F489309

General Info

Members Datasets Scaffolds Average Seq Length
1062 429 2124 249

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0976420|Ga0436364_0976420_296_1123
Length 275
Sequence MWLEKRMPEMAASSIATAPVAAQAEQNLEASRPPRHVAIIMDGNGRWAAERGLPRTEGHRRGVEALRRTVRAAGEMGIRILTIFSFSAENWSRPPAEIRDLMGLLRRFIRNDLAELHGSNVRVRIIGERIGLDPEIRRLLEEAEELTHANDGLLLVVAFNYGGRQEIARAAQRIAEMVAAGKLATADITADLIGRHLDAPDLPDPDLIIRTSGEQRLSNFLMWQSAYSELIFVPIYWPDFDGSALDIAIAEYRRRERRFGGLIGRTLGAERAVAP

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
137 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
138 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
155 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
236 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
237 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
238 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
242 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
243 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
244 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
245 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
246 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
247 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
248 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
249 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
250 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
251 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
252 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
253 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
255 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
257 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
258 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
259 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
260 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
261 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
262 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
263 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
266 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
267 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
268 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
270 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
272 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
273 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
278 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
279 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
280 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
281 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
282 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
283 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
284 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
285 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
286 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
287 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
288 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
296 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
299 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
300 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
301 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
302 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
303 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
304 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
305 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
306 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
307 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
311 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
312 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
313 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
314 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
315 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
316 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
317 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
318 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
319 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
320 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
321 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
327 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
328 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
329 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
330 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
331 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
332 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
333 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
334 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
335 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
336 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
337 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
338 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
339 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
340 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
341 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
342 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
343 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
344 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
345 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
346 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
347 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
352 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
353 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
354 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
355 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
356 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
357 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
358 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
359 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
360 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
361 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
362 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
363 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
378 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
379 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
380 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
381 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
382 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
383 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
384 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
385 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
386 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
387 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
388 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
389 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
390 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
391 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
394 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
395 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
396 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
397 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
398 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
399 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
400 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
401 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
402 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
403 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
404 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
409 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
410 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
411 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
412 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
415 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
416 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
417 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
418 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
419 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
420 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
421 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
422 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
423 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
424 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
425 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
426 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
427 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
428 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
429 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.24
Nodule 0
Rhizoplane 9.23
Rhizosphere 85.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0976420 3300037853 Bacteria 1479
2 2214683829 2209111006 Bacteria 4471
3 ARSoilYngRDRAFT_c00716 3300000042 Bacteria 3074
4 ARcpr5yngRDRAFT_c001074 3300000043 Bacteria 3094
5 ARSoilOldRDRAFT_c000177 3300000044 Bacteria 10645
6 ARCol0yngRDRAFT_1000052 3300000652 Bacteria 20331
7 JGI24747J21853_1001554 3300001978 Bacteria 1742
8 JGI24737J22298_10003487 3300001990 Bacteria 5548
9 JGI24743J22301_10015874 3300001991 Bacteria 1400
10 JGI24750J21931_1003409 3300002070 Bacteria 1902
11 JGI24745J21846_1001824 3300002073 Bacteria 2109
12 JGI24738J21930_10003772 3300002075 Bacteria 3786
13 JGI24749J21850_1000734 3300002076 Bacteria 4727
14 JGI24744J21845_10000566 3300002077 Bacteria 6684
15 JGI24034J26672_10006473 3300002239 Bacteria 1689
16 JGI25406J46586_10010515 3300003203 Bacteria 4103
17 JGI25153J46596_10011896 3300003215 Bacteria 3811
18 JGI25404J52841_10000116 3300003659 Bacteria 8083
19 JGI25405J52794_10015418 3300003911 Bacteria 1501
20 Ga0065717_1003092 3300005276 Bacteria 1428
21 Ga0065704_10074934 3300005289 Bacteria 5898
22 Ga0065712_10000938 3300005290 Bacteria 7363
23 Ga0065715_10093899 3300005293 Bacteria 4508
24 Ga0065715_10111514 3300005293 Bacteria 2567
25 Ga0070676_10036202 3300005328 Bacteria 2842
26 Ga0070676_10158558 3300005328 Bacteria 1454
27 Ga0070683_100000836 3300005329 Bacteria 22825
28 Ga0070690_100003439 3300005330 Bacteria 8653
29 Ga0070690_100040778 3300005330 Bacteria 2937
30 Ga0070690_100081306 3300005330 Bacteria 2120
31 Ga0070690_100157976 3300005330 Bacteria 1551
32 Ga0070670_100006794 3300005331 Bacteria 9685
33 Ga0070670_100448221 3300005331 Bacteria 1143
34 Ga0070670_100579385 3300005331 Bacteria 1003
35 Ga0070677_10000406 3300005333 Bacteria 14999
36 Ga0070677_10089786 3300005333 Bacteria 1334
37 Ga0068869_100000653 3300005334 Bacteria 19619
38 Ga0068869_100177535 3300005334 Bacteria 1668
39 Ga0068869_100452192 3300005334 Bacteria 1065
40 Ga0070666_10063591 3300005335 Bacteria 2502
41 Ga0070666_10227128 3300005335 Bacteria 1318
42 Ga0070680_100023715 3300005336 Bacteria 4896
