F489309
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1062 | 429 | 2124 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0976420|Ga0436364_0976420_296_1123 |
| Length | 275 |
| Sequence | MWLEKRMPEMAASSIATAPVAAQAEQNLEASRPPRHVAIIMDGNGRWAAERGLPRTEGHRRGVEALRRTVRAAGEMGIRILTIFSFSAENWSRPPAEIRDLMGLLRRFIRNDLAELHGSNVRVRIIGERIGLDPEIRRLLEEAEELTHANDGLLLVVAFNYGGRQEIARAAQRIAEMVAAGKLATADITADLIGRHLDAPDLPDPDLIIRTSGEQRLSNFLMWQSAYSELIFVPIYWPDFDGSALDIAIAEYRRRERRFGGLIGRTLGAERAVAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 19 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 20 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 120 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 137 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 138 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 139 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 154 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 155 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 237 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 239 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 242 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 243 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 244 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 245 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 246 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 248 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 253 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 262 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 268 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 272 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 278 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 279 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 280 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 281 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 282 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 283 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 284 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 285 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 286 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 287 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 288 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 350 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 351 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 352 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 353 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 354 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 355 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 358 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 359 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 360 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 361 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 362 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 363 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 397 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 399 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 415 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 416 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 417 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 419 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 420 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 422 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 423 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 424 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 425 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 426 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 429 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.24 |
| Nodule | 0 |
| Rhizoplane | 9.23 |
| Rhizosphere | 85.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436364_0976420 | 3300037853 | Bacteria | 1479 |
| 2 | 2214683829 | 2209111006 | Bacteria | 4471 |
| 3 | ARSoilYngRDRAFT_c00716 | 3300000042 | Bacteria | 3074 |
| 4 | ARcpr5yngRDRAFT_c001074 | 3300000043 | Bacteria | 3094 |
| 5 | ARSoilOldRDRAFT_c000177 | 3300000044 | Bacteria | 10645 |
| 6 | ARCol0yngRDRAFT_1000052 | 3300000652 | Bacteria | 20331 |
| 7 | JGI24747J21853_1001554 | 3300001978 | Bacteria | 1742 |
| 8 | JGI24737J22298_10003487 | 3300001990 | Bacteria | 5548 |
| 9 | JGI24743J22301_10015874 | 3300001991 | Bacteria | 1400 |
| 10 | JGI24750J21931_1003409 | 3300002070 | Bacteria | 1902 |
| 11 | JGI24745J21846_1001824 | 3300002073 | Bacteria | 2109 |
| 12 | JGI24738J21930_10003772 | 3300002075 | Bacteria | 3786 |
| 13 | JGI24749J21850_1000734 | 3300002076 | Bacteria | 4727 |
| 14 | JGI24744J21845_10000566 | 3300002077 | Bacteria | 6684 |
| 15 | JGI24034J26672_10006473 | 3300002239 | Bacteria | 1689 |
| 16 | JGI25406J46586_10010515 | 3300003203 | Bacteria | 4103 |
| 17 | JGI25153J46596_10011896 | 3300003215 | Bacteria | 3811 |
| 18 | JGI25404J52841_10000116 | 3300003659 | Bacteria | 8083 |
| 19 | JGI25405J52794_10015418 | 3300003911 | Bacteria | 1501 |
| 20 | Ga0065717_1003092 | 3300005276 | Bacteria | 1428 |
| 21 | Ga0065704_10074934 | 3300005289 | Bacteria | 5898 |
| 22 | Ga0065712_10000938 | 3300005290 | Bacteria | 7363 |
| 23 | Ga0065715_10093899 | 3300005293 | Bacteria | 4508 |
| 24 | Ga0065715_10111514 | 3300005293 | Bacteria | 2567 |
| 25 | Ga0070676_10036202 | 3300005328 | Bacteria | 2842 |
| 26 | Ga0070676_10158558 | 3300005328 | Bacteria | 1454 |
| 27 | Ga0070683_100000836 | 3300005329 | Bacteria | 22825 |
| 28 | Ga0070690_100003439 | 3300005330 | Bacteria | 8653 |
| 29 | Ga0070690_100040778 | 3300005330 | Bacteria | 2937 |
| 30 | Ga0070690_100081306 | 3300005330 | Bacteria | 2120 |
| 31 | Ga0070690_100157976 | 3300005330 | Bacteria | 1551 |
| 32 | Ga0070670_100006794 | 3300005331 | Bacteria | 9685 |
| 33 | Ga0070670_100448221 | 3300005331 | Bacteria | 1143 |
| 34 | Ga0070670_100579385 | 3300005331 | Bacteria | 1003 |
| 35 | Ga0070677_10000406 | 3300005333 | Bacteria | 14999 |
| 36 | Ga0070677_10089786 | 3300005333 | Bacteria | 1334 |
| 37 | Ga0068869_100000653 | 3300005334 | Bacteria | 19619 |
| 38 | Ga0068869_100177535 | 3300005334 | Bacteria | 1668 |
| 39 | Ga0068869_100452192 | 3300005334 | Bacteria | 1065 |
| 40 | Ga0070666_10063591 | 3300005335 | Bacteria | 2502 |
| 41 | Ga0070666_10227128 | 3300005335 | Bacteria | 1318 |
| 42 | Ga0070680_100023715 | 3300005336 | Bacteria | 4896 |
| 43 | Ga0070680_100067501 | 3300005336 | Bacteria | 2933 |
| 44 | Ga0070682_100012500 | 3300005337 | Bacteria | 4870 |
| 45 | Ga0070682_100070250 | 3300005337 | Bacteria | 2238 |
| 46 | Ga0070682_100109320 | 3300005337 | Bacteria | 1840 |
| 47 | Ga0068868_100059640 | 3300005338 | Bacteria | 3019 |
| 48 | Ga0068868_100186430 | 3300005338 | Bacteria | 1724 |
| 49 | Ga0068868_100519982 | 3300005338 | Bacteria | 1045 |
| 50 | Ga0070660_100007849 | 3300005339 | Bacteria | 7442 |
| 51 | Ga0070660_100089102 | 3300005339 | Bacteria | 2431 |
| 52 | Ga0070660_100096882 | 3300005339 | Bacteria | 2333 |
| 53 | Ga0070689_100015309 | 3300005340 | Bacteria | 5589 |
| 54 | Ga0070689_100018611 | 3300005340 | Bacteria | 5120 |
| 55 | Ga0070689_100047564 | 3300005340 | Bacteria | 3307 |
| 56 | Ga0070689_100113956 | 3300005340 | Bacteria | 2153 |
| 57 | Ga0070689_100262149 | 3300005340 | Bacteria | 1429 |
| 58 | Ga0070691_10008462 | 3300005341 | Bacteria | 4709 |
| 59 | Ga0070691_10009743 | 3300005341 | Bacteria | 4380 |
| 60 | Ga0070691_10195183 | 3300005341 | Bacteria | 1061 |
| 61 | Ga0070687_100000387 | 3300005343 | Bacteria | 14981 |
| 62 | Ga0070687_100024312 | 3300005343 | Bacteria | 2891 |
| 63 | Ga0070687_100057305 | 3300005343 | Bacteria | 2043 |
| 64 | Ga0070687_100392891 | 3300005343 | Bacteria | 907 |
| 65 | Ga0070661_100007161 | 3300005344 | Bacteria | 7689 |
| 66 | Ga0070661_100378482 | 3300005344 | Bacteria | 1115 |
| 67 | Ga0070661_100400872 | 3300005344 | Bacteria | 1085 |
| 68 | Ga0070692_10005794 | 3300005345 | Bacteria | 5312 |
| 69 | Ga0070692_10023542 | 3300005345 | Bacteria | 3018 |
| 70 | Ga0070668_100004606 | 3300005347 | Bacteria | 10214 |
| 71 | Ga0070668_100043370 | 3300005347 | Bacteria | 3450 |
| 72 | Ga0070668_100212785 | 3300005347 | Bacteria | 1591 |
| 73 | Ga0070669_100026812 | 3300005353 | Bacteria | 4146 |
| 74 | Ga0070675_100009799 | 3300005354 | Bacteria | 7463 |
| 75 | Ga0070675_100064498 | 3300005354 | Bacteria | 3028 |
| 76 | Ga0070675_100138176 | 3300005354 | Bacteria | 2081 |
| 77 | Ga0070675_100244551 | 3300005354 | Bacteria | 1568 |
| 78 | Ga0070671_100021024 | 3300005355 | Bacteria | 5326 |
| 79 | Ga0070671_100530867 | 3300005355 | Bacteria | 1014 |
| 80 | Ga0070674_100010056 | 3300005356 | Bacteria | 5697 |
| 81 | Ga0070674_100010545 | 3300005356 | Bacteria | 5593 |
| 82 | Ga0070674_100022446 | 3300005356 | Bacteria | 4070 |
| 83 | Ga0070674_100096844 | 3300005356 | Bacteria | 2142 |
| 84 | Ga0070674_100161599 | 3300005356 | Bacteria | 1700 |
| 85 | Ga0070673_100001011 | 3300005364 | Bacteria | 15945 |
| 86 | Ga0070673_100063811 | 3300005364 | Bacteria | 2932 |
| 87 | Ga0070688_100000551 | 3300005365 | Bacteria | 18929 |
| 88 | Ga0070688_100014036 | 3300005365 | Bacteria | 4531 |
| 89 | Ga0070688_100063949 | 3300005365 | Bacteria | 2334 |
| 90 | Ga0070688_100208620 | 3300005365 | Bacteria | 1371 |
| 91 | Ga0070688_100332273 | 3300005365 | Bacteria | 1107 |
| 92 | Ga0070659_100020868 | 3300005366 | Bacteria | 4982 |
| 93 | Ga0070659_100070572 | 3300005366 | Bacteria | 2775 |
| 94 | Ga0070659_100266313 | 3300005366 | Bacteria | 1423 |
| 95 | Ga0070659_100675240 | 3300005366 | Bacteria | 892 |
| 96 | Ga0070667_100014714 | 3300005367 | Bacteria | 6463 |
| 97 | Ga0070667_100094015 | 3300005367 | Bacteria | 2582 |
| 98 | Ga0070667_100201766 | 3300005367 | Bacteria | 1765 |
| 99 | Ga0070667_100394241 | 3300005367 | Bacteria | 1259 |
| 100 | Ga0070709_10001535 | 3300005434 | Bacteria | 12464 |
| 101 | Ga0070709_10071449 | 3300005434 | Bacteria | 2240 |
| 102 | Ga0070714_100014895 | 3300005435 | Bacteria | 6251 |
| 103 | Ga0070714_100226099 | 3300005435 | Bacteria | 1722 |
| 104 | Ga0070713_100000374 | 3300005436 | Bacteria | 28680 |
| 105 | Ga0070713_100026161 | 3300005436 | Bacteria | 4576 |
| 106 | Ga0070713_100320004 | 3300005436 | Bacteria | 1432 |
| 107 | Ga0070710_10015137 | 3300005437 | Bacteria | 3897 |
| 108 | Ga0070710_10024690 | 3300005437 | Bacteria | 3174 |
| 109 | Ga0070710_10064338 | 3300005437 | Bacteria | 2098 |
| 110 | Ga0070710_10110143 | 3300005437 | Bacteria | 1653 |
| 111 | Ga0070701_10052669 | 3300005438 | Bacteria | 2115 |
| 112 | Ga0070711_100050965 | 3300005439 | Bacteria | 2840 |
| 113 | Ga0070711_100194658 | 3300005439 | Bacteria | 1560 |
| 114 | Ga0070711_100239874 | 3300005439 | Bacteria | 1417 |
| 115 | Ga0070711_100291903 | 3300005439 | Bacteria | 1294 |
| 116 | Ga0070711_100741445 | 3300005439 | Bacteria | 829 |
| 117 | Ga0070705_100009385 | 3300005440 | Bacteria | 4863 |
| 118 | Ga0070705_100640258 | 3300005440 | Bacteria | 828 |
| 119 | Ga0070700_100017175 | 3300005441 | Bacteria | 4132 |
| 120 | Ga0070700_100035376 | 3300005441 | Bacteria | 3022 |
| 121 | Ga0070694_100004575 | 3300005444 | Bacteria | 8319 |
| 122 | Ga0070694_100008773 | 3300005444 | Bacteria | 6193 |
| 123 | Ga0070708_100155645 | 3300005445 | Bacteria | 2128 |
| 124 | Ga0070663_100011350 | 3300005455 | Bacteria | 5589 |
| 125 | Ga0070663_100085837 | 3300005455 | Bacteria | 2323 |
| 126 | Ga0070663_100270618 | 3300005455 | Bacteria | 1350 |
| 127 | Ga0070678_100000503 | 3300005456 | Bacteria | 18826 |
| 128 | Ga0070678_100001680 | 3300005456 | Bacteria | 11863 |
| 129 | Ga0070678_100216200 | 3300005456 | Bacteria | 1591 |
| 130 | Ga0070678_100446239 | 3300005456 | Bacteria | 1132 |
| 131 | Ga0070662_100012649 | 3300005457 | Bacteria | 5601 |
| 132 | Ga0070662_100034368 | 3300005457 | Bacteria | 3574 |
| 133 | Ga0070681_10020942 | 3300005458 | Bacteria | 6551 |
| 134 | Ga0070681_10100540 | 3300005458 | Bacteria | 2838 |
| 135 | Ga0070681_10174186 | 3300005458 | Bacteria | 2073 |
| 136 | Ga0070681_10392608 | 3300005458 | Bacteria | 1298 |
| 137 | Ga0068867_100004320 | 3300005459 | Bacteria | 10002 |
| 138 | Ga0068867_100065850 | 3300005459 | Bacteria | 2698 |
| 139 | Ga0070685_10006222 | 3300005466 | Bacteria | 6077 |
| 140 | Ga0070685_10020618 | 3300005466 | Bacteria | 3568 |
| 141 | Ga0070685_10029468 | 3300005466 | Bacteria | 3049 |
| 142 | Ga0070685_10163620 | 3300005466 | Bacteria | 1420 |
| 143 | Ga0070706_100271121 | 3300005467 | Bacteria | 1584 |
| 144 | Ga0070707_100505169 | 3300005468 | Bacteria | 1171 |
| 145 | Ga0070679_100007143 | 3300005530 | Bacteria | 10423 |
| 146 | Ga0070679_100014295 | 3300005530 | Bacteria | 7623 |
| 147 | Ga0070679_100053017 | 3300005530 | Bacteria | 4037 |
| 148 | Ga0070679_100235287 | 3300005530 | Bacteria | 1791 |
| 149 | Ga0070684_100004467 | 3300005535 | Bacteria | 10651 |
| 150 | Ga0070684_100199471 | 3300005535 | Bacteria | 1822 |
| 151 | Ga0070684_100285342 | 3300005535 | Bacteria | 1513 |
| 152 | Ga0068853_100011959 | 3300005539 | Bacteria | 7059 |
| 153 | Ga0068853_100473732 | 3300005539 | Bacteria | 1180 |
