F489272
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1060 | 437 | 1060 | 54 |
Family's Representative Sequence
| Representative Sequence | 3300031852|Ga0307410_11209769|Ga0307410_112097691 |
| Length | 59 |
| Sequence | MAKANEKRIAVTLECTTCKRRNYITTKNKVNDRERIEMKKYCRWDRTHTVHKETRLPRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 96 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 97 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 115 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 124 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 186 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 187 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 210 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 212 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 224 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 233 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 240 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 241 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 244 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 245 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 246 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 247 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 254 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 255 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 256 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 257 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 258 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 259 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 260 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 261 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 262 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 263 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 264 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 265 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 266 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 267 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 268 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 269 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 270 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 271 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 272 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 273 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 274 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 275 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 276 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 277 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 278 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 279 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 280 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 281 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 282 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 283 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 284 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 285 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 286 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 287 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 290 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 291 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 341 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 342 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 343 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 344 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 345 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 346 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 353 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 354 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 389 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 393 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 408 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 409 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 411 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 413 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.92 |
| Metatranscriptomes | 7.08 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.09 |
| Nodule | 0 |
| Rhizoplane | 5.75 |
| Rhizosphere | 87.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10093413 | 3300001991 | Bacteria | 643 |
| 2 | Ga0007429J51699_1081227 | 3300003579 | Bacteria | 502 |
| 3 | JGI25405J52794_10007263 | 3300003911 | Bacteria | 2041 |
| 4 | Ga0058859_11691400 | 3300004798 | Bacteria | 573 |
| 5 | Ga0058859_11763347 | 3300004798 | Bacteria | 575 |
| 6 | Ga0058863_11901821 | 3300004799 | Bacteria | 1305 |
| 7 | Ga0058863_11937226 | 3300004799 | Bacteria | 619 |
| 8 | Ga0058861_11583168 | 3300004800 | Bacteria | 625 |
| 9 | Ga0058861_11737476 | 3300004800 | Bacteria | 560 |
| 10 | Ga0058862_10114983 | 3300004803 | Bacteria | 698 |
| 11 | Ga0058862_12780895 | 3300004803 | Bacteria | 819 |
| 12 | Ga0070658_10713506 | 3300005327 | Bacteria | 871 |
| 13 | Ga0070658_11060214 | 3300005327 | Bacteria | 705 |
| 14 | Ga0070676_10221914 | 3300005328 | Bacteria | 1249 |
| 15 | Ga0070676_10858029 | 3300005328 | Bacteria | 674 |
| 16 | Ga0070676_11064977 | 3300005328 | Bacteria | 610 |
| 17 | Ga0070676_11195419 | 3300005328 | Bacteria | 578 |
| 18 | Ga0070683_100709232 | 3300005329 | Bacteria | 964 |
| 19 | Ga0070683_100740591 | 3300005329 | Bacteria | 942 |
| 20 | Ga0070683_100829688 | 3300005329 | Bacteria | 886 |
| 21 | Ga0070683_101483179 | 3300005329 | Bacteria | 652 |
| 22 | Ga0070670_102091255 | 3300005331 | Bacteria | 522 |
| 23 | Ga0070670_102213498 | 3300005331 | Bacteria | 506 |
| 24 | Ga0068869_101504766 | 3300005334 | Bacteria | 598 |
| 25 | Ga0068869_101854245 | 3300005334 | Bacteria | 540 |
| 26 | Ga0070666_11446764 | 3300005335 | Bacteria | 514 |
| 27 | Ga0070680_101506011 | 3300005336 | Bacteria | 583 |
| 28 | Ga0070682_100629022 | 3300005337 | Bacteria | 851 |
| 29 | Ga0068868_100034373 | 3300005338 | Bacteria | 3913 |
| 30 | Ga0068868_102064552 | 3300005338 | Bacteria | 542 |
| 31 | Ga0068868_102369881 | 3300005338 | Bacteria | 507 |
| 32 | Ga0070660_101690313 | 3300005339 | Bacteria | 539 |
| 33 | Ga0070689_101005870 | 3300005340 | Bacteria | 742 |
| 34 | Ga0070691_10135160 | 3300005341 | Bacteria | 1252 |
| 35 | Ga0070661_101606993 | 3300005344 | Bacteria | 550 |
| 36 | Ga0070675_100079130 | 3300005354 | Bacteria | 2739 |
| 37 | Ga0070675_100477649 | 3300005354 | Bacteria | 1121 |
| 38 | Ga0070675_101718830 | 3300005354 | Bacteria | 579 |
| 39 | Ga0070671_101862869 | 3300005355 | Bacteria | 535 |
| 40 | Ga0070674_100293369 | 3300005356 | Bacteria | 1294 |
| 41 | Ga0070673_101108487 | 3300005364 | Bacteria | 740 |
| 42 | Ga0070673_101257047 | 3300005364 | Bacteria | 695 |
| 43 | Ga0070688_100719387 | 3300005365 | Bacteria | 775 |
| 44 | Ga0070688_101726998 | 3300005365 | Bacteria | 513 |
| 45 | Ga0070659_101480329 | 3300005366 | Bacteria | 605 |
| 46 | Ga0070667_100664434 | 3300005367 | Bacteria | 963 |
| 47 | Ga0070667_101120607 | 3300005367 | Bacteria | 736 |
| 48 | Ga0070709_10364631 | 3300005434 | Bacteria | 1071 |
| 49 | Ga0070714_101259885 | 3300005435 | Bacteria | 722 |
| 50 | Ga0070714_101342730 | 3300005435 | Bacteria | 698 |
| 51 | Ga0070713_100294117 | 3300005436 | Bacteria | 1493 |
| 52 | Ga0070713_100413850 | 3300005436 | Bacteria | 1261 |
| 53 | Ga0070710_10291202 | 3300005437 | Bacteria | 1063 |
| 54 | Ga0070711_100951950 | 3300005439 | Bacteria | 735 |
| 55 | Ga0070700_100178248 | 3300005441 | Bacteria | 1477 |
| 56 | Ga0070663_100405864 | 3300005455 | Bacteria | 1115 |
| 57 | Ga0070678_100190277 | 3300005456 | Bacteria | 1687 |
| 58 | Ga0070678_100261078 | 3300005456 | Bacteria | 1457 |
| 59 | Ga0070678_100746981 | 3300005456 | Bacteria | 885 |
| 60 | Ga0070707_100924309 | 3300005468 | Bacteria | 837 |
| 61 | Ga0070699_100142068 | 3300005518 | Bacteria | 2120 |
| 62 | Ga0070684_100279708 | 3300005535 | Bacteria | 1529 |
| 63 | Ga0070697_101138362 | 3300005536 | Bacteria | 695 |
| 64 | Ga0070697_101598453 | 3300005536 | Bacteria | 583 |
| 65 | Ga0068853_102304050 | 3300005539 | Bacteria | 522 |
| 66 | Ga0070672_100263217 | 3300005543 | Bacteria | 1455 |
| 67 | Ga0070672_100957358 | 3300005543 | Bacteria | 758 |
| 68 | Ga0070686_100738009 | 3300005544 | Bacteria | 789 |
| 69 | Ga0070686_101101932 | 3300005544 | Bacteria | 656 |
| 70 | Ga0070686_101525749 | 3300005544 | Bacteria | 564 |
| 71 | Ga0070696_100164219 | 3300005546 | Bacteria | 1638 |
| 72 | Ga0070696_100363370 | 3300005546 | Bacteria | 1124 |
| 73 | Ga0070693_100143037 | 3300005547 | Bacteria | 1508 |
| 74 | Ga0070693_101476753 | 3300005547 | Bacteria | 531 |
| 75 | Ga0070704_100356813 | 3300005549 | Bacteria | 1236 |
| 76 | Ga0070704_101839589 | 3300005549 | Bacteria | 561 |
| 77 | Ga0068855_100998116 | 3300005563 | Bacteria | 880 |
| 78 | Ga0068854_100466416 | 3300005578 | Bacteria | 1058 |
| 79 | Ga0068854_100475958 | 3300005578 | Bacteria | 1048 |
| 80 | Ga0068854_101277562 | 3300005578 | Bacteria | 660 |
| 81 | Ga0068856_100095065 | 3300005614 | Bacteria | 2968 |
| 82 | Ga0068856_101316205 | 3300005614 | Bacteria | 738 |
| 83 | Ga0070702_100882345 | 3300005615 | Bacteria | 699 |
| 84 | Ga0070702_101055190 | 3300005615 | Bacteria | 647 |
| 85 | Ga0068864_100874234 | 3300005618 | Bacteria | 887 |
