga0495667_0000551 Ga0495667_0000551_16115_16558 147
977 3300046559 Ga0495667_0060348 Ga0495667_0060348_205_648 147
978 3300046663 Ga0495635_0001218 Ga0495635_0001218_2637_3080 147
979 3300046663 Ga0495635_0023042 Ga0495635_0023042_3837_4280 147
980 3300046675 Ga0495657_0019076 Ga0495657_0019076_1064_1507 147
981 3300046675 Ga0495657_0131203 Ga0495657_0131203_136_579 147
982 3300046678 Ga0495599_0009152 Ga0495599_0009152_3319_3762 147
983 3300046678 Ga0495599_0125057 Ga0495599_0125057_92_535 147
984 3300046679 Ga0495623_0016600 Ga0495623_0016600_2672_3115 147
985 3300046679 Ga0495623_0022621 Ga0495623_0022621_3544_3987 147
986 3300046680 Ga0495646_0000643 Ga0495646_0000643_2550_2993 147
987 3300046683 Ga0495658_0403890 Ga0495658_0403890_132_575 147
988 3300046684 Ga0495669_0144646 Ga0495669_0144646_299_742 147
989 3300046690 Ga0495624_0062626 Ga0495624_0062626_1231_1674 147
990 3300046809 Ga0495600_0001007 Ga0495600_0001007_3489_3932 147
991 3300046809 Ga0495600_0266369 Ga0495600_0266369_174_617 147
992 3300047315 Ga0495581_0045989 Ga0495581_0045989_879_1322 147
993 3300047317 Ga0495604_0015936 Ga0495604_0015936_3746_4189 147
994 3300047317 Ga0495604_0023465 Ga0495604_0023465_3941_4384 147
995 3300047319 Ga0495674_0003683 Ga0495674_0003683_10388_10831 147
996 3300047319 Ga0495674_0114961 Ga0495674_0114961_1758_2201 147
997 3300047321 Ga0495676_0130352 Ga0495676_0130352_1233_1676 147
998 3300047322 Ga0495680_0001909 Ga0495680_0001909_12882_13325 147
999 3300047322 Ga0495680_0046311 Ga0495680_0046311_212_655 147
1000 3300047444 Ga0495675_0001972 Ga0495675_0001972_7564_8007 147
1001 3300047444 Ga0495675_0011175 Ga0495675_0011175_3786_4229 147
1002 3300047471 Ga0495684_0000313 Ga0495684_0000313_27224_27667 147
1003 3300047471 Ga0495684_0035943 Ga0495684_0035943_71_514 147
1004 3300047673 Ga0495593_0001524 Ga0495593_0001524_6201_6644 147
1005 3300048088 Ga0495602_0050780 Ga0495602_0050780_395_838 147
1006 3300048088 Ga0495602_0059972 Ga0495602_0059972_1812_2255 147
1007 3300048909 Ga0496106_0294060 Ga0496106_0294060_707_1150 147
1008 3300048911 Ga0496108_0852630 Ga0496108_0852630_47_490 147
1009 3300048913 Ga0496110_0122513 Ga0496110_0122513_166_609 147
1010 3300048914 Ga0496111_0145014 Ga0496111_0145014_491_934 147
1011 3300048914 Ga0496111_0155083 Ga0496111_0155083_987_1430 147
1012 3300048914 Ga0496111_0548895 Ga0496111_0548895_365_808 147
1013 3300048915 Ga0496112_0001974 Ga0496112_0001974_9333_9776 147
1014 3300048915 Ga0496112_0186304 Ga0496112_0186304_1370_1813 147
1015 3300048915 Ga0496112_0237027 Ga0496112_0237027_359_802 147
1016 3300048916 Ga0496113_0274424 Ga0496113_0274424_199_642 147
1017 3300048917 Ga0496114_1593423 Ga0496114_1593423_45_488 147
1018 3300048918 Ga0496115_0223229 Ga0496115_0223229_770_1213 147
1019 3300048918 Ga0496115_0256728 Ga0496115_0256728_198_641 147
1020 3300048918 Ga0496115_0260811 Ga0496115_0260811_369_812 147
1021 3300048918 Ga0496115_0268189 Ga0496115_0268189_665_1108 147
1022 3300048918 Ga0496115_0937074 Ga0496115_0937074_38_481 147
1023 3300049569 Ga0501032_0019827 Ga0501032_0019827_3455_3904 147
1024 3300049569 Ga0501032_0227629 Ga0501032_0227629_694_1143 147
1025 3300049569 Ga0501032_0664431 Ga0501032_0664431_146_595 147
1026 3300049571 Ga0501034_0697001 Ga0501034_0697001_294_743 147
1027 3300049571 Ga0501034_0776041 Ga0501034_0776041_350_799 147
1028 3300049572 Ga0501036_0103183 Ga0501036_0103183_1727_2176 147
1029 3300049573 Ga0501037_0580240 Ga0501037_0580240_92_541 147
1030 3300049574 Ga0501038_0083459 Ga0501038_0083459_1311_1760 147
1031 3300049574 Ga0501038_0531410 Ga0501038_0531410_58_507 147
1032 3300049575 Ga0501039_0193009 Ga0501039_0193009_815_1264 147
1033 3300049575 Ga0501039_0244298 Ga0501039_0244298_590_1039 147
1034 3300049581 Ga0501047_0124847 Ga0501047_0124847_1980_2429 147
1035 3300049581 Ga0501047_1158453 Ga0501047_1158453_50_499 147
1036 3300049583 Ga0501067_0080761 Ga0501067_0080761_948_1397 147
1037 3300049584 Ga0501068_0036146 Ga0501068_0036146_649_1098 147
1038 3300049585 Ga0501069_0023410 Ga0501069_0023410_1094_1543 147
1039 3300049588 Ga0501072_0444037 Ga0501072_0444037_491_940 147
1040 3300049589 Ga0501073_0063515 Ga0501073_0063515_569_1018 147
1041 3300049592 Ga0501076_0260681 Ga0501076_0260681_576_1025 147
1042 3300049742 Ga0501080_0234585 Ga0501080_0234585_699_1148 147
1043 3300049743 Ga0501081_0603531 Ga0501081_0603531_83_532 147
1044 3300049744 Ga0501083_0036945 Ga0501083_0036945_2649_3098 147
1045 3300049822 Ga0501035_0044770 Ga0501035_0044770_2566_3015 147
1046 3300049822 Ga0501035_0152365 Ga0501035_0152365_49_498 147
1047 3300049823 Ga0501044_0130692 Ga0501044_0130692_1934_2383 147
1048 3300049824 Ga0501045_0005982 Ga0501045_0005982_6711_7160 147
1049 3300049824 Ga0501045_1376484 Ga0501045_1376484_41_484 147
1050 3300050491 nmdc:mga00v17_388333_c1 nmdc:mga00v17_388333_c1_300_743 147
1051 3300050512 nmdc:mga0n895_69515_c1 nmdc:mga0n895_69515_c1_1465_1908 147
1052 3300050513 nmdc:mga0rr50_179637_c1 nmdc:mga0rr50_179637_c1_87_530 147
1053 3300050513 nmdc:mga0rr50_308324_c2 nmdc:mga0rr50_308324_c2_382_825 147
1054 3300050514 nmdc:mga08x19_140497_c1 nmdc:mga08x19_140497_c1_1128_1571 147
1055 3300053077 Ga0495601_0054219 Ga0495601_0054219_776_1219 147
1056 3300053078 Ga0495612_0016378 Ga0495612_0016378_2393_2836 147
1057 3300053083 Ga0495655_0178933 Ga0495655_0178933_20_463 147
1058 3300053084 Ga0495595_0000445 Ga0495595_0000445_12680_13123 147
1059 3300053084 Ga0495595_0054813 Ga0495595_0054813_174_617 147
1060 3300053085 Ga0495619_0001995 Ga0495619_0001995_10471_10914 147
1061 3300053102 Ga0500554_003817 Ga0500554_003817_198_641 147
1062 3300053150 Ga0500603_028836 Ga0500603_028836_19_462 147
1063 3300053178 Ga0500637_0011408 Ga0500637_0011408_2736_3179 147
1064 3300054114 Ga0501084_0309355 Ga0501084_0309355_386_835 147
1065 3300060353 Ga0501082_1215592 Ga0501082_1215592_161_610 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