| 154 | Ga0068853_100571116 | 3300005539 | Bacteria | 1072 |
| 155 | Ga0070672_100002662 | 3300005543 | Bacteria | 11415 |
| 156 | Ga0070672_100214152 | 3300005543 | Bacteria | 1614 |
| 157 | Ga0070686_100002499 | 3300005544 | Bacteria | 10126 |
| 158 | Ga0070686_100023040 | 3300005544 | Bacteria | 3717 |
| 159 | Ga0070686_100030270 | 3300005544 | Bacteria | 3300 |
| 160 | Ga0070695_100003125 | 3300005545 | Bacteria | 9645 |
| 161 | Ga0070695_100127682 | 3300005545 | Bacteria | 1748 |
| 162 | Ga0070696_100038605 | 3300005546 | Bacteria | 3296 |
| 163 | Ga0070696_100053093 | 3300005546 | Bacteria | 2820 |
| 164 | Ga0070696_100153041 | 3300005546 | Bacteria | 1694 |
| 165 | Ga0070693_100003325 | 3300005547 | Bacteria | 7473 |
| 166 | Ga0070665_100363486 | 3300005548 | Bacteria | 1453 |
| 167 | Ga0070704_100003203 | 3300005549 | Bacteria | 9359 |
| 168 | Ga0070704_100033298 | 3300005549 | Bacteria | 3482 |
| 169 | Ga0070704_100085808 | 3300005549 | Bacteria | 2331 |
| 170 | Ga0068855_100017732 | 3300005563 | Bacteria | 8558 |
| 171 | Ga0070664_100019380 | 3300005564 | Bacteria | 5598 |
| 172 | Ga0070664_100025896 | 3300005564 | Bacteria | 4863 |
| 173 | Ga0070664_100187454 | 3300005564 | Bacteria | 1842 |
| 174 | Ga0070664_100395732 | 3300005564 | Bacteria | 1263 |
| 175 | Ga0068857_100032591 | 3300005577 | Bacteria | 4607 |
| 176 | Ga0068857_100108984 | 3300005577 | Bacteria | 2488 |
| 177 | Ga0068854_100009551 | 3300005578 | Bacteria | 6260 |
| 178 | Ga0068854_100035574 | 3300005578 | Bacteria | 3486 |
| 179 | Ga0068854_100060065 | 3300005578 | Bacteria | 2749 |
| 180 | Ga0068856_100034493 | 3300005614 | Bacteria | 4956 |
| 181 | Ga0068856_100167253 | 3300005614 | Bacteria | 2210 |
| 182 | Ga0068856_100194395 | 3300005614 | Bacteria | 2043 |
| 183 | Ga0068856_100272371 | 3300005614 | Bacteria | 1709 |
| 184 | Ga0068856_100624041 | 3300005614 | Bacteria | 1099 |
| 185 | Ga0070702_100002390 | 3300005615 | Bacteria | 8081 |
| 186 | Ga0070702_100146256 | 3300005615 | Bacteria | 1511 |
| 187 | Ga0070702_100216923 | 3300005615 | Bacteria | 1277 |
| 188 | Ga0068852_100012478 | 3300005616 | Bacteria | 6454 |
| 189 | Ga0068859_100183126 | 3300005617 | Bacteria | 2178 |
| 190 | Ga0068859_100515679 | 3300005617 | Bacteria | 1290 |
| 191 | Ga0068864_100001890 | 3300005618 | Bacteria | 17197 |
| 192 | Ga0068864_100063892 | 3300005618 | Bacteria | 3191 |
| 193 | Ga0068864_100073542 | 3300005618 | Bacteria | 2980 |
| 194 | Ga0068866_10002069 | 3300005718 | Bacteria | 8344 |
| 195 | Ga0068866_10050636 | 3300005718 | Bacteria | 2110 |
| 196 | Ga0068866_10069103 | 3300005718 | Bacteria | 1860 |
| 197 | Ga0068861_100003757 | 3300005719 | Bacteria | 10129 |
| 198 | Ga0068861_100064738 | 3300005719 | Bacteria | 2814 |
| 199 | Ga0068861_100155202 | 3300005719 | Bacteria | 1882 |
| 200 | Ga0068851_10116079 | 3300005834 | Bacteria | 1434 |
| 201 | Ga0068870_10002328 | 3300005840 | Bacteria | 7899 |
| 202 | Ga0068870_10053927 | 3300005840 | Bacteria | 2137 |
| 203 | Ga0068863_100000965 | 3300005841 | Bacteria | 28914 |
| 204 | Ga0068858_100015531 | 3300005842 | Bacteria | 7161 |
| 205 | Ga0068858_100062000 | 3300005842 | Bacteria | 3457 |
| 206 | Ga0068858_100145878 | 3300005842 | Bacteria | 2223 |
| 207 | Ga0068858_100232547 | 3300005842 | Bacteria | 1748 |
| 208 | Ga0068858_100250532 | 3300005842 | Bacteria | 1682 |
| 209 | Ga0068860_100041173 | 3300005843 | Bacteria | 4412 |
| 210 | Ga0068860_100227129 | 3300005843 | Bacteria | 1814 |
| 211 | Ga0068860_100239981 | 3300005843 | Bacteria | 1763 |
| 212 | Ga0068862_100005484 | 3300005844 | Bacteria | 10603 |
| 213 | Ga0068862_100148364 | 3300005844 | Bacteria | 2086 |
| 214 | Ga0068862_100784011 | 3300005844 | Bacteria | 930 |
| 215 | Ga0081455_10000150 | 3300005937 | Bacteria | 83695 |
| 216 | Ga0081540_1000194 | 3300005983 | Bacteria | 62934 |
| 217 | Ga0081540_1090962 | 3300005983 | Bacteria | 1342 |
| 218 | Ga0081539_10001643 | 3300005985 | Bacteria | 36361 |
| 219 | Ga0070717_10000224 | 3300006028 | Bacteria | 39308 |
| 220 | Ga0070717_10049980 | 3300006028 | Bacteria | 3434 |
| 221 | Ga0075365_10039429 | 3300006038 | Bacteria | 3075 |
| 222 | Ga0075365_10270964 | 3300006038 | Bacteria | 1194 |
| 223 | Ga0075368_10050629 | 3300006042 | Bacteria | 1650 |
| 224 | Ga0075363_100030255 | 3300006048 | Bacteria | 2801 |
| 225 | Ga0075363_100180815 | 3300006048 | Bacteria | 1200 |
| 226 | Ga0075364_10099900 | 3300006051 | Bacteria | 1932 |
| 227 | Ga0070715_10000875 | 3300006163 | Bacteria | 8330 |
| 228 | Ga0070712_100017766 | 3300006175 | Bacteria | 4607 |
| 229 | Ga0070712_100218414 | 3300006175 | Bacteria | 1507 |
| 230 | Ga0070712_100225212 | 3300006175 | Bacteria | 1486 |
| 231 | Ga0075362_10020287 | 3300006177 | Bacteria | 2775 |
| 232 | Ga0075362_10030555 | 3300006177 | Bacteria | 2326 |
| 233 | Ga0075367_10082699 | 3300006178 | Bacteria | 1944 |
| 234 | Ga0075366_10019553 | 3300006195 | Bacteria | 3921 |
| 235 | Ga0075366_10166573 | 3300006195 | Bacteria | 1336 |
| 236 | Ga0075366_10174196 | 3300006195 | Bacteria | 1306 |
| 237 | Ga0097621_100000933 | 3300006237 | Bacteria | 20454 |
| 238 | Ga0097621_100053981 | 3300006237 | Bacteria | 3276 |
| 239 | Ga0097621_100352327 | 3300006237 | Bacteria | 1309 |
| 240 | Ga0075370_10040033 | 3300006353 | Bacteria | 2642 |
| 241 | Ga0068871_100003230 | 3300006358 | Bacteria | 11175 |
| 242 | Ga0068871_100016325 | 3300006358 | Bacteria | 5589 |
| 243 | Ga0068871_100266806 | 3300006358 | Bacteria | 1495 |
| 244 | Ga0075428_100002909 | 3300006844 | Bacteria | 18640 |
| 245 | Ga0075428_100075176 | 3300006844 | Bacteria | 3690 |
| 246 | Ga0075430_100057219 | 3300006846 | Bacteria | 3280 |
| 247 | Ga0075431_100000417 | 3300006847 | Bacteria | 34661 |
| 248 | Ga0075433_10006082 | 3300006852 | Bacteria | 9507 |
| 249 | Ga0075434_100027565 | 3300006871 | Bacteria | 5579 |
| 250 | Ga0075434_100052487 | 3300006871 | Bacteria | 4051 |
| 251 | Ga0075434_100071605 | 3300006871 | Bacteria | 3458 |
| 252 | Ga0075434_100187825 | 3300006871 | Bacteria | 2087 |
| 253 | Ga0068865_100005683 | 3300006881 | Bacteria | 7576 |
| 254 | Ga0068865_100022622 | 3300006881 | Bacteria | 4104 |
| 255 | Ga0068865_100037839 | 3300006881 | Bacteria | 3261 |
| 256 | Ga0075436_100062885 | 3300006914 | Bacteria | 2565 |
| 257 | Ga0097620_100183124 | 3300006931 | Bacteria | 2178 |
| 258 | Ga0097620_100515708 | 3300006931 | Bacteria | 1290 |
| 259 | Ga0075435_100113284 | 3300007076 | Bacteria | 2257 |
| 260 | Ga0075435_100175337 | 3300007076 | Bacteria | 1810 |
| 261 | Ga0099795_10111930 | 3300007788 | Bacteria | 1083 |
| 262 | Ga0105251_10027581 | 3300009011 | Bacteria | 2877 |
| 263 | Ga0105250_10035983 | 3300009092 | Bacteria | 1987 |
| 264 | Ga0105240_10081598 | 3300009093 | Bacteria | 3973 |
| 265 | Ga0105240_10440816 | 3300009093 | Bacteria | 1459 |
| 266 | Ga0111539_10004674 | 3300009094 | Bacteria | 17895 |
| 267 | Ga0111539_10019057 | 3300009094 | Bacteria | 8479 |
| 268 | Ga0111539_10019652 | 3300009094 | Bacteria | 8334 |
| 269 | Ga0111539_10042118 | 3300009094 | Bacteria | 5486 |
| 270 | Ga0111539_10140997 | 3300009094 | Bacteria | 2821 |
| 271 | Ga0111539_10342217 | 3300009094 | Bacteria | 1741 |
| 272 | Ga0105245_10001656 | 3300009098 | Bacteria | 20280 |
| 273 | Ga0105245_10003204 | 3300009098 | Bacteria | 14646 |
| 274 | Ga0105245_10018814 | 3300009098 | Bacteria | 6044 |
| 275 | Ga0105245_10173623 | 3300009098 | Bacteria | 2054 |
| 276 | Ga0105245_10390035 | 3300009098 | Bacteria | 1389 |
| 277 | Ga0105245_10432900 | 3300009098 | Bacteria | 1320 |
| 278 | Ga0105245_11176211 | 3300009098 | Bacteria | 814 |
| 279 | Ga0105247_10006703 | 3300009101 | Bacteria | 7109 |
| 280 | Ga0105247_10013200 | 3300009101 | Bacteria | 4956 |
| 281 | Ga0105247_10071388 | 3300009101 | Bacteria | 2171 |
| 282 | Ga0114129_10002339 | 3300009147 | Bacteria | 26307 |
| 283 | Ga0114129_10004632 | 3300009147 | Bacteria | 19409 |
| 284 | Ga0114129_10607056 | 3300009147 | Bacteria | 1417 |
| 285 | Ga0114129_10737055 | 3300009147 | Bacteria | 1263 |
| 286 | Ga0105243_10006896 | 3300009148 | Bacteria | 8756 |
| 287 | Ga0105243_10041478 | 3300009148 | Bacteria | 3599 |
| 288 | Ga0105243_10089067 | 3300009148 | Bacteria | 2536 |
| 289 | Ga0105243_10348234 | 3300009148 | Bacteria | 1359 |
| 290 | Ga0105243_10530169 | 3300009148 | Bacteria | 1121 |
| 291 | Ga0105241_10006513 | 3300009174 | Bacteria | 8608 |
| 292 | Ga0105241_10096828 | 3300009174 | Bacteria | 2338 |
| 293 | Ga0105241_10111580 | 3300009174 | Bacteria | 2189 |
| 294 | Ga0105241_10250746 | 3300009174 | Bacteria | 1501 |
| 295 | Ga0105242_10000350 | 3300009176 | Bacteria | 37047 |
| 296 | Ga0105242_10024355 | 3300009176 | Bacteria | 4780 |
| 297 | Ga0105248_10013825 | 3300009177 | Bacteria | 8882 |
| 298 | Ga0105248_10049645 | 3300009177 | Bacteria | 4706 |
| 299 | Ga0105248_10110720 | 3300009177 | Bacteria | 3096 |
| 300 | Ga0105248_10324662 | 3300009177 | Bacteria | 1734 |
| 301 | Ga0105248_10624242 | 3300009177 | Bacteria | 1216 |
| 302 | Ga0105237_10024953 | 3300009545 | Bacteria | 6115 |
| 303 | Ga0105238_10012148 | 3300009551 | Bacteria | 8679 |
| 304 | Ga0105238_10063703 | 3300009551 | Bacteria | 3687 |
| 305 | Ga0105238_10517614 | 3300009551 | Bacteria | 1195 |
| 306 | Ga0105249_10007727 | 3300009553 | Bacteria | 9372 |
| 307 | Ga0105249_10040055 | 3300009553 | Bacteria | 4255 |
| 308 | Ga0105249_10127719 | 3300009553 | Bacteria | 2423 |
| 309 | Ga0105249_10293227 | 3300009553 | Bacteria | 1629 |
| 310 | Ga0105249_10453682 | 3300009553 | Bacteria | 1321 |
| 311 | Ga0105239_10015881 | 3300010375 | Bacteria | 8335 |
| 312 | Ga0105246_10002609 | 3300011119 | Bacteria | 10906 |
| 313 | Ga0105246_10037341 | 3300011119 | Bacteria | 3260 |
| 314 | Ga0105246_10510944 | 3300011119 | Bacteria | 1022 |
| 315 | Ga0157335_1002447 | 3300012492 | Bacteria | 1121 |
| 316 | Ga0157345_1004463 | 3300012498 | Bacteria | 1052 |
| 317 | Ga0157338_1000333 | 3300012515 | Bacteria | 2602 |
| 318 | Ga0157373_10016816 | 3300013100 | Bacteria | 5333 |
| 319 | Ga0157373_10115290 | 3300013100 | Bacteria | 1889 |
| 320 | Ga0157373_10173329 | 3300013100 | Bacteria | 1518 |
| 321 | Ga0157371_10007888 | 3300013102 | Bacteria | 8546 |
| 322 | Ga0157369_10152465 | 3300013105 | Bacteria | 2442 |
| 323 | Ga0157374_10012338 | 3300013296 | Bacteria | 7434 |
| 324 | Ga0157374_10148011 | 3300013296 | Bacteria | 2282 |
| 325 | Ga0157374_10347370 | 3300013296 | Bacteria | 1474 |
| 326 | Ga0157378_10017794 | 3300013297 | Bacteria | 6239 |
| 327 | Ga0157378_10160074 | 3300013297 | Bacteria | 2105 |
| 328 | Ga0157378_10630667 | 3300013297 | Bacteria | 1086 |
| 329 | Ga0163162_10031946 | 3300013306 | Bacteria | 5225 |
| 330 | Ga0163162_10064226 | 3300013306 | Bacteria | 3716 |
| 331 | Ga0163162_10172900 | 3300013306 | Bacteria | 2285 |
| 332 | Ga0163162_10505145 | 3300013306 | Bacteria | 1339 |
| 333 | Ga0163162_10564149 | 3300013306 | Bacteria | 1266 |
| 334 | Ga0157372_10030590 | 3300013307 | Bacteria | 5891 |
| 335 | Ga0157372_10188680 | 3300013307 | Bacteria | 2387 |
| 336 | Ga0157375_10009132 | 3300013308 | Bacteria | 8687 |
| 337 | Ga0157375_10533886 | 3300013308 | Bacteria | 1336 |
| 338 | Ga0157375_11072232 | 3300013308 | Bacteria | 942 |
| 339 | Ga0163163_10019655 | 3300014325 | Bacteria | 6346 |
| 340 | Ga0163163_10304924 | 3300014325 | Bacteria | 1645 |
| 341 | Ga0163163_10592532 | 3300014325 | Bacteria | 1172 |
| 342 | Ga0163163_10703381 | 3300014325 | Bacteria | 1074 |
| 343 | Ga0157380_10002593 | 3300014326 | Bacteria | 12218 |
| 344 | Ga0157377_10002234 | 3300014745 | Bacteria | 8508 |
| 345 | Ga0157379_10021452 | 3300014968 | Bacteria | 5718 |
| 346 | Ga0157379_10117763 | 3300014968 | Bacteria | 2389 |
| 347 | Ga0157379_10589917 | 3300014968 | Bacteria | 1036 |
| 348 | Ga0157376_10000663 | 3300014969 | Bacteria | 22264 |
| 349 | Ga0157376_10215687 | 3300014969 | Bacteria | 1774 |
| 350 | Ga0157376_10318892 | 3300014969 | Bacteria | 1477 |
| 351 | Ga0163161_10005222 | 3300017792 | Bacteria | 9036 |
| 352 | Ga0163161_10098739 | 3300017792 | Bacteria | 2171 |
| 353 | Ga0213876_10019512 | 3300021384 | Bacteria | 3582 |
| 354 | Ga0213876_10042765 | 3300021384 | Bacteria | 2394 |
| 355 | Ga0213875_10000023 | 3300021388 | Bacteria | 213455 |
| 356 | Ga0207666_1000137 | 3300025271 | Bacteria | 11385 |
| 357 | Ga0207666_1000707 | 3300025271 | Bacteria | 4003 |
| 358 | Ga0207673_1000157 | 3300025290 | Bacteria | 6690 |
| 359 | Ga0209758_1000566 | 3300025297 | Bacteria | 58298 |
| 360 | Ga0207697_10005981 | 3300025315 | Bacteria | 5574 |
| 361 | Ga0207697_10005996 | 3300025315 | Bacteria | 5565 |
| 362 | Ga0207713_1026153 | 3300025735 | Bacteria | 2680 |
| 363 | Ga0207653_10004160 | 3300025885 | Bacteria | 4550 |
| 364 | Ga0207682_10000043 | 3300025893 | Bacteria | 52108 |
| 365 | Ga0207682_10139651 | 3300025893 | Bacteria | 1087 |
| 366 | Ga0207692_10006390 | 3300025898 | Bacteria | 4778 |
| 367 | Ga0207692_10103923 | 3300025898 | Bacteria | 1565 |
| 368 | Ga0207710_10008544 | 3300025900 | Bacteria | 4318 |
| 369 | Ga0207710_10009164 | 3300025900 | Bacteria | 4164 |
| 370 | Ga0207710_10039774 | 3300025900 | Bacteria | 2082 |
| 371 | Ga0207688_10000162 | 3300025901 | Bacteria | 29107 |