| 86 | Ga0068864_101135432 | 3300005618 | Bacteria | 779 |
| 87 | Ga0068861_101431539 | 3300005719 | Bacteria | 676 |
| 88 | Ga0068861_101601226 | 3300005719 | Bacteria | 642 |
| 89 | Ga0068861_101787042 | 3300005719 | Bacteria | 609 |
| 90 | Ga0068870_11040195 | 3300005840 | Bacteria | 586 |
| 91 | Ga0068863_100957774 | 3300005841 | Bacteria | 857 |
| 92 | Ga0068858_100749462 | 3300005842 | Bacteria | 951 |
| 93 | Ga0068858_100915574 | 3300005842 | Bacteria | 858 |
| 94 | Ga0068860_100779864 | 3300005843 | Bacteria | 969 |
| 95 | Ga0081455_10007316 | 3300005937 | Bacteria | 11644 |
| 96 | Ga0081455_10119047 | 3300005937 | Bacteria | 2083 |
| 97 | Ga0081455_10156224 | 3300005937 | Bacteria | 1753 |
| 98 | Ga0081455_10319132 | 3300005937 | Bacteria | 1108 |
| 99 | Ga0081455_10727658 | 3300005937 | Bacteria | 629 |
| 100 | Ga0081538_10001047 | 3300005981 | Bacteria | 29464 |
| 101 | Ga0081538_10031895 | 3300005981 | Bacteria | 3543 |
| 102 | Ga0081538_10036163 | 3300005981 | Bacteria | 3229 |
| 103 | Ga0081540_1065959 | 3300005983 | Bacteria | 1699 |
| 104 | Ga0081539_10016636 | 3300005985 | Bacteria | 5232 |
| 105 | Ga0070717_10610237 | 3300006028 | Bacteria | 990 |
| 106 | Ga0070717_10624837 | 3300006028 | Bacteria | 977 |
| 107 | Ga0070717_11467929 | 3300006028 | Bacteria | 619 |
| 108 | Ga0075365_10032064 | 3300006038 | Bacteria | 3375 |
| 109 | Ga0075365_10313913 | 3300006038 | Bacteria | 1104 |
| 110 | Ga0075365_10326010 | 3300006038 | Bacteria | 1082 |
| 111 | Ga0075365_10395004 | 3300006038 | Bacteria | 976 |
| 112 | Ga0075365_10536235 | 3300006038 | Bacteria | 828 |
| 113 | Ga0075365_10561011 | 3300006038 | Bacteria | 808 |
| 114 | Ga0075365_10627489 | 3300006038 | Bacteria | 760 |
| 115 | Ga0075365_10834040 | 3300006038 | Bacteria | 650 |
| 116 | Ga0075365_10851019 | 3300006038 | Bacteria | 643 |
| 117 | Ga0075365_10978153 | 3300006038 | Bacteria | 596 |
| 118 | Ga0075368_10093386 | 3300006042 | Bacteria | 1231 |
| 119 | Ga0075368_10128283 | 3300006042 | Bacteria | 1053 |
| 120 | Ga0075363_100266033 | 3300006048 | Bacteria | 990 |
| 121 | Ga0075363_100349923 | 3300006048 | Bacteria | 863 |
| 122 | Ga0075363_100390590 | 3300006048 | Bacteria | 817 |
| 123 | Ga0075364_10037645 | 3300006051 | Bacteria | 3133 |
| 124 | Ga0075364_10394716 | 3300006051 | Bacteria | 944 |
| 125 | Ga0075364_10420223 | 3300006051 | Bacteria | 913 |
| 126 | Ga0075364_10535114 | 3300006051 | Bacteria | 801 |
| 127 | Ga0075364_10669665 | 3300006051 | Bacteria | 708 |
| 128 | Ga0075364_10807253 | 3300006051 | Bacteria | 639 |
| 129 | Ga0070715_10324028 | 3300006163 | Bacteria | 833 |
| 130 | Ga0070716_100712634 | 3300006173 | Bacteria | 768 |
| 131 | Ga0070716_100906196 | 3300006173 | Bacteria | 691 |
| 132 | Ga0075362_10575273 | 3300006177 | Bacteria | 581 |
| 133 | Ga0075367_10293775 | 3300006178 | Bacteria | 1022 |
| 134 | Ga0075367_10340213 | 3300006178 | Bacteria | 946 |
| 135 | Ga0097621_100641734 | 3300006237 | Bacteria | 974 |
| 136 | Ga0097621_101223606 | 3300006237 | Bacteria | 708 |
| 137 | Ga0097621_101596973 | 3300006237 | Bacteria | 620 |
| 138 | Ga0068871_101455335 | 3300006358 | Bacteria | 647 |
| 139 | Ga0075428_100000196 | 3300006844 | Bacteria | 57534 |
| 140 | Ga0075428_100046579 | 3300006844 | Bacteria | 4762 |
| 141 | Ga0075428_100072837 | 3300006844 | Bacteria | 3752 |
| 142 | Ga0075428_100287916 | 3300006844 | Bacteria | 1767 |
| 143 | Ga0075428_100346990 | 3300006844 | Bacteria | 1593 |
| 144 | Ga0075428_100539167 | 3300006844 | Bacteria | 1247 |
| 145 | Ga0075428_100737499 | 3300006844 | Bacteria | 1048 |
| 146 | Ga0075428_100849081 | 3300006844 | Bacteria | 969 |
| 147 | Ga0075428_101203607 | 3300006844 | Bacteria | 798 |
| 148 | Ga0075430_100012671 | 3300006846 | Bacteria | 7182 |
| 149 | Ga0075430_100049095 | 3300006846 | Bacteria | 3562 |
| 150 | Ga0075430_100070604 | 3300006846 | Bacteria | 2929 |
| 151 | Ga0075430_100127275 | 3300006846 | Bacteria | 2123 |
| 152 | Ga0075430_100192817 | 3300006846 | Bacteria | 1693 |
| 153 | Ga0075430_100202436 | 3300006846 | Bacteria | 1648 |
| 154 | Ga0075430_100270421 | 3300006846 | Bacteria | 1406 |
| 155 | Ga0075430_100377322 | 3300006846 | Bacteria | 1170 |
| 156 | Ga0075430_101189960 | 3300006846 | Bacteria | 627 |
| 157 | Ga0075431_100161427 | 3300006847 | Bacteria | 2304 |
| 158 | Ga0075431_100211212 | 3300006847 | Bacteria | 1982 |
| 159 | Ga0075431_100277739 | 3300006847 | Bacteria | 1696 |
| 160 | Ga0075431_100822029 | 3300006847 | Bacteria | 902 |
| 161 | Ga0075431_101055693 | 3300006847 | Bacteria | 778 |
| 162 | Ga0075431_101521337 | 3300006847 | Bacteria | 627 |
| 163 | Ga0075431_102014511 | 3300006847 | Bacteria | 532 |
| 164 | Ga0075433_10492269 | 3300006852 | Bacteria | 1080 |
| 165 | Ga0075433_11413122 | 3300006852 | Bacteria | 602 |
| 166 | Ga0075434_100463970 | 3300006871 | Bacteria | 1288 |
| 167 | Ga0075434_101629172 | 3300006871 | Bacteria | 654 |
| 168 | Ga0075429_100017826 | 3300006880 | Bacteria | 6140 |
| 169 | Ga0075429_100080625 | 3300006880 | Bacteria | 2837 |
| 170 | Ga0075429_100241406 | 3300006880 | Bacteria | 1582 |
| 171 | Ga0075429_100335878 | 3300006880 | Bacteria | 1322 |
| 172 | Ga0075429_100513859 | 3300006880 | Bacteria | 1049 |
| 173 | Ga0075429_101092823 | 3300006880 | Bacteria | 696 |
| 174 | Ga0068865_100875459 | 3300006881 | Bacteria | 779 |
| 175 | Ga0075436_100767534 | 3300006914 | Bacteria | 717 |
| 176 | Ga0075435_100924883 | 3300007076 | Bacteria | 761 |
| 177 | Ga0105251_10236920 | 3300009011 | Bacteria | 822 |
| 178 | Ga0105251_10648095 | 3300009011 | Bacteria | 505 |
| 179 | Ga0105244_10461297 | 3300009036 | Bacteria | 584 |
| 180 | Ga0105250_10219180 | 3300009092 | Bacteria | 806 |
| 181 | Ga0105240_11596371 | 3300009093 | Bacteria | 682 |
| 182 | Ga0105240_12500623 | 3300009093 | Bacteria | 534 |
| 183 | Ga0111539_10017154 | 3300009094 | Bacteria | 8963 |
| 184 | Ga0111539_10135171 | 3300009094 | Bacteria | 2888 |
| 185 | Ga0111539_10282169 | 3300009094 | Bacteria | 1933 |
| 186 | Ga0111539_10866826 | 3300009094 | Bacteria | 1050 |
| 187 | Ga0111539_13121165 | 3300009094 | Bacteria | 535 |
| 188 | Ga0111539_13255030 | 3300009094 | Bacteria | 523 |
| 189 | Ga0105245_10006900 | 3300009098 | Bacteria | 9956 |
| 190 | Ga0105245_10112426 | 3300009098 | Bacteria | 2534 |
| 191 | Ga0105245_10125360 | 3300009098 | Bacteria | 2403 |
| 192 | Ga0105245_10139433 | 3300009098 | Bacteria | 2282 |
| 193 | Ga0105245_10307627 | 3300009098 | Bacteria | 1557 |
| 194 | Ga0114129_10033505 | 3300009147 | Bacteria | 7260 |
| 195 | Ga0114129_10127753 | 3300009147 | Bacteria | 3494 |
| 196 | Ga0114129_10218301 | 3300009147 | Bacteria | 2574 |
| 197 | Ga0114129_10322269 | 3300009147 | Bacteria | 2054 |
| 198 | Ga0114129_10388883 | 3300009147 | Bacteria | 1840 |
| 199 | Ga0114129_10495473 | 3300009147 | Bacteria | 1596 |
| 200 | Ga0114129_10506886 | 3300009147 | Bacteria | 1575 |
| 201 | Ga0114129_10690356 | 3300009147 | Bacteria | 1313 |
| 202 | Ga0114129_11561206 | 3300009147 | Bacteria | 809 |
| 203 | Ga0114129_11744361 | 3300009147 | Bacteria | 759 |
| 204 | Ga0105243_11670745 | 3300009148 | Bacteria | 665 |
| 205 | Ga0105243_11730507 | 3300009148 | Bacteria | 655 |
| 206 | Ga0105243_11846910 | 3300009148 | Bacteria | 636 |
| 207 | Ga0105243_11973607 | 3300009148 | Bacteria | 617 |
| 208 | Ga0105243_12458255 | 3300009148 | Bacteria | 560 |
| 209 | Ga0105241_10106762 | 3300009174 | Bacteria | 2235 |
| 210 | Ga0105242_10152954 | 3300009176 | Bacteria | 2013 |
| 211 | Ga0105242_11067994 | 3300009176 | Bacteria | 819 |
| 212 | Ga0105242_11358445 | 3300009176 | Bacteria | 736 |
| 213 | Ga0105237_10393022 | 3300009545 | Bacteria | 1391 |
| 214 | Ga0105237_10580561 | 3300009545 | Bacteria | 1128 |
| 215 | Ga0105237_11231884 | 3300009545 | Bacteria | 755 |
| 216 | Ga0105237_11699055 | 3300009545 | Bacteria | 638 |
| 217 | Ga0105238_10835170 | 3300009551 | Bacteria | 938 |
| 218 | Ga0105238_12046789 | 3300009551 | Bacteria | 606 |
| 219 | Ga0105238_12755047 | 3300009551 | Bacteria | 528 |
| 220 | Ga0105249_10405330 | 3300009553 | Bacteria | 1395 |
| 221 | Ga0105249_11258780 | 3300009553 | Bacteria | 811 |
| 222 | Ga0105239_10784491 | 3300010375 | Bacteria | 1091 |
| 223 | Ga0105239_10819270 | 3300010375 | Bacteria | 1067 |
| 224 | Ga0105239_11193994 | 3300010375 | Bacteria | 877 |
| 225 | Ga0105239_12897952 | 3300010375 | Bacteria | 560 |
| 226 | Ga0105246_10999416 | 3300011119 | Bacteria | 757 |
| 227 | Ga0105246_11422410 | 3300011119 | Bacteria | 648 |
| 228 | Ga0105246_12056615 | 3300011119 | Bacteria | 552 |
| 229 | Ga0105246_12413287 | 3300011119 | Bacteria | 516 |
| 230 | Ga0157328_1008993 | 3300012478 | Bacteria | 664 |
| 231 | Ga0157313_1034469 | 3300012503 | Bacteria | 592 |
| 232 | Ga0154012_106651 | 3300013059 | Bacteria | 1134 |
| 233 | Ga0157370_11747096 | 3300013104 | Bacteria | 558 |
| 234 | Ga0157369_11268793 | 3300013105 | Bacteria | 751 |
| 235 | Ga0157374_10807669 | 3300013296 | Bacteria | 954 |
| 236 | Ga0157374_10873496 | 3300013296 | Bacteria | 916 |
| 237 | Ga0157374_11370466 | 3300013296 | Bacteria | 730 |
| 238 | Ga0157374_11706263 | 3300013296 | Bacteria | 655 |
| 239 | Ga0157378_10510658 | 3300013297 | Bacteria | 1202 |
| 240 | Ga0157378_11085654 | 3300013297 | Bacteria | 837 |
| 241 | Ga0157378_11444784 | 3300013297 | Bacteria | 731 |
| 242 | Ga0157378_11776044 | 3300013297 | Bacteria | 665 |
| 243 | Ga0157378_13121756 | 3300013297 | Bacteria | 514 |