43 Ga0070680_100067501 3300005336 Bacteria 2933
44 Ga0070682_100012500 3300005337 Bacteria 4870
45 Ga0070682_100070250 3300005337 Bacteria 2238
46 Ga0070682_100109320 3300005337 Bacteria 1840
47 Ga0068868_100059640 3300005338 Bacteria 3019
48 Ga0068868_100186430 3300005338 Bacteria 1724
49 Ga0068868_100519982 3300005338 Bacteria 1045
50 Ga0070660_100007849 3300005339 Bacteria 7442
51 Ga0070660_100089102 3300005339 Bacteria 2431
52 Ga0070660_100096882 3300005339 Bacteria 2333
53 Ga0070689_100015309 3300005340 Bacteria 5589
54 Ga0070689_100018611 3300005340 Bacteria 5120
55 Ga0070689_100047564 3300005340 Bacteria 3307
56 Ga0070689_100113956 3300005340 Bacteria 2153
57 Ga0070689_100262149 3300005340 Bacteria 1429
58 Ga0070691_10008462 3300005341 Bacteria 4709
59 Ga0070691_10009743 3300005341 Bacteria 4380
60 Ga0070691_10195183 3300005341 Bacteria 1061
61 Ga0070687_100000387 3300005343 Bacteria 14981
62 Ga0070687_100024312 3300005343 Bacteria 2891
63 Ga0070687_100057305 3300005343 Bacteria 2043
64 Ga0070687_100392891 3300005343 Bacteria 907
65 Ga0070661_100007161 3300005344 Bacteria 7689
66 Ga0070661_100378482 3300005344 Bacteria 1115
67 Ga0070661_100400872 3300005344 Bacteria 1085
68 Ga0070692_10005794 3300005345 Bacteria 5312
69 Ga0070692_10023542 3300005345 Bacteria 3018
70 Ga0070668_100004606 3300005347 Bacteria 10214
71 Ga0070668_100043370 3300005347 Bacteria 3450
72 Ga0070668_100212785 3300005347 Bacteria 1591
73 Ga0070669_100026812 3300005353 Bacteria 4146
74 Ga0070675_100009799 3300005354 Bacteria 7463
75 Ga0070675_100064498 3300005354 Bacteria 3028
76 Ga0070675_100138176 3300005354 Bacteria 2081
77 Ga0070675_100244551 3300005354 Bacteria 1568
78 Ga0070671_100021024 3300005355 Bacteria 5326
79 Ga0070671_100530867 3300005355 Bacteria 1014
80 Ga0070674_100010056 3300005356 Bacteria 5697
81 Ga0070674_100010545 3300005356 Bacteria 5593
82 Ga0070674_100022446 3300005356 Bacteria 4070
83 Ga0070674_100096844 3300005356 Bacteria 2142
84 Ga0070674_100161599 3300005356 Bacteria 1700
85 Ga0070673_100001011 3300005364 Bacteria 15945
86 Ga0070673_100063811 3300005364 Bacteria 2932
87 Ga0070688_100000551 3300005365 Bacteria 18929
88 Ga0070688_100014036 3300005365 Bacteria 4531
89 Ga0070688_100063949 3300005365 Bacteria 2334
90 Ga0070688_100208620 3300005365 Bacteria 1371
91 Ga0070688_100332273 3300005365 Bacteria 1107
92 Ga0070659_100020868 3300005366 Bacteria 4982
93 Ga0070659_100070572 3300005366 Bacteria 2775
94 Ga0070659_100266313 3300005366 Bacteria 1423
95 Ga0070659_100675240 3300005366 Bacteria 892
96 Ga0070667_100014714 3300005367 Bacteria 6463
97 Ga0070667_100094015 3300005367 Bacteria 2582
98 Ga0070667_100201766 3300005367 Bacteria 1765
99 Ga0070667_100394241 3300005367 Bacteria 1259
100 Ga0070709_10001535 3300005434 Bacteria 12464
101 Ga0070709_10071449 3300005434 Bacteria 2240
102 Ga0070714_100014895 3300005435 Bacteria 6251
103 Ga0070714_100226099 3300005435 Bacteria 1722
104 Ga0070713_100000374 3300005436 Bacteria 28680
105 Ga0070713_100026161 3300005436 Bacteria 4576
106 Ga0070713_100320004 3300005436 Bacteria 1432
107 Ga0070710_10015137 3300005437 Bacteria 3897
108 Ga0070710_10024690 3300005437 Bacteria 3174
109 Ga0070710_10064338 3300005437 Bacteria 2098
110 Ga0070710_10110143 3300005437 Bacteria 1653
111 Ga0070701_10052669 3300005438 Bacteria 2115
112 Ga0070711_100050965 3300005439 Bacteria 2840
113 Ga0070711_100194658 3300005439 Bacteria 1560
114 Ga0070711_100239874 3300005439 Bacteria 1417
115 Ga0070711_100291903 3300005439 Bacteria 1294
116 Ga0070711_100741445 3300005439 Bacteria 829
117 Ga0070705_100009385 3300005440 Bacteria 4863
118 Ga0070705_100640258 3300005440 Bacteria 828
119 Ga0070700_100017175 3300005441 Bacteria 4132
120 Ga0070700_100035376 3300005441 Bacteria 3022
121 Ga0070694_100004575 3300005444 Bacteria 8319
122 Ga0070694_100008773 3300005444 Bacteria 6193
123 Ga0070708_100155645 3300005445 Bacteria 2128
124 Ga0070663_100011350 3300005455 Bacteria 5589
125 Ga0070663_100085837 3300005455 Bacteria 2323
126 Ga0070663_100270618 3300005455 Bacteria 1350
127 Ga0070678_100000503 3300005456 Bacteria 18826
128 Ga0070678_100001680 3300005456 Bacteria 11863
129 Ga0070678_100216200 3300005456 Bacteria 1591
130 Ga0070678_100446239 3300005456 Bacteria 1132
131 Ga0070662_100012649 3300005457 Bacteria 5601
132 Ga0070662_100034368 3300005457 Bacteria 3574
133 Ga0070681_10020942 3300005458 Bacteria 6551
134 Ga0070681_10100540 3300005458 Bacteria 2838
135 Ga0070681_10174186 3300005458 Bacteria 2073
136 Ga0070681_10392608 3300005458 Bacteria 1298
137 Ga0068867_100004320 3300005459 Bacteria 10002
138 Ga0068867_100065850 3300005459 Bacteria 2698
139 Ga0070685_10006222 3300005466 Bacteria 6077
140 Ga0070685_10020618 3300005466 Bacteria 3568
141 Ga0070685_10029468 3300005466 Bacteria 3049
142 Ga0070685_10163620 3300005466 Bacteria 1420
143 Ga0070706_100271121 3300005467 Bacteria 1584
144 Ga0070707_100505169 3300005468 Bacteria 1171
145 Ga0070679_100007143 3300005530 Bacteria 10423
146 Ga0070679_100014295 3300005530 Bacteria 7623
147 Ga0070679_100053017 3300005530 Bacteria 4037
148 Ga0070679_100235287 3300005530 Bacteria 1791
149 Ga0070684_100004467 3300005535 Bacteria 10651
150 Ga0070684_100199471 3300005535 Bacteria 1822
151 Ga0070684_100285342 3300005535 Bacteria 1513
152 Ga0068853_100011959 3300005539 Bacteria 7059
153 Ga0068853_100473732 3300005539 Bacteria 1180
154 Ga0068853_100571116 3300005539 Bacteria 1072
155 Ga0070672_100002662 3300005543 Bacteria 11415
156 Ga0070672_100214152 3300005543 Bacteria 1614
157 Ga0070686_100002499 3300005544 Bacteria 10126
158 Ga0070686_100023040 3300005544 Bacteria 3717
159 Ga0070686_100030270 3300005544 Bacteria 3300
160 Ga0070695_100003125 3300005545 Bacteria 9645
161 Ga0070695_100127682 3300005545 Bacteria 1748
162 Ga0070696_100038605 3300005546 Bacteria 3296
163 Ga0070696_100053093 3300005546 Bacteria 2820
164 Ga0070696_100153041 3300005546 Bacteria 1694
165 Ga0070693_100003325 3300005547 Bacteria 7473
166 Ga0070665_100363486 3300005548 Bacteria 1453
167 Ga0070704_100003203 3300005549 Bacteria 9359
168 Ga0070704_100033298 3300005549 Bacteria 3482
169 Ga0070704_100085808 3300005549 Bacteria 2331
170 Ga0068855_100017732 3300005563 Bacteria 8558
171 Ga0070664_100019380 3300005564 Bacteria 5598
172 Ga0070664_100025896 3300005564 Bacteria 4863
173 Ga0070664_100187454 3300005564 Bacteria 1842
174 Ga0070664_100395732 3300005564 Bacteria 1263
175 Ga0068857_100032591 3300005577 Bacteria 4607
176 Ga0068857_100108984 3300005577 Bacteria 2488
177 Ga0068854_100009551 3300005578 Bacteria 6260
178 Ga0068854_100035574 3300005578 Bacteria 3486
179 Ga0068854_100060065 3300005578 Bacteria 2749
180 Ga0068856_100034493 3300005614 Bacteria 4956
181 Ga0068856_100167253 3300005614 Bacteria 2210
182 Ga0068856_100194395 3300005614 Bacteria 2043
183 Ga0068856_100272371 3300005614 Bacteria 1709
184 Ga0068856_100624041 3300005614 Bacteria 1099
185 Ga0070702_100002390 3300005615 Bacteria 8081
186 Ga0070702_100146256 3300005615 Bacteria 1511
187 Ga0070702_100216923 3300005615 Bacteria 1277
188 Ga0068852_100012478 3300005616 Bacteria 6454
189 Ga0068859_100183126 3300005617 Bacteria 2178
190 Ga0068859_100515679 3300005617 Bacteria 1290
191 Ga0068864_100001890 3300005618 Bacteria 17197
192 Ga0068864_100063892 3300005618 Bacteria 3191
193 Ga0068864_100073542 3300005618 Bacteria 2980
194 Ga0068866_10002069 3300005718 Bacteria 8344
195 Ga0068866_10050636 3300005718 Bacteria 2110
196 Ga0068866_10069103 3300005718 Bacteria 1860
197 Ga0068861_100003757 3300005719 Bacteria 10129
198 Ga0068861_100064738 3300005719 Bacteria 2814
199 Ga0068861_100155202 3300005719 Bacteria 1882
200 Ga0068851_10116079 3300005834 Bacteria 1434
201 Ga0068870_10002328 3300005840 Bacteria 7899
202 Ga0068870_10053927 3300005840 Bacteria 2137
203 Ga0068863_100000965 3300005841 Bacteria 28914
204 Ga0068858_100015531 3300005842 Bacteria 7161
205 Ga0068858_100062000 3300005842 Bacteria 3457
206 Ga0068858_100145878 3300005842 Bacteria 2223
207 Ga0068858_100232547 3300005842 Bacteria 1748
208 Ga0068858_100250532 3300005842 Bacteria 1682
209 Ga0068860_100041173 3300005843 Bacteria 4412
210 Ga0068860_100227129 3300005843 Bacteria 1814
211 Ga0068860_100239981 3300005843 Bacteria 1763
212 Ga0068862_100005484 3300005844 Bacteria 10603
213 Ga0068862_100148364 3300005844 Bacteria 2086
214 Ga0068862_100784011 3300005844 Bacteria 930
215 Ga0081455_10000150 3300005937 Bacteria 83695
216 Ga0081540_1000194 3300005983 Bacteria 62934
217 Ga0081540_1090962 3300005983 Bacteria 1342
218 Ga0081539_10001643 3300005985 Bacteria 36361
219 Ga0070717_10000224 3300006028 Bacteria 39308
220 Ga0070717_10049980 3300006028 Bacteria 3434
221 Ga0075365_10039429 3300006038 Bacteria 3075
222 Ga0075365_10270964 3300006038 Bacteria 1194
223 Ga0075368_10050629 3300006042 Bacteria 1650
224 Ga0075363_100030255 3300006048 Bacteria 2801
225 Ga0075363_100180815 3300006048 Bacteria 1200
226 Ga0075364_10099900 3300006051 Bacteria 1932
227 Ga0070715_10000875 3300006163 Bacteria 8330
228 Ga0070712_100017766 3300006175 Bacteria 4607
229 Ga0070712_100218414 3300006175 Bacteria 1507
230 Ga0070712_100225212 3300006175 Bacteria 1486
231 Ga0075362_10020287 3300006177 Bacteria 2775
232 Ga0075362_10030555 3300006177 Bacteria 2326
233 Ga0075367_10082699 3300006178 Bacteria 1944
234 Ga0075366_10019553 3300006195 Bacteria 3921
235 Ga0075366_10166573 3300006195 Bacteria 1336
236 Ga0075366_10174196 3300006195 Bacteria 1306
237 Ga0097621_100000933 3300006237 Bacteria 20454
238 Ga0097621_100053981 3300006237 Bacteria 3276
239 Ga0097621_100352327 3300006237 Bacteria 1309
240 Ga0075370_10040033 3300006353 Bacteria 2642
241 Ga0068871_100003230 3300006358 Bacteria 11175
242 Ga0068871_100016325 3300006358 Bacteria 5589
243 Ga0068871_100266806 3300006358 Bacteria 1495
244 Ga0075428_100002909 3300006844 Bacteria 18640
245 Ga0075428_100075176 3300006844 Bacteria 3690
246 Ga0075430_100057219 3300006846 Bacteria 3280
247 Ga0075431_100000417 3300006847 Bacteria 34661
248 Ga0075433_10006082 3300006852 Bacteria 9507
249 Ga0075434_100027565 3300006871 Bacteria 5579
250 Ga0075434_100052487 3300006871 Bacteria 4051
251 Ga0075434_100071605 3300006871 Bacteria 3458
252 Ga0075434_100187825 3300006871 Bacteria 2087
253 Ga0068865_100005683 3300006881 Bacteria 7576
254 Ga0068865_100022622 3300006881 Bacteria 4104
255 Ga0068865_100037839 3300006881 Bacteria 3261
256 Ga0075436_100062885 3300006914 Bacteria 2565
257 Ga0097620_100183124 3300006931 Bacteria 2178
258 Ga0097620_100515708 3300006931 Bacteria 1290
259 Ga0075435_100113284 3300007076 Bacteria 2257
260 Ga0075435_100175337 3300007076 Bacteria 1810
261 Ga0099795_10111930 3300007788 Bacteria 1083
262 Ga0105251_10027581 3300009011 Bacteria 2877
263 Ga0105250_10035983 3300009092 Bacteria 1987
264 Ga0105240_10081598 3300009093 Bacteria 3973
265 Ga0105240_10440816 3300009093 Bacteria 1459