| 372 | Ga0207688_10064701 | 3300025901 | Bacteria | 2065 |
| 373 | Ga0207680_10039488 | 3300025903 | Bacteria | 2739 |
| 374 | Ga0207680_10053569 | 3300025903 | Bacteria | 2423 |
| 375 | Ga0207647_10001692 | 3300025904 | Bacteria | 17014 |
| 376 | Ga0207685_10000826 | 3300025905 | Bacteria | 5759 |
| 377 | Ga0207699_10007186 | 3300025906 | Bacteria | 5435 |
| 378 | Ga0207699_10015725 | 3300025906 | Bacteria | 3938 |
| 379 | Ga0207699_10086121 | 3300025906 | Bacteria | 1961 |
| 380 | Ga0207645_10000899 | 3300025907 | Bacteria | 24667 |
| 381 | Ga0207645_10038802 | 3300025907 | Bacteria | 3053 |
| 382 | Ga0207645_10041949 | 3300025907 | Bacteria | 2928 |
| 383 | Ga0207643_10000128 | 3300025908 | Bacteria | 51191 |
| 384 | Ga0207643_10062409 | 3300025908 | Bacteria | 2130 |
| 385 | Ga0207654_10006844 | 3300025911 | Bacteria | 5738 |
| 386 | Ga0207654_10013931 | 3300025911 | Bacteria | 4144 |
| 387 | Ga0207654_10100289 | 3300025911 | Bacteria | 1783 |
| 388 | Ga0207707_10004166 | 3300025912 | Bacteria | 12809 |
| 389 | Ga0207707_10032397 | 3300025912 | Bacteria | 4574 |
| 390 | Ga0207707_10122634 | 3300025912 | Bacteria | 2273 |
| 391 | Ga0207707_10148070 | 3300025912 | Bacteria | 2052 |
| 392 | Ga0207695_10369083 | 3300025913 | Bacteria | 1321 |
| 393 | Ga0207693_10025205 | 3300025915 | Bacteria | 4716 |
| 394 | Ga0207693_10027123 | 3300025915 | Bacteria | 4529 |
| 395 | Ga0207693_10176062 | 3300025915 | Bacteria | 1683 |
| 396 | Ga0207693_10188366 | 3300025915 | Bacteria | 1624 |
| 397 | Ga0207663_10118644 | 3300025916 | Bacteria | 1807 |
| 398 | Ga0207663_10171449 | 3300025916 | Bacteria | 1542 |
| 399 | Ga0207663_10210863 | 3300025916 | Bacteria | 1408 |
| 400 | Ga0207660_10011570 | 3300025917 | Bacteria | 5749 |
| 401 | Ga0207660_10020123 | 3300025917 | Bacteria | 4475 |
| 402 | Ga0207662_10004338 | 3300025918 | Bacteria | 7450 |
| 403 | Ga0207662_10067417 | 3300025918 | Bacteria | 2158 |
| 404 | Ga0207662_10103919 | 3300025918 | Bacteria | 1763 |
| 405 | Ga0207662_10207467 | 3300025918 | Bacteria | 1271 |
| 406 | Ga0207657_10011210 | 3300025919 | Bacteria | 8913 |
| 407 | Ga0207657_10015174 | 3300025919 | Bacteria | 7479 |
| 408 | Ga0207657_10249673 | 3300025919 | Bacteria | 1415 |
| 409 | Ga0207649_10002424 | 3300025920 | Bacteria | 10439 |
| 410 | Ga0207649_10015848 | 3300025920 | Bacteria | 4237 |
| 411 | Ga0207652_10068036 | 3300025921 | Bacteria | 3089 |
| 412 | Ga0207652_10182137 | 3300025921 | Bacteria | 1888 |
| 413 | Ga0207652_10297098 | 3300025921 | Bacteria | 1458 |
| 414 | Ga0207652_10556093 | 3300025921 | Bacteria | 1031 |
| 415 | Ga0207646_10312980 | 3300025922 | Bacteria | 1419 |
| 416 | Ga0207681_10017442 | 3300025923 | Bacteria | 4507 |
| 417 | Ga0207681_10144989 | 3300025923 | Bacteria | 1773 |
| 418 | Ga0207681_10661374 | 3300025923 | Bacteria | 867 |
| 419 | Ga0207694_10028568 | 3300025924 | Bacteria | 4252 |
| 420 | Ga0207694_10138520 | 3300025924 | Bacteria | 1956 |
| 421 | Ga0207650_10031811 | 3300025925 | Bacteria | 3813 |
| 422 | Ga0207659_10030342 | 3300025926 | Bacteria | 3693 |
| 423 | Ga0207659_10100751 | 3300025926 | Bacteria | 2177 |
| 424 | Ga0207659_10441642 | 3300025926 | Bacteria | 1094 |
| 425 | Ga0207659_10501877 | 3300025926 | Bacteria | 1027 |
| 426 | Ga0207687_10000522 | 3300025927 | Bacteria | 25753 |
| 427 | Ga0207687_10009438 | 3300025927 | Bacteria | 6382 |
| 428 | Ga0207687_10066634 | 3300025927 | Bacteria | 2560 |
| 429 | Ga0207687_10157239 | 3300025927 | Bacteria | 1740 |
| 430 | Ga0207687_10236741 | 3300025927 | Bacteria | 1445 |
| 431 | Ga0207700_10013954 | 3300025928 | Bacteria | 5251 |
| 432 | Ga0207664_10034479 | 3300025929 | Bacteria | 3898 |
| 433 | Ga0207664_10144501 | 3300025929 | Bacteria | 2016 |
| 434 | Ga0207664_10275377 | 3300025929 | Bacteria | 1475 |
| 435 | Ga0207664_10289504 | 3300025929 | Bacteria | 1439 |
| 436 | Ga0207644_10000611 | 3300025931 | Bacteria | 22735 |
| 437 | Ga0207644_10047844 | 3300025931 | Bacteria | 3054 |
| 438 | Ga0207644_10101273 | 3300025931 | Bacteria | 2164 |
| 439 | Ga0207644_10511475 | 3300025931 | Bacteria | 991 |
| 440 | Ga0207690_10003223 | 3300025932 | Bacteria | 9794 |
| 441 | Ga0207706_10010796 | 3300025933 | Bacteria | 8335 |
| 442 | Ga0207706_10035483 | 3300025933 | Bacteria | 4433 |
| 443 | Ga0207706_10077610 | 3300025933 | Bacteria | 2921 |
| 444 | Ga0207706_10354978 | 3300025933 | Bacteria | 1274 |
| 445 | Ga0207686_10003172 | 3300025934 | Bacteria | 8849 |
| 446 | Ga0207686_10022617 | 3300025934 | Bacteria | 3622 |
| 447 | Ga0207686_10181402 | 3300025934 | Bacteria | 1493 |
| 448 | Ga0207709_10001270 | 3300025935 | Bacteria | 18052 |
| 449 | Ga0207709_10069997 | 3300025935 | Bacteria | 2223 |
| 450 | Ga0207670_10000631 | 3300025936 | Bacteria | 18876 |
| 451 | Ga0207670_10008282 | 3300025936 | Bacteria | 5861 |
| 452 | Ga0207670_10011017 | 3300025936 | Bacteria | 5230 |
| 453 | Ga0207670_10556630 | 3300025936 | Bacteria | 938 |
| 454 | Ga0207669_10000797 | 3300025937 | Bacteria | 13482 |
| 455 | Ga0207669_10015672 | 3300025937 | Bacteria | 3829 |
| 456 | Ga0207669_10097054 | 3300025937 | Bacteria | 1937 |
| 457 | Ga0207704_10007276 | 3300025938 | Bacteria | 5217 |
| 458 | Ga0207704_10046381 | 3300025938 | Bacteria | 2590 |
| 459 | Ga0207704_10129434 | 3300025938 | Bacteria | 1745 |
| 460 | Ga0207665_10008424 | 3300025939 | Bacteria | 6797 |
| 461 | Ga0207665_10087241 | 3300025939 | Bacteria | 2157 |
| 462 | Ga0207665_10121854 | 3300025939 | Bacteria | 1843 |
| 463 | Ga0207691_10008026 | 3300025940 | Bacteria | 10147 |
| 464 | Ga0207691_10071292 | 3300025940 | Bacteria | 3136 |
| 465 | Ga0207691_10343936 | 3300025940 | Bacteria | 1277 |
| 466 | Ga0207711_10040416 | 3300025941 | Bacteria | 3968 |
| 467 | Ga0207711_10370080 | 3300025941 | Bacteria | 1329 |
| 468 | Ga0207689_10000165 | 3300025942 | Bacteria | 57494 |
| 469 | Ga0207689_10060237 | 3300025942 | Bacteria | 3121 |
| 470 | Ga0207689_10187368 | 3300025942 | Bacteria | 1706 |
| 471 | Ga0207661_10004909 | 3300025944 | Bacteria | 9371 |
| 472 | Ga0207679_10000112 | 3300025945 | Bacteria | 65716 |
| 473 | Ga0207679_10147957 | 3300025945 | Bacteria | 1908 |
| 474 | Ga0207679_10211040 | 3300025945 | Bacteria | 1628 |
| 475 | Ga0207667_10056264 | 3300025949 | Bacteria | 4132 |
| 476 | Ga0207651_10018034 | 3300025960 | Bacteria | 4188 |
| 477 | Ga0207651_10094868 | 3300025960 | Bacteria | 2195 |
| 478 | Ga0207651_10141887 | 3300025960 | Bacteria | 1857 |
| 479 | Ga0207651_10394283 | 3300025960 | Bacteria | 1176 |
| 480 | Ga0207712_10004163 | 3300025961 | Bacteria | 9135 |
| 481 | Ga0207712_10104441 | 3300025961 | Bacteria | 2112 |
| 482 | Ga0207712_10156743 | 3300025961 | Bacteria | 1765 |
| 483 | Ga0207668_10001083 | 3300025972 | Bacteria | 16234 |
| 484 | Ga0207668_10266591 | 3300025972 | Bacteria | 1398 |
| 485 | Ga0207668_10445086 | 3300025972 | Bacteria | 1104 |
| 486 | Ga0207640_10000382 | 3300025981 | Bacteria | 28458 |
| 487 | Ga0207640_10134193 | 3300025981 | Bacteria | 1794 |
| 488 | Ga0207658_10017898 | 3300025986 | Bacteria | 4884 |
| 489 | Ga0207658_10056408 | 3300025986 | Bacteria | 2915 |
| 490 | Ga0207658_10446609 | 3300025986 | Bacteria | 1144 |
| 491 | Ga0207658_10476500 | 3300025986 | Bacteria | 1108 |
| 492 | Ga0207677_10018249 | 3300026023 | Bacteria | 4207 |
| 493 | Ga0207677_10132356 | 3300026023 | Bacteria | 1896 |
| 494 | Ga0207703_10027237 | 3300026035 | Bacteria | 4500 |
| 495 | Ga0207703_10075133 | 3300026035 | Bacteria | 2800 |
| 496 | Ga0207703_10096507 | 3300026035 | Bacteria | 2496 |
| 497 | Ga0207703_10334789 | 3300026035 | Bacteria | 1389 |
| 498 | Ga0207703_10401314 | 3300026035 | Bacteria | 1272 |
| 499 | Ga0207703_10690492 | 3300026035 | Bacteria | 970 |
| 500 | Ga0207639_10025940 | 3300026041 | Bacteria | 4254 |
| 501 | Ga0207678_10003507 | 3300026067 | Bacteria | 14107 |
| 502 | Ga0207678_10010035 | 3300026067 | Bacteria | 8311 |
| 503 | Ga0207678_10022143 | 3300026067 | Bacteria | 5568 |
| 504 | Ga0207708_10016432 | 3300026075 | Bacteria | 5565 |
| 505 | Ga0207708_10028647 | 3300026075 | Bacteria | 4217 |
| 506 | Ga0207708_10194657 | 3300026075 | Bacteria | 1615 |
| 507 | Ga0207708_10573370 | 3300026075 | Bacteria | 954 |
| 508 | Ga0207702_10129725 | 3300026078 | Bacteria | 2267 |
| 509 | Ga0207641_10001777 | 3300026088 | Bacteria | 20763 |
| 510 | Ga0207648_10013960 | 3300026089 | Bacteria | 7447 |
| 511 | Ga0207648_10105676 | 3300026089 | Bacteria | 2470 |
| 512 | Ga0207648_10165333 | 3300026089 | Bacteria | 1955 |
| 513 | Ga0207676_10000494 | 3300026095 | Bacteria | 33145 |
| 514 | Ga0207676_10064465 | 3300026095 | Bacteria | 2914 |
| 515 | Ga0207676_10702111 | 3300026095 | Bacteria | 980 |
| 516 | Ga0207674_10031526 | 3300026116 | Bacteria | 5568 |
| 517 | Ga0207674_10035553 | 3300026116 | Bacteria | 5199 |
| 518 | Ga0207675_100024932 | 3300026118 | Bacteria | 5565 |
| 519 | Ga0207675_100039290 | 3300026118 | Bacteria | 4417 |
| 520 | Ga0207675_100092415 | 3300026118 | Bacteria | 2846 |
| 521 | Ga0207675_100383792 | 3300026118 | Bacteria | 1382 |
| 522 | Ga0207683_10001272 | 3300026121 | Bacteria | 22830 |
| 523 | Ga0207683_10004940 | 3300026121 | Bacteria | 11469 |
| 524 | Ga0207683_10007540 | 3300026121 | Bacteria | 9324 |
| 525 | Ga0207683_10272258 | 3300026121 | Bacteria | 1547 |
| 526 | Ga0207698_10004416 | 3300026142 | Bacteria | 8568 |
| 527 | Ga0207698_10442937 | 3300026142 | Bacteria | 1252 |
| 528 | Ga0209996_1006884 | 3300027395 | Bacteria | 1476 |
| 529 | Ga0210002_1001447 | 3300027617 | Bacteria | 3348 |
| 530 | Ga0209983_1008271 | 3300027665 | Bacteria | 2127 |
| 531 | Ga0209588_1063612 | 3300027671 | Bacteria | 1192 |
| 532 | Ga0209966_1002370 | 3300027695 | Bacteria | 3138 |
| 533 | Ga0209998_10001523 | 3300027717 | Bacteria | 5574 |
| 534 | Ga0209998_10001929 | 3300027717 | Bacteria | 4879 |
| 535 | Ga0209974_10004333 | 3300027876 | Bacteria | 5046 |
| 536 | Ga0209974_10109708 | 3300027876 | Bacteria | 970 |
| 537 | Ga0207428_10000064 | 3300027907 | Bacteria | 151185 |
| 538 | Ga0207428_10003786 | 3300027907 | Bacteria | 14512 |
| 539 | Ga0207428_10034470 | 3300027907 | Bacteria | 4147 |
| 540 | Ga0207428_10189633 | 3300027907 | Bacteria | 1550 |
| 541 | Ga0207428_10275307 | 3300027907 | Bacteria | 1250 |
| 542 | Ga0268266_10018410 | 3300028379 | Bacteria | 5952 |
| 543 | Ga0268265_10001549 | 3300028380 | Bacteria | 19094 |
| 544 | Ga0268265_10186109 | 3300028380 | Bacteria | 1789 |
| 545 | Ga0268265_10199557 | 3300028380 | Bacteria | 1734 |
| 546 | Ga0268265_10320851 | 3300028380 | Bacteria | 1403 |
| 547 | Ga0268264_10004661 | 3300028381 | Bacteria | 11653 |
| 548 | Ga0268264_10219598 | 3300028381 | Bacteria | 1749 |
| 549 | Ga0268264_10315037 | 3300028381 | Bacteria | 1477 |
| 550 | Ga0268264_10803016 | 3300028381 | Bacteria | 940 |
| 551 | Ga0265337_1017384 | 3300028556 | Bacteria | 2306 |
| 552 | Ga0265325_10000006 | 3300031241 | Bacteria | 255758 |
| 553 | Ga0265325_10000252 | 3300031241 | Bacteria | 38198 |
| 554 | Ga0265316_10294747 | 3300031344 | Bacteria | 1183 |
| 555 | Ga0307513_10172432 | 3300031456 | Bacteria | 2039 |
| 556 | Ga0265313_10032639 | 3300031595 | Bacteria | 2655 |
| 557 | Ga0316579_10013487 | 3300031691 | Bacteria | 3515 |
| 558 | Ga0265342_10019058 | 3300031712 | Bacteria | 4429 |
| 559 | Ga0307412_10446746 | 3300031911 | Bacteria | 1064 |
| 560 | Ga0373948_0000698 | 3300034817 | Bacteria | 4362 |
| 561 | Ga0373950_0000757 | 3300034818 | Bacteria | 4025 |
| 562 | Ga0373958_0005082 | 3300034819 | Bacteria | 1980 |
| 563 | Ga0373938_0006960 | 3300034957 | Bacteria | 1975 |
| 564 | Ga0373938_0008876 | 3300034957 | Bacteria | 1806 |
| 565 | Ga0373938_0013494 | 3300034957 | Bacteria | 1551 |
| 566 | Ga0373926_0028132 | 3300035083 | Bacteria | 1972 |
| 567 | Ga0373926_0038715 | 3300035083 | Bacteria | 1699 |
| 568 | Ga0373928_0002965 | 3300035084 | Bacteria | 3273 |
| 569 | Ga0373928_0004781 | 3300035084 | Bacteria | 2583 |
| 570 | Ga0373928_0006581 | 3300035084 | Bacteria | 2234 |
| 571 | Ga0373929_0002903 | 3300035085 | Bacteria | 3128 |
| 572 | Ga0373929_0012768 | 3300035085 | Bacteria | 1601 |
| 573 | Ga0373940_0006426 | 3300035088 | Bacteria | 2605 |
| 574 | Ga0373940_0016817 | 3300035088 | Bacteria | 1816 |
| 575 | Ga0373944_0038564 | 3300035089 | Bacteria | 1467 |
| 576 | Ga0373949_0001309 | 3300035090 | Bacteria | 7201 |
| 577 | Ga0373949_0005175 | 3300035090 | Bacteria | 2926 |
| 578 | Ga0373949_0005768 | 3300035090 | Bacteria | 2755 |
| 579 | Ga0373951_0001012 | 3300035091 | Bacteria | 7564 |
| 580 | Ga0373951_0001653 | 3300035091 | Bacteria | 5847 |
| 581 | Ga0373952_0000401 | 3300035092 | Bacteria | 7420 |
| 582 | Ga0373952_0002793 | 3300035092 | Bacteria | 3157 |
| 583 | Ga0373952_0006356 | 3300035092 | Bacteria | 2180 |
| 584 | Ga0373923_0163210 | 3300035111 | Bacteria | 1017 |
| 585 | Ga0373932_0002484 | 3300035112 | Bacteria | 4646 |
| 586 | Ga0373932_0008055 | 3300035112 | Bacteria | 2515 |
| 587 | Ga0373932_0018775 | 3300035112 | Bacteria | 1793 |
| 588 | Ga0373936_0123129 | 3300035113 | Bacteria | 1109 |
| 589 | Ga0373939_0002908 | 3300035114 | Bacteria | 4023 |
| 590 | Ga0373939_0024704 | 3300035114 | Bacteria | 1676 |
| 591 | Ga0373939_0027565 | 3300035114 | Bacteria | 1610 |