| 244 | Ga0163162_10256092 | 3300013306 | Bacteria | 1882 |
| 245 | Ga0163162_10896354 | 3300013306 | Unclassified | 1000 |
| 246 | Ga0163162_11083186 | 3300013306 | Bacteria | 908 |
| 247 | Ga0157375_10118551 | 3300013308 | Bacteria | 2753 |
| 248 | Ga0157375_10859841 | 3300013308 | Bacteria | 1053 |
| 249 | Ga0157375_12064198 | 3300013308 | Bacteria | 678 |
| 250 | Ga0157375_12614855 | 3300013308 | Bacteria | 603 |
| 251 | Ga0163163_10274565 | 3300014325 | Bacteria | 1737 |
| 252 | Ga0163163_10321979 | 3300014325 | Bacteria | 1600 |
| 253 | Ga0163163_10714793 | 3300014325 | Bacteria | 1065 |
| 254 | Ga0163163_12851582 | 3300014325 | Bacteria | 539 |
| 255 | Ga0157380_10765835 | 3300014326 | Bacteria | 978 |
| 256 | Ga0157380_10851850 | 3300014326 | Bacteria | 933 |
| 257 | Ga0157380_11148986 | 3300014326 | Bacteria | 818 |
| 258 | Ga0157380_12580504 | 3300014326 | Bacteria | 574 |
| 259 | Ga0157380_13351225 | 3300014326 | Bacteria | 512 |
| 260 | Ga0182008_10546950 | 3300014497 | Bacteria | 643 |
| 261 | Ga0182008_10817250 | 3300014497 | Bacteria | 542 |
| 262 | Ga0157377_10472271 | 3300014745 | Bacteria | 871 |
| 263 | Ga0157377_10997759 | 3300014745 | Bacteria | 634 |
| 264 | Ga0157377_11097057 | 3300014745 | Bacteria | 609 |
| 265 | Ga0157377_11100809 | 3300014745 | Bacteria | 609 |
| 266 | Ga0157379_10363435 | 3300014968 | Bacteria | 1327 |
| 267 | Ga0157379_10651723 | 3300014968 | Bacteria | 986 |
| 268 | Ga0157379_11829252 | 3300014968 | Bacteria | 597 |
| 269 | Ga0157379_11958008 | 3300014968 | Bacteria | 578 |
| 270 | Ga0157376_10483644 | 3300014969 | Bacteria | 1214 |
| 271 | Ga0157376_11267536 | 3300014969 | Bacteria | 766 |
| 272 | Ga0157376_11461812 | 3300014969 | Bacteria | 716 |
| 273 | Ga0157376_11589031 | 3300014969 | Bacteria | 688 |
| 274 | Ga0163161_10248945 | 3300017792 | Bacteria | 1384 |
| 275 | Ga0163161_10400335 | 3300017792 | Bacteria | 1101 |
| 276 | Ga0163161_11864671 | 3300017792 | Bacteria | 535 |
| 277 | Ga0184600_125282 | 3300019190 | Bacteria | 626 |
| 278 | Ga0197907_10247108 | 3300020069 | Bacteria | 505 |
| 279 | Ga0197907_10589538 | 3300020069 | Bacteria | 2583 |
| 280 | Ga0197907_11057705 | 3300020069 | Bacteria | 1334 |
| 281 | Ga0197907_11125084 | 3300020069 | Bacteria | 1156 |
| 282 | Ga0206356_10024041 | 3300020070 | Bacteria | 1200 |
| 283 | Ga0206356_10101155 | 3300020070 | Bacteria | 756 |
| 284 | Ga0206356_10167587 | 3300020070 | Bacteria | 1044 |
| 285 | Ga0206356_10687454 | 3300020070 | Bacteria | 728 |
| 286 | Ga0206356_11110022 | 3300020070 | Bacteria | 1225 |
| 287 | Ga0206355_1032864 | 3300020076 | Bacteria | 573 |
| 288 | Ga0206355_1142256 | 3300020076 | Bacteria | 2736 |
| 289 | Ga0206355_1152352 | 3300020076 | Bacteria | 598 |
| 290 | Ga0206355_1381204 | 3300020076 | Bacteria | 521 |
| 291 | Ga0206351_10782374 | 3300020077 | Bacteria | 632 |
| 292 | Ga0206352_10639442 | 3300020078 | Bacteria | 511 |
| 293 | Ga0206352_10974728 | 3300020078 | Bacteria | 963 |
| 294 | Ga0206350_10384629 | 3300020080 | Bacteria | 606 |
| 295 | Ga0206350_10848760 | 3300020080 | Bacteria | 858 |
| 296 | Ga0206350_10938383 | 3300020080 | Bacteria | 510 |
| 297 | Ga0206354_10706372 | 3300020081 | Bacteria | 2268 |
| 298 | Ga0206354_11473913 | 3300020081 | Bacteria | 962 |
| 299 | Ga0206354_11479482 | 3300020081 | Bacteria | 909 |
| 300 | Ga0206353_10024359 | 3300020082 | Bacteria | 1893 |
| 301 | Ga0206353_10356547 | 3300020082 | Bacteria | 786 |
| 302 | Ga0154015_1400150 | 3300020610 | Bacteria | 557 |
| 303 | Ga0213873_10020965 | 3300021358 | Bacteria | 1533 |
| 304 | Ga0213876_10054990 | 3300021384 | Bacteria | 2101 |
| 305 | Ga0213876_10110186 | 3300021384 | Bacteria | 1461 |
| 306 | Ga0213871_10238896 | 3300021441 | Bacteria | 575 |
| 307 | Ga0224712_10081246 | 3300022467 | Bacteria | 1338 |
| 308 | Ga0224712_10331220 | 3300022467 | Bacteria | 717 |
| 309 | Ga0247554_106394 | 3300023547 | Bacteria | 510 |
| 310 | Ga0207653_10235479 | 3300025885 | Bacteria | 698 |
| 311 | Ga0207692_10153231 | 3300025898 | Bacteria | 1322 |
| 312 | Ga0207692_10944941 | 3300025898 | Bacteria | 568 |
| 313 | Ga0207688_10046209 | 3300025901 | Bacteria | 2430 |
| 314 | Ga0207688_10473460 | 3300025901 | Bacteria | 783 |
| 315 | Ga0207680_10151280 | 3300025903 | Bacteria | 1547 |
| 316 | Ga0207680_10316675 | 3300025903 | Bacteria | 1090 |
| 317 | Ga0207680_11127254 | 3300025903 | Bacteria | 560 |
| 318 | Ga0207699_10607684 | 3300025906 | Bacteria | 796 |
| 319 | Ga0207645_10685534 | 3300025907 | Bacteria | 696 |
| 320 | Ga0207645_10840308 | 3300025907 | Bacteria | 624 |
| 321 | Ga0207643_10870332 | 3300025908 | Bacteria | 584 |
| 322 | Ga0207654_10452010 | 3300025911 | Bacteria | 901 |
| 323 | Ga0207693_10500037 | 3300025915 | Bacteria | 949 |
| 324 | Ga0207693_11441010 | 3300025915 | Bacteria | 510 |
| 325 | Ga0207663_11216788 | 3300025916 | Bacteria | 606 |
| 326 | Ga0207660_10097116 | 3300025917 | Bacteria | 2195 |
| 327 | Ga0207662_11076343 | 3300025918 | Bacteria | 571 |
| 328 | Ga0207657_10337776 | 3300025919 | Bacteria | 1189 |
| 329 | Ga0207649_10150883 | 3300025920 | Bacteria | 1600 |
| 330 | Ga0207649_10812147 | 3300025920 | Bacteria | 730 |
| 331 | Ga0207694_10178096 | 3300025924 | Bacteria | 1723 |
| 332 | Ga0207694_11812244 | 3300025924 | Bacteria | 513 |
| 333 | Ga0207650_10204959 | 3300025925 | Bacteria | 1581 |
| 334 | Ga0207659_10059773 | 3300025926 | Bacteria | 2741 |
| 335 | Ga0207687_10070235 | 3300025927 | Bacteria | 2500 |
| 336 | Ga0207687_11122156 | 3300025927 | Bacteria | 675 |
| 337 | Ga0207687_11152352 | 3300025927 | Bacteria | 666 |
| 338 | Ga0207700_10419079 | 3300025928 | Bacteria | 1176 |
| 339 | Ga0207700_11118174 | 3300025928 | Bacteria | 704 |
| 340 | Ga0207700_11576877 | 3300025928 | Bacteria | 581 |
| 341 | Ga0207664_11572742 | 3300025929 | Bacteria | 579 |
| 342 | Ga0207706_10382544 | 3300025933 | Bacteria | 1221 |
| 343 | Ga0207706_10601087 | 3300025933 | Bacteria | 945 |
| 344 | Ga0207686_10064757 | 3300025934 | Bacteria | 2328 |
| 345 | Ga0207709_10599467 | 3300025935 | Bacteria | 872 |
| 346 | Ga0207709_10905988 | 3300025935 | Bacteria | 717 |
| 347 | Ga0207669_10159177 | 3300025937 | Bacteria | 1593 |
| 348 | Ga0207669_10344540 | 3300025937 | Bacteria | 1149 |
| 349 | Ga0207669_10391164 | 3300025937 | Bacteria | 1086 |
| 350 | Ga0207704_10095529 | 3300025938 | Bacteria | 1965 |
| 351 | Ga0207704_10345537 | 3300025938 | Bacteria | 1156 |
| 352 | Ga0207665_11005653 | 3300025939 | Bacteria | 663 |
| 353 | Ga0207691_10156968 | 3300025940 | Bacteria | 1998 |
| 354 | Ga0207691_10590833 | 3300025940 | Bacteria | 940 |
| 355 | Ga0207691_10693260 | 3300025940 | Bacteria | 859 |
| 356 | Ga0207689_10681235 | 3300025942 | Bacteria | 867 |
| 357 | Ga0207689_10813246 | 3300025942 | Bacteria | 789 |
| 358 | Ga0207661_11298879 | 3300025944 | Bacteria | 669 |
| 359 | Ga0207661_12000328 | 3300025944 | Bacteria | 525 |
| 360 | Ga0207679_10366534 | 3300025945 | Bacteria | 1260 |
| 361 | Ga0207679_10745577 | 3300025945 | Bacteria | 890 |
| 362 | Ga0207667_12036654 | 3300025949 | Bacteria | 534 |
| 363 | Ga0207651_10493412 | 3300025960 | Bacteria | 1057 |
| 364 | Ga0207651_10635441 | 3300025960 | Bacteria | 936 |
| 365 | Ga0207712_11343767 | 3300025961 | Bacteria | 639 |
| 366 | Ga0207668_10821566 | 3300025972 | Bacteria | 824 |
| 367 | Ga0207668_11013627 | 3300025972 | Bacteria | 742 |
| 368 | Ga0207668_11921325 | 3300025972 | Bacteria | 534 |
| 369 | Ga0207640_10479508 | 3300025981 | Bacteria | 1031 |
| 370 | Ga0207658_10572746 | 3300025986 | Bacteria | 1012 |
| 371 | Ga0207677_10344072 | 3300026023 | Bacteria | 1247 |
| 372 | Ga0207703_10656406 | 3300026035 | Bacteria | 995 |
| 373 | Ga0207703_11073099 | 3300026035 | Bacteria | 773 |
| 374 | Ga0207639_10786827 | 3300026041 | Bacteria | 886 |
| 375 | Ga0207678_10365034 | 3300026067 | Bacteria | 1246 |
| 376 | Ga0207708_10401534 | 3300026075 | Bacteria | 1133 |
| 377 | Ga0207702_10670075 | 3300026078 | Bacteria | 1021 |
| 378 | Ga0207648_10288269 | 3300026089 | Bacteria | 1469 |
| 379 | Ga0207648_10402964 | 3300026089 | Bacteria | 1240 |
| 380 | Ga0207676_12080288 | 3300026095 | Bacteria | 566 |
| 381 | Ga0207675_100166244 | 3300026118 | Bacteria | 2107 |
| 382 | Ga0207675_100619327 | 3300026118 | Bacteria | 1087 |
| 383 | Ga0207675_101612586 | 3300026118 | Bacteria | 669 |
| 384 | Ga0207683_10087312 | 3300026121 | Bacteria | 2773 |
| 385 | Ga0207683_10284136 | 3300026121 | Bacteria | 1512 |
| 386 | Ga0207683_10646070 | 3300026121 | Bacteria | 980 |
| 387 | Ga0207683_10795452 | 3300026121 | Bacteria | 878 |
| 388 | Ga0207683_11199042 | 3300026121 | Bacteria | 704 |
| 389 | Ga0207698_12335913 | 3300026142 | Bacteria | 546 |
| 390 | Ga0209998_10184219 | 3300027717 | Bacteria | 543 |
| 391 | Ga0209813_10084645 | 3300027866 | Bacteria | 1054 |
| 392 | Ga0209813_10109340 | 3300027866 | Bacteria | 950 |
| 393 | Ga0207428_10084908 | 3300027907 | Bacteria | 2466 |
| 394 | Ga0207428_10121688 | 3300027907 | Bacteria | 2001 |
| 395 | Ga0207428_10390806 | 3300027907 | Bacteria | 1019 |
| 396 | Ga0207428_10874862 | 3300027907 | Bacteria | 636 |
| 397 | Ga0265356_1021342 | 3300028017 | Bacteria | 701 |
| 398 | Ga0265356_1027591 | 3300028017 | Bacteria | 616 |
| 399 | Ga0268266_10966333 | 3300028379 | Bacteria | 824 |
| 400 | Ga0268265_10239570 | 3300028380 | Bacteria | 1600 |
| 401 | Ga0268264_12316436 | 3300028381 | Bacteria | 544 |