266 Ga0111539_10004674 3300009094 Bacteria 17895
267 Ga0111539_10019057 3300009094 Bacteria 8479
268 Ga0111539_10019652 3300009094 Bacteria 8334
269 Ga0111539_10042118 3300009094 Bacteria 5486
270 Ga0111539_10140997 3300009094 Bacteria 2821
271 Ga0111539_10342217 3300009094 Bacteria 1741
272 Ga0105245_10001656 3300009098 Bacteria 20280
273 Ga0105245_10003204 3300009098 Bacteria 14646
274 Ga0105245_10018814 3300009098 Bacteria 6044
275 Ga0105245_10173623 3300009098 Bacteria 2054
276 Ga0105245_10390035 3300009098 Bacteria 1389
277 Ga0105245_10432900 3300009098 Bacteria 1320
278 Ga0105245_11176211 3300009098 Bacteria 814
279 Ga0105247_10006703 3300009101 Bacteria 7109
280 Ga0105247_10013200 3300009101 Bacteria 4956
281 Ga0105247_10071388 3300009101 Bacteria 2171
282 Ga0114129_10002339 3300009147 Bacteria 26307
283 Ga0114129_10004632 3300009147 Bacteria 19409
284 Ga0114129_10607056 3300009147 Bacteria 1417
285 Ga0114129_10737055 3300009147 Bacteria 1263
286 Ga0105243_10006896 3300009148 Bacteria 8756
287 Ga0105243_10041478 3300009148 Bacteria 3599
288 Ga0105243_10089067 3300009148 Bacteria 2536
289 Ga0105243_10348234 3300009148 Bacteria 1359
290 Ga0105243_10530169 3300009148 Bacteria 1121
291 Ga0105241_10006513 3300009174 Bacteria 8608
292 Ga0105241_10096828 3300009174 Bacteria 2338
293 Ga0105241_10111580 3300009174 Bacteria 2189
294 Ga0105241_10250746 3300009174 Bacteria 1501
295 Ga0105242_10000350 3300009176 Bacteria 37047
296 Ga0105242_10024355 3300009176 Bacteria 4780
297 Ga0105248_10013825 3300009177 Bacteria 8882
298 Ga0105248_10049645 3300009177 Bacteria 4706
299 Ga0105248_10110720 3300009177 Bacteria 3096
300 Ga0105248_10324662 3300009177 Bacteria 1734
301 Ga0105248_10624242 3300009177 Bacteria 1216
302 Ga0105237_10024953 3300009545 Bacteria 6115
303 Ga0105238_10012148 3300009551 Bacteria 8679
304 Ga0105238_10063703 3300009551 Bacteria 3687
305 Ga0105238_10517614 3300009551 Bacteria 1195
306 Ga0105249_10007727 3300009553 Bacteria 9372
307 Ga0105249_10040055 3300009553 Bacteria 4255
308 Ga0105249_10127719 3300009553 Bacteria 2423
309 Ga0105249_10293227 3300009553 Bacteria 1629
310 Ga0105249_10453682 3300009553 Bacteria 1321
311 Ga0105239_10015881 3300010375 Bacteria 8335
312 Ga0105246_10002609 3300011119 Bacteria 10906
313 Ga0105246_10037341 3300011119 Bacteria 3260
314 Ga0105246_10510944 3300011119 Bacteria 1022
315 Ga0157335_1002447 3300012492 Bacteria 1121
316 Ga0157345_1004463 3300012498 Bacteria 1052
317 Ga0157338_1000333 3300012515 Bacteria 2602
318 Ga0157373_10016816 3300013100 Bacteria 5333
319 Ga0157373_10115290 3300013100 Bacteria 1889
320 Ga0157373_10173329 3300013100 Bacteria 1518
321 Ga0157371_10007888 3300013102 Bacteria 8546
322 Ga0157369_10152465 3300013105 Bacteria 2442
323 Ga0157374_10012338 3300013296 Bacteria 7434
324 Ga0157374_10148011 3300013296 Bacteria 2282
325 Ga0157374_10347370 3300013296 Bacteria 1474
326 Ga0157378_10017794 3300013297 Bacteria 6239
327 Ga0157378_10160074 3300013297 Bacteria 2105
328 Ga0157378_10630667 3300013297 Bacteria 1086
329 Ga0163162_10031946 3300013306 Bacteria 5225
330 Ga0163162_10064226 3300013306 Bacteria 3716
331 Ga0163162_10172900 3300013306 Bacteria 2285
332 Ga0163162_10505145 3300013306 Bacteria 1339
333 Ga0163162_10564149 3300013306 Bacteria 1266
334 Ga0157372_10030590 3300013307 Bacteria 5891
335 Ga0157372_10188680 3300013307 Bacteria 2387
336 Ga0157375_10009132 3300013308 Bacteria 8687
337 Ga0157375_10533886 3300013308 Bacteria 1336
338 Ga0157375_11072232 3300013308 Bacteria 942
339 Ga0163163_10019655 3300014325 Bacteria 6346
340 Ga0163163_10304924 3300014325 Bacteria 1645
341 Ga0163163_10592532 3300014325 Bacteria 1172
342 Ga0163163_10703381 3300014325 Bacteria 1074
343 Ga0157380_10002593 3300014326 Bacteria 12218
344 Ga0157377_10002234 3300014745 Bacteria 8508
345 Ga0157379_10021452 3300014968 Bacteria 5718
346 Ga0157379_10117763 3300014968 Bacteria 2389
347 Ga0157379_10589917 3300014968 Bacteria 1036
348 Ga0157376_10000663 3300014969 Bacteria 22264
349 Ga0157376_10215687 3300014969 Bacteria 1774
350 Ga0157376_10318892 3300014969 Bacteria 1477
351 Ga0163161_10005222 3300017792 Bacteria 9036
352 Ga0163161_10098739 3300017792 Bacteria 2171
353 Ga0213876_10019512 3300021384 Bacteria 3582
354 Ga0213876_10042765 3300021384 Bacteria 2394
355 Ga0213875_10000023 3300021388 Bacteria 213455
356 Ga0207666_1000137 3300025271 Bacteria 11385
357 Ga0207666_1000707 3300025271 Bacteria 4003
358 Ga0207673_1000157 3300025290 Bacteria 6690
359 Ga0209758_1000566 3300025297 Bacteria 58298
360 Ga0207697_10005981 3300025315 Bacteria 5574
361 Ga0207697_10005996 3300025315 Bacteria 5565
362 Ga0207713_1026153 3300025735 Bacteria 2680
363 Ga0207653_10004160 3300025885 Bacteria 4550
364 Ga0207682_10000043 3300025893 Bacteria 52108
365 Ga0207682_10139651 3300025893 Bacteria 1087
366 Ga0207692_10006390 3300025898 Bacteria 4778
367 Ga0207692_10103923 3300025898 Bacteria 1565
368 Ga0207710_10008544 3300025900 Bacteria 4318
369 Ga0207710_10009164 3300025900 Bacteria 4164
370 Ga0207710_10039774 3300025900 Bacteria 2082
371 Ga0207688_10000162 3300025901 Bacteria 29107
372 Ga0207688_10064701 3300025901 Bacteria 2065
373 Ga0207680_10039488 3300025903 Bacteria 2739
374 Ga0207680_10053569 3300025903 Bacteria 2423
375 Ga0207647_10001692 3300025904 Bacteria 17014
376 Ga0207685_10000826 3300025905 Bacteria 5759
377 Ga0207699_10007186 3300025906 Bacteria 5435
378 Ga0207699_10015725 3300025906 Bacteria 3938
379 Ga0207699_10086121 3300025906 Bacteria 1961
380 Ga0207645_10000899 3300025907 Bacteria 24667
381 Ga0207645_10038802 3300025907 Bacteria 3053
382 Ga0207645_10041949 3300025907 Bacteria 2928
383 Ga0207643_10000128 3300025908 Bacteria 51191
384 Ga0207643_10062409 3300025908 Bacteria 2130
385 Ga0207654_10006844 3300025911 Bacteria 5738
386 Ga0207654_10013931 3300025911 Bacteria 4144
387 Ga0207654_10100289 3300025911 Bacteria 1783
388 Ga0207707_10004166 3300025912 Bacteria 12809
389 Ga0207707_10032397 3300025912 Bacteria 4574
390 Ga0207707_10122634 3300025912 Bacteria 2273
391 Ga0207707_10148070 3300025912 Bacteria 2052
392 Ga0207695_10369083 3300025913 Bacteria 1321
393 Ga0207693_10025205 3300025915 Bacteria 4716
394 Ga0207693_10027123 3300025915 Bacteria 4529
395 Ga0207693_10176062 3300025915 Bacteria 1683
396 Ga0207693_10188366 3300025915 Bacteria 1624
397 Ga0207663_10118644 3300025916 Bacteria 1807
398 Ga0207663_10171449 3300025916 Bacteria 1542
399 Ga0207663_10210863 3300025916 Bacteria 1408
400 Ga0207660_10011570 3300025917 Bacteria 5749
401 Ga0207660_10020123 3300025917 Bacteria 4475
402 Ga0207662_10004338 3300025918 Bacteria 7450
403 Ga0207662_10067417 3300025918 Bacteria 2158
404 Ga0207662_10103919 3300025918 Bacteria 1763
405 Ga0207662_10207467 3300025918 Bacteria 1271
406 Ga0207657_10011210 3300025919 Bacteria 8913
407 Ga0207657_10015174 3300025919 Bacteria 7479
408 Ga0207657_10249673 3300025919 Bacteria 1415
409 Ga0207649_10002424 3300025920 Bacteria 10439
410 Ga0207649_10015848 3300025920 Bacteria 4237
411 Ga0207652_10068036 3300025921 Bacteria 3089
412 Ga0207652_10182137 3300025921 Bacteria 1888
413 Ga0207652_10297098 3300025921 Bacteria 1458
414 Ga0207652_10556093 3300025921 Bacteria 1031
415 Ga0207646_10312980 3300025922 Bacteria 1419
416 Ga0207681_10017442 3300025923 Bacteria 4507
417 Ga0207681_10144989 3300025923 Bacteria 1773
418 Ga0207681_10661374 3300025923 Bacteria 867
419 Ga0207694_10028568 3300025924 Bacteria 4252
420 Ga0207694_10138520 3300025924 Bacteria 1956
421 Ga0207650_10031811 3300025925 Bacteria 3813
422 Ga0207659_10030342 3300025926 Bacteria 3693
423 Ga0207659_10100751 3300025926 Bacteria 2177
424 Ga0207659_10441642 3300025926 Bacteria 1094
425 Ga0207659_10501877 3300025926 Bacteria 1027
426 Ga0207687_10000522 3300025927 Bacteria 25753
427 Ga0207687_10009438 3300025927 Bacteria 6382
428 Ga0207687_10066634 3300025927 Bacteria 2560
429 Ga0207687_10157239 3300025927 Bacteria 1740
430 Ga0207687_10236741 3300025927 Bacteria 1445
431 Ga0207700_10013954 3300025928 Bacteria 5251
432 Ga0207664_10034479 3300025929 Bacteria 3898
433 Ga0207664_10144501 3300025929 Bacteria 2016
434 Ga0207664_10275377 3300025929 Bacteria 1475
435 Ga0207664_10289504 3300025929 Bacteria 1439
436 Ga0207644_10000611 3300025931 Bacteria 22735
437 Ga0207644_10047844 3300025931 Bacteria 3054
438 Ga0207644_10101273 3300025931 Bacteria 2164
439 Ga0207644_10511475 3300025931 Bacteria 991
440 Ga0207690_10003223 3300025932 Bacteria 9794
441 Ga0207706_10010796 3300025933 Bacteria 8335
442 Ga0207706_10035483 3300025933 Bacteria 4433
443 Ga0207706_10077610 3300025933 Bacteria 2921
444 Ga0207706_10354978 3300025933 Bacteria 1274
445 Ga0207686_10003172 3300025934 Bacteria 8849
446 Ga0207686_10022617 3300025934 Bacteria 3622
447 Ga0207686_10181402 3300025934 Bacteria 1493
448 Ga0207709_10001270 3300025935 Bacteria 18052
449 Ga0207709_10069997 3300025935 Bacteria 2223
450 Ga0207670_10000631 3300025936 Bacteria 18876
451 Ga0207670_10008282 3300025936 Bacteria 5861
452 Ga0207670_10011017 3300025936 Bacteria 5230
453 Ga0207670_10556630 3300025936 Bacteria 938
454 Ga0207669_10000797 3300025937 Bacteria 13482
455 Ga0207669_10015672 3300025937 Bacteria 3829
456 Ga0207669_10097054 3300025937 Bacteria 1937
457 Ga0207704_10007276 3300025938 Bacteria 5217
458 Ga0207704_10046381 3300025938 Bacteria 2590
459 Ga0207704_10129434 3300025938 Bacteria 1745
460 Ga0207665_10008424 3300025939 Bacteria 6797
461 Ga0207665_10087241 3300025939 Bacteria 2157
462 Ga0207665_10121854 3300025939 Bacteria 1843
463 Ga0207691_10008026 3300025940 Bacteria 10147
464 Ga0207691_10071292 3300025940 Bacteria 3136
465 Ga0207691_10343936 3300025940 Bacteria 1277
466 Ga0207711_10040416 3300025941 Bacteria 3968
467 Ga0207711_10370080 3300025941 Bacteria 1329
468 Ga0207689_10000165 3300025942 Bacteria 57494
469 Ga0207689_10060237 3300025942 Bacteria 3121
470 Ga0207689_10187368 3300025942 Bacteria 1706
471 Ga0207661_10004909 3300025944 Bacteria 9371
472 Ga0207679_10000112 3300025945 Bacteria 65716
473 Ga0207679_10147957 3300025945 Bacteria 1908
474 Ga0207679_10211040 3300025945 Bacteria 1628
475 Ga0207667_10056264 3300025949 Bacteria 4132
476 Ga0207651_10018034 3300025960 Bacteria 4188
477 Ga0207651_10094868 3300025960 Bacteria 2195
478 Ga0207651_10141887 3300025960 Bacteria 1857
479 Ga0207651_10394283 3300025960 Bacteria 1176
480 Ga0207712_10004163 3300025961 Bacteria 9135
481 Ga0207712_10104441 3300025961 Bacteria 2112
482 Ga0207712_10156743 3300025961 Bacteria 1765
483 Ga0207668_10001083 3300025972 Bacteria 16234
484 Ga0207668_10266591 3300025972 Bacteria 1398
485 Ga0207668_10445086 3300025972 Bacteria 1104
486 Ga0207640_10000382 3300025981 Bacteria 28458
487 Ga0207640_10134193 3300025981 Bacteria 1794
488 Ga0207658_10017898 3300025986 Bacteria 4884
489 Ga0207658_10056408 3300025986 Bacteria 2915
490 Ga0207658_10446609 3300025986 Bacteria 1144
491 Ga0207658_10476500 3300025986 Bacteria 1108