| 592 | Ga0373939_0066381 | 3300035114 | Bacteria | 1163 |
| 593 | Ga0373939_0083288 | 3300035114 | Bacteria | 1067 |
| 594 | Ga0373941_0000504 | 3300035115 | Bacteria | 7789 |
| 595 | Ga0373941_0014277 | 3300035115 | Bacteria | 2117 |
| 596 | Ga0373953_0006578 | 3300035117 | Bacteria | 3839 |
| 597 | Ga0373953_0035448 | 3300035117 | Bacteria | 1961 |
| 598 | Ga0373954_0002902 | 3300035118 | Bacteria | 7229 |
| 599 | Ga0373954_0004502 | 3300035118 | Bacteria | 5993 |
| 600 | Ga0373956_0005198 | 3300035119 | Bacteria | 5210 |
| 601 | Ga0373956_0005225 | 3300035119 | Bacteria | 5201 |
| 602 | Ga0373956_0032976 | 3300035119 | Bacteria | 2275 |
| 603 | Ga0373956_0043729 | 3300035119 | Bacteria | 1995 |
| 604 | Ga0373957_0000543 | 3300035120 | Bacteria | 9552 |
| 605 | Ga0373943_0001305 | 3300035170 | Bacteria | 11190 |
| 606 | Ga0373943_0159285 | 3300035170 | Bacteria | 1228 |
| 607 | Ga0373946_0016248 | 3300035171 | Bacteria | 2833 |
| 608 | Ga0373946_0134740 | 3300035171 | Bacteria | 1140 |
| 609 | Ga0373946_0206280 | 3300035171 | Bacteria | 943 |
| 610 | Ga0373955_0002625 | 3300035172 | Bacteria | 7867 |
| 611 | Ga0373955_0014757 | 3300035172 | Bacteria | 3810 |
| 612 | Ga0373955_0028939 | 3300035172 | Bacteria | 2877 |
| 613 | Ga0373942_0004233 | 3300035207 | Bacteria | 3340 |
| 614 | Ga0373961_0003997 | 3300035241 | Bacteria | 3594 |
| 615 | Ga0373961_0072745 | 3300035241 | Bacteria | 1066 |
| 616 | Ga0373962_0002408 | 3300035242 | Bacteria | 4451 |
| 617 | Ga0373962_0003465 | 3300035242 | Bacteria | 3790 |
| 618 | Ga0373962_0028155 | 3300035242 | Bacteria | 1523 |
| 619 | Ga0373962_0079186 | 3300035242 | Bacteria | 995 |
| 620 | Ga0373924_0026611 | 3300035410 | Bacteria | 2295 |
| 621 | Ga0373931_0001286 | 3300035691 | Bacteria | 10727 |
| 622 | Ga0373931_0008271 | 3300035691 | Bacteria | 4929 |
| 623 | Ga0373931_0043717 | 3300035691 | Bacteria | 2360 |
| 624 | Ga0373931_0103800 | 3300035691 | Bacteria | 1603 |
| 625 | Ga0373935_0003279 | 3300035692 | Bacteria | 9359 |
| 626 | Ga0373935_0009562 | 3300035692 | Bacteria | 5803 |
| 627 | Ga0373927_0015396 | 3300035695 | Bacteria | 5054 |
| 628 | Ga0373927_0186071 | 3300035695 | Bacteria | 1362 |
| 629 | Ga0373927_0205481 | 3300035695 | Bacteria | 1293 |
| 630 | Ga0373933_0004530 | 3300035724 | Bacteria | 7622 |
| 631 | Ga0373933_0167136 | 3300035724 | Bacteria | 1399 |
| 632 | Ga0373947_0047816 | 3300035725 | Bacteria | 2565 |
| 633 | Ga0373947_0054703 | 3300035725 | Bacteria | 2409 |
| 634 | Ga0373947_0126893 | 3300035725 | Bacteria | 1625 |
| 635 | Ga0373947_0167699 | 3300035725 | Bacteria | 1423 |
| 636 | Ga0373937_0001302 | 3300036401 | Bacteria | 20904 |
| 637 | Ga0373937_0002947 | 3300036401 | Bacteria | 14245 |
| 638 | Ga0373937_0014182 | 3300036401 | Bacteria | 7030 |
| 639 | Ga0373937_0039323 | 3300036401 | Bacteria | 4311 |
| 640 | Ga0373937_0040918 | 3300036401 | Bacteria | 4226 |
| 641 | Ga0373937_0240745 | 3300036401 | Bacteria | 1705 |
| 642 | Ga0373937_0328218 | 3300036401 | Bacteria | 1448 |
| 643 | Ga0373937_0783496 | 3300036401 | Bacteria | 901 |
| 644 | Ga0373925_0043026 | 3300037068 | Bacteria | 3351 |
| 645 | Ga0373925_0248806 | 3300037068 | Bacteria | 1425 |
| 646 | Ga0436364_0024145 | 3300037853 | Bacteria | 1838 |
| 647 | Ga0436364_1042090 | 3300037853 | Bacteria | 19013 |
| 648 | Ga0436364_1078356 | 3300037853 | Bacteria | 1276 |
| 649 | Ga0436365_0719053 | 3300039437 | Bacteria | 4848 |
| 650 | Ga0436365_0725763 | 3300039437 | Bacteria | 2244 |
| 651 | Ga0436365_1188741 | 3300039437 | Bacteria | 6858 |
| 652 | Ga0436365_1227929 | 3300039437 | Bacteria | 4335 |
| 653 | Ga0436360_1007413 | 3300039438 | Bacteria | 1565 |
| 654 | Ga0436363_0375711 | 3300039450 | Bacteria | 1085 |
| 655 | Ga0436362_0896511 | 3300039453 | Bacteria | 1124 |
| 656 | Ga0439453_0002674 | 3300041408 | Bacteria | 2483 |
| 657 | Ga0439453_0003546 | 3300041408 | Bacteria | 2252 |
| 658 | Ga0451853_4050201 | 3300041512 | Bacteria | 1102 |
| 659 | Ga0439443_001472 | 3300042003 | Bacteria | 2606 |
| 660 | Ga0439455_0012765 | 3300042012 | Bacteria | 1892 |
| 661 | Ga0439444_0017706 | 3300042437 | Bacteria | 1226 |
| 662 | Ga0439464_0066223 | 3300042439 | Bacteria | 1063 |
| 663 | Ga0439460_0036376 | 3300042461 | Bacteria | 1428 |
| 664 | Ga0451577_0174013 | 3300042876 | Bacteria | 1940 |
| 665 | Ga0439440_0024267 | 3300042993 | Bacteria | 1389 |
| 666 | Ga0466967_0297481 | 3300045976 | Bacteria | 1552 |
| 667 | Ga0495592_0005759 | 3300046454 | Bacteria | 9175 |
| 668 | Ga0495592_0018759 | 3300046454 | Bacteria | 5266 |
| 669 | Ga0495592_0181710 | 3300046454 | Bacteria | 1432 |
| 670 | Ga0495603_0021766 | 3300046455 | Bacteria | 3882 |
| 671 | Ga0495629_0000253 | 3300046459 | Bacteria | 46595 |
| 672 | Ga0495629_0077225 | 3300046459 | Bacteria | 2324 |
| 673 | Ga0495629_0105459 | 3300046459 | Bacteria | 1966 |
| 674 | Ga0495638_0023879 | 3300046460 | Bacteria | 3993 |
| 675 | Ga0495638_0129888 | 3300046460 | Bacteria | 1481 |
| 676 | Ga0495651_0014216 | 3300046462 | Bacteria | 6153 |
| 677 | Ga0495651_0015195 | 3300046462 | Bacteria | 5950 |
| 678 | Ga0495651_0040620 | 3300046462 | Bacteria | 3617 |
| 679 | Ga0495651_0110841 | 3300046462 | Bacteria | 2029 |
| 680 | Ga0495653_0017400 | 3300046463 | Bacteria | 5846 |
| 681 | Ga0495653_0162831 | 3300046463 | Bacteria | 1547 |
| 682 | Ga0495653_0170534 | 3300046463 | Bacteria | 1502 |
| 683 | Ga0495653_0282822 | 3300046463 | Bacteria | 1088 |
| 684 | Ga0495650_0042409 | 3300046471 | Bacteria | 1937 |
| 685 | Ga0495580_0047078 | 3300046472 | Bacteria | 3058 |
| 686 | Ga0495580_0060832 | 3300046472 | Bacteria | 2653 |
| 687 | Ga0495580_0410648 | 3300046472 | Bacteria | 912 |
| 688 | Ga0495582_0041140 | 3300046473 | Bacteria | 2546 |
| 689 | Ga0495639_0005636 | 3300046475 | Bacteria | 5386 |
| 690 | Ga0495639_0013858 | 3300046475 | Bacteria | 3485 |
| 691 | Ga0495639_0063459 | 3300046475 | Bacteria | 1696 |
| 692 | Ga0495662_0008670 | 3300046476 | Bacteria | 4999 |
| 693 | Ga0495664_0073000 | 3300046477 | Bacteria | 2051 |
| 694 | Ga0495664_0195838 | 3300046477 | Bacteria | 1225 |
| 695 | Ga0495584_0061045 | 3300046491 | Bacteria | 1895 |
| 696 | Ga0495585_0007151 | 3300046492 | Bacteria | 6855 |
| 697 | Ga0495594_0002753 | 3300046499 | Bacteria | 9125 |
| 698 | Ga0495594_0041096 | 3300046499 | Bacteria | 2532 |
| 699 | Ga0495607_0026487 | 3300046501 | Bacteria | 3597 |
| 700 | Ga0495608_0001048 | 3300046511 | Bacteria | 19467 |
| 701 | Ga0495608_0043899 | 3300046511 | Bacteria | 2986 |
| 702 | Ga0495618_0029595 | 3300046514 | Bacteria | 3417 |
| 703 | Ga0495628_0002572 | 3300046516 | Bacteria | 16332 |
| 704 | Ga0495628_0099872 | 3300046516 | Bacteria | 2240 |
| 705 | Ga0495630_0017093 | 3300046517 | Bacteria | 5309 |
| 706 | Ga0495630_0095930 | 3300046517 | Bacteria | 2242 |
| 707 | Ga0495631_0131587 | 3300046518 | Bacteria | 1075 |
| 708 | Ga0495644_0002206 | 3300046523 | Bacteria | 7797 |
| 709 | Ga0495666_0063210 | 3300046526 | Bacteria | 1767 |
| 710 | Ga0495652_0002428 | 3300046529 | Bacteria | 19213 |
| 711 | Ga0495652_0023199 | 3300046529 | Bacteria | 5501 |
| 712 | Ga0495665_0125571 | 3300046531 | Bacteria | 1344 |
| 713 | Ga0495640_0017869 | 3300046533 | Bacteria | 5272 |
| 714 | Ga0495586_0019877 | 3300046535 | Bacteria | 3577 |
| 715 | Ga0495587_0013625 | 3300046536 | Bacteria | 5109 |
| 716 | Ga0495587_0018674 | 3300046536 | Bacteria | 4298 |
| 717 | Ga0495621_0003600 | 3300046539 | Bacteria | 4279 |
| 718 | Ga0495645_0017543 | 3300046543 | Bacteria | 5128 |
| 719 | Ga0495622_0027226 | 3300046557 | Bacteria | 2668 |
| 720 | Ga0495622_0045670 | 3300046557 | Bacteria | 2035 |
| 721 | Ga0495667_0003718 | 3300046559 | Bacteria | 10261 |
| 722 | Ga0495667_0005014 | 3300046559 | Bacteria | 8946 |
| 723 | Ga0495667_0007579 | 3300046559 | Bacteria | 7365 |
| 724 | Ga0495667_0108306 | 3300046559 | Bacteria | 1795 |
| 725 | Ga0495656_0001748 | 3300046615 | Bacteria | 7119 |
| 726 | Ga0495634_0064058 | 3300046642 | Bacteria | 2438 |
| 727 | Ga0495634_0156918 | 3300046642 | Bacteria | 1436 |
| 728 | Ga0495634_0199204 | 3300046642 | Bacteria | 1244 |
| 729 | Ga0495611_0029924 | 3300046648 | Bacteria | 2391 |
| 730 | Ga0495635_0010356 | 3300046663 | Bacteria | 6520 |
| 731 | Ga0495635_0016934 | 3300046663 | Bacteria | 5091 |
| 732 | Ga0495635_0028736 | 3300046663 | Bacteria | 3864 |
| 733 | Ga0495635_0052291 | 3300046663 | Bacteria | 2814 |
| 734 | Ga0495661_0015998 | 3300046665 | Bacteria | 4987 |
| 735 | Ga0495588_0002028 | 3300046674 | Bacteria | 8666 |
| 736 | Ga0495657_0027256 | 3300046675 | Bacteria | 4035 |
| 737 | Ga0495657_0050262 | 3300046675 | Bacteria | 2803 |
| 738 | Ga0495599_0018956 | 3300046678 | Bacteria | 4289 |
| 739 | Ga0495623_0000769 | 3300046679 | Bacteria | 21491 |
| 740 | Ga0495623_0007229 | 3300046679 | Bacteria | 7207 |
| 741 | Ga0495646_0016203 | 3300046680 | Bacteria | 4731 |
| 742 | Ga0495646_0246795 | 3300046680 | Bacteria | 958 |
| 743 | Ga0495647_0002159 | 3300046681 | Bacteria | 6148 |
| 744 | Ga0495658_0000473 | 3300046683 | Bacteria | 22266 |
| 745 | Ga0495658_0050088 | 3300046683 | Bacteria | 2361 |
| 746 | Ga0495658_0068764 | 3300046683 | Bacteria | 2051 |
| 747 | Ga0495658_0195239 | 3300046683 | Bacteria | 1260 |
| 748 | Ga0495613_0005369 | 3300046689 | Bacteria | 9625 |
| 749 | Ga0495613_0063014 | 3300046689 | Bacteria | 2713 |
| 750 | Ga0495613_0081446 | 3300046689 | Bacteria | 2351 |
| 751 | Ga0495670_0005085 | 3300046691 | Bacteria | 6469 |
| 752 | Ga0495600_0002018 | 3300046809 | Bacteria | 11415 |
| 753 | Ga0495600_0007230 | 3300046809 | Bacteria | 6776 |
| 754 | Ga0495600_0018503 | 3300046809 | Bacteria | 4439 |
| 755 | Ga0495600_0061493 | 3300046809 | Bacteria | 2453 |
| 756 | Ga0495581_0002175 | 3300047315 | Bacteria | 11071 |
| 757 | Ga0495581_0073173 | 3300047315 | Bacteria | 1983 |
| 758 | Ga0495581_0219960 | 3300047315 | Bacteria | 1110 |
| 759 | Ga0495604_0002235 | 3300047317 | Bacteria | 15508 |
| 760 | Ga0495674_0049481 | 3300047319 | Bacteria | 3714 |
| 761 | Ga0495674_0057206 | 3300047319 | Bacteria | 3414 |
| 762 | Ga0495674_0058173 | 3300047319 | Bacteria | 3381 |
| 763 | Ga0495674_0207802 | 3300047319 | Bacteria | 1622 |
| 764 | Ga0495672_0087065 | 3300047320 | Bacteria | 1726 |
| 765 | Ga0495676_0029258 | 3300047321 | Bacteria | 4692 |
| 766 | Ga0495676_0422142 | 3300047321 | Bacteria | 882 |
| 767 | Ga0495680_0012645 | 3300047322 | Bacteria | 7415 |
| 768 | Ga0495680_0035253 | 3300047322 | Bacteria | 4031 |
| 769 | Ga0495680_0053489 | 3300047322 | Bacteria | 3141 |
| 770 | Ga0495680_0211739 | 3300047322 | Bacteria | 1387 |
| 771 | Ga0495680_0509751 | 3300047322 | Bacteria | 815 |
| 772 | Ga0495675_0059856 | 3300047444 | Bacteria | 2414 |
| 773 | Ga0495675_0080810 | 3300047444 | Bacteria | 2047 |
| 774 | Ga0495675_0090792 | 3300047444 | Bacteria | 1917 |
| 775 | Ga0495677_0019854 | 3300047445 | Bacteria | 2437 |
| 776 | Ga0495684_0006615 | 3300047471 | Bacteria | 8990 |
| 777 | Ga0495684_0130806 | 3300047471 | Bacteria | 1885 |
| 778 | Ga0495684_0222305 | 3300047471 | Bacteria | 1384 |
| 779 | Ga0495602_0001451 | 3300048088 | Bacteria | 23534 |
| 780 | Ga0495602_0157691 | 3300048088 | Bacteria | 1776 |
| 781 | Ga0496100_0002412 | 3300048903 | Bacteria | 9472 |
| 782 | Ga0496100_0003757 | 3300048903 | Bacteria | 7952 |
| 783 | Ga0496100_0009774 | 3300048903 | Bacteria | 5400 |
| 784 | Ga0496100_0012545 | 3300048903 | Bacteria | 4861 |
| 785 | Ga0496100_0027796 | 3300048903 | Bacteria | 3482 |
| 786 | Ga0496100_0051850 | 3300048903 | Bacteria | 2665 |
| 787 | Ga0496101_0000235 | 3300048904 | Bacteria | 41146 |
| 788 | Ga0496101_0001165 | 3300048904 | Bacteria | 15728 |
| 789 | Ga0496101_0010317 | 3300048904 | Bacteria | 6169 |
| 790 | Ga0496101_0017473 | 3300048904 | Bacteria | 4866 |
| 791 | Ga0496101_0074476 | 3300048904 | Bacteria | 2497 |
| 792 | Ga0496101_0157660 | 3300048904 | Bacteria | 1739 |
| 793 | Ga0496101_0370568 | 3300048904 | Bacteria | 1126 |
| 794 | Ga0496101_0378004 | 3300048904 | Bacteria | 1114 |
| 795 | Ga0496102_0002224 | 3300048905 | Bacteria | 16640 |
| 796 | Ga0496102_0061440 | 3300048905 | Bacteria | 3438 |
| 797 | Ga0496102_0119256 | 3300048905 | Bacteria | 2463 |
| 798 | Ga0496102_0137434 | 3300048905 | Bacteria | 2290 |
| 799 | Ga0496102_0282491 | 3300048905 | Bacteria | 1564 |
| 800 | Ga0496102_0338022 | 3300048905 | Bacteria | 1418 |
| 801 | Ga0496102_0613050 | 3300048905 | Bacteria | 1011 |
| 802 | Ga0496103_0026234 | 3300048906 | Bacteria | 3528 |
| 803 | Ga0496103_0095061 | 3300048906 | Bacteria | 1883 |
| 804 | Ga0496103_0098539 | 3300048906 | Bacteria | 1848 |
| 805 | Ga0496103_0150016 | 3300048906 | Bacteria | 1493 |
| 806 | Ga0496103_0157848 | 3300048906 | Bacteria | 1454 |
| 807 | Ga0496104_0003146 | 3300048907 | Bacteria | 14223 |
| 808 | Ga0496104_0006422 | 3300048907 | Bacteria | 10338 |
| 809 | Ga0496104_0018551 | 3300048907 | Bacteria | 6349 |
| 810 | Ga0496104_0056495 | 3300048907 | Bacteria | 3712 |
| 811 | Ga0496104_0058441 | 3300048907 | Bacteria | 3650 |
| 812 | Ga0496104_0100561 | 3300048907 | Bacteria | 2768 |
| 813 | Ga0496104_0138009 | 3300048907 | Bacteria | 2343 |
| 814 | Ga0496104_0147480 | 3300048907 | Bacteria | 2259 |