43

125

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ku8-assembly3.cif.gz_C structures of pkgi reveal a cgmp-selective activation mechanism 0.9372 3 115
3co2-assembly1.cif.gz_C mlotik1 ion channel cyclic-nucleotide binding domain mutant 0.9256 6 117
3j4q-assembly1.cif.gz_C pseudo-atomic model of the akap18-pka complex in a bent conformation derived from electron microscopy 0.9077 3 113
2qvs-assembly1.cif.gz_B crystal structure of type iia holoenzyme of camp-dependent protein kinase 0.9077 3 113
3plq-assembly1.cif.gz_A crystal structure of pka type i regulatory subunit bound with rp-8-br-camps 0.9022 5 114
ID Description Score Start End Superfamily
af_E7F7H6_385_507_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9156 8 125 2.60.120.10
af_Q4DSV5_212_344_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9148 3 112 2.60.120.10
af_E9AGM0_334_458_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9083 3 112 2.60.120.10
5j3uA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9042 3 112 2.60.120.10
3of1A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9041 2 111 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A537R663-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9989 1 124 GO:0003700
GO:0005829
AF-A0A537R663-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.983 1 124 GO:0003700
GO:0005829
AF-A0A431P2R6-F1-model_v4 deleted 0.9733 1 145
AF-A0A5E4NT20-F1-model_v4 Cyclic nucleotide-binding protein 0.9708 1 138 GO:0003700
GO:0005829
AF-A0A4U6BN04-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9705 1 145 GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
92.46 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map