492 Ga0207677_10018249 3300026023 Bacteria 4207
493 Ga0207677_10132356 3300026023 Bacteria 1896
494 Ga0207703_10027237 3300026035 Bacteria 4500
495 Ga0207703_10075133 3300026035 Bacteria 2800
496 Ga0207703_10096507 3300026035 Bacteria 2496
497 Ga0207703_10334789 3300026035 Bacteria 1389
498 Ga0207703_10401314 3300026035 Bacteria 1272
499 Ga0207703_10690492 3300026035 Bacteria 970
500 Ga0207639_10025940 3300026041 Bacteria 4254
501 Ga0207678_10003507 3300026067 Bacteria 14107
502 Ga0207678_10010035 3300026067 Bacteria 8311
503 Ga0207678_10022143 3300026067 Bacteria 5568
504 Ga0207708_10016432 3300026075 Bacteria 5565
505 Ga0207708_10028647 3300026075 Bacteria 4217
506 Ga0207708_10194657 3300026075 Bacteria 1615
507 Ga0207708_10573370 3300026075 Bacteria 954
508 Ga0207702_10129725 3300026078 Bacteria 2267
509 Ga0207641_10001777 3300026088 Bacteria 20763
510 Ga0207648_10013960 3300026089 Bacteria 7447
511 Ga0207648_10105676 3300026089 Bacteria 2470
512 Ga0207648_10165333 3300026089 Bacteria 1955
513 Ga0207676_10000494 3300026095 Bacteria 33145
514 Ga0207676_10064465 3300026095 Bacteria 2914
515 Ga0207676_10702111 3300026095 Bacteria 980
516 Ga0207674_10031526 3300026116 Bacteria 5568
517 Ga0207674_10035553 3300026116 Bacteria 5199
518 Ga0207675_100024932 3300026118 Bacteria 5565
519 Ga0207675_100039290 3300026118 Bacteria 4417
520 Ga0207675_100092415 3300026118 Bacteria 2846
521 Ga0207675_100383792 3300026118 Bacteria 1382
522 Ga0207683_10001272 3300026121 Bacteria 22830
523 Ga0207683_10004940 3300026121 Bacteria 11469
524 Ga0207683_10007540 3300026121 Bacteria 9324
525 Ga0207683_10272258 3300026121 Bacteria 1547
526 Ga0207698_10004416 3300026142 Bacteria 8568
527 Ga0207698_10442937 3300026142 Bacteria 1252
528 Ga0209996_1006884 3300027395 Bacteria 1476
529 Ga0210002_1001447 3300027617 Bacteria 3348
530 Ga0209983_1008271 3300027665 Bacteria 2127
531 Ga0209588_1063612 3300027671 Bacteria 1192
532 Ga0209966_1002370 3300027695 Bacteria 3138
533 Ga0209998_10001523 3300027717 Bacteria 5574
534 Ga0209998_10001929 3300027717 Bacteria 4879
535 Ga0209974_10004333 3300027876 Bacteria 5046
536 Ga0209974_10109708 3300027876 Bacteria 970
537 Ga0207428_10000064 3300027907 Bacteria 151185
538 Ga0207428_10003786 3300027907 Bacteria 14512
539 Ga0207428_10034470 3300027907 Bacteria 4147
540 Ga0207428_10189633 3300027907 Bacteria 1550
541 Ga0207428_10275307 3300027907 Bacteria 1250
542 Ga0268266_10018410 3300028379 Bacteria 5952
543 Ga0268265_10001549 3300028380 Bacteria 19094
544 Ga0268265_10186109 3300028380 Bacteria 1789
545 Ga0268265_10199557 3300028380 Bacteria 1734
546 Ga0268265_10320851 3300028380 Bacteria 1403
547 Ga0268264_10004661 3300028381 Bacteria 11653
548 Ga0268264_10219598 3300028381 Bacteria 1749
549 Ga0268264_10315037 3300028381 Bacteria 1477
550 Ga0268264_10803016 3300028381 Bacteria 940
551 Ga0265337_1017384 3300028556 Bacteria 2306
552 Ga0265325_10000006 3300031241 Bacteria 255758
553 Ga0265325_10000252 3300031241 Bacteria 38198
554 Ga0265316_10294747 3300031344 Bacteria 1183
555 Ga0307513_10172432 3300031456 Bacteria 2039
556 Ga0265313_10032639 3300031595 Bacteria 2655
557 Ga0316579_10013487 3300031691 Bacteria 3515
558 Ga0265342_10019058 3300031712 Bacteria 4429
559 Ga0307412_10446746 3300031911 Bacteria 1064
560 Ga0373948_0000698 3300034817 Bacteria 4362
561 Ga0373950_0000757 3300034818 Bacteria 4025
562 Ga0373958_0005082 3300034819 Bacteria 1980
563 Ga0373938_0006960 3300034957 Bacteria 1975
564 Ga0373938_0008876 3300034957 Bacteria 1806
565 Ga0373938_0013494 3300034957 Bacteria 1551
566 Ga0373926_0028132 3300035083 Bacteria 1972
567 Ga0373926_0038715 3300035083 Bacteria 1699
568 Ga0373928_0002965 3300035084 Bacteria 3273
569 Ga0373928_0004781 3300035084 Bacteria 2583
570 Ga0373928_0006581 3300035084 Bacteria 2234
571 Ga0373929_0002903 3300035085 Bacteria 3128
572 Ga0373929_0012768 3300035085 Bacteria 1601
573 Ga0373940_0006426 3300035088 Bacteria 2605
574 Ga0373940_0016817 3300035088 Bacteria 1816
575 Ga0373944_0038564 3300035089 Bacteria 1467
576 Ga0373949_0001309 3300035090 Bacteria 7201
577 Ga0373949_0005175 3300035090 Bacteria 2926
578 Ga0373949_0005768 3300035090 Bacteria 2755
579 Ga0373951_0001012 3300035091 Bacteria 7564
580 Ga0373951_0001653 3300035091 Bacteria 5847
581 Ga0373952_0000401 3300035092 Bacteria 7420
582 Ga0373952_0002793 3300035092 Bacteria 3157
583 Ga0373952_0006356 3300035092 Bacteria 2180
584 Ga0373923_0163210 3300035111 Bacteria 1017
585 Ga0373932_0002484 3300035112 Bacteria 4646
586 Ga0373932_0008055 3300035112 Bacteria 2515
587 Ga0373932_0018775 3300035112 Bacteria 1793
588 Ga0373936_0123129 3300035113 Bacteria 1109
589 Ga0373939_0002908 3300035114 Bacteria 4023
590 Ga0373939_0024704 3300035114 Bacteria 1676
591 Ga0373939_0027565 3300035114 Bacteria 1610
592 Ga0373939_0066381 3300035114 Bacteria 1163
593 Ga0373939_0083288 3300035114 Bacteria 1067
594 Ga0373941_0000504 3300035115 Bacteria 7789
595 Ga0373941_0014277 3300035115 Bacteria 2117
596 Ga0373953_0006578 3300035117 Bacteria 3839
597 Ga0373953_0035448 3300035117 Bacteria 1961
598 Ga0373954_0002902 3300035118 Bacteria 7229
599 Ga0373954_0004502 3300035118 Bacteria 5993
600 Ga0373956_0005198 3300035119 Bacteria 5210
601 Ga0373956_0005225 3300035119 Bacteria 5201
602 Ga0373956_0032976 3300035119 Bacteria 2275
603 Ga0373956_0043729 3300035119 Bacteria 1995
604 Ga0373957_0000543 3300035120 Bacteria 9552
605 Ga0373943_0001305 3300035170 Bacteria 11190
606 Ga0373943_0159285 3300035170 Bacteria 1228
607 Ga0373946_0016248 3300035171 Bacteria 2833
608 Ga0373946_0134740 3300035171 Bacteria 1140
609 Ga0373946_0206280 3300035171 Bacteria 943
610 Ga0373955_0002625 3300035172 Bacteria 7867
611 Ga0373955_0014757 3300035172 Bacteria 3810
612 Ga0373955_0028939 3300035172 Bacteria 2877
613 Ga0373942_0004233 3300035207 Bacteria 3340
614 Ga0373961_0003997 3300035241 Bacteria 3594
615 Ga0373961_0072745 3300035241 Bacteria 1066
616 Ga0373962_0002408 3300035242 Bacteria 4451
617 Ga0373962_0003465 3300035242 Bacteria 3790
618 Ga0373962_0028155 3300035242 Bacteria 1523
619 Ga0373962_0079186 3300035242 Bacteria 995
620 Ga0373924_0026611 3300035410 Bacteria 2295
621 Ga0373931_0001286 3300035691 Bacteria 10727
622 Ga0373931_0008271 3300035691 Bacteria 4929
623 Ga0373931_0043717 3300035691 Bacteria 2360
624 Ga0373931_0103800 3300035691 Bacteria 1603
625 Ga0373935_0003279 3300035692 Bacteria 9359
626 Ga0373935_0009562 3300035692 Bacteria 5803
627 Ga0373927_0015396 3300035695 Bacteria 5054
628 Ga0373927_0186071 3300035695 Bacteria 1362
629 Ga0373927_0205481 3300035695 Bacteria 1293
630 Ga0373933_0004530 3300035724 Bacteria 7622
631 Ga0373933_0167136 3300035724 Bacteria 1399
632 Ga0373947_0047816 3300035725 Bacteria 2565
633 Ga0373947_0054703 3300035725 Bacteria 2409
634 Ga0373947_0126893 3300035725 Bacteria 1625
635 Ga0373947_0167699 3300035725 Bacteria 1423
636 Ga0373937_0001302 3300036401 Bacteria 20904
637 Ga0373937_0002947 3300036401 Bacteria 14245
638 Ga0373937_0014182 3300036401 Bacteria 7030
639 Ga0373937_0039323 3300036401 Bacteria 4311
640 Ga0373937_0040918 3300036401 Bacteria 4226
641 Ga0373937_0240745 3300036401 Bacteria 1705
642 Ga0373937_0328218 3300036401 Bacteria 1448
643 Ga0373937_0783496 3300036401 Bacteria 901
644 Ga0373925_0043026 3300037068 Bacteria 3351
645 Ga0373925_0248806 3300037068 Bacteria 1425
646 Ga0436364_0024145 3300037853 Bacteria 1838
647 Ga0436364_1042090 3300037853 Bacteria 19013
648 Ga0436364_1078356 3300037853 Bacteria 1276
649 Ga0436365_0719053 3300039437 Bacteria 4848
650 Ga0436365_0725763 3300039437 Bacteria 2244
651 Ga0436365_1188741 3300039437 Bacteria 6858
652 Ga0436365_1227929 3300039437 Bacteria 4335
653 Ga0436360_1007413 3300039438 Bacteria 1565
654 Ga0436363_0375711 3300039450 Bacteria 1085
655 Ga0436362_0896511 3300039453 Bacteria 1124
656 Ga0439453_0002674 3300041408 Bacteria 2483
657 Ga0439453_0003546 3300041408 Bacteria 2252
658 Ga0451853_4050201 3300041512 Bacteria 1102
659 Ga0439443_001472 3300042003 Bacteria 2606
660 Ga0439455_0012765 3300042012 Bacteria 1892
661 Ga0439444_0017706 3300042437 Bacteria 1226
662 Ga0439464_0066223 3300042439 Bacteria 1063
663 Ga0439460_0036376 3300042461 Bacteria 1428
664 Ga0451577_0174013 3300042876 Bacteria 1940
665 Ga0439440_0024267 3300042993 Bacteria 1389
666 Ga0466967_0297481 3300045976 Bacteria 1552
667 Ga0495592_0005759 3300046454 Bacteria 9175
668 Ga0495592_0018759 3300046454 Bacteria 5266
669 Ga0495592_0181710 3300046454 Bacteria 1432
670 Ga0495603_0021766 3300046455 Bacteria 3882
671 Ga0495629_0000253 3300046459 Bacteria 46595
672 Ga0495629_0077225 3300046459 Bacteria 2324
673 Ga0495629_0105459 3300046459 Bacteria 1966
674 Ga0495638_0023879 3300046460 Bacteria 3993
675 Ga0495638_0129888 3300046460 Bacteria 1481
676 Ga0495651_0014216 3300046462 Bacteria 6153
677 Ga0495651_0015195 3300046462 Bacteria 5950
678 Ga0495651_0040620 3300046462 Bacteria 3617
679 Ga0495651_0110841 3300046462 Bacteria 2029
680 Ga0495653_0017400 3300046463 Bacteria 5846
681 Ga0495653_0162831 3300046463 Bacteria 1547
682 Ga0495653_0170534 3300046463 Bacteria 1502
683 Ga0495653_0282822 3300046463 Bacteria 1088
684 Ga0495650_0042409 3300046471 Bacteria 1937
685 Ga0495580_0047078 3300046472 Bacteria 3058
686 Ga0495580_0060832 3300046472 Bacteria 2653
687 Ga0495580_0410648 3300046472 Bacteria 912
688 Ga0495582_0041140 3300046473 Bacteria 2546
689 Ga0495639_0005636 3300046475 Bacteria 5386
690 Ga0495639_0013858 3300046475 Bacteria 3485
691 Ga0495639_0063459 3300046475 Bacteria 1696
692 Ga0495662_0008670 3300046476 Bacteria 4999
693 Ga0495664_0073000 3300046477 Bacteria 2051
694 Ga0495664_0195838 3300046477 Bacteria 1225
695 Ga0495584_0061045 3300046491 Bacteria 1895
696 Ga0495585_0007151 3300046492 Bacteria 6855
697 Ga0495594_0002753 3300046499 Bacteria 9125
698 Ga0495594_0041096 3300046499 Bacteria 2532
699 Ga0495607_0026487 3300046501 Bacteria 3597
700 Ga0495608_0001048 3300046511 Bacteria 19467
701 Ga0495608_0043899 3300046511 Bacteria 2986
702 Ga0495618_0029595 3300046514 Bacteria 3417
703 Ga0495628_0002572 3300046516 Bacteria 16332
704 Ga0495628_0099872 3300046516 Bacteria 2240
705 Ga0495630_0017093 3300046517 Bacteria 5309
706 Ga0495630_0095930 3300046517 Bacteria 2242
707 Ga0495631_0131587 3300046518 Bacteria 1075
708 Ga0495644_0002206 3300046523 Bacteria 7797
709 Ga0495666_0063210 3300046526 Bacteria 1767
710 Ga0495652_0002428 3300046529 Bacteria 19213
711 Ga0495652_0023199 3300046529 Bacteria 5501
712 Ga0495665_0125571 3300046531 Bacteria 1344
713 Ga0495640_0017869 3300046533 Bacteria 5272
714 Ga0495586_0019877 3300046535 Bacteria 3577
715 Ga0495587_0013625 3300046536 Bacteria 5109
716 Ga0495587_0018674 3300046536 Bacteria 4298
717 Ga0495621_0003600 3300046539 Bacteria 4279
718 Ga0495645_0017543 3300046543 Bacteria 5128
719 Ga0495622_0027226 3300046557 Bacteria 2668
720 Ga0495622_0045670 3300046557 Bacteria 2035