| 815 | Ga0496105_0000840 | 3300048908 | Bacteria | 20909 |
| 816 | Ga0496105_0002908 | 3300048908 | Bacteria | 12568 |
| 817 | Ga0496105_0040505 | 3300048908 | Bacteria | 3841 |
| 818 | Ga0496105_0050017 | 3300048908 | Bacteria | 3453 |
| 819 | Ga0496105_0119874 | 3300048908 | Bacteria | 2170 |
| 820 | Ga0496105_0490507 | 3300048908 | Bacteria | 965 |
| 821 | Ga0496106_0002108 | 3300048909 | Bacteria | 14874 |
| 822 | Ga0496106_0004642 | 3300048909 | Bacteria | 10189 |
| 823 | Ga0496106_0012281 | 3300048909 | Bacteria | 6321 |
| 824 | Ga0496106_0018551 | 3300048909 | Bacteria | 5147 |
| 825 | Ga0496106_0077522 | 3300048909 | Bacteria | 2548 |
| 826 | Ga0496106_0525147 | 3300048909 | Bacteria | 950 |
| 827 | Ga0496107_0002984 | 3300048910 | Bacteria | 11209 |
| 828 | Ga0496107_0024758 | 3300048910 | Bacteria | 4247 |
| 829 | Ga0496107_0031487 | 3300048910 | Bacteria | 3785 |
| 830 | Ga0496107_0060146 | 3300048910 | Bacteria | 2749 |
| 831 | Ga0496107_0063826 | 3300048910 | Bacteria | 2669 |
| 832 | Ga0496107_0086974 | 3300048910 | Bacteria | 2282 |
| 833 | Ga0496107_0280117 | 3300048910 | Bacteria | 1241 |
| 834 | Ga0496108_0005305 | 3300048911 | Bacteria | 10406 |
| 835 | Ga0496108_0011953 | 3300048911 | Bacteria | 7062 |
| 836 | Ga0496108_0027044 | 3300048911 | Bacteria | 4733 |
| 837 | Ga0496108_0080492 | 3300048911 | Bacteria | 2759 |
| 838 | Ga0496108_0107696 | 3300048911 | Bacteria | 2380 |
| 839 | Ga0496108_0127350 | 3300048911 | Bacteria | 2187 |
| 840 | Ga0496108_0152171 | 3300048911 | Bacteria | 1996 |
| 841 | Ga0496108_0576904 | 3300048911 | Bacteria | 980 |
| 842 | Ga0496109_0029476 | 3300048912 | Bacteria | 4915 |
| 843 | Ga0496109_0031599 | 3300048912 | Bacteria | 4753 |
| 844 | Ga0496109_0038758 | 3300048912 | Bacteria | 4310 |
| 845 | Ga0496109_0081526 | 3300048912 | Bacteria | 2981 |
| 846 | Ga0496109_0158170 | 3300048912 | Bacteria | 2122 |
| 847 | Ga0496109_0260732 | 3300048912 | Bacteria | 1632 |
| 848 | Ga0496109_0933963 | 3300048912 | Bacteria | 805 |
| 849 | Ga0496110_0013851 | 3300048913 | Bacteria | 6682 |
| 850 | Ga0496110_0028561 | 3300048913 | Bacteria | 4792 |
| 851 | Ga0496110_0039327 | 3300048913 | Bacteria | 4118 |
| 852 | Ga0496110_0118743 | 3300048913 | Bacteria | 2381 |
| 853 | Ga0496110_0224999 | 3300048913 | Bacteria | 1706 |
| 854 | Ga0496110_0262906 | 3300048913 | Bacteria | 1571 |
| 855 | Ga0496111_0016755 | 3300048914 | Bacteria | 5055 |
| 856 | Ga0496111_0053227 | 3300048914 | Bacteria | 2924 |
| 857 | Ga0496111_0081807 | 3300048914 | Bacteria | 2357 |
| 858 | Ga0496111_0114273 | 3300048914 | Bacteria | 1990 |
| 859 | Ga0496111_0272630 | 3300048914 | Bacteria | 1255 |
| 860 | Ga0496112_0091807 | 3300048915 | Bacteria | 3005 |
| 861 | Ga0496112_0092520 | 3300048915 | Bacteria | 2993 |
| 862 | Ga0496112_0225675 | 3300048915 | Bacteria | 1828 |
| 863 | Ga0496112_0335940 | 3300048915 | Bacteria | 1454 |
| 864 | Ga0496113_0005116 | 3300048916 | Bacteria | 8147 |
| 865 | Ga0496113_0036455 | 3300048916 | Bacteria | 3604 |
| 866 | Ga0496113_0071765 | 3300048916 | Bacteria | 2634 |
| 867 | Ga0496113_0081558 | 3300048916 | Bacteria | 2480 |
| 868 | Ga0496113_0135983 | 3300048916 | Bacteria | 1931 |
| 869 | Ga0496113_0557933 | 3300048916 | Bacteria | 918 |
| 870 | Ga0496114_0017924 | 3300048917 | Bacteria | 5723 |
| 871 | Ga0496114_0035283 | 3300048917 | Bacteria | 4129 |
| 872 | Ga0496114_0050804 | 3300048917 | Bacteria | 3451 |
| 873 | Ga0496114_0078290 | 3300048917 | Bacteria | 2789 |
| 874 | Ga0496114_0377182 | 3300048917 | Bacteria | 1255 |
| 875 | Ga0496115_0002701 | 3300048918 | Bacteria | 12737 |
| 876 | Ga0496115_0078410 | 3300048918 | Bacteria | 2687 |
| 877 | Ga0496115_0240729 | 3300048918 | Bacteria | 1491 |
| 878 | Ga0496115_0242839 | 3300048918 | Bacteria | 1484 |
| 879 | Ga0501031_0050849 | 3300049568 | Bacteria | 2699 |
| 880 | Ga0501031_0079695 | 3300049568 | Bacteria | 2134 |
| 881 | Ga0501032_0019828 | 3300049569 | Bacteria | 4695 |
| 882 | Ga0501032_0104196 | 3300049569 | Bacteria | 1879 |
| 883 | Ga0501032_0236287 | 3300049569 | Bacteria | 1188 |
| 884 | Ga0501032_0309258 | 3300049569 | Bacteria | 1021 |
| 885 | Ga0501032_0382136 | 3300049569 | Bacteria | 905 |
| 886 | Ga0501033_0043575 | 3300049570 | Bacteria | 3341 |
| 887 | Ga0501033_0134853 | 3300049570 | Bacteria | 1786 |
| 888 | Ga0501034_0003959 | 3300049571 | Bacteria | 16646 |
| 889 | Ga0501034_0006739 | 3300049571 | Bacteria | 12298 |
| 890 | Ga0501034_0069144 | 3300049571 | Bacteria | 3542 |
| 891 | Ga0501034_0330778 | 3300049571 | Bacteria | 1455 |
| 892 | Ga0501036_0000598 | 3300049572 | Bacteria | 26139 |
| 893 | Ga0501036_0040164 | 3300049572 | Bacteria | 3957 |
| 894 | Ga0501036_0044198 | 3300049572 | Bacteria | 3773 |
| 895 | Ga0501037_0007098 | 3300049573 | Bacteria | 8188 |
| 896 | Ga0501037_0041220 | 3300049573 | Bacteria | 3395 |
| 897 | Ga0501037_0107552 | 3300049573 | Bacteria | 2009 |
| 898 | Ga0501037_0166300 | 3300049573 | Bacteria | 1570 |
| 899 | Ga0501037_0167161 | 3300049573 | Bacteria | 1565 |
| 900 | Ga0501038_0037767 | 3300049574 | Bacteria | 4233 |
| 901 | Ga0501038_0075227 | 3300049574 | Bacteria | 2855 |
| 902 | Ga0501038_0130202 | 3300049574 | Bacteria | 2066 |
| 903 | Ga0501039_0035014 | 3300049575 | Bacteria | 3875 |
| 904 | Ga0501039_0074547 | 3300049575 | Bacteria | 2637 |
| 905 | Ga0501039_0189071 | 3300049575 | Bacteria | 1619 |
| 906 | Ga0501040_0270066 | 3300049576 | Bacteria | 1214 |
| 907 | Ga0501041_0095507 | 3300049577 | Bacteria | 1837 |
| 908 | Ga0501043_0003254 | 3300049579 | Bacteria | 13391 |
| 909 | Ga0501043_0017656 | 3300049579 | Bacteria | 5596 |
| 910 | Ga0501043_0047438 | 3300049579 | Bacteria | 3377 |
| 911 | Ga0501043_0049113 | 3300049579 | Bacteria | 3317 |
| 912 | Ga0501043_0061123 | 3300049579 | Bacteria | 2958 |
| 913 | Ga0501043_0282894 | 3300049579 | Bacteria | 1271 |
| 914 | Ga0501046_0014798 | 3300049580 | Bacteria | 6568 |
| 915 | Ga0501046_0028044 | 3300049580 | Bacteria | 4589 |
| 916 | Ga0501046_0434438 | 3300049580 | Bacteria | 945 |
| 917 | Ga0501047_0002105 | 3300049581 | Bacteria | 19040 |
| 918 | Ga0501047_0085747 | 3300049581 | Bacteria | 3026 |
| 919 | Ga0501047_0105692 | 3300049581 | Bacteria | 2695 |
| 920 | Ga0501047_0171308 | 3300049581 | Bacteria | 2039 |
| 921 | Ga0501047_0183486 | 3300049581 | Bacteria | 1958 |
| 922 | Ga0501048_0002496 | 3300049582 | Bacteria | 14045 |
| 923 | Ga0501048_0017647 | 3300049582 | Bacteria | 5253 |
| 924 | Ga0501048_0258353 | 3300049582 | Bacteria | 1237 |
| 925 | Ga0501048_0343522 | 3300049582 | Bacteria | 1064 |
| 926 | Ga0501068_0048874 | 3300049584 | Bacteria | 2554 |
| 927 | Ga0501068_0065334 | 3300049584 | Bacteria | 2214 |
| 928 | Ga0501068_0088307 | 3300049584 | Bacteria | 1910 |
| 929 | Ga0501068_0103068 | 3300049584 | Bacteria | 1769 |
| 930 | Ga0501069_0011518 | 3300049585 | Bacteria | 4684 |
| 931 | Ga0501069_0057089 | 3300049585 | Bacteria | 2175 |
| 932 | Ga0501070_0015259 | 3300049586 | Bacteria | 6464 |
| 933 | Ga0501070_0016722 | 3300049586 | Bacteria | 6160 |
| 934 | Ga0501070_0023399 | 3300049586 | Bacteria | 5176 |
| 935 | Ga0501070_0043730 | 3300049586 | Bacteria | 3727 |
| 936 | Ga0501070_0075515 | 3300049586 | Bacteria | 2790 |
| 937 | Ga0501070_0280105 | 3300049586 | Bacteria | 1360 |
| 938 | Ga0501071_0297737 | 3300049587 | Bacteria | 1222 |
| 939 | Ga0501072_0000845 | 3300049588 | Bacteria | 22505 |
| 940 | Ga0501072_0040255 | 3300049588 | Bacteria | 3670 |
| 941 | Ga0501072_0669449 | 3300049588 | Bacteria | 816 |
| 942 | Ga0501073_0018898 | 3300049589 | Bacteria | 4979 |
| 943 | Ga0501073_0046290 | 3300049589 | Bacteria | 3060 |
| 944 | Ga0501073_0097620 | 3300049589 | Bacteria | 2040 |
| 945 | Ga0501073_0183551 | 3300049589 | Bacteria | 1448 |
| 946 | Ga0501074_0015702 | 3300049590 | Bacteria | 5505 |
| 947 | Ga0501074_0032545 | 3300049590 | Bacteria | 3777 |
| 948 | Ga0501074_0052280 | 3300049590 | Bacteria | 2949 |
| 949 | Ga0501074_0333574 | 3300049590 | Bacteria | 1076 |
| 950 | Ga0501075_0004574 | 3300049591 | Bacteria | 9378 |
| 951 | Ga0501076_0087439 | 3300049592 | Bacteria | 2506 |
| 952 | Ga0501076_0327452 | 3300049592 | Bacteria | 1257 |
| 953 | Ga0501077_0016834 | 3300049593 | Bacteria | 4612 |
| 954 | Ga0501077_0039717 | 3300049593 | Bacteria | 2998 |
| 955 | Ga0501079_0023072 | 3300049741 | Bacteria | 4777 |
| 956 | Ga0501079_0355930 | 3300049741 | Bacteria | 1147 |
| 957 | Ga0501080_0000734 | 3300049742 | Bacteria | 26489 |
| 958 | Ga0501080_0058354 | 3300049742 | Bacteria | 3593 |
| 959 | Ga0501080_0151455 | 3300049742 | Bacteria | 2143 |
| 960 | Ga0501080_0298122 | 3300049742 | Bacteria | 1462 |
| 961 | Ga0501080_0342737 | 3300049742 | Bacteria | 1350 |
| 962 | Ga0501080_0444138 | 3300049742 | Bacteria | 1163 |
| 963 | Ga0501080_0549880 | 3300049742 | Bacteria | 1028 |
| 964 | Ga0501081_0010487 | 3300049743 | Bacteria | 6048 |
| 965 | Ga0501081_0113097 | 3300049743 | Bacteria | 1928 |
| 966 | Ga0501081_0159139 | 3300049743 | Bacteria | 1627 |
| 967 | Ga0501081_0174625 | 3300049743 | Bacteria | 1552 |
| 968 | Ga0501083_0022492 | 3300049744 | Bacteria | 4374 |
| 969 | Ga0501083_0038933 | 3300049744 | Bacteria | 3230 |
| 970 | Ga0501083_0188603 | 3300049744 | Bacteria | 1346 |
| 971 | Ga0501035_0020489 | 3300049822 | Bacteria | 6073 |
| 972 | Ga0501035_0065229 | 3300049822 | Bacteria | 3234 |
| 973 | Ga0501044_0002568 | 3300049823 | Bacteria | 20676 |
| 974 | Ga0501044_0003362 | 3300049823 | Bacteria | 18040 |
| 975 | Ga0501044_0019047 | 3300049823 | Bacteria | 7348 |
| 976 | Ga0501044_0103780 | 3300049823 | Bacteria | 2857 |
| 977 | Ga0501044_0156455 | 3300049823 | Bacteria | 2258 |
| 978 | Ga0501044_0505353 | 3300049823 | Bacteria | 1109 |
| 979 | Ga0501045_0027462 | 3300049824 | Bacteria | 4102 |
| 980 | nmdc:mga03683_107406_c1 | 3300050489 | Bacteria | 1231 |
| 981 | nmdc:mga03n38_177813_c1 | 3300050490 | Bacteria | 1088 |
| 982 | nmdc:mga03n38_55130_c1 | 3300050490 | Bacteria | 1790 |
| 983 | nmdc:mga00v17_69478_c1 | 3300050491 | Bacteria | 2180 |
| 984 | nmdc:mga0yw44_280705_c1 | 3300050492 | Bacteria | 1113 |
| 985 | nmdc:mga0yw44_46099_c1 | 3300050492 | Bacteria | 1347 |
| 986 | nmdc:mga0k408_17176_c1 | 3300050493 | Bacteria | 4028 |
| 987 | nmdc:mga0k408_20132_c1 | 3300050493 | Bacteria | 3734 |
| 988 | nmdc:mga0k408_40582_c1 | 3300050493 | Bacteria | 2678 |
| 989 | nmdc:mga06z11_178348_c1 | 3300050494 | Bacteria | 1224 |
| 990 | nmdc:mga06z11_197452_c1 | 3300050494 | Bacteria | 1167 |
| 991 | nmdc:mga06z11_34669_c1 | 3300050494 | Bacteria | 2479 |
| 992 | nmdc:mga07m45_170201_c1 | 3300050496 | Bacteria | 1266 |
| 993 | nmdc:mga07m45_189016_c1 | 3300050496 | Bacteria | 1197 |
| 994 | nmdc:mga07m45_93406_c1 | 3300050496 | Bacteria | 1413 |
| 995 | nmdc:mga07m45_94679_c1 | 3300050496 | Bacteria | 1713 |
| 996 | nmdc:mga05p37_853_c1 | 3300050507 | Bacteria | 34336 |
| 997 | nmdc:mga05p37_93337_c1 | 3300050507 | Bacteria | 3708 |
| 998 | nmdc:mga09592_69461_c1 | 3300050508 | Bacteria | 2988 |
| 999 | nmdc:mga0qj67_42968_c1 | 3300050509 | Bacteria | 3559 |
| 1000 | nmdc:mga06r32_1399_c1 | 3300050510 | Bacteria | 21806 |
| 1001 | nmdc:mga08y16_127231_c1 | 3300050511 | Bacteria | 2650 |
| 1002 | nmdc:mga08y16_162699_c1 | 3300050511 | Bacteria | 2319 |
| 1003 | nmdc:mga08y16_2157_c1 | 3300050511 | Bacteria | 20180 |
| 1004 | nmdc:mga08y16_450630_c1 | 3300050511 | Bacteria | 1312 |
| 1005 | nmdc:mga08y16_8527_c1 | 3300050511 | Bacteria | 10738 |
| 1006 | nmdc:mga08y16_95982_c1 | 3300050511 | Bacteria | 3088 |
| 1007 | nmdc:mga0n895_108407_c1 | 3300050512 | Bacteria | 2791 |
| 1008 | nmdc:mga0n895_27226_c1 | 3300050512 | Bacteria | 5428 |
| 1009 | nmdc:mga0n895_3918_c1 | 3300050512 | Bacteria | 12090 |
| 1010 | nmdc:mga0rr50_123529_c1 | 3300050513 | Bacteria | 2064 |
| 1011 | nmdc:mga0rr50_85087_c1 | 3300050513 | Bacteria | 2450 |
| 1012 | nmdc:mga08x19_162922_c1 | 3300050514 | Bacteria | 1515 |
| 1013 | nmdc:mga08x19_97022_c1 | 3300050514 | Bacteria | 1951 |
| 1014 | nmdc:mga0a205_1019_c1 | 3300050515 | Bacteria | 23295 |
| 1015 | nmdc:mga0a205_2903_c2 | 3300050515 | Bacteria | 12753 |
| 1016 | Ga0495601_0000413 | 3300053077 | Bacteria | 22423 |
| 1017 | Ga0495601_0000668 | 3300053077 | Bacteria | 18282 |
| 1018 | Ga0495601_0008299 | 3300053077 | Bacteria | 6131 |
| 1019 | Ga0495601_0022790 | 3300053077 | Bacteria | 3847 |
| 1020 | Ga0495601_0029279 | 3300053077 | Bacteria | 3414 |
| 1021 | Ga0495601_0148945 | 3300053077 | Bacteria | 1527 |
| 1022 | Ga0495612_0001737 | 3300053078 | Bacteria | 8936 |
| 1023 | Ga0495612_0002338 | 3300053078 | Bacteria | 7810 |
| 1024 | Ga0495612_0004014 | 3300053078 | Bacteria | 6097 |
| 1025 | Ga0495612_0004192 | 3300053078 | Bacteria | 5977 |
| 1026 | Ga0495595_0000301 | 3300053084 | Bacteria | 19169 |
| 1027 | Ga0495595_0002695 | 3300053084 | Bacteria | 6968 |
| 1028 | Ga0495595_0008215 | 3300053084 | Bacteria | 4285 |
| 1029 | Ga0495595_0008748 | 3300053084 | Bacteria | 4167 |
| 1030 | Ga0495595_0011183 | 3300053084 | Bacteria | 3748 |
| 1031 | Ga0495619_0000087 | 3300053085 | Bacteria | 69727 |
| 1032 | Ga0495619_0001679 | 3300053085 | Bacteria | 14639 |
| 1033 | Ga0495619_0005102 | 3300053085 | Bacteria | 8337 |