| 402 | Ga0265326_10017736 | 3300028558 | Bacteria | 2052 |
| 403 | Ga0265334_10078979 | 3300028573 | Bacteria | 1215 |
| 404 | Ga0265322_10137391 | 3300028654 | Bacteria | 698 |
| 405 | Ga0265336_10006068 | 3300028666 | Bacteria | 4390 |
| 406 | Ga0265338_10042488 | 3300028800 | Bacteria | 4232 |
| 407 | Ga0265338_10307751 | 3300028800 | Bacteria | 1150 |
| 408 | Ga0314311_1180737 | 3300030733 | Bacteria | 560 |
| 409 | Ga0316182_1287661 | 3300030745 | Bacteria | 677 |
| 410 | Ga0265763_1004811 | 3300030763 | Bacteria | 1116 |
| 411 | Ga0265767_111628 | 3300030836 | Bacteria | 599 |
| 412 | Ga0265766_1006750 | 3300030863 | Bacteria | 758 |
| 413 | Ga0265770_1020187 | 3300030878 | Bacteria | 1051 |
| 414 | Ga0265760_10245547 | 3300031090 | Bacteria | 618 |
| 415 | Ga0265331_10394159 | 3300031250 | Bacteria | 621 |
| 416 | Ga0265327_10003346 | 3300031251 | Bacteria | 15471 |
| 417 | Ga0265327_10150414 | 3300031251 | Bacteria | 1081 |
| 418 | Ga0265327_10202506 | 3300031251 | Bacteria | 898 |
| 419 | Ga0265327_10211866 | 3300031251 | Bacteria | 874 |
| 420 | Ga0265327_10517721 | 3300031251 | Bacteria | 514 |
| 421 | Ga0307408_100637289 | 3300031548 | Bacteria | 951 |
| 422 | Ga0307408_101159554 | 3300031548 | Bacteria | 719 |
| 423 | Ga0316575_10243219 | 3300031665 | Bacteria | 754 |
| 424 | Ga0316575_10524911 | 3300031665 | Bacteria | 515 |
| 425 | Ga0265314_10287627 | 3300031711 | Bacteria | 927 |
| 426 | Ga0265314_10466220 | 3300031711 | Bacteria | 670 |
| 427 | Ga0265342_10390477 | 3300031712 | Bacteria | 720 |
| 428 | Ga0316576_10088062 | 3300031727 | Bacteria | 2311 |
| 429 | Ga0316576_10092047 | 3300031727 | Bacteria | 2259 |
| 430 | Ga0316576_10105006 | 3300031727 | Bacteria | 2114 |
| 431 | Ga0307405_10948525 | 3300031731 | Bacteria | 731 |
| 432 | Ga0307413_10399232 | 3300031824 | Bacteria | 1077 |
| 433 | Ga0307413_11054229 | 3300031824 | Bacteria | 700 |
| 434 | Ga0307410_10577870 | 3300031852 | Bacteria | 935 |
| 435 | Ga0307410_11209769 | 3300031852 | Bacteria | 658 |
| 436 | Ga0326468_10071867 | 3300031889 | Bacteria | 577 |
| 437 | Ga0307406_10368945 | 3300031901 | Bacteria | 1128 |
| 438 | Ga0307407_10047656 | 3300031903 | Bacteria | 2434 |
| 439 | Ga0307412_11892374 | 3300031911 | Bacteria | 550 |
| 440 | Ga0307409_100154336 | 3300031995 | Bacteria | 1998 |
| 441 | Ga0307409_101867695 | 3300031995 | Bacteria | 630 |
| 442 | Ga0307409_101961637 | 3300031995 | Bacteria | 615 |
| 443 | Ga0307409_102307722 | 3300031995 | Bacteria | 567 |
| 444 | Ga0307416_100508282 | 3300032002 | Bacteria | 1271 |
| 445 | Ga0307416_100623445 | 3300032002 | Bacteria | 1161 |
| 446 | Ga0307416_101048050 | 3300032002 | Bacteria | 919 |
| 447 | Ga0307416_101445333 | 3300032002 | Bacteria | 793 |
| 448 | Ga0307415_100170571 | 3300032126 | Bacteria | 1696 |
| 449 | Ga0307415_100361133 | 3300032126 | Bacteria | 1226 |
| 450 | Ga0307415_100679024 | 3300032126 | Bacteria | 927 |
| 451 | Ga0307415_101078465 | 3300032126 | Bacteria | 751 |
| 452 | Ga0307415_101542307 | 3300032126 | Bacteria | 637 |
| 453 | Ga0316583_10025279 | 3300032133 | Bacteria | 2121 |
| 454 | Ga0373959_0218525 | 3300034820 | Bacteria | 510 |
| 455 | Ga0373926_0143683 | 3300035083 | Bacteria | 907 |
| 456 | Ga0373928_0104417 | 3300035084 | Bacteria | 743 |
| 457 | Ga0373944_0160046 | 3300035089 | Bacteria | 798 |
| 458 | Ga0373936_0259042 | 3300035113 | Bacteria | 778 |
| 459 | Ga0373941_0122679 | 3300035115 | Bacteria | 928 |
| 460 | Ga0373941_0485803 | 3300035115 | Bacteria | 523 |
| 461 | Ga0373953_0535639 | 3300035117 | Bacteria | 520 |
| 462 | Ga0373954_0192125 | 3300035118 | Bacteria | 1002 |
| 463 | Ga0373954_0659212 | 3300035118 | Bacteria | 519 |
| 464 | Ga0373956_0570298 | 3300035119 | Bacteria | 540 |
| 465 | Ga0373957_0075203 | 3300035120 | Bacteria | 1327 |
| 466 | Ga0373943_0165986 | 3300035170 | Bacteria | 1205 |
| 467 | Ga0373943_0787598 | 3300035170 | Bacteria | 565 |
| 468 | Ga0373955_0019862 | 3300035172 | Bacteria | 3367 |
| 469 | Ga0373955_0722610 | 3300035172 | Bacteria | 612 |
| 470 | Ga0373955_0902131 | 3300035172 | Bacteria | 544 |
| 471 | Ga0373961_0320769 | 3300035241 | Bacteria | 578 |
| 472 | Ga0373962_0387606 | 3300035242 | Bacteria | 512 |
| 473 | Ga0316574_0119753 | 3300035398 | Bacteria | 1690 |
| 474 | Ga0316574_0310356 | 3300035398 | Bacteria | 1002 |
| 475 | Ga0373931_0087405 | 3300035691 | Bacteria | 1731 |
| 476 | Ga0373931_1203545 | 3300035691 | Bacteria | 519 |
| 477 | Ga0373935_0978227 | 3300035692 | Bacteria | 628 |
| 478 | Ga0373935_1009759 | 3300035692 | Bacteria | 618 |
| 479 | Ga0373935_1027252 | 3300035692 | Bacteria | 613 |
| 480 | Ga0373927_0002910 | 3300035695 | Bacteria | 12450 |
| 481 | Ga0373933_0272575 | 3300035724 | Bacteria | 1092 |
| 482 | Ga0373933_0404241 | 3300035724 | Bacteria | 891 |
| 483 | Ga0373947_0145011 | 3300035725 | Bacteria | 1526 |
| 484 | Ga0373947_0745119 | 3300035725 | Bacteria | 668 |
| 485 | Ga0373937_0054860 | 3300036401 | Bacteria | 3657 |
| 486 | Ga0373937_0116611 | 3300036401 | Bacteria | 2487 |
| 487 | Ga0373937_0580766 | 3300036401 | Bacteria | 1064 |
| 488 | Ga0373937_0616501 | 3300036401 | Bacteria | 1030 |
| 489 | Ga0373937_1420592 | 3300036401 | Bacteria | 642 |
| 490 | Ga0373937_1669340 | 3300036401 | Bacteria | 584 |
| 491 | Ga0373937_1783256 | 3300036401 | Bacteria | 562 |
| 492 | Ga0373937_1828365 | 3300036401 | Bacteria | 554 |
| 493 | Ga0373937_1870122 | 3300036401 | Bacteria | 547 |
| 494 | Ga0265778_029342 | 3300036457 | Bacteria | 707 |
| 495 | Ga0316582_0020691 | 3300036647 | Bacteria | 3874 |
| 496 | Ga0316584_0090261 | 3300036712 | Bacteria | 2294 |
| 497 | Ga0316584_0090430 | 3300036712 | Bacteria | 2291 |
| 498 | Ga0316584_0871483 | 3300036712 | Bacteria | 608 |
| 499 | Ga0373925_0074969 | 3300037068 | Bacteria | 2563 |
| 500 | Ga0373925_0273612 | 3300037068 | Bacteria | 1359 |
| 501 | Ga0373925_0716708 | 3300037068 | Bacteria | 825 |
| 502 | Ga0395905_0349343 | 3300037471 | Bacteria | 1371 |
| 503 | Ga0436364_1339422 | 3300037853 | Bacteria | 1303 |
| 504 | Ga0395901_0292595 | 3300038443 | Bacteria | 1690 |
| 505 | Ga0436365_0864646 | 3300039437 | Bacteria | 2079 |
| 506 | Ga0436365_1137434 | 3300039437 | Bacteria | 5368 |
| 507 | Ga0436360_0398486 | 3300039438 | Bacteria | 1376 |
| 508 | Ga0436360_1025531 | 3300039438 | Bacteria | 1739 |
| 509 | Ga0436361_0347571 | 3300039447 | Bacteria | 520 |
| 510 | Ga0436361_0363213 | 3300039447 | Bacteria | 723 |
| 511 | Ga0436363_0158754 | 3300039450 | Bacteria | 638 |
| 512 | Ga0436362_0452528 | 3300039453 | Bacteria | 1305 |
| 513 | Ga0436362_0574409 | 3300039453 | Bacteria | 878 |
| 514 | Ga0436362_0610963 | 3300039453 | Bacteria | 683 |
| 515 | Ga0436362_0926769 | 3300039453 | Bacteria | 6312 |
| 516 | Ga0436362_1267422 | 3300039453 | Bacteria | 670 |
| 517 | Ga0439438_087931 | 3300041405 | Bacteria | 759 |
| 518 | Ga0439447_082074 | 3300041407 | Bacteria | 744 |
| 519 | Ga0439447_144531 | 3300041407 | Bacteria | 547 |
| 520 | Ga0439466_0060806 | 3300041411 | Bacteria | 1217 |
| 521 | Ga0439465_0115468 | 3300041413 | Bacteria | 938 |
| 522 | Ga0439465_0185422 | 3300041413 | Bacteria | 754 |
| 523 | Ga0451789_0295635 | 3300041443 | Bacteria | 587 |
| 524 | Ga0451789_0691516 | 3300041443 | Bacteria | 687 |
| 525 | Ga0451789_1001237 | 3300041443 | Bacteria | 606 |
| 526 | Ga0451793_0786865 | 3300041452 | Bacteria | 516 |
| 527 | Ga0451793_0888147 | 3300041452 | Bacteria | 674 |
| 528 | Ga0451800_0557038 | 3300041459 | Bacteria | 595 |
| 529 | Ga0451800_1560776 | 3300041459 | Bacteria | 627 |
| 530 | Ga0451802_0727857 | 3300041460 | Bacteria | 557 |
| 531 | Ga0451804_0322183 | 3300041463 | Bacteria | 505 |
| 532 | Ga0451807_0805328 | 3300041486 | Bacteria | 1026 |
| 533 | Ga0451833_0476916 | 3300041491 | Bacteria | 590 |
| 534 | Ga0451835_0236827 | 3300041492 | Bacteria | 810 |
| 535 | Ga0451837_0284750 | 3300041494 | Bacteria | 669 |
| 536 | Ga0451837_1331350 | 3300041494 | Bacteria | 1115 |
| 537 | Ga0451841_1231041 | 3300041498 | Bacteria | 665 |
| 538 | Ga0451845_0696073 | 3300041501 | Bacteria | 606 |
| 539 | Ga0451845_0849781 | 3300041501 | Bacteria | 591 |
| 540 | Ga0451843_0421569 | 3300041509 | Bacteria | 500 |
| 541 | Ga0451855_0451382 | 3300041511 | Bacteria | 748 |
| 542 | Ga0451855_0993140 | 3300041511 | Bacteria | 693 |
| 543 | Ga0451855_1220682 | 3300041511 | Bacteria | 517 |
| 544 | Ga0451853_3989981 | 3300041512 | Bacteria | 534 |
| 545 | Ga0451853_3990262 | 3300041512 | Bacteria | 554 |
| 546 | Ga0439443_003376 | 3300042003 | Bacteria | 2008 |
| 547 | Ga0439448_0016232 | 3300042005 | Bacteria | 2264 |
| 548 | Ga0439432_097560 | 3300042006 | Bacteria | 881 |
| 549 | Ga0439450_004279 | 3300042008 | Bacteria | 2427 |
| 550 | Ga0439451_015259 | 3300042009 | Bacteria | 1548 |
| 551 | Ga0439452_048599 | 3300042010 | Bacteria | 978 |
| 552 | Ga0439454_012781 | 3300042011 | Bacteria | 1143 |
| 553 | Ga0439455_0003578 | 3300042012 | Bacteria | 2987 |
| 554 | Ga0439456_069019 | 3300042013 | Bacteria | 782 |
| 555 | Ga0439462_0060113 | 3300042015 | Bacteria | 1028 |
| 556 | Ga0439463_001797 | 3300042016 | Bacteria | 5582 |
| 557 | Ga0450914_013191 | 3300042118 | Bacteria | 838 |
| 558 | Ga0450920_091232 | 3300042122 | Bacteria | 629 |
| 559 | Ga0450923_064275 | 3300042125 | Bacteria | 805 |
| 560 | Ga0439446_0233382 | 3300042156 | Bacteria | 630 |
| 561 | Ga0439434_0076777 | 3300042435 | Bacteria | 1056 |