721 Ga0495667_0003718 3300046559 Bacteria 10261
722 Ga0495667_0005014 3300046559 Bacteria 8946
723 Ga0495667_0007579 3300046559 Bacteria 7365
724 Ga0495667_0108306 3300046559 Bacteria 1795
725 Ga0495656_0001748 3300046615 Bacteria 7119
726 Ga0495634_0064058 3300046642 Bacteria 2438
727 Ga0495634_0156918 3300046642 Bacteria 1436
728 Ga0495634_0199204 3300046642 Bacteria 1244
729 Ga0495611_0029924 3300046648 Bacteria 2391
730 Ga0495635_0010356 3300046663 Bacteria 6520
731 Ga0495635_0016934 3300046663 Bacteria 5091
732 Ga0495635_0028736 3300046663 Bacteria 3864
733 Ga0495635_0052291 3300046663 Bacteria 2814
734 Ga0495661_0015998 3300046665 Bacteria 4987
735 Ga0495588_0002028 3300046674 Bacteria 8666
736 Ga0495657_0027256 3300046675 Bacteria 4035
737 Ga0495657_0050262 3300046675 Bacteria 2803
738 Ga0495599_0018956 3300046678 Bacteria 4289
739 Ga0495623_0000769 3300046679 Bacteria 21491
740 Ga0495623_0007229 3300046679 Bacteria 7207
741 Ga0495646_0016203 3300046680 Bacteria 4731
742 Ga0495646_0246795 3300046680 Bacteria 958
743 Ga0495647_0002159 3300046681 Bacteria 6148
744 Ga0495658_0000473 3300046683 Bacteria 22266
745 Ga0495658_0050088 3300046683 Bacteria 2361
746 Ga0495658_0068764 3300046683 Bacteria 2051
747 Ga0495658_0195239 3300046683 Bacteria 1260
748 Ga0495613_0005369 3300046689 Bacteria 9625
749 Ga0495613_0063014 3300046689 Bacteria 2713
750 Ga0495613_0081446 3300046689 Bacteria 2351
751 Ga0495670_0005085 3300046691 Bacteria 6469
752 Ga0495600_0002018 3300046809 Bacteria 11415
753 Ga0495600_0007230 3300046809 Bacteria 6776
754 Ga0495600_0018503 3300046809 Bacteria 4439
755 Ga0495600_0061493 3300046809 Bacteria 2453
756 Ga0495581_0002175 3300047315 Bacteria 11071
757 Ga0495581_0073173 3300047315 Bacteria 1983
758 Ga0495581_0219960 3300047315 Bacteria 1110
759 Ga0495604_0002235 3300047317 Bacteria 15508
760 Ga0495674_0049481 3300047319 Bacteria 3714
761 Ga0495674_0057206 3300047319 Bacteria 3414
762 Ga0495674_0058173 3300047319 Bacteria 3381
763 Ga0495674_0207802 3300047319 Bacteria 1622
764 Ga0495672_0087065 3300047320 Bacteria 1726
765 Ga0495676_0029258 3300047321 Bacteria 4692
766 Ga0495676_0422142 3300047321 Bacteria 882
767 Ga0495680_0012645 3300047322 Bacteria 7415
768 Ga0495680_0035253 3300047322 Bacteria 4031
769 Ga0495680_0053489 3300047322 Bacteria 3141
770 Ga0495680_0211739 3300047322 Bacteria 1387
771 Ga0495680_0509751 3300047322 Bacteria 815
772 Ga0495675_0059856 3300047444 Bacteria 2414
773 Ga0495675_0080810 3300047444 Bacteria 2047
774 Ga0495675_0090792 3300047444 Bacteria 1917
775 Ga0495677_0019854 3300047445 Bacteria 2437
776 Ga0495684_0006615 3300047471 Bacteria 8990
777 Ga0495684_0130806 3300047471 Bacteria 1885
778 Ga0495684_0222305 3300047471 Bacteria 1384
779 Ga0495602_0001451 3300048088 Bacteria 23534
780 Ga0495602_0157691 3300048088 Bacteria 1776
781 Ga0496100_0002412 3300048903 Bacteria 9472
782 Ga0496100_0003757 3300048903 Bacteria 7952
783 Ga0496100_0009774 3300048903 Bacteria 5400
784 Ga0496100_0012545 3300048903 Bacteria 4861
785 Ga0496100_0027796 3300048903 Bacteria 3482
786 Ga0496100_0051850 3300048903 Bacteria 2665
787 Ga0496101_0000235 3300048904 Bacteria 41146
788 Ga0496101_0001165 3300048904 Bacteria 15728
789 Ga0496101_0010317 3300048904 Bacteria 6169
790 Ga0496101_0017473 3300048904 Bacteria 4866
791 Ga0496101_0074476 3300048904 Bacteria 2497
792 Ga0496101_0157660 3300048904 Bacteria 1739
793 Ga0496101_0370568 3300048904 Bacteria 1126
794 Ga0496101_0378004 3300048904 Bacteria 1114
795 Ga0496102_0002224 3300048905 Bacteria 16640
796 Ga0496102_0061440 3300048905 Bacteria 3438
797 Ga0496102_0119256 3300048905 Bacteria 2463
798 Ga0496102_0137434 3300048905 Bacteria 2290
799 Ga0496102_0282491 3300048905 Bacteria 1564
800 Ga0496102_0338022 3300048905 Bacteria 1418
801 Ga0496102_0613050 3300048905 Bacteria 1011
802 Ga0496103_0026234 3300048906 Bacteria 3528
803 Ga0496103_0095061 3300048906 Bacteria 1883
804 Ga0496103_0098539 3300048906 Bacteria 1848
805 Ga0496103_0150016 3300048906 Bacteria 1493
806 Ga0496103_0157848 3300048906 Bacteria 1454
807 Ga0496104_0003146 3300048907 Bacteria 14223
808 Ga0496104_0006422 3300048907 Bacteria 10338
809 Ga0496104_0018551 3300048907 Bacteria 6349
810 Ga0496104_0056495 3300048907 Bacteria 3712
811 Ga0496104_0058441 3300048907 Bacteria 3650
812 Ga0496104_0100561 3300048907 Bacteria 2768
813 Ga0496104_0138009 3300048907 Bacteria 2343
814 Ga0496104_0147480 3300048907 Bacteria 2259
815 Ga0496105_0000840 3300048908 Bacteria 20909
816 Ga0496105_0002908 3300048908 Bacteria 12568
817 Ga0496105_0040505 3300048908 Bacteria 3841
818 Ga0496105_0050017 3300048908 Bacteria 3453
819 Ga0496105_0119874 3300048908 Bacteria 2170
820 Ga0496105_0490507 3300048908 Bacteria 965
821 Ga0496106_0002108 3300048909 Bacteria 14874
822 Ga0496106_0004642 3300048909 Bacteria 10189
823 Ga0496106_0012281 3300048909 Bacteria 6321
824 Ga0496106_0018551 3300048909 Bacteria 5147
825 Ga0496106_0077522 3300048909 Bacteria 2548
826 Ga0496106_0525147 3300048909 Bacteria 950
827 Ga0496107_0002984 3300048910 Bacteria 11209
828 Ga0496107_0024758 3300048910 Bacteria 4247
829 Ga0496107_0031487 3300048910 Bacteria 3785
830 Ga0496107_0060146 3300048910 Bacteria 2749
831 Ga0496107_0063826 3300048910 Bacteria 2669
832 Ga0496107_0086974 3300048910 Bacteria 2282
833 Ga0496107_0280117 3300048910 Bacteria 1241
834 Ga0496108_0005305 3300048911 Bacteria 10406
835 Ga0496108_0011953 3300048911 Bacteria 7062
836 Ga0496108_0027044 3300048911 Bacteria 4733
837 Ga0496108_0080492 3300048911 Bacteria 2759
838 Ga0496108_0107696 3300048911 Bacteria 2380
839 Ga0496108_0127350 3300048911 Bacteria 2187
840 Ga0496108_0152171 3300048911 Bacteria 1996
841 Ga0496108_0576904 3300048911 Bacteria 980
842 Ga0496109_0029476 3300048912 Bacteria 4915
843 Ga0496109_0031599 3300048912 Bacteria 4753
844 Ga0496109_0038758 3300048912 Bacteria 4310
845 Ga0496109_0081526 3300048912 Bacteria 2981
846 Ga0496109_0158170 3300048912 Bacteria 2122
847 Ga0496109_0260732 3300048912 Bacteria 1632
848 Ga0496109_0933963 3300048912 Bacteria 805
849 Ga0496110_0013851 3300048913 Bacteria 6682
850 Ga0496110_0028561 3300048913 Bacteria 4792
851 Ga0496110_0039327 3300048913 Bacteria 4118
852 Ga0496110_0118743 3300048913 Bacteria 2381
853 Ga0496110_0224999 3300048913 Bacteria 1706
854 Ga0496110_0262906 3300048913 Bacteria 1571
855 Ga0496111_0016755 3300048914 Bacteria 5055
856 Ga0496111_0053227 3300048914 Bacteria 2924
857 Ga0496111_0081807 3300048914 Bacteria 2357
858 Ga0496111_0114273 3300048914 Bacteria 1990
859 Ga0496111_0272630 3300048914 Bacteria 1255
860 Ga0496112_0091807 3300048915 Bacteria 3005
861 Ga0496112_0092520 3300048915 Bacteria 2993
862 Ga0496112_0225675 3300048915 Bacteria 1828
863 Ga0496112_0335940 3300048915 Bacteria 1454
864 Ga0496113_0005116 3300048916 Bacteria 8147
865 Ga0496113_0036455 3300048916 Bacteria 3604
866 Ga0496113_0071765 3300048916 Bacteria 2634
867 Ga0496113_0081558 3300048916 Bacteria 2480
868 Ga0496113_0135983 3300048916 Bacteria 1931
869 Ga0496113_0557933 3300048916 Bacteria 918
870 Ga0496114_0017924 3300048917 Bacteria 5723
871 Ga0496114_0035283 3300048917 Bacteria 4129
872 Ga0496114_0050804 3300048917 Bacteria 3451
873 Ga0496114_0078290 3300048917 Bacteria 2789
874 Ga0496114_0377182 3300048917 Bacteria 1255
875 Ga0496115_0002701 3300048918 Bacteria 12737
876 Ga0496115_0078410 3300048918 Bacteria 2687
877 Ga0496115_0240729 3300048918 Bacteria 1491
878 Ga0496115_0242839 3300048918 Bacteria 1484
879 Ga0501031_0050849 3300049568 Bacteria 2699
880 Ga0501031_0079695 3300049568 Bacteria 2134
881 Ga0501032_0019828 3300049569 Bacteria 4695
882 Ga0501032_0104196 3300049569 Bacteria 1879
883 Ga0501032_0236287 3300049569 Bacteria 1188
884 Ga0501032_0309258 3300049569 Bacteria 1021
885 Ga0501032_0382136 3300049569 Bacteria 905
886 Ga0501033_0043575 3300049570 Bacteria 3341
887 Ga0501033_0134853 3300049570 Bacteria 1786
888 Ga0501034_0003959 3300049571 Bacteria 16646
889 Ga0501034_0006739 3300049571 Bacteria 12298
890 Ga0501034_0069144 3300049571 Bacteria 3542
891 Ga0501034_0330778 3300049571 Bacteria 1455
892 Ga0501036_0000598 3300049572 Bacteria 26139
893 Ga0501036_0040164 3300049572 Bacteria 3957
894 Ga0501036_0044198 3300049572 Bacteria 3773
895 Ga0501037_0007098 3300049573 Bacteria 8188
896 Ga0501037_0041220 3300049573 Bacteria 3395
897 Ga0501037_0107552 3300049573 Bacteria 2009
898 Ga0501037_0166300 3300049573 Bacteria 1570
899 Ga0501037_0167161 3300049573 Bacteria 1565
900 Ga0501038_0037767 3300049574 Bacteria 4233
901 Ga0501038_0075227 3300049574 Bacteria 2855
902 Ga0501038_0130202 3300049574 Bacteria 2066
903 Ga0501039_0035014 3300049575 Bacteria 3875
904 Ga0501039_0074547 3300049575 Bacteria 2637
905 Ga0501039_0189071 3300049575 Bacteria 1619
906 Ga0501040_0270066 3300049576 Bacteria 1214
907 Ga0501041_0095507 3300049577 Bacteria 1837
908 Ga0501043_0003254 3300049579 Bacteria 13391
909 Ga0501043_0017656 3300049579 Bacteria 5596
910 Ga0501043_0047438 3300049579 Bacteria 3377
911 Ga0501043_0049113 3300049579 Bacteria 3317
912 Ga0501043_0061123 3300049579 Bacteria 2958
913 Ga0501043_0282894 3300049579 Bacteria 1271
914 Ga0501046_0014798 3300049580 Bacteria 6568
915 Ga0501046_0028044 3300049580 Bacteria 4589
916 Ga0501046_0434438 3300049580 Bacteria 945
917 Ga0501047_0002105 3300049581 Bacteria 19040
918 Ga0501047_0085747 3300049581 Bacteria 3026
919 Ga0501047_0105692 3300049581 Bacteria 2695
920 Ga0501047_0171308 3300049581 Bacteria 2039
921 Ga0501047_0183486 3300049581 Bacteria 1958
922 Ga0501048_0002496 3300049582 Bacteria 14045
923 Ga0501048_0017647 3300049582 Bacteria 5253
924 Ga0501048_0258353 3300049582 Bacteria 1237
925 Ga0501048_0343522 3300049582 Bacteria 1064
926 Ga0501068_0048874 3300049584 Bacteria 2554
927 Ga0501068_0065334 3300049584 Bacteria 2214
928 Ga0501068_0088307 3300049584 Bacteria 1910
929 Ga0501068_0103068 3300049584 Bacteria 1769
930 Ga0501069_0011518 3300049585 Bacteria 4684
931 Ga0501069_0057089 3300049585 Bacteria 2175
932 Ga0501070_0015259 3300049586 Bacteria 6464
933 Ga0501070_0016722 3300049586 Bacteria 6160
934 Ga0501070_0023399 3300049586 Bacteria 5176
935 Ga0501070_0043730 3300049586 Bacteria 3727
936 Ga0501070_0075515 3300049586 Bacteria 2790
937 Ga0501070_0280105 3300049586 Bacteria 1360
938 Ga0501071_0297737 3300049587 Bacteria 1222
939 Ga0501072_0000845 3300049588 Bacteria 22505
940 Ga0501072_0040255 3300049588 Bacteria 3670
941 Ga0501072_0669449 3300049588 Bacteria 816
942 Ga0501073_0018898 3300049589 Bacteria 4979
943 Ga0501073_0046290 3300049589 Bacteria 3060
944 Ga0501073_0097620 3300049589 Bacteria 2040
945 Ga0501073_0183551 3300049589 Bacteria 1448
946 Ga0501074_0015702 3300049590 Bacteria 5505
947 Ga0501074_0032545 3300049590 Bacteria 3777
948 Ga0501074_0052280 3300049590 Bacteria 2949
949 Ga0501074_0333574 3300049590 Bacteria 1076
950 Ga0501075_0004574 3300049591 Bacteria 9378