| 1034 | Ga0495619_0014361 | 3300053085 | Bacteria | 5000 |
| 1035 | Ga0495619_0060618 | 3300053085 | Bacteria | 2515 |
| 1036 | Ga0495619_0257876 | 3300053085 | Bacteria | 1208 |
| 1037 | Ga0500643_005113 | 3300053087 | Bacteria | 5727 |
| 1038 | Ga0500644_0002906 | 3300053088 | Bacteria | 4249 |
| 1039 | Ga0500651_0005475 | 3300053093 | Bacteria | 7248 |
| 1040 | Ga0500566_0012955 | 3300053094 | Bacteria | 4914 |
| 1041 | Ga0500641_0005972 | 3300053096 | Bacteria | 4312 |
| 1042 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1043 | Ga0500595_061926 | 3300053119 | Bacteria | 1128 |
| 1044 | Ga0500618_042463 | 3300053125 | Bacteria | 1041 |
| 1045 | Ga0500642_0016599 | 3300053130 | Bacteria | 2802 |
| 1046 | Ga0500652_024710 | 3300053131 | Bacteria | 2296 |
| 1047 | Ga0500568_0018059 | 3300053139 | Bacteria | 3097 |
| 1048 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1049 | Ga0500616_0074832 | 3300053153 | Bacteria | 1716 |
| 1050 | Ga0500645_000219 | 3300053730 | Bacteria | 43658 |
| 1051 | Ga0501084_0015544 | 3300054114 | Bacteria | 6313 |
| 1052 | Ga0501084_0092617 | 3300054114 | Bacteria | 2537 |
| 1053 | Ga0501084_0154469 | 3300054114 | Bacteria | 1935 |
| 1054 | Ga0501084_0157502 | 3300054114 | Bacteria | 1915 |
| 1055 | Ga0501084_0217130 | 3300054114 | Bacteria | 1613 |
| 1056 | Ga0501084_0438872 | 3300054114 | Bacteria | 1104 |
| 1057 | Ga0501084_0477645 | 3300054114 | Bacteria | 1054 |
| 1058 | Ga0501082_0005723 | 3300060353 | Bacteria | 10782 |
| 1059 | Ga0501082_0193642 | 3300060353 | Bacteria | 1768 |
| 1060 | Ga0501082_0504713 | 3300060353 | Bacteria | 1057 |
| 1061 | 2643756289 | 2643221547 | Bacteria | 4740017 |
| 1062 | 8002063743 | 8002060224 | Bacteria | 4026565 |
| 1063 | Ga0436364_0976420 | |||
| 1064 | 2214683829 | |||
| 1065 | ARSoilYngRDRAFT_c00716 | |||
| 1066 | ARcpr5yngRDRAFT_c001074 | |||
| 1067 | ARSoilOldRDRAFT_c000177 | |||
| 1068 | ARCol0yngRDRAFT_1000052 | |||
| 1069 | JGI24747J21853_1001554 | |||
| 1070 | JGI24737J22298_10003487 | |||
| 1071 | JGI24743J22301_10015874 | |||
| 1072 | JGI24750J21931_1003409 | |||
| 1073 | JGI24745J21846_1001824 | |||
| 1074 | JGI24738J21930_10003772 | |||
| 1075 | JGI24749J21850_1000734 | |||
| 1076 | JGI24744J21845_10000566 | |||
| 1077 | JGI24034J26672_10006473 | |||
| 1078 | JGI25406J46586_10010515 | |||
| 1079 | JGI25153J46596_10011896 | |||
| 1080 | JGI25404J52841_10000116 | |||
| 1081 | JGI25405J52794_10015418 | |||
| 1082 | Ga0065717_1003092 | |||
| 1083 | Ga0065704_10074934 | |||
| 1084 | Ga0065712_10000938 | |||
| 1085 | Ga0065715_10093899 | |||
| 1086 | Ga0065715_10111514 | |||
| 1087 | Ga0070676_10036202 | |||
| 1088 | Ga0070676_10158558 | |||
| 1089 | Ga0070683_100000836 | |||
| 1090 | Ga0070690_100003439 | |||
| 1091 | Ga0070690_100040778 | |||
| 1092 | Ga0070690_100081306 | |||
| 1093 | Ga0070690_100157976 | |||
| 1094 | Ga0070670_100006794 | |||
| 1095 | Ga0070670_100448221 | |||
| 1096 | Ga0070670_100579385 | |||
| 1097 | Ga0070677_10000406 | |||
| 1098 | Ga0070677_10089786 | |||
| 1099 | Ga0068869_100000653 | |||
| 1100 | Ga0068869_100177535 | |||
| 1101 | Ga0068869_100452192 | |||
| 1102 | Ga0070666_10063591 | |||
| 1103 | Ga0070666_10227128 | |||
| 1104 | Ga0070680_100023715 | |||
| 1105 | Ga0070680_100067501 | |||
| 1106 | Ga0070682_100012500 | |||
| 1107 | Ga0070682_100070250 | |||
| 1108 | Ga0070682_100109320 | |||
| 1109 | Ga0068868_100059640 | |||
| 1110 | Ga0068868_100186430 | |||
| 1111 | Ga0068868_100519982 | |||
| 1112 | Ga0070660_100007849 | |||
| 1113 | Ga0070660_100089102 | |||
| 1114 | Ga0070660_100096882 | |||
| 1115 | Ga0070689_100015309 | |||
| 1116 | Ga0070689_100018611 | |||
| 1117 | Ga0070689_100047564 | |||
| 1118 | Ga0070689_100113956 | |||
| 1119 | Ga0070689_100262149 | |||
| 1120 | Ga0070691_10008462 | |||
| 1121 | Ga0070691_10009743 | |||
| 1122 | Ga0070691_10195183 | |||
| 1123 | Ga0070687_100000387 | |||
| 1124 | Ga0070687_100024312 | |||
| 1125 | Ga0070687_100057305 | |||
| 1126 | Ga0070687_100392891 | |||
| 1127 | Ga0070661_100007161 | |||
| 1128 | Ga0070661_100378482 | |||
| 1129 | Ga0070661_100400872 | |||
| 1130 | Ga0070692_10005794 | |||
| 1131 | Ga0070692_10023542 | |||
| 1132 | Ga0070668_100004606 | |||
| 1133 | Ga0070668_100043370 | |||
| 1134 | Ga0070668_100212785 | |||
| 1135 | Ga0070669_100026812 | |||
| 1136 | Ga0070675_100009799 | |||
| 1137 | Ga0070675_100064498 | |||
| 1138 | Ga0070675_100138176 | |||
| 1139 | Ga0070675_100244551 | |||
| 1140 | Ga0070671_100021024 | |||
| 1141 | Ga0070671_100530867 | |||
| 1142 | Ga0070674_100010056 | |||
| 1143 | Ga0070674_100010545 | |||
| 1144 | Ga0070674_100022446 | |||
| 1145 | Ga0070674_100096844 | |||
| 1146 | Ga0070674_100161599 | |||
| 1147 | Ga0070673_100001011 | |||
| 1148 | Ga0070673_100063811 | |||
| 1149 | Ga0070688_100000551 | |||
| 1150 | Ga0070688_100014036 | |||
| 1151 | Ga0070688_100063949 | |||
| 1152 | Ga0070688_100208620 | |||
| 1153 | Ga0070688_100332273 | |||
| 1154 | Ga0070659_100020868 | |||
| 1155 | Ga0070659_100070572 | |||
| 1156 | Ga0070659_100266313 | |||
| 1157 | Ga0070659_100675240 | |||
| 1158 | Ga0070667_100014714 | |||
| 1159 | Ga0070667_100094015 | |||
| 1160 | Ga0070667_100201766 | |||
| 1161 | Ga0070667_100394241 | |||
| 1162 | Ga0070709_10001535 | |||
| 1163 | Ga0070709_10071449 | |||
| 1164 | Ga0070714_100014895 | |||
| 1165 | Ga0070714_100226099 | |||
| 1166 | Ga0070713_100000374 | |||
| 1167 | Ga0070713_100026161 | |||
| 1168 | Ga0070713_100320004 | |||
| 1169 | Ga0070710_10015137 | |||
| 1170 | Ga0070710_10024690 | |||
| 1171 | Ga0070710_10064338 | |||
| 1172 | Ga0070710_10110143 | |||
| 1173 | Ga0070701_10052669 | |||
| 1174 | Ga0070711_100050965 | |||
| 1175 | Ga0070711_100194658 | |||
| 1176 | Ga0070711_100239874 | |||
| 1177 | Ga0070711_100291903 | |||
| 1178 | Ga0070711_100741445 | |||
| 1179 | Ga0070705_100009385 | |||
| 1180 | Ga0070705_100640258 | |||
| 1181 | Ga0070700_100017175 | |||
| 1182 | Ga0070700_100035376 | |||
| 1183 | Ga0070694_100004575 | |||
| 1184 | Ga0070694_100008773 | |||
| 1185 | Ga0070708_100155645 | |||
| 1186 | Ga0070663_100011350 | |||
| 1187 | Ga0070663_100085837 | |||
| 1188 | Ga0070663_100270618 | |||
| 1189 | Ga0070678_100000503 | |||
| 1190 | Ga0070678_100001680 | |||
| 1191 | Ga0070678_100216200 | |||
| 1192 | Ga0070678_100446239 | |||
| 1193 | Ga0070662_100012649 | |||
| 1194 | Ga0070662_100034368 | |||
| 1195 | Ga0070681_10020942 | |||
| 1196 | Ga0070681_10100540 | |||
| 1197 | Ga0070681_10174186 | |||
| 1198 | Ga0070681_10392608 | |||
| 1199 | Ga0068867_100004320 | |||
| 1200 | Ga0068867_100065850 | |||
| 1201 | Ga0070685_10006222 | |||
| 1202 | Ga0070685_10020618 | |||
| 1203 | Ga0070685_10029468 | |||
| 1204 | Ga0070685_10163620 | |||
| 1205 | Ga0070706_100271121 | |||
| 1206 | Ga0070707_100505169 | |||
| 1207 | Ga0070679_100007143 | |||
| 1208 | Ga0070679_100014295 | |||
| 1209 | Ga0070679_100053017 | |||
| 1210 | Ga0070679_100235287 | |||
| 1211 | Ga0070684_100004467 | |||
| 1212 | Ga0070684_100199471 | |||
| 1213 | Ga0070684_100285342 | |||
| 1214 | Ga0068853_100011959 | |||
| 1215 | Ga0068853_100473732 | |||
| 1216 | Ga0068853_100571116 | |||
| 1217 | Ga0070672_100002662 | |||
| 1218 | Ga0070672_100214152 | |||
| 1219 | Ga0070686_100002499 | |||
| 1220 | Ga0070686_100023040 | |||
| 1221 | Ga0070686_100030270 | |||
| 1222 | Ga0070695_100003125 | |||
| 1223 | Ga0070695_100127682 | |||
| 1224 | Ga0070696_100038605 | |||
| 1225 | Ga0070696_100053093 | |||
| 1226 | Ga0070696_100153041 | |||
| 1227 | Ga0070693_100003325 | |||
| 1228 | Ga0070665_100363486 | |||
| 1229 | Ga0070704_100003203 | |||
| 1230 | Ga0070704_100033298 | |||
| 1231 | Ga0070704_100085808 | |||
| 1232 | Ga0068855_100017732 | |||
| 1233 | Ga0070664_100019380 | |||
| 1234 | Ga0070664_100025896 | |||
| 1235 | Ga0070664_100187454 | |||
| 1236 | Ga0070664_100395732 | |||
| 1237 | Ga0068857_100032591 | |||
| 1238 | Ga0068857_100108984 | |||
| 1239 | Ga0068854_100009551 | |||
| 1240 | Ga0068854_100035574 | |||
| 1241 | Ga0068854_100060065 | |||
| 1242 | Ga0068856_100034493 | |||
| 1243 | Ga0068856_100167253 | |||
| 1244 | Ga0068856_100194395 | |||
| 1245 | Ga0068856_100272371 | |||
| 1246 | Ga0068856_100624041 | |||
| 1247 | Ga0070702_100002390 | |||
| 1248 | Ga0070702_100146256 | |||
| 1249 | Ga0070702_100216923 | |||
| 1250 | Ga0068852_100012478 | |||
| 1251 | Ga0068859_100183126 | |||
| 1252 | Ga0068859_100515679 | |||
| 1253 | Ga0068864_100001890 | |||
| 1254 | Ga0068864_100063892 | |||
| 1255 | Ga0068864_100073542 | |||
| 1256 | Ga0068866_10002069 | |||
| 1257 | Ga0068866_10050636 | |||
| 1258 | Ga0068866_10069103 | |||
| 1259 | Ga0068861_100003757 | |||
| 1260 | Ga0068861_100064738 | |||
| 1261 | Ga0068861_100155202 | |||
| 1262 | Ga0068851_10116079 | |||
| 1263 | Ga0068870_10002328 | |||
| 1264 | Ga0068870_10053927 | |||
| 1265 | Ga0068863_100000965 | |||
| 1266 | Ga0068858_100015531 | |||
| 1267 | Ga0068858_100062000 | |||
| 1268 | Ga0068858_100145878 | |||
| 1269 | Ga0068858_100232547 | |||
| 1270 | Ga0068858_100250532 | |||
| 1271 | Ga0068860_100041173 | |||
| 1272 | Ga0068860_100227129 | |||
| 1273 | Ga0068860_100239981 | |||
| 1274 | Ga0068862_100005484 | |||
| 1275 | Ga0068862_100148364 | |||
| 1276 | Ga0068862_100784011 | |||
| 1277 | Ga0081455_10000150 | |||
| 1278 | Ga0081540_1000194 | |||
| 1279 | Ga0081540_1090962 | |||
| 1280 | Ga0081539_10001643 | |||
| 1281 | Ga0070717_10000224 | |||
| 1282 | Ga0070717_10049980 | |||
| 1283 | Ga0075365_10039429 | |||
| 1284 | Ga0075365_10270964 | |||
| 1285 | Ga0075368_10050629 | |||
| 1286 | Ga0075363_100030255 | |||
| 1287 | Ga0075363_100180815 | |||
| 1288 | Ga0075364_10099900 | |||
| 1289 | Ga0070715_10000875 | |||
| 1290 | Ga0070712_100017766 | |||
| 1291 | Ga0070712_100218414 | |||
| 1292 | Ga0070712_100225212 | |||
| 1293 | Ga0075362_10020287 | |||
| 1294 | Ga0075362_10030555 | |||
| 1295 | Ga0075367_10082699 | |||
| 1296 | Ga0075366_10019553 | |||
| 1297 | Ga0075366_10166573 | |||
| 1298 | Ga0075366_10174196 | |||
| 1299 | Ga0097621_100000933 | |||
| 1300 | Ga0097621_100053981 | |||
| 1301 | Ga0097621_100352327 | |||
| 1302 | Ga0075370_10040033 | |||
| 1303 | Ga0068871_100003230 | |||
| 1304 | Ga0068871_100016325 | |||
| 1305 | Ga0068871_100266806 | |||
| 1306 | Ga0075428_100002909 | |||
| 1307 | Ga0075428_100075176 | |||
| 1308 | Ga0075430_100057219 | |||
| 1309 | Ga0075431_100000417 | |||
| 1310 | Ga0075433_10006082 | |||
| 1311 | Ga0075434_100027565 | |||
| 1312 | Ga0075434_100052487 | |||
| 1313 | Ga0075434_100071605 | |||
| 1314 | Ga0075434_100187825 | |||
| 1315 | Ga0068865_100005683 | |||
| 1316 | Ga0068865_100022622 | |||
| 1317 | Ga0068865_100037839 | |||
| 1318 | Ga0075436_100062885 | |||
| 1319 | Ga0097620_100183124 | |||
| 1320 | Ga0097620_100515708 | |||
| 1321 | Ga0075435_100113284 | |||
| 1322 | Ga0075435_100175337 | |||
| 1323 | Ga0099795_10111930 | |||
| 1324 | Ga0105251_10027581 | |||
| 1325 | Ga0105250_10035983 | |||
| 1326 | Ga0105240_10081598 | |||
| 1327 | Ga0105240_10440816 | |||
| 1328 | Ga0111539_10004674 | |||
| 1329 | Ga0111539_10019057 | |||
| 1330 | Ga0111539_10019652 | |||
| 1331 | Ga0111539_10042118 | |||
| 1332 | Ga0111539_10140997 | |||
| 1333 | Ga0111539_10342217 | |||
| 1334 | Ga0105245_10001656 | |||
| 1335 | Ga0105245_10003204 | |||
| 1336 | Ga0105245_10018814 | |||
| 1337 | Ga0105245_10173623 | |||
| 1338 | Ga0105245_10390035 | |||
| 1339 | Ga0105245_10432900 | |||
| 1340 | Ga0105245_11176211 | |||
| 1341 | Ga0105247_10006703 | |||
| 1342 | Ga0105247_10013200 | |||
| 1343 | Ga0105247_10071388 | |||
| 1344 | Ga0114129_10002339 | |||
| 1345 | Ga0114129_10004632 | |||
| 1346 | Ga0114129_10607056 | |||
| 1347 | Ga0114129_10737055 | |||
| 1348 | Ga0105243_10006896 | |||
| 1349 | Ga0105243_10041478 | |||
| 1350 | Ga0105243_10089067 | |||
| 1351 | Ga0105243_10348234 | |||
| 1352 | Ga0105243_10530169 | |||
| 1353 | Ga0105241_10006513 | |||
| 1354 | Ga0105241_10096828 | |||
| 1355 | Ga0105241_10111580 | |||
| 1356 | Ga0105241_10250746 | |||
| 1357 | Ga0105242_10000350 | |||
| 1358 | Ga0105242_10024355 | |||
| 1359 | Ga0105248_10013825 | |||
| 1360 | Ga0105248_10049645 | |||
| 1361 | Ga0105248_10110720 | |||
| 1362 | Ga0105248_10324662 | |||
| 1363 | Ga0105248_10624242 | |||
| 1364 | Ga0105237_10024953 | |||
| 1365 | Ga0105238_10012148 | |||
| 1366 | Ga0105238_10063703 | |||
| 1367 | Ga0105238_10517614 | |||
| 1368 | Ga0105249_10007727 | |||
| 1369 | Ga0105249_10040055 | |||
| 1370 | Ga0105249_10127719 | |||
| 1371 | Ga0105249_10293227 | |||
| 1372 | Ga0105249_10453682 | |||
| 1373 | Ga0105239_10015881 | |||
| 1374 | Ga0105246_10002609 | |||
| 1375 | Ga0105246_10037341 | |||
| 1376 | Ga0105246_10510944 | |||
| 1377 | Ga0157335_1002447 | |||
| 1378 | Ga0157345_1004463 | |||
| 1379 | Ga0157338_1000333 | |||
| 1380 | Ga0157373_10016816 | |||
| 1381 | Ga0157373_10115290 | |||
| 1382 | Ga0157373_10173329 | |||
| 1383 | Ga0157371_10007888 | |||
| 1384 | Ga0157369_10152465 | |||
| 1385 | Ga0157374_10012338 | |||
| 1386 | Ga0157374_10148011 | |||
| 1387 | Ga0157374_10347370 | |||
| 1388 | Ga0157378_10017794 | |||
| 1389 | Ga0157378_10160074 | |||
| 1390 | Ga0157378_10630667 | |||