| 562 | Ga0439435_0115736 | 3300042436 | Bacteria | 836 |
| 563 | Ga0439444_0000757 | 3300042437 | Bacteria | 3846 |
| 564 | Ga0439464_0003182 | 3300042439 | Bacteria | 4117 |
| 565 | Ga0439464_0126431 | 3300042439 | Bacteria | 790 |
| 566 | Ga0439460_0002253 | 3300042461 | Bacteria | 4636 |
| 567 | Ga0450901_003463 | 3300042533 | Bacteria | 1644 |
| 568 | Ga0439440_0041725 | 3300042993 | Bacteria | 1120 |
| 569 | Ga0466965_0834830 | 3300044683 | Bacteria | 535 |
| 570 | Ga0466966_0037227 | 3300044684 | Bacteria | 3139 |
| 571 | Ga0466961_0355835 | 3300044693 | Bacteria | 891 |
| 572 | Ga0466968_0087216 | 3300044735 | Bacteria | 1378 |
| 573 | Ga0466957_0581686 | 3300044842 | Bacteria | 783 |
| 574 | Ga0466959_0180664 | 3300045049 | Bacteria | 1476 |
| 575 | Ga0466958_0602654 | 3300045836 | Bacteria | 714 |
| 576 | Ga0466967_0656943 | 3300045976 | Bacteria | 1037 |
| 577 | Ga0466967_2067220 | 3300045976 | Bacteria | 566 |
| 578 | Ga0495592_0128998 | 3300046454 | Bacteria | 1771 |
| 579 | Ga0495592_0151325 | 3300046454 | Bacteria | 1604 |
| 580 | Ga0495592_0355136 | 3300046454 | Bacteria | 939 |
| 581 | Ga0495603_0624689 | 3300046455 | Bacteria | 617 |
| 582 | Ga0495629_0481440 | 3300046459 | Bacteria | 838 |
| 583 | Ga0495629_0664506 | 3300046459 | Bacteria | 693 |
| 584 | Ga0495641_0021235 | 3300046461 | Bacteria | 3270 |
| 585 | Ga0495641_0104193 | 3300046461 | Bacteria | 1266 |
| 586 | Ga0495641_0201483 | 3300046461 | Bacteria | 892 |
| 587 | Ga0495651_0005682 | 3300046462 | Bacteria | 9506 |
| 588 | Ga0495651_0391713 | 3300046462 | Bacteria | 909 |
| 589 | Ga0495651_0513824 | 3300046462 | Bacteria | 765 |
| 590 | Ga0495651_0597985 | 3300046462 | Bacteria | 696 |
| 591 | Ga0495651_0895033 | 3300046462 | Bacteria | 543 |
| 592 | Ga0495653_0058564 | 3300046463 | Bacteria | 2928 |
| 593 | Ga0495653_0533690 | 3300046463 | Bacteria | 728 |
| 594 | Ga0495653_0550953 | 3300046463 | Bacteria | 713 |
| 595 | Ga0495582_0176399 | 3300046473 | Bacteria | 1217 |
| 596 | Ga0495582_0454066 | 3300046473 | Bacteria | 740 |
| 597 | Ga0495582_0748203 | 3300046473 | Bacteria | 566 |
| 598 | Ga0495662_0200332 | 3300046476 | Bacteria | 984 |
| 599 | Ga0495664_0084408 | 3300046477 | Bacteria | 1906 |
| 600 | Ga0495585_0311439 | 3300046492 | Bacteria | 772 |
| 601 | Ga0495594_0641089 | 3300046499 | Bacteria | 602 |
| 602 | Ga0495594_0679396 | 3300046499 | Bacteria | 582 |
| 603 | Ga0495594_0823113 | 3300046499 | Bacteria | 523 |
| 604 | Ga0495608_0069453 | 3300046511 | Bacteria | 2301 |
| 605 | Ga0495608_0420908 | 3300046511 | Bacteria | 815 |
| 606 | Ga0495608_0625484 | 3300046511 | Bacteria | 645 |
| 607 | Ga0495618_0097683 | 3300046514 | Bacteria | 1879 |
| 608 | Ga0495618_0314173 | 3300046514 | Unclassified | 971 |
| 609 | Ga0495628_0019367 | 3300046516 | Bacteria | 5627 |
| 610 | Ga0495628_0168479 | 3300046516 | Bacteria | 1661 |
| 611 | Ga0495628_0231487 | 3300046516 | Bacteria | 1385 |
| 612 | Ga0495628_1210942 | 3300046516 | Bacteria | 512 |
| 613 | Ga0495630_0028174 | 3300046517 | Bacteria | 4173 |
| 614 | Ga0495630_0113574 | 3300046517 | Bacteria | 2052 |
| 615 | Ga0495630_0140615 | 3300046517 | Bacteria | 1835 |
| 616 | Ga0495630_0352319 | 3300046517 | Unclassified | 1127 |
| 617 | Ga0495630_0528407 | 3300046517 | Bacteria | 905 |
| 618 | Ga0495630_1087710 | 3300046517 | Bacteria | 606 |
| 619 | Ga0495666_0291138 | 3300046526 | Bacteria | 739 |
| 620 | Ga0495642_0069434 | 3300046528 | Bacteria | 1472 |
| 621 | Ga0495652_0374333 | 3300046529 | Bacteria | 1014 |
| 622 | Ga0495652_0527843 | 3300046529 | Bacteria | 815 |
| 623 | Ga0495652_0698763 | 3300046529 | Bacteria | 683 |
| 624 | Ga0495640_0056994 | 3300046533 | Bacteria | 2667 |
| 625 | Ga0495640_0076340 | 3300046533 | Bacteria | 2236 |
| 626 | Ga0495640_0087602 | 3300046533 | Bacteria | 2059 |
| 627 | Ga0495640_0800607 | 3300046533 | Bacteria | 562 |
| 628 | Ga0495586_0464037 | 3300046535 | Bacteria | 730 |
| 629 | Ga0495586_0680193 | 3300046535 | Bacteria | 594 |
| 630 | Ga0495587_0132627 | 3300046536 | Bacteria | 1423 |
| 631 | Ga0495587_0205073 | 3300046536 | Bacteria | 1114 |
| 632 | Ga0495587_0770909 | 3300046536 | Bacteria | 526 |
| 633 | Ga0495621_0245483 | 3300046539 | Bacteria | 730 |
| 634 | Ga0495645_0323489 | 3300046543 | Bacteria | 1001 |
| 635 | Ga0495645_0559553 | 3300046543 | Bacteria | 708 |
| 636 | Ga0495622_0291670 | 3300046557 | Unclassified | 712 |
| 637 | Ga0495667_0015268 | 3300046559 | Bacteria | 5186 |
| 638 | Ga0495667_0068099 | 3300046559 | Bacteria | 2325 |
| 639 | Ga0495667_0259101 | 3300046559 | Bacteria | 1106 |
| 640 | Ga0495667_0304783 | 3300046559 | Bacteria | 1009 |
| 641 | Ga0495667_0359884 | 3300046559 | Bacteria | 919 |
| 642 | Ga0495667_0396329 | 3300046559 | Bacteria | 870 |
| 643 | Ga0495634_0209614 | 3300046642 | Bacteria | 1207 |
| 644 | Ga0495634_0424011 | 3300046642 | Bacteria | 788 |
| 645 | Ga0495634_0553314 | 3300046642 | Bacteria | 671 |
| 646 | Ga0495634_0799176 | 3300046642 | Bacteria | 538 |
| 647 | Ga0495635_0046466 | 3300046663 | Bacteria | 2995 |
| 648 | Ga0495635_0280918 | 3300046663 | Bacteria | 1118 |
| 649 | Ga0495635_0565278 | 3300046663 | Bacteria | 745 |
| 650 | Ga0495635_0778175 | 3300046663 | Bacteria | 618 |
| 651 | Ga0495635_1080304 | 3300046663 | Unclassified | 508 |
| 652 | Ga0495657_0017051 | 3300046675 | Bacteria | 5279 |
| 653 | Ga0495657_0096798 | 3300046675 | Bacteria | 1885 |
| 654 | Ga0495657_0184591 | 3300046675 | Bacteria | 1278 |
| 655 | Ga0495657_0278600 | 3300046675 | Bacteria | 1001 |
| 656 | Ga0495657_0361019 | 3300046675 | Bacteria | 858 |
| 657 | Ga0495599_0091479 | 3300046678 | Bacteria | 1898 |
| 658 | Ga0495599_0295148 | 3300046678 | Bacteria | 979 |
| 659 | Ga0495599_0480960 | 3300046678 | Bacteria | 733 |
| 660 | Ga0495623_0248087 | 3300046679 | Bacteria | 1002 |
| 661 | Ga0495646_0237372 | 3300046680 | Bacteria | 981 |
| 662 | Ga0495647_0132473 | 3300046681 | Bacteria | 1057 |
| 663 | Ga0495658_0014297 | 3300046683 | Bacteria | 4053 |
| 664 | Ga0495658_0062617 | 3300046683 | Bacteria | 2139 |
| 665 | Ga0495658_0086682 | 3300046683 | Bacteria | 1848 |
| 666 | Ga0495658_0951589 | 3300046683 | Bacteria | 549 |
| 667 | Ga0495658_1059420 | 3300046683 | Bacteria | 517 |
| 668 | Ga0495613_0653299 | 3300046689 | Bacteria | 696 |
| 669 | Ga0495613_0732338 | 3300046689 | Bacteria | 649 |
| 670 | Ga0495624_0285218 | 3300046690 | Bacteria | 997 |
| 671 | Ga0495624_0356056 | 3300046690 | Bacteria | 880 |
| 672 | Ga0495624_0375872 | 3300046690 | Bacteria | 854 |
| 673 | Ga0495624_0475863 | 3300046690 | Bacteria | 748 |
| 674 | Ga0495649_0641251 | 3300046694 | Bacteria | 523 |
| 675 | Ga0495600_0028453 | 3300046809 | Bacteria | 3616 |
| 676 | Ga0495600_0190559 | 3300046809 | Unclassified | 1319 |
| 677 | Ga0495581_0383626 | 3300047315 | Bacteria | 820 |
| 678 | Ga0495604_0042560 | 3300047317 | Bacteria | 3559 |
| 679 | Ga0495604_0089881 | 3300047317 | Bacteria | 2282 |
| 680 | Ga0495604_0410140 | 3300047317 | Bacteria | 891 |
| 681 | Ga0495604_0600100 | 3300047317 | Bacteria | 706 |
| 682 | Ga0495604_0808674 | 3300047317 | Bacteria | 590 |
| 683 | Ga0495674_0163881 | 3300047319 | Bacteria | 1859 |
| 684 | Ga0495674_0267012 | 3300047319 | Bacteria | 1405 |
| 685 | Ga0495674_0285311 | 3300047319 | Bacteria | 1352 |
| 686 | Ga0495674_0969493 | 3300047319 | Bacteria | 653 |
| 687 | Ga0495676_0177237 | 3300047321 | Bacteria | 1496 |
| 688 | Ga0495676_0324421 | 3300047321 | Bacteria | 1034 |
| 689 | Ga0495676_0475446 | 3300047321 | Bacteria | 822 |
| 690 | Ga0495680_0065023 | 3300047322 | Bacteria | 2795 |
| 691 | Ga0495680_0089549 | 3300047322 | Bacteria | 2310 |
| 692 | Ga0495680_0117332 | 3300047322 | Bacteria | 1967 |
| 693 | Ga0495680_0204490 | 3300047322 | Bacteria | 1415 |
| 694 | Ga0495680_0566005 | 3300047322 | Bacteria | 764 |
| 695 | Ga0495680_0591023 | 3300047322 | Unclassified | 744 |
| 696 | Ga0495680_0939472 | 3300047322 | Bacteria | 556 |
| 697 | Ga0495675_0079892 | 3300047444 | Bacteria | 2060 |
| 698 | Ga0495684_0283136 | 3300047471 | Unclassified | 1195 |
| 699 | Ga0495684_0322488 | 3300047471 | Bacteria | 1104 |
| 700 | Ga0495593_0661103 | 3300047673 | Bacteria | 525 |
| 701 | Ga0495602_0264127 | 3300048088 | Bacteria | 1275 |
| 702 | Ga0495602_0300801 | 3300048088 | Bacteria | 1174 |
| 703 | Ga0495602_0653655 | 3300048088 | Bacteria | 718 |
| 704 | Ga0495614_0125970 | 3300048089 | Bacteria | 1132 |
| 705 | Ga0495614_0225853 | 3300048089 | Bacteria | 852 |
| 706 | Ga0496100_0077946 | 3300048903 | Bacteria | 2229 |
| 707 | Ga0496100_0617189 | 3300048903 | Bacteria | 843 |
| 708 | Ga0496101_0055641 | 3300048904 | Bacteria | 2858 |
| 709 | Ga0496101_1225117 | 3300048904 | Bacteria | 588 |
| 710 | Ga0496101_1268418 | 3300048904 | Bacteria | 577 |
| 711 | Ga0496102_0027272 | 3300048905 | Bacteria | 5100 |
| 712 | Ga0496102_0295812 | 3300048905 | Bacteria | 1526 |
| 713 | Ga0496102_0772597 | 3300048905 | Bacteria | 883 |
| 714 | Ga0496102_1120588 | 3300048905 | Bacteria | 707 |
| 715 | Ga0496102_1181124 | 3300048905 | Bacteria | 685 |
| 716 | Ga0496103_0105389 | 3300048906 | Bacteria | 1788 |
| 717 | Ga0496103_0484622 | 3300048906 | Bacteria | 792 |
| 718 | Ga0496103_0860057 | 3300048906 | Bacteria | 570 |
| 719 | Ga0496104_0089203 | 3300048907 | Bacteria | 2946 |
| 720 | Ga0496104_0335185 | 3300048907 | Bacteria | 1425 |
| 721 | Ga0496104_0563723 | 3300048907 | Bacteria | 1050 |