951 Ga0501076_0087439 3300049592 Bacteria 2506
952 Ga0501076_0327452 3300049592 Bacteria 1257
953 Ga0501077_0016834 3300049593 Bacteria 4612
954 Ga0501077_0039717 3300049593 Bacteria 2998
955 Ga0501079_0023072 3300049741 Bacteria 4777
956 Ga0501079_0355930 3300049741 Bacteria 1147
957 Ga0501080_0000734 3300049742 Bacteria 26489
958 Ga0501080_0058354 3300049742 Bacteria 3593
959 Ga0501080_0151455 3300049742 Bacteria 2143
960 Ga0501080_0298122 3300049742 Bacteria 1462
961 Ga0501080_0342737 3300049742 Bacteria 1350
962 Ga0501080_0444138 3300049742 Bacteria 1163
963 Ga0501080_0549880 3300049742 Bacteria 1028
964 Ga0501081_0010487 3300049743 Bacteria 6048
965 Ga0501081_0113097 3300049743 Bacteria 1928
966 Ga0501081_0159139 3300049743 Bacteria 1627
967 Ga0501081_0174625 3300049743 Bacteria 1552
968 Ga0501083_0022492 3300049744 Bacteria 4374
969 Ga0501083_0038933 3300049744 Bacteria 3230
970 Ga0501083_0188603 3300049744 Bacteria 1346
971 Ga0501035_0020489 3300049822 Bacteria 6073
972 Ga0501035_0065229 3300049822 Bacteria 3234
973 Ga0501044_0002568 3300049823 Bacteria 20676
974 Ga0501044_0003362 3300049823 Bacteria 18040
975 Ga0501044_0019047 3300049823 Bacteria 7348
976 Ga0501044_0103780 3300049823 Bacteria 2857
977 Ga0501044_0156455 3300049823 Bacteria 2258
978 Ga0501044_0505353 3300049823 Bacteria 1109
979 Ga0501045_0027462 3300049824 Bacteria 4102
980 nmdc:mga03683_107406_c1 3300050489 Bacteria 1231
981 nmdc:mga03n38_177813_c1 3300050490 Bacteria 1088
982 nmdc:mga03n38_55130_c1 3300050490 Bacteria 1790
983 nmdc:mga00v17_69478_c1 3300050491 Bacteria 2180
984 nmdc:mga0yw44_280705_c1 3300050492 Bacteria 1113
985 nmdc:mga0yw44_46099_c1 3300050492 Bacteria 1347
986 nmdc:mga0k408_17176_c1 3300050493 Bacteria 4028
987 nmdc:mga0k408_20132_c1 3300050493 Bacteria 3734
988 nmdc:mga0k408_40582_c1 3300050493 Bacteria 2678
989 nmdc:mga06z11_178348_c1 3300050494 Bacteria 1224
990 nmdc:mga06z11_197452_c1 3300050494 Bacteria 1167
991 nmdc:mga06z11_34669_c1 3300050494 Bacteria 2479
992 nmdc:mga07m45_170201_c1 3300050496 Bacteria 1266
993 nmdc:mga07m45_189016_c1 3300050496 Bacteria 1197
994 nmdc:mga07m45_93406_c1 3300050496 Bacteria 1413
995 nmdc:mga07m45_94679_c1 3300050496 Bacteria 1713
996 nmdc:mga05p37_853_c1 3300050507 Bacteria 34336
997 nmdc:mga05p37_93337_c1 3300050507 Bacteria 3708
998 nmdc:mga09592_69461_c1 3300050508 Bacteria 2988
999 nmdc:mga0qj67_42968_c1 3300050509 Bacteria 3559
1000 nmdc:mga06r32_1399_c1 3300050510 Bacteria 21806
1001 nmdc:mga08y16_127231_c1 3300050511 Bacteria 2650
1002 nmdc:mga08y16_162699_c1 3300050511 Bacteria 2319
1003 nmdc:mga08y16_2157_c1 3300050511 Bacteria 20180
1004 nmdc:mga08y16_450630_c1 3300050511 Bacteria 1312
1005 nmdc:mga08y16_8527_c1 3300050511 Bacteria 10738
1006 nmdc:mga08y16_95982_c1 3300050511 Bacteria 3088
1007 nmdc:mga0n895_108407_c1 3300050512 Bacteria 2791
1008 nmdc:mga0n895_27226_c1 3300050512 Bacteria 5428
1009 nmdc:mga0n895_3918_c1 3300050512 Bacteria 12090
1010 nmdc:mga0rr50_123529_c1 3300050513 Bacteria 2064
1011 nmdc:mga0rr50_85087_c1 3300050513 Bacteria 2450
1012 nmdc:mga08x19_162922_c1 3300050514 Bacteria 1515
1013 nmdc:mga08x19_97022_c1 3300050514 Bacteria 1951
1014 nmdc:mga0a205_1019_c1 3300050515 Bacteria 23295
1015 nmdc:mga0a205_2903_c2 3300050515 Bacteria 12753
1016 Ga0495601_0000413 3300053077 Bacteria 22423
1017 Ga0495601_0000668 3300053077 Bacteria 18282
1018 Ga0495601_0008299 3300053077 Bacteria 6131
1019 Ga0495601_0022790 3300053077 Bacteria 3847
1020 Ga0495601_0029279 3300053077 Bacteria 3414
1021 Ga0495601_0148945 3300053077 Bacteria 1527
1022 Ga0495612_0001737 3300053078 Bacteria 8936
1023 Ga0495612_0002338 3300053078 Bacteria 7810
1024 Ga0495612_0004014 3300053078 Bacteria 6097
1025 Ga0495612_0004192 3300053078 Bacteria 5977
1026 Ga0495595_0000301 3300053084 Bacteria 19169
1027 Ga0495595_0002695 3300053084 Bacteria 6968
1028 Ga0495595_0008215 3300053084 Bacteria 4285
1029 Ga0495595_0008748 3300053084 Bacteria 4167
1030 Ga0495595_0011183 3300053084 Bacteria 3748
1031 Ga0495619_0000087 3300053085 Bacteria 69727
1032 Ga0495619_0001679 3300053085 Bacteria 14639
1033 Ga0495619_0005102 3300053085 Bacteria 8337
1034 Ga0495619_0014361 3300053085 Bacteria 5000
1035 Ga0495619_0060618 3300053085 Bacteria 2515
1036 Ga0495619_0257876 3300053085 Bacteria 1208
1037 Ga0500643_005113 3300053087 Bacteria 5727
1038 Ga0500644_0002906 3300053088 Bacteria 4249
1039 Ga0500651_0005475 3300053093 Bacteria 7248
1040 Ga0500566_0012955 3300053094 Bacteria 4914
1041 Ga0500641_0005972 3300053096 Bacteria 4312
1042 Ga0500595_000002 3300053119 Bacteria 1074388
1043 Ga0500595_061926 3300053119 Bacteria 1128
1044 Ga0500618_042463 3300053125 Bacteria 1041
1045 Ga0500642_0016599 3300053130 Bacteria 2802
1046 Ga0500652_024710 3300053131 Bacteria 2296
1047 Ga0500568_0018059 3300053139 Bacteria 3097
1048 Ga0500616_0000002 3300053153 Bacteria 1611257
1049 Ga0500616_0074832 3300053153 Bacteria 1716
1050 Ga0500645_000219 3300053730 Bacteria 43658
1051 Ga0501084_0015544 3300054114 Bacteria 6313
1052 Ga0501084_0092617 3300054114 Bacteria 2537
1053 Ga0501084_0154469 3300054114 Bacteria 1935
1054 Ga0501084_0157502 3300054114 Bacteria 1915
1055 Ga0501084_0217130 3300054114 Bacteria 1613
1056 Ga0501084_0438872 3300054114 Bacteria 1104
1057 Ga0501084_0477645 3300054114 Bacteria 1054
1058 Ga0501082_0005723 3300060353 Bacteria 10782
1059 Ga0501082_0193642 3300060353 Bacteria 1768
1060 Ga0501082_0504713 3300060353 Bacteria 1057
1061 2643756289 2643221547 Bacteria 4740017
1062 8002063743 8002060224 Bacteria 4026565
1063 Ga0436364_0976420
1064 2214683829
1065 ARSoilYngRDRAFT_c00716
1066 ARcpr5yngRDRAFT_c001074
1067 ARSoilOldRDRAFT_c000177
1068 ARCol0yngRDRAFT_1000052
1069 JGI24747J21853_1001554
1070 JGI24737J22298_10003487
1071 JGI24743J22301_10015874
1072 JGI24750J21931_1003409
1073 JGI24745J21846_1001824
1074 JGI24738J21930_10003772
1075 JGI24749J21850_1000734
1076 JGI24744J21845_10000566
1077 JGI24034J26672_10006473
1078 JGI25406J46586_10010515
1079 JGI25153J46596_10011896
1080 JGI25404J52841_10000116
1081 JGI25405J52794_10015418
1082 Ga0065717_1003092
1083 Ga0065704_10074934
1084 Ga0065712_10000938
1085 Ga0065715_10093899
1086 Ga0065715_10111514
1087 Ga0070676_10036202
1088 Ga0070676_10158558
1089 Ga0070683_100000836
1090 Ga0070690_100003439
1091 Ga0070690_100040778
1092 Ga0070690_100081306
1093 Ga0070690_100157976
1094 Ga0070670_100006794
1095 Ga0070670_100448221
1096 Ga0070670_100579385
1097 Ga0070677_10000406
1098 Ga0070677_10089786
1099 Ga0068869_100000653
1100 Ga0068869_100177535
1101 Ga0068869_100452192
1102 Ga0070666_10063591
1103 Ga0070666_10227128
1104 Ga0070680_100023715
1105 Ga0070680_100067501
1106 Ga0070682_100012500
1107 Ga0070682_100070250
1108 Ga0070682_100109320
1109 Ga0068868_100059640
1110 Ga0068868_100186430
1111 Ga0068868_100519982
1112 Ga0070660_100007849
1113 Ga0070660_100089102
1114 Ga0070660_100096882
1115 Ga0070689_100015309
1116 Ga0070689_100018611
1117 Ga0070689_100047564
1118 Ga0070689_100113956
1119 Ga0070689_100262149
1120 Ga0070691_10008462
1121 Ga0070691_10009743
1122 Ga0070691_10195183
1123 Ga0070687_100000387
1124 Ga0070687_100024312
1125 Ga0070687_100057305
1126 Ga0070687_100392891
1127 Ga0070661_100007161
1128 Ga0070661_100378482
1129 Ga0070661_100400872
1130 Ga0070692_10005794
1131 Ga0070692_10023542
1132 Ga0070668_100004606
1133 Ga0070668_100043370
1134 Ga0070668_100212785
1135 Ga0070669_100026812
1136 Ga0070675_100009799
1137 Ga0070675_100064498
1138 Ga0070675_100138176
1139 Ga0070675_100244551
1140 Ga0070671_100021024
1141 Ga0070671_100530867
1142 Ga0070674_100010056
1143 Ga0070674_100010545
1144 Ga0070674_100022446
1145 Ga0070674_100096844
1146 Ga0070674_100161599
1147 Ga0070673_100001011
1148 Ga0070673_100063811
1149 Ga0070688_100000551
1150 Ga0070688_100014036
1151 Ga0070688_100063949
1152 Ga0070688_100208620
1153 Ga0070688_100332273
1154 Ga0070659_100020868
1155 Ga0070659_100070572
1156 Ga0070659_100266313
1157 Ga0070659_100675240
1158 Ga0070667_100014714
1159 Ga0070667_100094015
1160 Ga0070667_100201766
1161 Ga0070667_100394241
1162 Ga0070709_10001535
1163 Ga0070709_10071449
1164 Ga0070714_100014895
1165 Ga0070714_100226099
1166 Ga0070713_100000374
1167 Ga0070713_100026161
1168 Ga0070713_100320004
1169 Ga0070710_10015137
1170 Ga0070710_10024690
1171 Ga0070710_10064338
1172 Ga0070710_10110143
1173 Ga0070701_10052669
1174 Ga0070711_100050965
1175 Ga0070711_100194658
1176 Ga0070711_100239874
1177 Ga0070711_100291903
1178 Ga0070711_100741445
1179 Ga0070705_100009385
1180 Ga0070705_100640258
1181 Ga0070700_100017175
1182 Ga0070700_100035376
1183 Ga0070694_100004575
1184 Ga0070694_100008773
1185 Ga0070708_100155645
1186 Ga0070663_100011350
1187 Ga0070663_100085837
1188 Ga0070663_100270618
1189 Ga0070678_100000503
1190 Ga0070678_100001680
1191 Ga0070678_100216200
1192 Ga0070678_100446239
1193 Ga0070662_100012649
1194 Ga0070662_100034368
1195 Ga0070681_10020942
1196 Ga0070681_10100540
1197 Ga0070681_10174186
1198 Ga0070681_10392608
1199 Ga0068867_100004320
1200 Ga0068867_100065850
1201 Ga0070685_10006222
1202 Ga0070685_10020618
1203 Ga0070685_10029468
1204 Ga0070685_10163620
1205 Ga0070706_100271121
1206 Ga0070707_100505169
1207 Ga0070679_100007143
1208 Ga0070679_100014295
1209 Ga0070679_100053017
1210 Ga0070679_100235287
1211 Ga0070684_100004467
1212 Ga0070684_100199471
1213 Ga0070684_100285342
1214 Ga0068853_100011959
1215 Ga0068853_100473732
1216 Ga0068853_100571116
1217 Ga0070672_100002662
1218 Ga0070672_100214152
1219 Ga0070686_100002499
1220 Ga0070686_100023040
1221 Ga0070686_100030270
1222 Ga0070695_100003125
1223 Ga0070695_100127682
1224 Ga0070696_100038605
1225 Ga0070696_100053093
1226 Ga0070696_100153041
1227 Ga0070693_100003325
1228 Ga0070665_100363486
1229 Ga0070704_100003203
1230 Ga0070704_100033298
1231 Ga0070704_100085808
1232 Ga0068855_100017732
1233 Ga0070664_100019380
1234 Ga0070664_100025896
1235 Ga0070664_100187454
1236 Ga0070664_100395732
1237 Ga0068857_100032591
1238 Ga0068857_100108984
1239 Ga0068854_100009551
1240 Ga0068854_100035574
1241 Ga0068854_100060065
1242 Ga0068856_100034493
1243 Ga0068856_100167253
1244 Ga0068856_100194395
1245 Ga0068856_100272371
1246 Ga0068856_100624041
1247 Ga0070702_100002390
1248 Ga0070702_100146256
1249 Ga0070702_100216923
1250 Ga0068852_100012478
1251 Ga0068859_100183126
1252 Ga0068859_100515679
1253 Ga0068864_100001890
1254 Ga0068864_100063892
1255 Ga0068864_100073542
1256 Ga0068866_10002069
1257 Ga0068866_10050636
1258 Ga0068866_10069103
1259 Ga0068861_100003757
1260 Ga0068861_100064738
1261 Ga0068861_100155202
1262 Ga0068851_10116079
1263 Ga0068870_10002328
1264 Ga0068870_10053927
1265 Ga0068863_100000965
1266 Ga0068858_100015531
1267 Ga0068858_100062000
1268 Ga0068858_100145878
1269 Ga0068858_100232547
1270 Ga0068858_100250532
1271 Ga0068860_100041173
1272 Ga0068860_100227129
1273 Ga0068860_100239981
1274 Ga0068862_100005484
1275 Ga0068862_100148364