| 1391 | Ga0163162_10031946 | |||
| 1392 | Ga0163162_10064226 | |||
| 1393 | Ga0163162_10172900 | |||
| 1394 | Ga0163162_10505145 | |||
| 1395 | Ga0163162_10564149 | |||
| 1396 | Ga0157372_10030590 | |||
| 1397 | Ga0157372_10188680 | |||
| 1398 | Ga0157375_10009132 | |||
| 1399 | Ga0157375_10533886 | |||
| 1400 | Ga0157375_11072232 | |||
| 1401 | Ga0163163_10019655 | |||
| 1402 | Ga0163163_10304924 | |||
| 1403 | Ga0163163_10592532 | |||
| 1404 | Ga0163163_10703381 | |||
| 1405 | Ga0157380_10002593 | |||
| 1406 | Ga0157377_10002234 | |||
| 1407 | Ga0157379_10021452 | |||
| 1408 | Ga0157379_10117763 | |||
| 1409 | Ga0157379_10589917 | |||
| 1410 | Ga0157376_10000663 | |||
| 1411 | Ga0157376_10215687 | |||
| 1412 | Ga0157376_10318892 | |||
| 1413 | Ga0163161_10005222 | |||
| 1414 | Ga0163161_10098739 | |||
| 1415 | Ga0213876_10019512 | |||
| 1416 | Ga0213876_10042765 | |||
| 1417 | Ga0213875_10000023 | |||
| 1418 | Ga0207666_1000137 | |||
| 1419 | Ga0207666_1000707 | |||
| 1420 | Ga0207673_1000157 | |||
| 1421 | Ga0209758_1000566 | |||
| 1422 | Ga0207697_10005981 | |||
| 1423 | Ga0207697_10005996 | |||
| 1424 | Ga0207713_1026153 | |||
| 1425 | Ga0207653_10004160 | |||
| 1426 | Ga0207682_10000043 | |||
| 1427 | Ga0207682_10139651 | |||
| 1428 | Ga0207692_10006390 | |||
| 1429 | Ga0207692_10103923 | |||
| 1430 | Ga0207710_10008544 | |||
| 1431 | Ga0207710_10009164 | |||
| 1432 | Ga0207710_10039774 | |||
| 1433 | Ga0207688_10000162 | |||
| 1434 | Ga0207688_10064701 | |||
| 1435 | Ga0207680_10039488 | |||
| 1436 | Ga0207680_10053569 | |||
| 1437 | Ga0207647_10001692 | |||
| 1438 | Ga0207685_10000826 | |||
| 1439 | Ga0207699_10007186 | |||
| 1440 | Ga0207699_10015725 | |||
| 1441 | Ga0207699_10086121 | |||
| 1442 | Ga0207645_10000899 | |||
| 1443 | Ga0207645_10038802 | |||
| 1444 | Ga0207645_10041949 | |||
| 1445 | Ga0207643_10000128 | |||
| 1446 | Ga0207643_10062409 | |||
| 1447 | Ga0207654_10006844 | |||
| 1448 | Ga0207654_10013931 | |||
| 1449 | Ga0207654_10100289 | |||
| 1450 | Ga0207707_10004166 | |||
| 1451 | Ga0207707_10032397 | |||
| 1452 | Ga0207707_10122634 | |||
| 1453 | Ga0207707_10148070 | |||
| 1454 | Ga0207695_10369083 | |||
| 1455 | Ga0207693_10025205 | |||
| 1456 | Ga0207693_10027123 | |||
| 1457 | Ga0207693_10176062 | |||
| 1458 | Ga0207693_10188366 | |||
| 1459 | Ga0207663_10118644 | |||
| 1460 | Ga0207663_10171449 | |||
| 1461 | Ga0207663_10210863 | |||
| 1462 | Ga0207660_10011570 | |||
| 1463 | Ga0207660_10020123 | |||
| 1464 | Ga0207662_10004338 | |||
| 1465 | Ga0207662_10067417 | |||
| 1466 | Ga0207662_10103919 | |||
| 1467 | Ga0207662_10207467 | |||
| 1468 | Ga0207657_10011210 | |||
| 1469 | Ga0207657_10015174 | |||
| 1470 | Ga0207657_10249673 | |||
| 1471 | Ga0207649_10002424 | |||
| 1472 | Ga0207649_10015848 | |||
| 1473 | Ga0207652_10068036 | |||
| 1474 | Ga0207652_10182137 | |||
| 1475 | Ga0207652_10297098 | |||
| 1476 | Ga0207652_10556093 | |||
| 1477 | Ga0207646_10312980 | |||
| 1478 | Ga0207681_10017442 | |||
| 1479 | Ga0207681_10144989 | |||
| 1480 | Ga0207681_10661374 | |||
| 1481 | Ga0207694_10028568 | |||
| 1482 | Ga0207694_10138520 | |||
| 1483 | Ga0207650_10031811 | |||
| 1484 | Ga0207659_10030342 | |||
| 1485 | Ga0207659_10100751 | |||
| 1486 | Ga0207659_10441642 | |||
| 1487 | Ga0207659_10501877 | |||
| 1488 | Ga0207687_10000522 | |||
| 1489 | Ga0207687_10009438 | |||
| 1490 | Ga0207687_10066634 | |||
| 1491 | Ga0207687_10157239 | |||
| 1492 | Ga0207687_10236741 | |||
| 1493 | Ga0207700_10013954 | |||
| 1494 | Ga0207664_10034479 | |||
| 1495 | Ga0207664_10144501 | |||
| 1496 | Ga0207664_10275377 | |||
| 1497 | Ga0207664_10289504 | |||
| 1498 | Ga0207644_10000611 | |||
| 1499 | Ga0207644_10047844 | |||
| 1500 | Ga0207644_10101273 | |||
| 1501 | Ga0207644_10511475 | |||
| 1502 | Ga0207690_10003223 | |||
| 1503 | Ga0207706_10010796 | |||
| 1504 | Ga0207706_10035483 | |||
| 1505 | Ga0207706_10077610 | |||
| 1506 | Ga0207706_10354978 | |||
| 1507 | Ga0207686_10003172 | |||
| 1508 | Ga0207686_10022617 | |||
| 1509 | Ga0207686_10181402 | |||
| 1510 | Ga0207709_10001270 | |||
| 1511 | Ga0207709_10069997 | |||
| 1512 | Ga0207670_10000631 | |||
| 1513 | Ga0207670_10008282 | |||
| 1514 | Ga0207670_10011017 | |||
| 1515 | Ga0207670_10556630 | |||
| 1516 | Ga0207669_10000797 | |||
| 1517 | Ga0207669_10015672 | |||
| 1518 | Ga0207669_10097054 | |||
| 1519 | Ga0207704_10007276 | |||
| 1520 | Ga0207704_10046381 | |||
| 1521 | Ga0207704_10129434 | |||
| 1522 | Ga0207665_10008424 | |||
| 1523 | Ga0207665_10087241 | |||
| 1524 | Ga0207665_10121854 | |||
| 1525 | Ga0207691_10008026 | |||
| 1526 | Ga0207691_10071292 | |||
| 1527 | Ga0207691_10343936 | |||
| 1528 | Ga0207711_10040416 | |||
| 1529 | Ga0207711_10370080 | |||
| 1530 | Ga0207689_10000165 | |||
| 1531 | Ga0207689_10060237 | |||
| 1532 | Ga0207689_10187368 | |||
| 1533 | Ga0207661_10004909 | |||
| 1534 | Ga0207679_10000112 | |||
| 1535 | Ga0207679_10147957 | |||
| 1536 | Ga0207679_10211040 | |||
| 1537 | Ga0207667_10056264 | |||
| 1538 | Ga0207651_10018034 | |||
| 1539 | Ga0207651_10094868 | |||
| 1540 | Ga0207651_10141887 | |||
| 1541 | Ga0207651_10394283 | |||
| 1542 | Ga0207712_10004163 | |||
| 1543 | Ga0207712_10104441 | |||
| 1544 | Ga0207712_10156743 | |||
| 1545 | Ga0207668_10001083 | |||
| 1546 | Ga0207668_10266591 | |||
| 1547 | Ga0207668_10445086 | |||
| 1548 | Ga0207640_10000382 | |||
| 1549 | Ga0207640_10134193 | |||
| 1550 | Ga0207658_10017898 | |||
| 1551 | Ga0207658_10056408 | |||
| 1552 | Ga0207658_10446609 | |||
| 1553 | Ga0207658_10476500 | |||
| 1554 | Ga0207677_10018249 | |||
| 1555 | Ga0207677_10132356 | |||
| 1556 | Ga0207703_10027237 | |||
| 1557 | Ga0207703_10075133 | |||
| 1558 | Ga0207703_10096507 | |||
| 1559 | Ga0207703_10334789 | |||
| 1560 | Ga0207703_10401314 | |||
| 1561 | Ga0207703_10690492 | |||
| 1562 | Ga0207639_10025940 | |||
| 1563 | Ga0207678_10003507 | |||
| 1564 | Ga0207678_10010035 | |||
| 1565 | Ga0207678_10022143 | |||
| 1566 | Ga0207708_10016432 | |||
| 1567 | Ga0207708_10028647 | |||
| 1568 | Ga0207708_10194657 | |||
| 1569 | Ga0207708_10573370 | |||
| 1570 | Ga0207702_10129725 | |||
| 1571 | Ga0207641_10001777 | |||
| 1572 | Ga0207648_10013960 | |||
| 1573 | Ga0207648_10105676 | |||
| 1574 | Ga0207648_10165333 | |||
| 1575 | Ga0207676_10000494 | |||
| 1576 | Ga0207676_10064465 | |||
| 1577 | Ga0207676_10702111 | |||
| 1578 | Ga0207674_10031526 | |||
| 1579 | Ga0207674_10035553 | |||
| 1580 | Ga0207675_100024932 | |||
| 1581 | Ga0207675_100039290 | |||
| 1582 | Ga0207675_100092415 | |||
| 1583 | Ga0207675_100383792 | |||
| 1584 | Ga0207683_10001272 | |||
| 1585 | Ga0207683_10004940 | |||
| 1586 | Ga0207683_10007540 | |||
| 1587 | Ga0207683_10272258 | |||
| 1588 | Ga0207698_10004416 | |||
| 1589 | Ga0207698_10442937 | |||
| 1590 | Ga0209996_1006884 | |||
| 1591 | Ga0210002_1001447 | |||
| 1592 | Ga0209983_1008271 | |||
| 1593 | Ga0209588_1063612 | |||
| 1594 | Ga0209966_1002370 | |||
| 1595 | Ga0209998_10001523 | |||
| 1596 | Ga0209998_10001929 | |||
| 1597 | Ga0209974_10004333 | |||
| 1598 | Ga0209974_10109708 | |||
| 1599 | Ga0207428_10000064 | |||
| 1600 | Ga0207428_10003786 | |||
| 1601 | Ga0207428_10034470 | |||
| 1602 | Ga0207428_10189633 | |||
| 1603 | Ga0207428_10275307 | |||
| 1604 | Ga0268266_10018410 | |||
| 1605 | Ga0268265_10001549 | |||
| 1606 | Ga0268265_10186109 | |||
| 1607 | Ga0268265_10199557 | |||
| 1608 | Ga0268265_10320851 | |||
| 1609 | Ga0268264_10004661 | |||
| 1610 | Ga0268264_10219598 | |||
| 1611 | Ga0268264_10315037 | |||
| 1612 | Ga0268264_10803016 | |||
| 1613 | Ga0265337_1017384 | |||
| 1614 | Ga0265325_10000006 | |||
| 1615 | Ga0265325_10000252 | |||
| 1616 | Ga0265316_10294747 | |||
| 1617 | Ga0307513_10172432 | |||
| 1618 | Ga0265313_10032639 | |||
| 1619 | Ga0316579_10013487 | |||
| 1620 | Ga0265342_10019058 | |||
| 1621 | Ga0307412_10446746 | |||
| 1622 | Ga0373948_0000698 | |||
| 1623 | Ga0373950_0000757 | |||
| 1624 | Ga0373958_0005082 | |||
| 1625 | Ga0373938_0006960 | |||
| 1626 | Ga0373938_0008876 | |||
| 1627 | Ga0373938_0013494 | |||
| 1628 | Ga0373926_0028132 | |||
| 1629 | Ga0373926_0038715 | |||
| 1630 | Ga0373928_0002965 | |||
| 1631 | Ga0373928_0004781 | |||
| 1632 | Ga0373928_0006581 | |||
| 1633 | Ga0373929_0002903 | |||
| 1634 | Ga0373929_0012768 | |||
| 1635 | Ga0373940_0006426 | |||
| 1636 | Ga0373940_0016817 | |||
| 1637 | Ga0373944_0038564 | |||
| 1638 | Ga0373949_0001309 | |||
| 1639 | Ga0373949_0005175 | |||
| 1640 | Ga0373949_0005768 | |||
| 1641 | Ga0373951_0001012 | |||
| 1642 | Ga0373951_0001653 | |||
| 1643 | Ga0373952_0000401 | |||
| 1644 | Ga0373952_0002793 | |||
| 1645 | Ga0373952_0006356 | |||
| 1646 | Ga0373923_0163210 | |||
| 1647 | Ga0373932_0002484 | |||
| 1648 | Ga0373932_0008055 | |||
| 1649 | Ga0373932_0018775 | |||
| 1650 | Ga0373936_0123129 | |||
| 1651 | Ga0373939_0002908 | |||
| 1652 | Ga0373939_0024704 | |||
| 1653 | Ga0373939_0027565 | |||
| 1654 | Ga0373939_0066381 | |||
| 1655 | Ga0373939_0083288 | |||
| 1656 | Ga0373941_0000504 | |||
| 1657 | Ga0373941_0014277 | |||
| 1658 | Ga0373953_0006578 | |||
| 1659 | Ga0373953_0035448 | |||
| 1660 | Ga0373954_0002902 | |||
| 1661 | Ga0373954_0004502 | |||
| 1662 | Ga0373956_0005198 | |||
| 1663 | Ga0373956_0005225 | |||
| 1664 | Ga0373956_0032976 | |||
| 1665 | Ga0373956_0043729 | |||
| 1666 | Ga0373957_0000543 | |||
| 1667 | Ga0373943_0001305 | |||
| 1668 | Ga0373943_0159285 | |||
| 1669 | Ga0373946_0016248 | |||
| 1670 | Ga0373946_0134740 | |||
| 1671 | Ga0373946_0206280 | |||
| 1672 | Ga0373955_0002625 | |||
| 1673 | Ga0373955_0014757 | |||
| 1674 | Ga0373955_0028939 | |||
| 1675 | Ga0373942_0004233 | |||
| 1676 | Ga0373961_0003997 | |||
| 1677 | Ga0373961_0072745 | |||
| 1678 | Ga0373962_0002408 | |||
| 1679 | Ga0373962_0003465 | |||
| 1680 | Ga0373962_0028155 | |||
| 1681 | Ga0373962_0079186 | |||
| 1682 | Ga0373924_0026611 | |||
| 1683 | Ga0373931_0001286 | |||
| 1684 | Ga0373931_0008271 | |||
| 1685 | Ga0373931_0043717 | |||
| 1686 | Ga0373931_0103800 | |||
| 1687 | Ga0373935_0003279 | |||
| 1688 | Ga0373935_0009562 | |||
| 1689 | Ga0373927_0015396 | |||
| 1690 | Ga0373927_0186071 | |||
| 1691 | Ga0373927_0205481 | |||
| 1692 | Ga0373933_0004530 | |||
| 1693 | Ga0373933_0167136 | |||
| 1694 | Ga0373947_0047816 | |||
| 1695 | Ga0373947_0054703 | |||
| 1696 | Ga0373947_0126893 | |||
| 1697 | Ga0373947_0167699 | |||
| 1698 | Ga0373937_0001302 | |||
| 1699 | Ga0373937_0002947 | |||
| 1700 | Ga0373937_0014182 | |||
| 1701 | Ga0373937_0039323 | |||
| 1702 | Ga0373937_0040918 | |||
| 1703 | Ga0373937_0240745 | |||
| 1704 | Ga0373937_0328218 | |||
| 1705 | Ga0373937_0783496 | |||
| 1706 | Ga0373925_0043026 | |||
| 1707 | Ga0373925_0248806 | |||
| 1708 | Ga0436364_0024145 | |||
| 1709 | Ga0436364_1042090 | |||
| 1710 | Ga0436364_1078356 | |||
| 1711 | Ga0436365_0719053 | |||
| 1712 | Ga0436365_0725763 | |||
| 1713 | Ga0436365_1188741 | |||
| 1714 | Ga0436365_1227929 | |||
| 1715 | Ga0436360_1007413 | |||
| 1716 | Ga0436363_0375711 | |||
| 1717 | Ga0436362_0896511 | |||
| 1718 | Ga0439453_0002674 | |||
| 1719 | Ga0439453_0003546 | |||
| 1720 | Ga0451853_4050201 | |||
| 1721 | Ga0439443_001472 | |||
| 1722 | Ga0439455_0012765 | |||
| 1723 | Ga0439444_0017706 | |||
| 1724 | Ga0439464_0066223 | |||
| 1725 | Ga0439460_0036376 | |||
| 1726 | Ga0451577_0174013 | |||
| 1727 | Ga0439440_0024267 | |||
| 1728 | Ga0466967_0297481 | |||
| 1729 | Ga0495592_0005759 | |||
| 1730 | Ga0495592_0018759 | |||
| 1731 | Ga0495592_0181710 | |||
| 1732 | Ga0495603_0021766 | |||
| 1733 | Ga0495629_0000253 | |||
| 1734 | Ga0495629_0077225 | |||
| 1735 | Ga0495629_0105459 | |||
| 1736 | Ga0495638_0023879 | |||
| 1737 | Ga0495638_0129888 | |||
| 1738 | Ga0495651_0014216 | |||
| 1739 | Ga0495651_0015195 | |||
| 1740 | Ga0495651_0040620 | |||
| 1741 | Ga0495651_0110841 | |||
| 1742 | Ga0495653_0017400 | |||
| 1743 | Ga0495653_0162831 | |||
| 1744 | Ga0495653_0170534 | |||
| 1745 | Ga0495653_0282822 | |||
| 1746 | Ga0495650_0042409 | |||
| 1747 | Ga0495580_0047078 | |||
| 1748 | Ga0495580_0060832 | |||
| 1749 | Ga0495580_0410648 | |||
| 1750 | Ga0495582_0041140 | |||
| 1751 | Ga0495639_0005636 | |||
| 1752 | Ga0495639_0013858 | |||
| 1753 | Ga0495639_0063459 | |||
| 1754 | Ga0495662_0008670 | |||
| 1755 | Ga0495664_0073000 | |||
| 1756 | Ga0495664_0195838 | |||
| 1757 | Ga0495584_0061045 | |||
| 1758 | Ga0495585_0007151 | |||
| 1759 | Ga0495594_0002753 | |||
| 1760 | Ga0495594_0041096 | |||
| 1761 | Ga0495607_0026487 | |||
| 1762 | Ga0495608_0001048 | |||
| 1763 | Ga0495608_0043899 | |||
| 1764 | Ga0495618_0029595 | |||
| 1765 | Ga0495628_0002572 | |||
| 1766 | Ga0495628_0099872 | |||
| 1767 | Ga0495630_0017093 | |||
| 1768 | Ga0495630_0095930 | |||
| 1769 | Ga0495631_0131587 | |||
| 1770 | Ga0495644_0002206 | |||
| 1771 | Ga0495666_0063210 | |||
| 1772 | Ga0495652_0002428 | |||
| 1773 | Ga0495652_0023199 | |||
| 1774 | Ga0495665_0125571 | |||
| 1775 | Ga0495640_0017869 | |||
| 1776 | Ga0495586_0019877 | |||
| 1777 | Ga0495587_0013625 | |||
| 1778 | Ga0495587_0018674 | |||
| 1779 | Ga0495621_0003600 | |||
| 1780 | Ga0495645_0017543 | |||
| 1781 | Ga0495622_0027226 | |||
| 1782 | Ga0495622_0045670 | |||