| 722 | Ga0496104_0876480 | 3300048907 | Bacteria | 803 |
| 723 | Ga0496105_0016968 | 3300048908 | Bacteria | 5826 |
| 724 | Ga0496105_0411240 | 3300048908 | Bacteria | 1072 |
| 725 | Ga0496105_0456126 | 3300048908 | Bacteria | 1008 |
| 726 | Ga0496105_0560820 | 3300048908 | Bacteria | 890 |
| 727 | Ga0496106_0446383 | 3300048909 | Bacteria | 1039 |
| 728 | Ga0496107_0058190 | 3300048910 | Bacteria | 2795 |
| 729 | Ga0496107_0637306 | 3300048910 | Bacteria | 786 |
| 730 | Ga0496107_0914307 | 3300048910 | Bacteria | 639 |
| 731 | Ga0496108_0040002 | 3300048911 | Bacteria | 3907 |
| 732 | Ga0496108_0420159 | 3300048911 | Bacteria | 1168 |
| 733 | Ga0496108_0647265 | 3300048911 | Bacteria | 919 |
| 734 | Ga0496108_0975395 | 3300048911 | Bacteria | 725 |
| 735 | Ga0496109_0013733 | 3300048912 | Bacteria | 7037 |
| 736 | Ga0496109_0627674 | 3300048912 | Bacteria | 1011 |
| 737 | Ga0496109_0669716 | 3300048912 | Bacteria | 975 |
| 738 | Ga0496109_1585368 | 3300048912 | Bacteria | 589 |
| 739 | Ga0496110_0080430 | 3300048913 | Bacteria | 2904 |
| 740 | Ga0496110_0082566 | 3300048913 | Bacteria | 2866 |
| 741 | Ga0496110_0148681 | 3300048913 | Bacteria | 2120 |
| 742 | Ga0496110_0172957 | 3300048913 | Bacteria | 1960 |
| 743 | Ga0496110_1609556 | 3300048913 | Bacteria | 560 |
| 744 | Ga0496111_0295235 | 3300048914 | Bacteria | 1201 |
| 745 | Ga0496111_0558261 | 3300048914 | Bacteria | 840 |
| 746 | Ga0496111_0766280 | 3300048914 | Bacteria | 699 |
| 747 | Ga0496111_1079274 | 3300048914 | Bacteria | 573 |
| 748 | Ga0496112_0164772 | 3300048915 | Bacteria | 2183 |
| 749 | Ga0496112_0660004 | 3300048915 | Bacteria | 975 |
| 750 | Ga0496112_1077872 | 3300048915 | Bacteria | 722 |
| 751 | Ga0496113_1075158 | 3300048916 | Bacteria | 632 |
| 752 | Ga0496114_0124845 | 3300048917 | Bacteria | 2218 |
| 753 | Ga0496114_0169930 | 3300048917 | Bacteria | 1899 |
| 754 | Ga0496114_1411923 | 3300048917 | Bacteria | 583 |
| 755 | Ga0496115_0005604 | 3300048918 | Bacteria | 9139 |
| 756 | Ga0496115_0585738 | 3300048918 | Bacteria | 888 |
| 757 | Ga0501307_062365 | 3300049162 | Bacteria | 581 |
| 758 | Ga0501031_0029061 | 3300049568 | Bacteria | 3605 |
| 759 | Ga0501031_0055955 | 3300049568 | Bacteria | 2570 |
| 760 | Ga0501032_0018194 | 3300049569 | Bacteria | 4925 |
| 761 | Ga0501032_0075987 | 3300049569 | Bacteria | 2237 |
| 762 | Ga0501032_0144989 | 3300049569 | Bacteria | 1563 |
| 763 | Ga0501032_0326977 | 3300049569 | Bacteria | 989 |
| 764 | Ga0501032_0992414 | 3300049569 | Bacteria | 528 |
| 765 | Ga0501033_0010017 | 3300049570 | Bacteria | 7280 |
| 766 | Ga0501033_0052492 | 3300049570 | Bacteria | 3021 |
| 767 | Ga0501033_0068083 | 3300049570 | Bacteria | 2618 |
| 768 | Ga0501034_0001825 | 3300049571 | Bacteria | 27031 |
| 769 | Ga0501034_0011458 | 3300049571 | Bacteria | 9188 |
| 770 | Ga0501034_0026359 | 3300049571 | Bacteria | 5919 |
| 771 | Ga0501034_0070102 | 3300049571 | Bacteria | 3517 |
| 772 | Ga0501036_0007041 | 3300049572 | Bacteria | 9150 |
| 773 | Ga0501036_0008564 | 3300049572 | Bacteria | 8389 |
| 774 | Ga0501036_0201044 | 3300049572 | Bacteria | 1676 |
| 775 | Ga0501036_0253788 | 3300049572 | Bacteria | 1473 |
| 776 | Ga0501036_0280132 | 3300049572 | Bacteria | 1395 |
| 777 | Ga0501036_1534181 | 3300049572 | Bacteria | 539 |
| 778 | Ga0501037_0070950 | 3300049573 | Bacteria | 2534 |
| 779 | Ga0501037_0181099 | 3300049573 | Bacteria | 1495 |
| 780 | Ga0501038_0041698 | 3300049574 | Bacteria | 4002 |
| 781 | Ga0501038_0116577 | 3300049574 | Bacteria | 2207 |
| 782 | Ga0501038_0830753 | 3300049574 | Bacteria | 685 |
| 783 | Ga0501038_1143385 | 3300049574 | Bacteria | 567 |
| 784 | Ga0501039_0005221 | 3300049575 | Bacteria | 9835 |
| 785 | Ga0501039_0141812 | 3300049575 | Bacteria | 1887 |
| 786 | Ga0501039_0776674 | 3300049575 | Bacteria | 748 |
| 787 | Ga0501039_0799519 | 3300049575 | Bacteria | 736 |
| 788 | Ga0501040_0015352 | 3300049576 | Bacteria | 5064 |
| 789 | Ga0501040_0021776 | 3300049576 | Bacteria | 4285 |
| 790 | Ga0501040_0099512 | 3300049576 | Bacteria | 2027 |
| 791 | Ga0501040_0702640 | 3300049576 | Bacteria | 731 |
| 792 | Ga0501041_0152846 | 3300049577 | Bacteria | 1441 |
| 793 | Ga0501041_0578227 | 3300049577 | Bacteria | 717 |
| 794 | Ga0501042_0058389 | 3300049578 | Bacteria | 2754 |
| 795 | Ga0501042_0069895 | 3300049578 | Bacteria | 2511 |
| 796 | Ga0501042_0099595 | 3300049578 | Bacteria | 2089 |
| 797 | Ga0501042_0210980 | 3300049578 | Bacteria | 1401 |
| 798 | Ga0501042_0211014 | 3300049578 | Bacteria | 1401 |
| 799 | Ga0501042_1062975 | 3300049578 | Bacteria | 590 |
| 800 | Ga0501043_0028890 | 3300049579 | Bacteria | 4352 |
| 801 | Ga0501043_0093630 | 3300049579 | Bacteria | 2362 |
| 802 | Ga0501043_0207850 | 3300049579 | Bacteria | 1517 |
| 803 | Ga0501043_0329824 | 3300049579 | Bacteria | 1162 |
| 804 | Ga0501043_0589583 | 3300049579 | Bacteria | 822 |
| 805 | Ga0501046_0054622 | 3300049580 | Bacteria | 3141 |
| 806 | Ga0501046_0074182 | 3300049580 | Bacteria | 2640 |
| 807 | Ga0501046_0088527 | 3300049580 | Bacteria | 2384 |
| 808 | Ga0501046_0142775 | 3300049580 | Bacteria | 1810 |
| 809 | Ga0501046_0841276 | 3300049580 | Bacteria | 642 |
| 810 | Ga0501047_0021371 | 3300049581 | Bacteria | 6211 |
| 811 | Ga0501047_0810406 | 3300049581 | Bacteria | 751 |
| 812 | Ga0501047_1051915 | 3300049581 | Bacteria | 627 |
| 813 | Ga0501048_0007282 | 3300049582 | Bacteria | 8389 |
| 814 | Ga0501048_0012084 | 3300049582 | Bacteria | 6434 |
| 815 | Ga0501048_0273325 | 3300049582 | Bacteria | 1201 |
| 816 | Ga0501048_0879075 | 3300049582 | Bacteria | 644 |
| 817 | Ga0501048_1032031 | 3300049582 | Bacteria | 591 |
| 818 | Ga0501067_0073272 | 3300049583 | Bacteria | 1897 |
| 819 | Ga0501067_0181187 | 3300049583 | Bacteria | 1173 |
| 820 | Ga0501067_0849989 | 3300049583 | Bacteria | 514 |
| 821 | Ga0501068_0060472 | 3300049584 | Bacteria | 2301 |
| 822 | Ga0501068_0085482 | 3300049584 | Bacteria | 1941 |
| 823 | Ga0501068_0110537 | 3300049584 | Bacteria | 1708 |
| 824 | Ga0501068_0310000 | 3300049584 | Bacteria | 1011 |
| 825 | Ga0501068_0353617 | 3300049584 | Bacteria | 944 |
| 826 | Ga0501068_0417811 | 3300049584 | Bacteria | 866 |
| 827 | Ga0501068_0463350 | 3300049584 | Bacteria | 821 |
| 828 | Ga0501068_0743945 | 3300049584 | Bacteria | 642 |
| 829 | Ga0501069_0024577 | 3300049585 | Bacteria | 3286 |
| 830 | Ga0501069_0456180 | 3300049585 | Bacteria | 760 |
| 831 | Ga0501069_0944532 | 3300049585 | Bacteria | 525 |
| 832 | Ga0501070_0015834 | 3300049586 | Bacteria | 6339 |
| 833 | Ga0501070_0081767 | 3300049586 | Bacteria | 2673 |
| 834 | Ga0501070_0128945 | 3300049586 | Bacteria | 2090 |
| 835 | Ga0501070_0237407 | 3300049586 | Bacteria | 1492 |
| 836 | Ga0501070_0273055 | 3300049586 | Bacteria | 1380 |
| 837 | Ga0501070_0421131 | 3300049586 | Bacteria | 1078 |
| 838 | Ga0501070_0456456 | 3300049586 | Bacteria | 1030 |
| 839 | Ga0501070_0548211 | 3300049586 | Bacteria | 926 |
| 840 | Ga0501071_0007079 | 3300049587 | Bacteria | 7328 |
| 841 | Ga0501071_0008766 | 3300049587 | Bacteria | 6699 |
| 842 | Ga0501071_0025765 | 3300049587 | Bacteria | 4121 |
| 843 | Ga0501071_0086358 | 3300049587 | Bacteria | 2301 |
| 844 | Ga0501071_0311569 | 3300049587 | Bacteria | 1194 |
| 845 | Ga0501071_0321234 | 3300049587 | Bacteria | 1176 |
| 846 | Ga0501071_0775276 | 3300049587 | Bacteria | 739 |
| 847 | Ga0501071_1014368 | 3300049587 | Bacteria | 641 |
| 848 | Ga0501071_1049934 | 3300049587 | Bacteria | 629 |
| 849 | Ga0501071_1470997 | 3300049587 | Bacteria | 526 |
| 850 | Ga0501072_0003175 | 3300049588 | Bacteria | 12358 |
| 851 | Ga0501072_0019717 | 3300049588 | Bacteria | 5216 |
| 852 | Ga0501072_0044698 | 3300049588 | Bacteria | 3482 |
| 853 | Ga0501072_0630461 | 3300049588 | Bacteria | 844 |
| 854 | Ga0501072_0723299 | 3300049588 | Bacteria | 782 |
| 855 | Ga0501073_0041651 | 3300049589 | Bacteria | 3245 |
| 856 | Ga0501073_0273544 | 3300049589 | Bacteria | 1165 |
| 857 | Ga0501073_0357846 | 3300049589 | Bacteria | 1008 |
| 858 | Ga0501073_0367927 | 3300049589 | Bacteria | 993 |
| 859 | Ga0501073_0445568 | 3300049589 | Bacteria | 895 |
| 860 | Ga0501073_0828433 | 3300049589 | Bacteria | 638 |
| 861 | Ga0501073_0864369 | 3300049589 | Bacteria | 623 |
| 862 | Ga0501074_0006817 | 3300049590 | Bacteria | 8251 |
| 863 | Ga0501074_0155300 | 3300049590 | Bacteria | 1635 |
| 864 | Ga0501074_0176379 | 3300049590 | Bacteria | 1525 |
| 865 | Ga0501074_0855272 | 3300049590 | Bacteria | 640 |
| 866 | Ga0501074_1016374 | 3300049590 | Bacteria | 583 |
| 867 | Ga0501074_1101261 | 3300049590 | Bacteria | 558 |
| 868 | Ga0501075_0005970 | 3300049591 | Bacteria | 8338 |
| 869 | Ga0501075_0071170 | 3300049591 | Bacteria | 2628 |
| 870 | Ga0501075_0138700 | 3300049591 | Bacteria | 1853 |
| 871 | Ga0501075_0231786 | 3300049591 | Bacteria | 1408 |
| 872 | Ga0501075_0739177 | 3300049591 | Bacteria | 749 |
| 873 | Ga0501075_0956393 | 3300049591 | Bacteria | 651 |
| 874 | Ga0501076_0057523 | 3300049592 | Bacteria | 3087 |
| 875 | Ga0501076_0217698 | 3300049592 | Bacteria | 1561 |
| 876 | Ga0501076_0269045 | 3300049592 | Bacteria | 1395 |
| 877 | Ga0501076_0703038 | 3300049592 | Bacteria | 834 |
| 878 | Ga0501076_1147524 | 3300049592 | Bacteria | 640 |
| 879 | Ga0501076_1342508 | 3300049592 | Bacteria | 588 |
| 880 | Ga0501076_1459667 | 3300049592 | Bacteria | 562 |
| 881 | Ga0501077_0000888 | 3300049593 | Bacteria | 17971 |