1276 Ga0068862_100784011
1277 Ga0081455_10000150
1278 Ga0081540_1000194
1279 Ga0081540_1090962
1280 Ga0081539_10001643
1281 Ga0070717_10000224
1282 Ga0070717_10049980
1283 Ga0075365_10039429
1284 Ga0075365_10270964
1285 Ga0075368_10050629
1286 Ga0075363_100030255
1287 Ga0075363_100180815
1288 Ga0075364_10099900
1289 Ga0070715_10000875
1290 Ga0070712_100017766
1291 Ga0070712_100218414
1292 Ga0070712_100225212
1293 Ga0075362_10020287
1294 Ga0075362_10030555
1295 Ga0075367_10082699
1296 Ga0075366_10019553
1297 Ga0075366_10166573
1298 Ga0075366_10174196
1299 Ga0097621_100000933
1300 Ga0097621_100053981
1301 Ga0097621_100352327
1302 Ga0075370_10040033
1303 Ga0068871_100003230
1304 Ga0068871_100016325
1305 Ga0068871_100266806
1306 Ga0075428_100002909
1307 Ga0075428_100075176
1308 Ga0075430_100057219
1309 Ga0075431_100000417
1310 Ga0075433_10006082
1311 Ga0075434_100027565
1312 Ga0075434_100052487
1313 Ga0075434_100071605
1314 Ga0075434_100187825
1315 Ga0068865_100005683
1316 Ga0068865_100022622
1317 Ga0068865_100037839
1318 Ga0075436_100062885
1319 Ga0097620_100183124
1320 Ga0097620_100515708
1321 Ga0075435_100113284
1322 Ga0075435_100175337
1323 Ga0099795_10111930
1324 Ga0105251_10027581
1325 Ga0105250_10035983
1326 Ga0105240_10081598
1327 Ga0105240_10440816
1328 Ga0111539_10004674
1329 Ga0111539_10019057
1330 Ga0111539_10019652
1331 Ga0111539_10042118
1332 Ga0111539_10140997
1333 Ga0111539_10342217
1334 Ga0105245_10001656
1335 Ga0105245_10003204
1336 Ga0105245_10018814
1337 Ga0105245_10173623
1338 Ga0105245_10390035
1339 Ga0105245_10432900
1340 Ga0105245_11176211
1341 Ga0105247_10006703
1342 Ga0105247_10013200
1343 Ga0105247_10071388
1344 Ga0114129_10002339
1345 Ga0114129_10004632
1346 Ga0114129_10607056
1347 Ga0114129_10737055
1348 Ga0105243_10006896
1349 Ga0105243_10041478
1350 Ga0105243_10089067
1351 Ga0105243_10348234
1352 Ga0105243_10530169
1353 Ga0105241_10006513
1354 Ga0105241_10096828
1355 Ga0105241_10111580
1356 Ga0105241_10250746
1357 Ga0105242_10000350
1358 Ga0105242_10024355
1359 Ga0105248_10013825
1360 Ga0105248_10049645
1361 Ga0105248_10110720
1362 Ga0105248_10324662
1363 Ga0105248_10624242
1364 Ga0105237_10024953
1365 Ga0105238_10012148
1366 Ga0105238_10063703
1367 Ga0105238_10517614
1368 Ga0105249_10007727
1369 Ga0105249_10040055
1370 Ga0105249_10127719
1371 Ga0105249_10293227
1372 Ga0105249_10453682
1373 Ga0105239_10015881
1374 Ga0105246_10002609
1375 Ga0105246_10037341
1376 Ga0105246_10510944
1377 Ga0157335_1002447
1378 Ga0157345_1004463
1379 Ga0157338_1000333
1380 Ga0157373_10016816
1381 Ga0157373_10115290
1382 Ga0157373_10173329
1383 Ga0157371_10007888
1384 Ga0157369_10152465
1385 Ga0157374_10012338
1386 Ga0157374_10148011
1387 Ga0157374_10347370
1388 Ga0157378_10017794
1389 Ga0157378_10160074
1390 Ga0157378_10630667
1391 Ga0163162_10031946
1392 Ga0163162_10064226
1393 Ga0163162_10172900
1394 Ga0163162_10505145
1395 Ga0163162_10564149
1396 Ga0157372_10030590
1397 Ga0157372_10188680
1398 Ga0157375_10009132
1399 Ga0157375_10533886
1400 Ga0157375_11072232
1401 Ga0163163_10019655
1402 Ga0163163_10304924
1403 Ga0163163_10592532
1404 Ga0163163_10703381
1405 Ga0157380_10002593
1406 Ga0157377_10002234
1407 Ga0157379_10021452
1408 Ga0157379_10117763
1409 Ga0157379_10589917
1410 Ga0157376_10000663
1411 Ga0157376_10215687
1412 Ga0157376_10318892
1413 Ga0163161_10005222
1414 Ga0163161_10098739
1415 Ga0213876_10019512
1416 Ga0213876_10042765
1417 Ga0213875_10000023
1418 Ga0207666_1000137
1419 Ga0207666_1000707
1420 Ga0207673_1000157
1421 Ga0209758_1000566
1422 Ga0207697_10005981
1423 Ga0207697_10005996
1424 Ga0207713_1026153
1425 Ga0207653_10004160
1426 Ga0207682_10000043
1427 Ga0207682_10139651
1428 Ga0207692_10006390
1429 Ga0207692_10103923
1430 Ga0207710_10008544
1431 Ga0207710_10009164
1432 Ga0207710_10039774
1433 Ga0207688_10000162
1434 Ga0207688_10064701
1435 Ga0207680_10039488
1436 Ga0207680_10053569
1437 Ga0207647_10001692
1438 Ga0207685_10000826
1439 Ga0207699_10007186
1440 Ga0207699_10015725
1441 Ga0207699_10086121
1442 Ga0207645_10000899
1443 Ga0207645_10038802
1444 Ga0207645_10041949
1445 Ga0207643_10000128
1446 Ga0207643_10062409
1447 Ga0207654_10006844
1448 Ga0207654_10013931
1449 Ga0207654_10100289
1450 Ga0207707_10004166
1451 Ga0207707_10032397
1452 Ga0207707_10122634
1453 Ga0207707_10148070
1454 Ga0207695_10369083
1455 Ga0207693_10025205
1456 Ga0207693_10027123
1457 Ga0207693_10176062
1458 Ga0207693_10188366
1459 Ga0207663_10118644
1460 Ga0207663_10171449
1461 Ga0207663_10210863
1462 Ga0207660_10011570
1463 Ga0207660_10020123
1464 Ga0207662_10004338
1465 Ga0207662_10067417
1466 Ga0207662_10103919
1467 Ga0207662_10207467
1468 Ga0207657_10011210
1469 Ga0207657_10015174
1470 Ga0207657_10249673
1471 Ga0207649_10002424
1472 Ga0207649_10015848
1473 Ga0207652_10068036
1474 Ga0207652_10182137
1475 Ga0207652_10297098
1476 Ga0207652_10556093
1477 Ga0207646_10312980
1478 Ga0207681_10017442
1479 Ga0207681_10144989
1480 Ga0207681_10661374
1481 Ga0207694_10028568
1482 Ga0207694_10138520
1483 Ga0207650_10031811
1484 Ga0207659_10030342
1485 Ga0207659_10100751
1486 Ga0207659_10441642
1487 Ga0207659_10501877
1488 Ga0207687_10000522
1489 Ga0207687_10009438
1490 Ga0207687_10066634
1491 Ga0207687_10157239
1492 Ga0207687_10236741
1493 Ga0207700_10013954
1494 Ga0207664_10034479
1495 Ga0207664_10144501
1496 Ga0207664_10275377
1497 Ga0207664_10289504
1498 Ga0207644_10000611
1499 Ga0207644_10047844
1500 Ga0207644_10101273
1501 Ga0207644_10511475
1502 Ga0207690_10003223
1503 Ga0207706_10010796
1504 Ga0207706_10035483
1505 Ga0207706_10077610
1506 Ga0207706_10354978
1507 Ga0207686_10003172
1508 Ga0207686_10022617
1509 Ga0207686_10181402
1510 Ga0207709_10001270
1511 Ga0207709_10069997
1512 Ga0207670_10000631
1513 Ga0207670_10008282
1514 Ga0207670_10011017
1515 Ga0207670_10556630
1516 Ga0207669_10000797
1517 Ga0207669_10015672
1518 Ga0207669_10097054
1519 Ga0207704_10007276
1520 Ga0207704_10046381
1521 Ga0207704_10129434
1522 Ga0207665_10008424
1523 Ga0207665_10087241
1524 Ga0207665_10121854
1525 Ga0207691_10008026
1526 Ga0207691_10071292
1527 Ga0207691_10343936
1528 Ga0207711_10040416
1529 Ga0207711_10370080
1530 Ga0207689_10000165
1531 Ga0207689_10060237
1532 Ga0207689_10187368
1533 Ga0207661_10004909
1534 Ga0207679_10000112
1535 Ga0207679_10147957
1536 Ga0207679_10211040
1537 Ga0207667_10056264
1538 Ga0207651_10018034
1539 Ga0207651_10094868
1540 Ga0207651_10141887
1541 Ga0207651_10394283
1542 Ga0207712_10004163
1543 Ga0207712_10104441
1544 Ga0207712_10156743
1545 Ga0207668_10001083
1546 Ga0207668_10266591
1547 Ga0207668_10445086
1548 Ga0207640_10000382
1549 Ga0207640_10134193
1550 Ga0207658_10017898
1551 Ga0207658_10056408
1552 Ga0207658_10446609
1553 Ga0207658_10476500
1554 Ga0207677_10018249
1555 Ga0207677_10132356
1556 Ga0207703_10027237
1557 Ga0207703_10075133
1558 Ga0207703_10096507
1559 Ga0207703_10334789
1560 Ga0207703_10401314
1561 Ga0207703_10690492
1562 Ga0207639_10025940
1563 Ga0207678_10003507
1564 Ga0207678_10010035
1565 Ga0207678_10022143
1566 Ga0207708_10016432
1567 Ga0207708_10028647
1568 Ga0207708_10194657
1569 Ga0207708_10573370
1570 Ga0207702_10129725
1571 Ga0207641_10001777
1572 Ga0207648_10013960
1573 Ga0207648_10105676
1574 Ga0207648_10165333
1575 Ga0207676_10000494
1576 Ga0207676_10064465
1577 Ga0207676_10702111
1578 Ga0207674_10031526
1579 Ga0207674_10035553
1580 Ga0207675_100024932
1581 Ga0207675_100039290
1582 Ga0207675_100092415
1583 Ga0207675_100383792
1584 Ga0207683_10001272
1585 Ga0207683_10004940
1586 Ga0207683_10007540
1587 Ga0207683_10272258
1588 Ga0207698_10004416
1589 Ga0207698_10442937
1590 Ga0209996_1006884
1591 Ga0210002_1001447
1592 Ga0209983_1008271
1593 Ga0209588_1063612
1594 Ga0209966_1002370
1595 Ga0209998_10001523
1596 Ga0209998_10001929
1597 Ga0209974_10004333
1598 Ga0209974_10109708
1599 Ga0207428_10000064
1600 Ga0207428_10003786
1601 Ga0207428_10034470
1602 Ga0207428_10189633
1603 Ga0207428_10275307
1604 Ga0268266_10018410
1605 Ga0268265_10001549
1606 Ga0268265_10186109
1607 Ga0268265_10199557
1608 Ga0268265_10320851
1609 Ga0268264_10004661
1610 Ga0268264_10219598
1611 Ga0268264_10315037
1612 Ga0268264_10803016
1613 Ga0265337_1017384
1614 Ga0265325_10000006
1615 Ga0265325_10000252
1616 Ga0265316_10294747
1617 Ga0307513_10172432
1618 Ga0265313_10032639
1619 Ga0316579_10013487
1620 Ga0265342_10019058
1621 Ga0307412_10446746
1622 Ga0373948_0000698
1623 Ga0373950_0000757
1624 Ga0373958_0005082
1625 Ga0373938_0006960
1626 Ga0373938_0008876
1627 Ga0373938_0013494
1628 Ga0373926_0028132
1629 Ga0373926_0038715
1630 Ga0373928_0002965
1631 Ga0373928_0004781
1632 Ga0373928_0006581
1633 Ga0373929_0002903
1634 Ga0373929_0012768
1635 Ga0373940_0006426
1636 Ga0373940_0016817
1637 Ga0373944_0038564
1638 Ga0373949_0001309
1639 Ga0373949_0005175
1640 Ga0373949_0005768
1641 Ga0373951_0001012
1642 Ga0373951_0001653
1643 Ga0373952_0000401
1644 Ga0373952_0002793
1645 Ga0373952_0006356
1646 Ga0373923_0163210
1647 Ga0373932_0002484
1648 Ga0373932_0008055
1649 Ga0373932_0018775
1650 Ga0373936_0123129
1651 Ga0373939_0002908
1652 Ga0373939_0024704
1653 Ga0373939_0027565
1654 Ga0373939_0066381
1655 Ga0373939_0083288
1656 Ga0373941_0000504
1657 Ga0373941_0014277
1658 Ga0373953_0006578
1659 Ga0373953_0035448
1660 Ga0373954_0002902
1661 Ga0373954_0004502
1662 Ga0373956_0005198
1663 Ga0373956_0005225
1664 Ga0373956_0032976
1665 Ga0373956_0043729
1666 Ga0373957_0000543
1667 Ga0373943_0001305
1668 Ga0373943_0159285
1669 Ga0373946_0016248
1670 Ga0373946_0134740
1671 Ga0373946_0206280
1672 Ga0373955_0002625
1673 Ga0373955_0014757
1674 Ga0373955_0028939
1675 Ga0373942_0004233
1676 Ga0373961_0003997
1677 Ga0373961_0072745
1678 Ga0373962_0002408
1679 Ga0373962_0003465
1680 Ga0373962_0028155
1681 Ga0373962_0079186
1682 Ga0373924_0026611
1683 Ga0373931_0001286
1684 Ga0373931_0008271
1685 Ga0373931_0043717
1686 Ga0373931_0103800
1687 Ga0373935_0003279
1688 Ga0373935_0009562
1689 Ga0373927_0015396
1690 Ga0373927_0186071
1691 Ga0373927_0205481
1692 Ga0373933_0004530
1693 Ga0373933_0167136
1694 Ga0373947_0047816
1695 Ga0373947_0054703
1696 Ga0373947_0126893
1697 Ga0373947_0167699
1698 Ga0373937_0001302
1699 Ga0373937_0002947
1700 Ga0373937_0014182
1701 Ga0373937_0039323
1702 Ga0373937_0040918
1703 Ga0373937_0240745
1704 Ga0373937_0328218
1705 Ga0373937_0783496
1706 Ga0373925_0043026
1707 Ga0373925_0248806
1708 Ga0436364_0024145
1709 Ga0436364_1042090
1710 Ga0436364_1078356
1711 Ga0436365_0719053
1712 Ga0436365_0725763
1713 Ga0436365_1188741
1714 Ga0436365_1227929
1715 Ga0436360_1007413
1716 Ga0436363_0375711
1717 Ga0436362_0896511
1718 Ga0439453_0002674
1719 Ga0439453_0003546
1720 Ga0451853_4050201
1721 Ga0439443_001472
1722 Ga0439455_0012765
1723 Ga0439444_0017706
1724 Ga0439464_0066223
1725 Ga0439460_0036376
1726 Ga0451577_0174013
1727 Ga0439440_0024267
1728 Ga0466967_0297481
1729 Ga0495592_0005759
1730 Ga0495592_0018759
1731 Ga0495592_0181710