| 1783 | Ga0495667_0003718 | |||
| 1784 | Ga0495667_0005014 | |||
| 1785 | Ga0495667_0007579 | |||
| 1786 | Ga0495667_0108306 | |||
| 1787 | Ga0495656_0001748 | |||
| 1788 | Ga0495634_0064058 | |||
| 1789 | Ga0495634_0156918 | |||
| 1790 | Ga0495634_0199204 | |||
| 1791 | Ga0495611_0029924 | |||
| 1792 | Ga0495635_0010356 | |||
| 1793 | Ga0495635_0016934 | |||
| 1794 | Ga0495635_0028736 | |||
| 1795 | Ga0495635_0052291 | |||
| 1796 | Ga0495661_0015998 | |||
| 1797 | Ga0495588_0002028 | |||
| 1798 | Ga0495657_0027256 | |||
| 1799 | Ga0495657_0050262 | |||
| 1800 | Ga0495599_0018956 | |||
| 1801 | Ga0495623_0000769 | |||
| 1802 | Ga0495623_0007229 | |||
| 1803 | Ga0495646_0016203 | |||
| 1804 | Ga0495646_0246795 | |||
| 1805 | Ga0495647_0002159 | |||
| 1806 | Ga0495658_0000473 | |||
| 1807 | Ga0495658_0050088 | |||
| 1808 | Ga0495658_0068764 | |||
| 1809 | Ga0495658_0195239 | |||
| 1810 | Ga0495613_0005369 | |||
| 1811 | Ga0495613_0063014 | |||
| 1812 | Ga0495613_0081446 | |||
| 1813 | Ga0495670_0005085 | |||
| 1814 | Ga0495600_0002018 | |||
| 1815 | Ga0495600_0007230 | |||
| 1816 | Ga0495600_0018503 | |||
| 1817 | Ga0495600_0061493 | |||
| 1818 | Ga0495581_0002175 | |||
| 1819 | Ga0495581_0073173 | |||
| 1820 | Ga0495581_0219960 | |||
| 1821 | Ga0495604_0002235 | |||
| 1822 | Ga0495674_0049481 | |||
| 1823 | Ga0495674_0057206 | |||
| 1824 | Ga0495674_0058173 | |||
| 1825 | Ga0495674_0207802 | |||
| 1826 | Ga0495672_0087065 | |||
| 1827 | Ga0495676_0029258 | |||
| 1828 | Ga0495676_0422142 | |||
| 1829 | Ga0495680_0012645 | |||
| 1830 | Ga0495680_0035253 | |||
| 1831 | Ga0495680_0053489 | |||
| 1832 | Ga0495680_0211739 | |||
| 1833 | Ga0495680_0509751 | |||
| 1834 | Ga0495675_0059856 | |||
| 1835 | Ga0495675_0080810 | |||
| 1836 | Ga0495675_0090792 | |||
| 1837 | Ga0495677_0019854 | |||
| 1838 | Ga0495684_0006615 | |||
| 1839 | Ga0495684_0130806 | |||
| 1840 | Ga0495684_0222305 | |||
| 1841 | Ga0495602_0001451 | |||
| 1842 | Ga0495602_0157691 | |||
| 1843 | Ga0496100_0002412 | |||
| 1844 | Ga0496100_0003757 | |||
| 1845 | Ga0496100_0009774 | |||
| 1846 | Ga0496100_0012545 | |||
| 1847 | Ga0496100_0027796 | |||
| 1848 | Ga0496100_0051850 | |||
| 1849 | Ga0496101_0000235 | |||
| 1850 | Ga0496101_0001165 | |||
| 1851 | Ga0496101_0010317 | |||
| 1852 | Ga0496101_0017473 | |||
| 1853 | Ga0496101_0074476 | |||
| 1854 | Ga0496101_0157660 | |||
| 1855 | Ga0496101_0370568 | |||
| 1856 | Ga0496101_0378004 | |||
| 1857 | Ga0496102_0002224 | |||
| 1858 | Ga0496102_0061440 | |||
| 1859 | Ga0496102_0119256 | |||
| 1860 | Ga0496102_0137434 | |||
| 1861 | Ga0496102_0282491 | |||
| 1862 | Ga0496102_0338022 | |||
| 1863 | Ga0496102_0613050 | |||
| 1864 | Ga0496103_0026234 | |||
| 1865 | Ga0496103_0095061 | |||
| 1866 | Ga0496103_0098539 | |||
| 1867 | Ga0496103_0150016 | |||
| 1868 | Ga0496103_0157848 | |||
| 1869 | Ga0496104_0003146 | |||
| 1870 | Ga0496104_0006422 | |||
| 1871 | Ga0496104_0018551 | |||
| 1872 | Ga0496104_0056495 | |||
| 1873 | Ga0496104_0058441 | |||
| 1874 | Ga0496104_0100561 | |||
| 1875 | Ga0496104_0138009 | |||
| 1876 | Ga0496104_0147480 | |||
| 1877 | Ga0496105_0000840 | |||
| 1878 | Ga0496105_0002908 | |||
| 1879 | Ga0496105_0040505 | |||
| 1880 | Ga0496105_0050017 | |||
| 1881 | Ga0496105_0119874 | |||
| 1882 | Ga0496105_0490507 | |||
| 1883 | Ga0496106_0002108 | |||
| 1884 | Ga0496106_0004642 | |||
| 1885 | Ga0496106_0012281 | |||
| 1886 | Ga0496106_0018551 | |||
| 1887 | Ga0496106_0077522 | |||
| 1888 | Ga0496106_0525147 | |||
| 1889 | Ga0496107_0002984 | |||
| 1890 | Ga0496107_0024758 | |||
| 1891 | Ga0496107_0031487 | |||
| 1892 | Ga0496107_0060146 | |||
| 1893 | Ga0496107_0063826 | |||
| 1894 | Ga0496107_0086974 | |||
| 1895 | Ga0496107_0280117 | |||
| 1896 | Ga0496108_0005305 | |||
| 1897 | Ga0496108_0011953 | |||
| 1898 | Ga0496108_0027044 | |||
| 1899 | Ga0496108_0080492 | |||
| 1900 | Ga0496108_0107696 | |||
| 1901 | Ga0496108_0127350 | |||
| 1902 | Ga0496108_0152171 | |||
| 1903 | Ga0496108_0576904 | |||
| 1904 | Ga0496109_0029476 | |||
| 1905 | Ga0496109_0031599 | |||
| 1906 | Ga0496109_0038758 | |||
| 1907 | Ga0496109_0081526 | |||
| 1908 | Ga0496109_0158170 | |||
| 1909 | Ga0496109_0260732 | |||
| 1910 | Ga0496109_0933963 | |||
| 1911 | Ga0496110_0013851 | |||
| 1912 | Ga0496110_0028561 | |||
| 1913 | Ga0496110_0039327 | |||
| 1914 | Ga0496110_0118743 | |||
| 1915 | Ga0496110_0224999 | |||
| 1916 | Ga0496110_0262906 | |||
| 1917 | Ga0496111_0016755 | |||
| 1918 | Ga0496111_0053227 | |||
| 1919 | Ga0496111_0081807 | |||
| 1920 | Ga0496111_0114273 | |||
| 1921 | Ga0496111_0272630 | |||
| 1922 | Ga0496112_0091807 | |||
| 1923 | Ga0496112_0092520 | |||
| 1924 | Ga0496112_0225675 | |||
| 1925 | Ga0496112_0335940 | |||
| 1926 | Ga0496113_0005116 | |||
| 1927 | Ga0496113_0036455 | |||
| 1928 | Ga0496113_0071765 | |||
| 1929 | Ga0496113_0081558 | |||
| 1930 | Ga0496113_0135983 | |||
| 1931 | Ga0496113_0557933 | |||
| 1932 | Ga0496114_0017924 | |||
| 1933 | Ga0496114_0035283 | |||
| 1934 | Ga0496114_0050804 | |||
| 1935 | Ga0496114_0078290 | |||
| 1936 | Ga0496114_0377182 | |||
| 1937 | Ga0496115_0002701 | |||
| 1938 | Ga0496115_0078410 | |||
| 1939 | Ga0496115_0240729 | |||
| 1940 | Ga0496115_0242839 | |||
| 1941 | Ga0501031_0050849 | |||
| 1942 | Ga0501031_0079695 | |||
| 1943 | Ga0501032_0019828 | |||
| 1944 | Ga0501032_0104196 | |||
| 1945 | Ga0501032_0236287 | |||
| 1946 | Ga0501032_0309258 | |||
| 1947 | Ga0501032_0382136 | |||
| 1948 | Ga0501033_0043575 | |||
| 1949 | Ga0501033_0134853 | |||
| 1950 | Ga0501034_0003959 | |||
| 1951 | Ga0501034_0006739 | |||
| 1952 | Ga0501034_0069144 | |||
| 1953 | Ga0501034_0330778 | |||
| 1954 | Ga0501036_0000598 | |||
| 1955 | Ga0501036_0040164 | |||
| 1956 | Ga0501036_0044198 | |||
| 1957 | Ga0501037_0007098 | |||
| 1958 | Ga0501037_0041220 | |||
| 1959 | Ga0501037_0107552 | |||
| 1960 | Ga0501037_0166300 | |||
| 1961 | Ga0501037_0167161 | |||
| 1962 | Ga0501038_0037767 | |||
| 1963 | Ga0501038_0075227 | |||
| 1964 | Ga0501038_0130202 | |||
| 1965 | Ga0501039_0035014 | |||
| 1966 | Ga0501039_0074547 | |||
| 1967 | Ga0501039_0189071 | |||
| 1968 | Ga0501040_0270066 | |||
| 1969 | Ga0501041_0095507 | |||
| 1970 | Ga0501043_0003254 | |||
| 1971 | Ga0501043_0017656 | |||
| 1972 | Ga0501043_0047438 | |||
| 1973 | Ga0501043_0049113 | |||
| 1974 | Ga0501043_0061123 | |||
| 1975 | Ga0501043_0282894 | |||
| 1976 | Ga0501046_0014798 | |||
| 1977 | Ga0501046_0028044 | |||
| 1978 | Ga0501046_0434438 | |||
| 1979 | Ga0501047_0002105 | |||
| 1980 | Ga0501047_0085747 | |||
| 1981 | Ga0501047_0105692 | |||
| 1982 | Ga0501047_0171308 | |||
| 1983 | Ga0501047_0183486 | |||
| 1984 | Ga0501048_0002496 | |||
| 1985 | Ga0501048_0017647 | |||
| 1986 | Ga0501048_0258353 | |||
| 1987 | Ga0501048_0343522 | |||
| 1988 | Ga0501068_0048874 | |||
| 1989 | Ga0501068_0065334 | |||
| 1990 | Ga0501068_0088307 | |||
| 1991 | Ga0501068_0103068 | |||
| 1992 | Ga0501069_0011518 | |||
| 1993 | Ga0501069_0057089 | |||
| 1994 | Ga0501070_0015259 | |||
| 1995 | Ga0501070_0016722 | |||
| 1996 | Ga0501070_0023399 | |||
| 1997 | Ga0501070_0043730 | |||
| 1998 | Ga0501070_0075515 | |||
| 1999 | Ga0501070_0280105 | |||
| 2000 | Ga0501071_0297737 | |||
| 2001 | Ga0501072_0000845 | |||
| 2002 | Ga0501072_0040255 | |||
| 2003 | Ga0501072_0669449 | |||
| 2004 | Ga0501073_0018898 | |||
| 2005 | Ga0501073_0046290 | |||
| 2006 | Ga0501073_0097620 | |||
| 2007 | Ga0501073_0183551 | |||
| 2008 | Ga0501074_0015702 | |||
| 2009 | Ga0501074_0032545 | |||
| 2010 | Ga0501074_0052280 | |||
| 2011 | Ga0501074_0333574 | |||
| 2012 | Ga0501075_0004574 | |||
| 2013 | Ga0501076_0087439 | |||
| 2014 | Ga0501076_0327452 | |||
| 2015 | Ga0501077_0016834 | |||
| 2016 | Ga0501077_0039717 | |||
| 2017 | Ga0501079_0023072 | |||
| 2018 | Ga0501079_0355930 | |||
| 2019 | Ga0501080_0000734 | |||
| 2020 | Ga0501080_0058354 | |||
| 2021 | Ga0501080_0151455 | |||
| 2022 | Ga0501080_0298122 | |||
| 2023 | Ga0501080_0342737 | |||
| 2024 | Ga0501080_0444138 | |||
| 2025 | Ga0501080_0549880 | |||
| 2026 | Ga0501081_0010487 | |||
| 2027 | Ga0501081_0113097 | |||
| 2028 | Ga0501081_0159139 | |||
| 2029 | Ga0501081_0174625 | |||
| 2030 | Ga0501083_0022492 | |||
| 2031 | Ga0501083_0038933 | |||
| 2032 | Ga0501083_0188603 | |||
| 2033 | Ga0501035_0020489 | |||
| 2034 | Ga0501035_0065229 | |||
| 2035 | Ga0501044_0002568 | |||
| 2036 | Ga0501044_0003362 | |||
| 2037 | Ga0501044_0019047 | |||
| 2038 | Ga0501044_0103780 | |||
| 2039 | Ga0501044_0156455 | |||
| 2040 | Ga0501044_0505353 | |||
| 2041 | Ga0501045_0027462 | |||
| 2042 | nmdc:mga03683_107406_c1 | |||
| 2043 | nmdc:mga03n38_177813_c1 | |||
| 2044 | nmdc:mga03n38_55130_c1 | |||
| 2045 | nmdc:mga00v17_69478_c1 | |||
| 2046 | nmdc:mga0yw44_280705_c1 | |||
| 2047 | nmdc:mga0yw44_46099_c1 | |||
| 2048 | nmdc:mga0k408_17176_c1 | |||
| 2049 | nmdc:mga0k408_20132_c1 | |||
| 2050 | nmdc:mga0k408_40582_c1 | |||
| 2051 | nmdc:mga06z11_178348_c1 | |||
| 2052 | nmdc:mga06z11_197452_c1 | |||
| 2053 | nmdc:mga06z11_34669_c1 | |||
| 2054 | nmdc:mga07m45_170201_c1 | |||
| 2055 | nmdc:mga07m45_189016_c1 | |||
| 2056 | nmdc:mga07m45_93406_c1 | |||
| 2057 | nmdc:mga07m45_94679_c1 | |||
| 2058 | nmdc:mga05p37_853_c1 | |||
| 2059 | nmdc:mga05p37_93337_c1 | |||
| 2060 | nmdc:mga09592_69461_c1 | |||
| 2061 | nmdc:mga0qj67_42968_c1 | |||
| 2062 | nmdc:mga06r32_1399_c1 | |||
| 2063 | nmdc:mga08y16_127231_c1 | |||
| 2064 | nmdc:mga08y16_162699_c1 | |||
| 2065 | nmdc:mga08y16_2157_c1 | |||
| 2066 | nmdc:mga08y16_450630_c1 | |||
| 2067 | nmdc:mga08y16_8527_c1 | |||
| 2068 | nmdc:mga08y16_95982_c1 | |||
| 2069 | nmdc:mga0n895_108407_c1 | |||
| 2070 | nmdc:mga0n895_27226_c1 | |||
| 2071 | nmdc:mga0n895_3918_c1 | |||
| 2072 | nmdc:mga0rr50_123529_c1 | |||
| 2073 | nmdc:mga0rr50_85087_c1 | |||
| 2074 | nmdc:mga08x19_162922_c1 | |||
| 2075 | nmdc:mga08x19_97022_c1 | |||
| 2076 | nmdc:mga0a205_1019_c1 | |||
| 2077 | nmdc:mga0a205_2903_c2 | |||
| 2078 | Ga0495601_0000413 | |||
| 2079 | Ga0495601_0000668 | |||
| 2080 | Ga0495601_0008299 | |||
| 2081 | Ga0495601_0022790 | |||
| 2082 | Ga0495601_0029279 | |||
| 2083 | Ga0495601_0148945 | |||
| 2084 | Ga0495612_0001737 | |||
| 2085 | Ga0495612_0002338 | |||
| 2086 | Ga0495612_0004014 | |||
| 2087 | Ga0495612_0004192 | |||
| 2088 | Ga0495595_0000301 | |||
| 2089 | Ga0495595_0002695 | |||
| 2090 | Ga0495595_0008215 | |||
| 2091 | Ga0495595_0008748 | |||
| 2092 | Ga0495595_0011183 | |||
| 2093 | Ga0495619_0000087 | |||
| 2094 | Ga0495619_0001679 | |||
| 2095 | Ga0495619_0005102 | |||
| 2096 | Ga0495619_0014361 | |||
| 2097 | Ga0495619_0060618 | |||
| 2098 | Ga0495619_0257876 | |||
| 2099 | Ga0500643_005113 | |||
| 2100 | Ga0500644_0002906 | |||
| 2101 | Ga0500651_0005475 | |||
| 2102 | Ga0500566_0012955 | |||
| 2103 | Ga0500641_0005972 | |||
| 2104 | Ga0500595_000002 | |||
| 2105 | Ga0500595_061926 | |||
| 2106 | Ga0500618_042463 | |||
| 2107 | Ga0500642_0016599 | |||
| 2108 | Ga0500652_024710 | |||
| 2109 | Ga0500568_0018059 | |||
| 2110 | Ga0500616_0000002 | |||
| 2111 | Ga0500616_0074832 | |||
| 2112 | Ga0500645_000219 | |||
| 2113 | Ga0501084_0015544 | |||
| 2114 | Ga0501084_0092617 | |||
| 2115 | Ga0501084_0154469 | |||
| 2116 | Ga0501084_0157502 | |||
| 2117 | Ga0501084_0217130 | |||
| 2118 | Ga0501084_0438872 | |||
| 2119 | Ga0501084_0477645 | |||
| 2120 | Ga0501082_0005723 | |||
| 2121 | Ga0501082_0193642 | |||
| 2122 | Ga0501082_0504713 | |||
| 2123 | 2643756289 | |||
| 2124 | 8002063743 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6szg-assembly1.cif.gz_A | acinetobacter baumannii undecaprenyl pyrophosphate synthase (ab-upps) in complex with gr839 and gsk513 | 0.9677 | 15 | 234 |
| 1x07-assembly1.cif.gz_A | crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp | 0.9669 | 16 | 238 |
| 4onc-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 | 0.9649 | 14 | 242 |
| 1x09-assembly1.cif.gz_A | crystal structure of the d26a mutant upps in complex with magnesium and isopentenyl pyrophosphate | 0.9649 | 17 | 237 |
| 4onc-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 | 0.9633 | 14 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7KA63_68_310_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9672 | 15 | 243 | 3.40.1180.10 |
| af_Q5FC21_4_262_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9638 | 15 | 235 | 3.40.1180.10 |
| af_O14171_12_259_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9629 | 15 | 235 | 3.40.1180.10 |
| 2vg2A01 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9628 | 12 | 237 | 3.40.1180.10 |
| 5hc7A00 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9575 | 15 | 237 | 3.40.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E0GQ45-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase | 0.9819 | 15 | 152 |
GO:0016094
GO:0045547 |
| AF-A0A2S9REF4-F1-model_v4 | deleted | 0.9793 | 14 | 144 |
|
| AF-A0A3D0MLJ4-F1-model_v4 | deleted | 0.9779 | 23 | 237 |
|
| AF-A0A7W0N335-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) | 0.9778 | 23 | 149 |
GO:0008834
GO:0016094 GO:0045547 |
| AF-A0A2N2LXK9-F1-model_v4 | Isoprenyl transferase (EC 2.5.1.-) | 0.9774 | 15 | 234 |
GO:0000287
GO:0005829 GO:0008834 GO:0016094 GO:0030145 GO:0045547 |