| 882 | Ga0501077_0036713 | 3300049593 | Bacteria | 3122 |
| 883 | Ga0501077_0099061 | 3300049593 | Bacteria | 1847 |
| 884 | Ga0501077_0198886 | 3300049593 | Bacteria | 1273 |
| 885 | Ga0501077_0329397 | 3300049593 | Bacteria | 974 |
| 886 | Ga0501077_0552288 | 3300049593 | Bacteria | 739 |
| 887 | Ga0501077_0824762 | 3300049593 | Bacteria | 596 |
| 888 | Ga0501079_0059945 | 3300049741 | Bacteria | 2935 |
| 889 | Ga0501079_0099422 | 3300049741 | Bacteria | 2254 |
| 890 | Ga0501079_0250713 | 3300049741 | Bacteria | 1383 |
| 891 | Ga0501079_0576496 | 3300049741 | Bacteria | 885 |
| 892 | Ga0501079_1262226 | 3300049741 | Bacteria | 582 |
| 893 | Ga0501080_0030535 | 3300049742 | Bacteria | 5021 |
| 894 | Ga0501080_0054028 | 3300049742 | Bacteria | 3741 |
| 895 | Ga0501080_0068025 | 3300049742 | Bacteria | 3313 |
| 896 | Ga0501080_0545144 | 3300049742 | Bacteria | 1033 |
| 897 | Ga0501080_0629606 | 3300049742 | Bacteria | 950 |
| 898 | Ga0501080_1444151 | 3300049742 | Bacteria | 586 |
| 899 | Ga0501081_0067020 | 3300049743 | Bacteria | 2497 |
| 900 | Ga0501081_0103227 | 3300049743 | Bacteria | 2017 |
| 901 | Ga0501081_0335613 | 3300049743 | Bacteria | 1113 |
| 902 | Ga0501081_0575787 | 3300049743 | Bacteria | 842 |
| 903 | Ga0501083_0045532 | 3300049744 | Bacteria | 2968 |
| 904 | Ga0501083_0157882 | 3300049744 | Bacteria | 1484 |
| 905 | Ga0501083_0327849 | 3300049744 | Bacteria | 995 |
| 906 | Ga0501083_0768758 | 3300049744 | Bacteria | 627 |
| 907 | Ga0501083_0989165 | 3300049744 | Bacteria | 547 |
| 908 | Ga0501035_0092379 | 3300049822 | Bacteria | 2663 |
| 909 | Ga0501035_0093954 | 3300049822 | Bacteria | 2638 |
| 910 | Ga0501035_0710222 | 3300049822 | Bacteria | 810 |
| 911 | Ga0501035_1544683 | 3300049822 | Bacteria | 505 |
| 912 | Ga0501044_0005604 | 3300049823 | Bacteria | 13944 |
| 913 | Ga0501044_0145682 | 3300049823 | Bacteria | 2354 |
| 914 | Ga0501044_0188172 | 3300049823 | Bacteria | 2028 |
| 915 | Ga0501044_0305364 | 3300049823 | Bacteria | 1519 |
| 916 | Ga0501045_0001378 | 3300049824 | Bacteria | 16195 |
| 917 | Ga0501045_0037014 | 3300049824 | Bacteria | 3546 |
| 918 | Ga0501045_0389523 | 3300049824 | Bacteria | 1037 |
| 919 | Ga0501045_1330946 | 3300049824 | Bacteria | 522 |
| 920 | nmdc:mga03n38_329755_c1 | 3300050490 | Bacteria | 826 |
| 921 | nmdc:mga03n38_750734_c1 | 3300050490 | Bacteria | 565 |
| 922 | nmdc:mga00v17_4409_c2 | 3300050491 | Bacteria | 4086 |
| 923 | nmdc:mga00v17_457492_c1 | 3300050491 | Bacteria | 828 |
| 924 | nmdc:mga00v17_521782_c1 | 3300050491 | Bacteria | 769 |
| 925 | nmdc:mga00v17_598768_c1 | 3300050491 | Bacteria | 711 |
| 926 | nmdc:mga00v17_665503_c1 | 3300050491 | Bacteria | 669 |
| 927 | nmdc:mga0yw44_1054667_c1 | 3300050492 | Bacteria | 550 |
| 928 | nmdc:mga0yw44_122103_c1 | 3300050492 | Bacteria | 1679 |
| 929 | nmdc:mga0yw44_130682_c1 | 3300050492 | Bacteria | 1625 |
| 930 | nmdc:mga0yw44_248776_c1 | 3300050492 | Bacteria | 1183 |
| 931 | nmdc:mga0yw44_369192_c1 | 3300050492 | Bacteria | 968 |
| 932 | nmdc:mga0yw44_514509_c1 | 3300050492 | Bacteria | 812 |
| 933 | nmdc:mga0yw44_567209_c1 | 3300050492 | Bacteria | 771 |
| 934 | nmdc:mga0yw44_70933_c1 | 3300050492 | Bacteria | 2161 |
| 935 | nmdc:mga0yw44_894416_c1 | 3300050492 | Bacteria | 602 |
| 936 | nmdc:mga0yw44_937358_c1 | 3300050492 | Bacteria | 587 |
| 937 | nmdc:mga0yw44_972161_c1 | 3300050492 | Bacteria | 575 |
| 938 | nmdc:mga06z11_109726_c1 | 3300050494 | Bacteria | 1526 |
| 939 | nmdc:mga06z11_232365_c1 | 3300050494 | Bacteria | 1081 |
| 940 | nmdc:mga06z11_929077_c1 | 3300050494 | Bacteria | 530 |
| 941 | nmdc:mga04h51_5332_c1 | 3300050495 | Bacteria | 3271 |
| 942 | nmdc:mga07m45_489654_c1 | 3300050496 | Bacteria | 712 |
| 943 | nmdc:mga05p37_1282483_c1 | 3300050507 | Bacteria | 748 |
| 944 | nmdc:mga05p37_168911_c1 | 3300050507 | Bacteria | 2669 |
| 945 | nmdc:mga05p37_169986_c1 | 3300050507 | Bacteria | 2659 |
| 946 | nmdc:mga05p37_248599_c1 | 3300050507 | Bacteria | 2134 |
| 947 | nmdc:mga05p37_31336_c1 | 3300050507 | Bacteria | 6495 |
| 948 | nmdc:mga05p37_48432_c1 | 3300050507 | Bacteria | 5227 |
| 949 | nmdc:mga05p37_486603_c1 | 3300050507 | Bacteria | 1420 |
| 950 | nmdc:mga09592_1174618_c1 | 3300050508 | Bacteria | 635 |
| 951 | nmdc:mga09592_1363859_c1 | 3300050508 | Bacteria | 581 |
| 952 | nmdc:mga09592_14153_c1 | 3300050508 | Bacteria | 6507 |
| 953 | nmdc:mga09592_1601914_c1 | 3300050508 | Bacteria | 527 |
| 954 | nmdc:mga09592_174787_c1 | 3300050508 | Bacteria | 1858 |
| 955 | nmdc:mga09592_22064_c1 | 3300050508 | Bacteria | 5253 |
| 956 | nmdc:mga09592_537208_c1 | 3300050508 | Bacteria | 1005 |
| 957 | nmdc:mga09592_58268_c1 | 3300050508 | Bacteria | 3266 |
| 958 | nmdc:mga0qj67_10020_c1 | 3300050509 | Bacteria | 7069 |
| 959 | nmdc:mga0qj67_1097172_c1 | 3300050509 | Bacteria | 622 |
| 960 | nmdc:mga0qj67_25091_c1 | 3300050509 | Bacteria | 4602 |
| 961 | nmdc:mga0qj67_2958_c1 | 3300050509 | Bacteria | 12183 |
| 962 | nmdc:mga0qj67_321947_c1 | 3300050509 | Bacteria | 1252 |
| 963 | nmdc:mga0qj67_352488_c1 | 3300050509 | Bacteria | 1190 |
| 964 | nmdc:mga0qj67_80075_c1 | 3300050509 | Bacteria | 2617 |
| 965 | nmdc:mga06r32_1401943_c1 | 3300050510 | Bacteria | 641 |
| 966 | nmdc:mga06r32_14563_c1 | 3300050510 | Bacteria | 7140 |
| 967 | nmdc:mga06r32_59926_c1 | 3300050510 | Bacteria | 3662 |
| 968 | nmdc:mga06r32_651_c1 | 3300050510 | Bacteria | 30303 |
| 969 | nmdc:mga06r32_973452_c1 | 3300050510 | Bacteria | 802 |
| 970 | nmdc:mga08y16_1055347_c1 | 3300050511 | Bacteria | 790 |
| 971 | nmdc:mga08y16_269645_c1 | 3300050511 | Bacteria | 1757 |
| 972 | nmdc:mga08y16_310310_c1 | 3300050511 | Bacteria | 1625 |
| 973 | nmdc:mga08y16_37553_c1 | 3300050511 | Bacteria | 5086 |
| 974 | nmdc:mga08y16_707484_c1 | 3300050511 | Bacteria | 1007 |
| 975 | nmdc:mga08y16_796174_c1 | 3300050511 | Bacteria | 938 |
| 976 | nmdc:mga08y16_847065_c1 | 3300050511 | Bacteria | 904 |
| 977 | nmdc:mga0n895_1445398_c1 | 3300050512 | Bacteria | 655 |
| 978 | nmdc:mga0n895_367000_c1 | 3300050512 | Bacteria | 1457 |
| 979 | nmdc:mga0n895_445221_c1 | 3300050512 | Bacteria | 1308 |
| 980 | nmdc:mga08x19_1087417_c1 | 3300050514 | Bacteria | 567 |
| 981 | nmdc:mga0a205_1136598_c1 | 3300050515 | Bacteria | 628 |
| 982 | nmdc:mga0a205_1378073_c1 | 3300050515 | Bacteria | 553 |
| 983 | nmdc:mga0a205_371807_c1 | 3300050515 | Bacteria | 1295 |
| 984 | nmdc:mga0sz30_542253_c1 | 3300050516 | Bacteria | 524 |
| 985 | Ga0495601_0010480 | 3300053077 | Bacteria | 5518 |
| 986 | Ga0495601_0075683 | 3300053077 | Bacteria | 2155 |
| 987 | Ga0495601_0279975 | 3300053077 | Bacteria | 1087 |
| 988 | Ga0495601_0283967 | 3300053077 | Bacteria | 1079 |
| 989 | Ga0495601_0603686 | 3300053077 | Bacteria | 704 |
| 990 | Ga0495601_0810885 | 3300053077 | Bacteria | 594 |
| 991 | Ga0495612_0205550 | 3300053078 | Bacteria | 869 |
| 992 | Ga0495612_0249303 | 3300053078 | Bacteria | 790 |
| 993 | Ga0495612_0539124 | 3300053078 | Bacteria | 537 |
| 994 | Ga0495595_0013597 | 3300053084 | Bacteria | 3441 |
| 995 | Ga0495595_0016457 | 3300053084 | Bacteria | 3164 |
| 996 | Ga0495595_0064141 | 3300053084 | Bacteria | 1726 |
| 997 | Ga0495595_0064440 | 3300053084 | Bacteria | 1722 |
| 998 | Ga0495595_0150260 | 3300053084 | Bacteria | 1146 |
| 999 | Ga0495595_0310277 | 3300053084 | Bacteria | 794 |
| 1000 | Ga0495595_0558807 | 3300053084 | Bacteria | 584 |
| 1001 | Ga0495595_0569265 | 3300053084 | Bacteria | 579 |
| 1002 | Ga0495619_0017532 | 3300053085 | Bacteria | 4535 |
| 1003 | Ga0495619_0039309 | 3300053085 | Bacteria | 3088 |
| 1004 | Ga0495619_0069369 | 3300053085 | Bacteria | 2356 |
| 1005 | Ga0495619_0097429 | 3300053085 | Bacteria | 1998 |
| 1006 | Ga0495619_0115619 | 3300053085 | Bacteria | 1836 |
| 1007 | Ga0495619_0183421 | 3300053085 | Bacteria | 1448 |
| 1008 | Ga0495619_0203239 | 3300053085 | Bacteria | 1372 |
| 1009 | Ga0495619_0321426 | 3300053085 | Bacteria | 1071 |
| 1010 | Ga0495619_0401455 | 3300053085 | Bacteria | 946 |
| 1011 | Ga0495619_0602496 | 3300053085 | Bacteria | 752 |
| 1012 | Ga0500646_0029483 | 3300053090 | Bacteria | 1503 |
| 1013 | Ga0500566_0117497 | 3300053094 | Bacteria | 1438 |
| 1014 | Ga0500641_0332521 | 3300053096 | Bacteria | 615 |
| 1015 | Ga0500555_021658 | 3300053103 | Bacteria | 1851 |
| 1016 | Ga0501084_0000009 | 3300054114 | Bacteria | 194961 |
| 1017 | Ga0501084_0003886 | 3300054114 | Bacteria | 12158 |
| 1018 | Ga0501084_0012833 | 3300054114 | Bacteria | 6940 |
| 1019 | Ga0501084_0245432 | 3300054114 | Bacteria | 1511 |
| 1020 | Ga0501084_1122865 | 3300054114 | Bacteria | 660 |
| 1021 | Ga0501084_1355937 | 3300054114 | Bacteria | 596 |
| 1022 | Ga0590075_014969 | 3300059424 | Bacteria | 1900 |
| 1023 | Ga0587070_076971 | 3300059491 | Bacteria | 724 |
| 1024 | Ga0587073_0271416 | 3300059492 | Bacteria | 540 |
| 1025 | Ga0587077_140525 | 3300059493 | Bacteria | 622 |
| 1026 | Ga0587080_120358 | 3300059503 | Bacteria | 581 |
| 1027 | Ga0587082_077902 | 3300059504 | Bacteria | 685 |
| 1028 | Ga0587085_151913 | 3300059506 | Bacteria | 535 |
| 1029 | Ga0587090_052905 | 3300059510 | Bacteria | 749 |
| 1030 | Ga0587092_099521 | 3300059512 | Bacteria | 597 |
| 1031 | Ga0587106_081501 | 3300059605 | Bacteria | 631 |
| 1032 | Ga0587131_006986 | 3300059609 | Bacteria | 743 |
| 1033 | Ga0587099_055129 | 3300059622 | Bacteria | 538 |
| 1034 | Ga0587101_055735 | 3300059623 | Bacteria | 693 |