1732 Ga0495603_0021766
1733 Ga0495629_0000253
1734 Ga0495629_0077225
1735 Ga0495629_0105459
1736 Ga0495638_0023879
1737 Ga0495638_0129888
1738 Ga0495651_0014216
1739 Ga0495651_0015195
1740 Ga0495651_0040620
1741 Ga0495651_0110841
1742 Ga0495653_0017400
1743 Ga0495653_0162831
1744 Ga0495653_0170534
1745 Ga0495653_0282822
1746 Ga0495650_0042409
1747 Ga0495580_0047078
1748 Ga0495580_0060832
1749 Ga0495580_0410648
1750 Ga0495582_0041140
1751 Ga0495639_0005636
1752 Ga0495639_0013858
1753 Ga0495639_0063459
1754 Ga0495662_0008670
1755 Ga0495664_0073000
1756 Ga0495664_0195838
1757 Ga0495584_0061045
1758 Ga0495585_0007151
1759 Ga0495594_0002753
1760 Ga0495594_0041096
1761 Ga0495607_0026487
1762 Ga0495608_0001048
1763 Ga0495608_0043899
1764 Ga0495618_0029595
1765 Ga0495628_0002572
1766 Ga0495628_0099872
1767 Ga0495630_0017093
1768 Ga0495630_0095930
1769 Ga0495631_0131587
1770 Ga0495644_0002206
1771 Ga0495666_0063210
1772 Ga0495652_0002428
1773 Ga0495652_0023199
1774 Ga0495665_0125571
1775 Ga0495640_0017869
1776 Ga0495586_0019877
1777 Ga0495587_0013625
1778 Ga0495587_0018674
1779 Ga0495621_0003600
1780 Ga0495645_0017543
1781 Ga0495622_0027226
1782 Ga0495622_0045670
1783 Ga0495667_0003718
1784 Ga0495667_0005014
1785 Ga0495667_0007579
1786 Ga0495667_0108306
1787 Ga0495656_0001748
1788 Ga0495634_0064058
1789 Ga0495634_0156918
1790 Ga0495634_0199204
1791 Ga0495611_0029924
1792 Ga0495635_0010356
1793 Ga0495635_0016934
1794 Ga0495635_0028736
1795 Ga0495635_0052291
1796 Ga0495661_0015998
1797 Ga0495588_0002028
1798 Ga0495657_0027256
1799 Ga0495657_0050262
1800 Ga0495599_0018956
1801 Ga0495623_0000769
1802 Ga0495623_0007229
1803 Ga0495646_0016203
1804 Ga0495646_0246795
1805 Ga0495647_0002159
1806 Ga0495658_0000473
1807 Ga0495658_0050088
1808 Ga0495658_0068764
1809 Ga0495658_0195239
1810 Ga0495613_0005369
1811 Ga0495613_0063014
1812 Ga0495613_0081446
1813 Ga0495670_0005085
1814 Ga0495600_0002018
1815 Ga0495600_0007230
1816 Ga0495600_0018503
1817 Ga0495600_0061493
1818 Ga0495581_0002175
1819 Ga0495581_0073173
1820 Ga0495581_0219960
1821 Ga0495604_0002235
1822 Ga0495674_0049481
1823 Ga0495674_0057206
1824 Ga0495674_0058173
1825 Ga0495674_0207802
1826 Ga0495672_0087065
1827 Ga0495676_0029258
1828 Ga0495676_0422142
1829 Ga0495680_0012645
1830 Ga0495680_0035253
1831 Ga0495680_0053489
1832 Ga0495680_0211739
1833 Ga0495680_0509751
1834 Ga0495675_0059856
1835 Ga0495675_0080810
1836 Ga0495675_0090792
1837 Ga0495677_0019854
1838 Ga0495684_0006615
1839 Ga0495684_0130806
1840 Ga0495684_0222305
1841 Ga0495602_0001451
1842 Ga0495602_0157691
1843 Ga0496100_0002412
1844 Ga0496100_0003757
1845 Ga0496100_0009774
1846 Ga0496100_0012545
1847 Ga0496100_0027796
1848 Ga0496100_0051850
1849 Ga0496101_0000235
1850 Ga0496101_0001165
1851 Ga0496101_0010317
1852 Ga0496101_0017473
1853 Ga0496101_0074476
1854 Ga0496101_0157660
1855 Ga0496101_0370568
1856 Ga0496101_0378004
1857 Ga0496102_0002224
1858 Ga0496102_0061440
1859 Ga0496102_0119256
1860 Ga0496102_0137434
1861 Ga0496102_0282491
1862 Ga0496102_0338022
1863 Ga0496102_0613050
1864 Ga0496103_0026234
1865 Ga0496103_0095061
1866 Ga0496103_0098539
1867 Ga0496103_0150016
1868 Ga0496103_0157848
1869 Ga0496104_0003146
1870 Ga0496104_0006422
1871 Ga0496104_0018551
1872 Ga0496104_0056495
1873 Ga0496104_0058441
1874 Ga0496104_0100561
1875 Ga0496104_0138009
1876 Ga0496104_0147480
1877 Ga0496105_0000840
1878 Ga0496105_0002908
1879 Ga0496105_0040505
1880 Ga0496105_0050017
1881 Ga0496105_0119874
1882 Ga0496105_0490507
1883 Ga0496106_0002108
1884 Ga0496106_0004642
1885 Ga0496106_0012281
1886 Ga0496106_0018551
1887 Ga0496106_0077522
1888 Ga0496106_0525147
1889 Ga0496107_0002984
1890 Ga0496107_0024758
1891 Ga0496107_0031487
1892 Ga0496107_0060146
1893 Ga0496107_0063826
1894 Ga0496107_0086974
1895 Ga0496107_0280117
1896 Ga0496108_0005305
1897 Ga0496108_0011953
1898 Ga0496108_0027044
1899 Ga0496108_0080492
1900 Ga0496108_0107696
1901 Ga0496108_0127350
1902 Ga0496108_0152171
1903 Ga0496108_0576904
1904 Ga0496109_0029476
1905 Ga0496109_0031599
1906 Ga0496109_0038758
1907 Ga0496109_0081526
1908 Ga0496109_0158170
1909 Ga0496109_0260732
1910 Ga0496109_0933963
1911 Ga0496110_0013851
1912 Ga0496110_0028561
1913 Ga0496110_0039327
1914 Ga0496110_0118743
1915 Ga0496110_0224999
1916 Ga0496110_0262906
1917 Ga0496111_0016755
1918 Ga0496111_0053227
1919 Ga0496111_0081807
1920 Ga0496111_0114273
1921 Ga0496111_0272630
1922 Ga0496112_0091807
1923 Ga0496112_0092520
1924 Ga0496112_0225675
1925 Ga0496112_0335940
1926 Ga0496113_0005116
1927 Ga0496113_0036455
1928 Ga0496113_0071765
1929 Ga0496113_0081558
1930 Ga0496113_0135983
1931 Ga0496113_0557933
1932 Ga0496114_0017924
1933 Ga0496114_0035283
1934 Ga0496114_0050804
1935 Ga0496114_0078290
1936 Ga0496114_0377182
1937 Ga0496115_0002701
1938 Ga0496115_0078410
1939 Ga0496115_0240729
1940 Ga0496115_0242839
1941 Ga0501031_0050849
1942 Ga0501031_0079695
1943 Ga0501032_0019828
1944 Ga0501032_0104196
1945 Ga0501032_0236287
1946 Ga0501032_0309258
1947 Ga0501032_0382136
1948 Ga0501033_0043575
1949 Ga0501033_0134853
1950 Ga0501034_0003959
1951 Ga0501034_0006739
1952 Ga0501034_0069144
1953 Ga0501034_0330778
1954 Ga0501036_0000598
1955 Ga0501036_0040164
1956 Ga0501036_0044198
1957 Ga0501037_0007098
1958 Ga0501037_0041220
1959 Ga0501037_0107552
1960 Ga0501037_0166300
1961 Ga0501037_0167161
1962 Ga0501038_0037767
1963 Ga0501038_0075227
1964 Ga0501038_0130202
1965 Ga0501039_0035014
1966 Ga0501039_0074547
1967 Ga0501039_0189071
1968 Ga0501040_0270066
1969 Ga0501041_0095507
1970 Ga0501043_0003254
1971 Ga0501043_0017656
1972 Ga0501043_0047438
1973 Ga0501043_0049113
1974 Ga0501043_0061123
1975 Ga0501043_0282894
1976 Ga0501046_0014798
1977 Ga0501046_0028044
1978 Ga0501046_0434438
1979 Ga0501047_0002105
1980 Ga0501047_0085747
1981 Ga0501047_0105692
1982 Ga0501047_0171308
1983 Ga0501047_0183486
1984 Ga0501048_0002496
1985 Ga0501048_0017647
1986 Ga0501048_0258353
1987 Ga0501048_0343522
1988 Ga0501068_0048874
1989 Ga0501068_0065334
1990 Ga0501068_0088307
1991 Ga0501068_0103068
1992 Ga0501069_0011518
1993 Ga0501069_0057089
1994 Ga0501070_0015259
1995 Ga0501070_0016722
1996 Ga0501070_0023399
1997 Ga0501070_0043730
1998 Ga0501070_0075515
1999 Ga0501070_0280105
2000 Ga0501071_0297737
2001 Ga0501072_0000845
2002 Ga0501072_0040255
2003 Ga0501072_0669449
2004 Ga0501073_0018898
2005 Ga0501073_0046290
2006 Ga0501073_0097620
2007 Ga0501073_0183551
2008 Ga0501074_0015702
2009 Ga0501074_0032545
2010 Ga0501074_0052280
2011 Ga0501074_0333574
2012 Ga0501075_0004574
2013 Ga0501076_0087439
2014 Ga0501076_0327452
2015 Ga0501077_0016834
2016 Ga0501077_0039717
2017 Ga0501079_0023072
2018 Ga0501079_0355930
2019 Ga0501080_0000734
2020 Ga0501080_0058354
2021 Ga0501080_0151455
2022 Ga0501080_0298122
2023 Ga0501080_0342737
2024 Ga0501080_0444138
2025 Ga0501080_0549880
2026 Ga0501081_0010487
2027 Ga0501081_0113097
2028 Ga0501081_0159139
2029 Ga0501081_0174625
2030 Ga0501083_0022492
2031 Ga0501083_0038933
2032 Ga0501083_0188603
2033 Ga0501035_0020489
2034 Ga0501035_0065229
2035 Ga0501044_0002568
2036 Ga0501044_0003362
2037 Ga0501044_0019047
2038 Ga0501044_0103780
2039 Ga0501044_0156455
2040 Ga0501044_0505353
2041 Ga0501045_0027462
2042 nmdc:mga03683_107406_c1
2043 nmdc:mga03n38_177813_c1
2044 nmdc:mga03n38_55130_c1
2045 nmdc:mga00v17_69478_c1
2046 nmdc:mga0yw44_280705_c1
2047 nmdc:mga0yw44_46099_c1
2048 nmdc:mga0k408_17176_c1
2049 nmdc:mga0k408_20132_c1
2050 nmdc:mga0k408_40582_c1
2051 nmdc:mga06z11_178348_c1
2052 nmdc:mga06z11_197452_c1
2053 nmdc:mga06z11_34669_c1
2054 nmdc:mga07m45_170201_c1
2055 nmdc:mga07m45_189016_c1
2056 nmdc:mga07m45_93406_c1
2057 nmdc:mga07m45_94679_c1
2058 nmdc:mga05p37_853_c1
2059 nmdc:mga05p37_93337_c1
2060 nmdc:mga09592_69461_c1
2061 nmdc:mga0qj67_42968_c1
2062 nmdc:mga06r32_1399_c1
2063 nmdc:mga08y16_127231_c1
2064 nmdc:mga08y16_162699_c1
2065 nmdc:mga08y16_2157_c1
2066 nmdc:mga08y16_450630_c1
2067 nmdc:mga08y16_8527_c1
2068 nmdc:mga08y16_95982_c1
2069 nmdc:mga0n895_108407_c1
2070 nmdc:mga0n895_27226_c1
2071 nmdc:mga0n895_3918_c1
2072 nmdc:mga0rr50_123529_c1
2073 nmdc:mga0rr50_85087_c1
2074 nmdc:mga08x19_162922_c1
2075 nmdc:mga08x19_97022_c1
2076 nmdc:mga0a205_1019_c1
2077 nmdc:mga0a205_2903_c2
2078 Ga0495601_0000413
2079 Ga0495601_0000668
2080 Ga0495601_0008299
2081 Ga0495601_0022790
2082 Ga0495601_0029279
2083 Ga0495601_0148945
2084 Ga0495612_0001737
2085 Ga0495612_0002338
2086 Ga0495612_0004014
2087 Ga0495612_0004192
2088 Ga0495595_0000301
2089 Ga0495595_0002695
2090 Ga0495595_0008215
2091 Ga0495595_0008748
2092 Ga0495595_0011183
2093 Ga0495619_0000087
2094 Ga0495619_0001679
2095 Ga0495619_0005102
2096 Ga0495619_0014361
2097 Ga0495619_0060618
2098 Ga0495619_0257876
2099 Ga0500643_005113
2100 Ga0500644_0002906
2101 Ga0500651_0005475
2102 Ga0500566_0012955
2103 Ga0500641_0005972
2104 Ga0500595_000002
2105 Ga0500595_061926
2106 Ga0500618_042463
2107 Ga0500642_0016599
2108 Ga0500652_024710
2109 Ga0500568_0018059
2110 Ga0500616_0000002
2111 Ga0500616_0074832
2112 Ga0500645_000219
2113 Ga0501084_0015544
2114 Ga0501084_0092617
2115 Ga0501084_0154469
2116 Ga0501084_0157502
2117 Ga0501084_0217130
2118 Ga0501084_0438872
2119 Ga0501084_0477645
2120 Ga0501082_0005723
2121 Ga0501082_0193642
2122 Ga0501082_0504713
2123 2643756289
2124 8002063743

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

40

260

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6szg-assembly1.cif.gz_A acinetobacter baumannii undecaprenyl pyrophosphate synthase (ab-upps) in complex with gr839 and gsk513 0.9677 15 234
1x07-assembly1.cif.gz_A crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp 0.9669 16 238
4onc-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 0.9649 14 242
1x09-assembly1.cif.gz_A crystal structure of the d26a mutant upps in complex with magnesium and isopentenyl pyrophosphate 0.9649 17 237
4onc-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 0.9633 14 240
ID Description Score Start End Superfamily
af_K7KA63_68_310_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9672 15 243 3.40.1180.10
af_Q5FC21_4_262_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9638 15 235 3.40.1180.10
af_O14171_12_259_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9629 15 235 3.40.1180.10
2vg2A01 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9628 12 237 3.40.1180.10
5hc7A00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9575 15 237 3.40.1180.10
ID Description Score Start End GO Terms
AF-A0A2E0GQ45-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9819 15 152 GO:0016094
GO:0045547
AF-A0A2S9REF4-F1-model_v4 deleted 0.9793 14 144
AF-A0A3D0MLJ4-F1-model_v4 deleted 0.9779 23 237
AF-A0A7W0N335-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9778 23 149 GO:0008834
GO:0016094
GO:0045547
AF-A0A2N2LXK9-F1-model_v4 Isoprenyl transferase (EC 2.5.1.-) 0.9774 15 234 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0030145
GO:0045547

Map