| 1035 | Ga0587109_115649 | 3300059624 | Bacteria | 632 |
| 1036 | Ga0587109_150584 | 3300059624 | Bacteria | 575 |
| 1037 | Ga0587109_196162 | 3300059624 | Bacteria | 523 |
| 1038 | Ga0587115_091690 | 3300059626 | Bacteria | 552 |
| 1039 | Ga0587115_102224 | 3300059626 | Bacteria | 533 |
| 1040 | Ga0587128_142288 | 3300059630 | Bacteria | 540 |
| 1041 | Ga0587128_168329 | 3300059630 | Bacteria | 510 |
| 1042 | Ga0587062_054287 | 3300059639 | Bacteria | 687 |
| 1043 | Ga0587068_154557 | 3300059641 | Bacteria | 521 |
| 1044 | Ga0587078_049683 | 3300059646 | Bacteria | 612 |
| 1045 | Ga0587079_183250 | 3300059647 | Bacteria | 562 |
| 1046 | Ga0587079_249224 | 3300059647 | Bacteria | 505 |
| 1047 | Ga0587110_031230 | 3300059654 | Bacteria | 650 |
| 1048 | Ga0587114_057106 | 3300059655 | Bacteria | 675 |
| 1049 | Ga0587120_030716 | 3300059659 | Bacteria | 548 |
| 1050 | Ga0587111_0082208 | 3300060346 | Bacteria | 772 |
| 1051 | Ga0587111_0103217 | 3300060346 | Bacteria | 713 |
| 1052 | Ga0501082_0016297 | 3300060353 | Bacteria | 6397 |
| 1053 | Ga0501082_0112758 | 3300060353 | Bacteria | 2354 |
| 1054 | Ga0501082_1189056 | 3300060353 | Bacteria | 666 |
| 1055 | Ga0501082_1384996 | 3300060353 | Bacteria | 614 |
| 1056 | Ga0501082_1551492 | 3300060353 | Bacteria | 578 |
| 1057 | Ga0530510_0019158 | 3300061734 | Bacteria | 4854 |
| 1058 | Ga0530510_0058612 | 3300061734 | Bacteria | 2784 |
| 1059 | Ga0530510_0143446 | 3300061734 | Bacteria | 1760 |
| 1060 | Ga0530510_0426184 | 3300061734 | Bacteria | 1002 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025927 | Ga0207687_11122156 | Ga0207687_111221561 | 49 |
| 2 | 3300009545 | Ga0105237_11231884 | Ga0105237_112318842 | 51 |
| 3 | 3300001991 | JGI24743J22301_10093413 | JGI24743J22301_100934133 | 53 |
| 4 | 3300003579 | Ga0007429J51699_1081227 | Ga0007429J51699_10812272 | 53 |
| 5 | 3300003911 | JGI25405J52794_10007263 | JGI25405J52794_100072632 | 53 |
| 6 | 3300004798 | Ga0058859_11691400 | Ga0058859_116914002 | 53 |
| 7 | 3300004798 | Ga0058859_11763347 | Ga0058859_117633472 | 53 |
| 8 | 3300004799 | Ga0058863_11901821 | Ga0058863_119018212 | 53 |
| 9 | 3300004799 | Ga0058863_11937226 | Ga0058863_119372262 | 53 |
| 10 | 3300004800 | Ga0058861_11583168 | Ga0058861_115831682 | 53 |
| 11 | 3300004800 | Ga0058861_11737476 | Ga0058861_117374762 | 53 |
| 12 | 3300004803 | Ga0058862_10114983 | Ga0058862_101149832 | 53 |
| 13 | 3300004803 | Ga0058862_12780895 | Ga0058862_127808951 | 53 |
| 14 | 3300005327 | Ga0070658_10713506 | Ga0070658_107135064 | 53 |
| 15 | 3300005327 | Ga0070658_11060214 | Ga0070658_110602141 | 53 |
| 16 | 3300005328 | Ga0070676_10221914 | Ga0070676_102219142 | 53 |
| 17 | 3300005328 | Ga0070676_10858029 | Ga0070676_108580292 | 53 |
| 18 | 3300005328 | Ga0070676_11064977 | Ga0070676_110649773 | 53 |
| 19 | 3300005328 | Ga0070676_11195419 | Ga0070676_111954191 | 53 |
| 20 | 3300005329 | Ga0070683_100709232 | Ga0070683_1007092322 | 53 |
| 21 | 3300005329 | Ga0070683_100740591 | Ga0070683_1007405912 | 53 |
| 22 | 3300005329 | Ga0070683_100829688 | Ga0070683_1008296882 | 53 |
| 23 | 3300005329 | Ga0070683_101483179 | Ga0070683_1014831791 | 53 |
| 24 | 3300005331 | Ga0070670_102091255 | Ga0070670_1020912552 | 53 |
| 25 | 3300005331 | Ga0070670_102213498 | Ga0070670_1022134982 | 53 |
| 26 | 3300005334 | Ga0068869_101504766 | Ga0068869_1015047661 | 53 |
| 27 | 3300005334 | Ga0068869_101854245 | Ga0068869_1018542451 | 53 |
| 28 | 3300005335 | Ga0070666_11446764 | Ga0070666_114467641 | 53 |
| 29 | 3300005336 | Ga0070680_101506011 | Ga0070680_1015060112 | 53 |
| 30 | 3300005337 | Ga0070682_100629022 | Ga0070682_1006290224 | 53 |
| 31 | 3300005338 | Ga0068868_100034373 | Ga0068868_1000343734 | 53 |
| 32 | 3300005338 | Ga0068868_102064552 | Ga0068868_1020645522 | 53 |
| 33 | 3300005338 | Ga0068868_102369881 | Ga0068868_1023698812 | 53 |
| 34 | 3300005339 | Ga0070660_101690313 | Ga0070660_1016903132 | 53 |
| 35 | 3300005340 | Ga0070689_101005870 | Ga0070689_1010058701 | 53 |
| 36 | 3300005341 | Ga0070691_10135160 | Ga0070691_101351602 | 53 |
| 37 | 3300005344 | Ga0070661_101606993 | Ga0070661_1016069931 | 53 |
| 38 | 3300005354 | Ga0070675_100079130 | Ga0070675_1000791302 | 53 |
| 39 | 3300005354 | Ga0070675_100477649 | Ga0070675_1004776492 | 53 |
| 40 | 3300005354 | Ga0070675_101718830 | Ga0070675_1017188301 | 53 |
| 41 | 3300005355 | Ga0070671_101862869 | Ga0070671_1018628692 | 53 |
| 42 | 3300005356 | Ga0070674_100293369 | Ga0070674_1002933692 | 53 |
| 43 | 3300005364 | Ga0070673_101108487 | Ga0070673_1011084872 | 53 |
| 44 | 3300005364 | Ga0070673_101257047 | Ga0070673_1012570472 | 53 |
| 45 | 3300005365 | Ga0070688_100719387 | Ga0070688_1007193872 | 53 |
| 46 | 3300005365 | Ga0070688_101726998 | Ga0070688_1017269981 | 53 |
| 47 | 3300005366 | Ga0070659_101480329 | Ga0070659_1014803293 | 53 |
| 48 | 3300005367 | Ga0070667_100664434 | Ga0070667_1006644341 | 53 |
| 49 | 3300005367 | Ga0070667_101120607 | Ga0070667_1011206072 | 53 |
| 50 | 3300005434 | Ga0070709_10364631 | Ga0070709_103646313 | 53 |
| 51 | 3300005435 | Ga0070714_101259885 | Ga0070714_1012598852 | 53 |
| 52 | 3300005435 | Ga0070714_101342730 | Ga0070714_1013427301 | 53 |
| 53 | 3300005436 | Ga0070713_100294117 | Ga0070713_1002941174 | 53 |
| 54 | 3300005436 | Ga0070713_100413850 | Ga0070713_1004138501 | 53 |
| 55 | 3300005437 | Ga0070710_10291202 | Ga0070710_102912022 | 53 |
| 56 | 3300005439 | Ga0070711_100951950 | Ga0070711_1009519501 | 53 |
| 57 | 3300005441 | Ga0070700_100178248 | Ga0070700_1001782485 | 53 |
| 58 | 3300005455 | Ga0070663_100405864 | Ga0070663_1004058642 | 53 |
| 59 | 3300005456 | Ga0070678_100190277 | Ga0070678_1001902774 | 53 |
| 60 | 3300005456 | Ga0070678_100261078 | Ga0070678_1002610784 | 53 |
| 61 | 3300005456 | Ga0070678_100746981 | Ga0070678_1007469813 | 53 |
| 62 | 3300005468 | Ga0070707_100924309 | Ga0070707_1009243092 | 53 |
| 63 | 3300005518 | Ga0070699_100142068 | Ga0070699_1001420685 | 53 |
| 64 | 3300005535 | Ga0070684_100279708 | Ga0070684_1002797084 | 53 |
| 65 | 3300005536 | Ga0070697_101138362 | Ga0070697_1011383622 | 53 |
| 66 | 3300005536 | Ga0070697_101598453 | Ga0070697_1015984532 | 53 |
| 67 | 3300005539 | Ga0068853_102304050 | Ga0068853_1023040502 | 53 |
| 68 | 3300005543 | Ga0070672_100263217 | Ga0070672_1002632173 | 53 |
| 69 | 3300005543 | Ga0070672_100957358 | Ga0070672_1009573582 | 53 |
| 70 | 3300005544 | Ga0070686_100738009 | Ga0070686_1007380092 | 53 |
| 71 | 3300005544 | Ga0070686_101101932 | Ga0070686_1011019321 | 53 |
| 72 | 3300005544 | Ga0070686_101525749 | Ga0070686_1015257492 | 53 |
| 73 | 3300005546 | Ga0070696_100164219 | Ga0070696_1001642194 | 53 |
| 74 | 3300005546 | Ga0070696_100363370 | Ga0070696_1003633703 | 53 |
| 75 | 3300005547 | Ga0070693_100143037 | Ga0070693_1001430373 | 53 |
| 76 | 3300005547 | Ga0070693_101476753 | Ga0070693_1014767532 | 53 |
| 77 | 3300005549 | Ga0070704_100356813 | Ga0070704_1003568133 | 53 |
| 78 | 3300005549 | Ga0070704_101839589 | Ga0070704_1018395892 | 53 |
| 79 | 3300005563 | Ga0068855_100998116 | Ga0068855_1009981162 | 53 |
| 80 | 3300005578 | Ga0068854_100466416 | Ga0068854_1004664162 | 53 |
| 81 | 3300005578 | Ga0068854_100475958 | Ga0068854_1004759582 | 53 |
| 82 | 3300005578 | Ga0068854_101277562 | Ga0068854_1012775623 | 53 |
| 83 | 3300005614 | Ga0068856_100095065 | Ga0068856_1000950656 | 53 |
| 84 | 3300005614 | Ga0068856_101316205 | Ga0068856_1013162052 | 53 |
| 85 | 3300005615 | Ga0070702_100882345 | Ga0070702_1008823454 | 53 |
| 86 | 3300005615 | Ga0070702_101055190 | Ga0070702_1010551901 | 53 |
| 87 | 3300005618 | Ga0068864_100874234 | Ga0068864_1008742342 | 53 |
| 88 | 3300005618 | Ga0068864_101135432 | Ga0068864_1011354324 | 53 |
| 89 | 3300005719 | Ga0068861_101431539 | Ga0068861_1014315392 | 53 |
| 90 | 3300005719 | Ga0068861_101601226 | Ga0068861_1016012261 | 53 |
| 91 | 3300005719 | Ga0068861_101787042 | Ga0068861_1017870422 | 53 |
| 92 | 3300005840 | Ga0068870_11040195 | Ga0068870_110401952 | 53 |
| 93 | 3300005841 | Ga0068863_100957774 | Ga0068863_1009577744 | 53 |
| 94 | 3300005842 | Ga0068858_100749462 | Ga0068858_1007494622 | 53 |
| 95 | 3300005842 | Ga0068858_100915574 | Ga0068858_1009155742 | 53 |
| 96 | 3300005843 | Ga0068860_100779864 | Ga0068860_1007798642 | 53 |
| 97 | 3300005937 | Ga0081455_10007316 | Ga0081455_100073163 | 53 |
| 98 | 3300005937 | Ga0081455_10119047 | Ga0081455_101190472 | 53 |
| 99 | 3300005937 | Ga0081455_10156224 | Ga0081455_101562242 | 53 |
| 100 | 3300005937 | Ga0081455_10319132 | Ga0081455_103191322 | 53 |
| 101 | 3300005937 | Ga0081455_10727658 | Ga0081455_107276581 | 53 |
| 102 | 3300005981 | Ga0081538_10001047 | Ga0081538_1000104725 | 53 |
| 103 | 3300005981 | Ga0081538_10031895 | Ga0081538_100318959 | 53 |
| 104 | 3300005981 | Ga0081538_10036163 | Ga0081538_100361632 | 53 |
| 105 | 3300005983 | Ga0081540_1065959 | Ga0081540_10659594 | 53 |
| 106 | 3300005985 | Ga0081539_10016636 | Ga0081539_100166367 | 53 |
| 107 | 3300006028 | Ga0070717_10610237 | Ga0070717_106102372 | 53 |
| 108 | 3300006028 | Ga0070717_10624837 | Ga0070717_106248372 | 53 |
| 109 | 3300006028 | Ga0070717_11467929 | Ga0070717_114679292 | 53 |
| 110 | 3300006038 | Ga0075365_10032064 | Ga0075365_100320643 | 53 |
| 111 | 3300006038 | Ga0075365_10313913 | Ga0075365_103139131 | 53 |
| 112 | 3300006038 | Ga0075365_10326010 | Ga0075365_103260102 | 53 |
| 113 | 3300006038 | Ga0075365_10395004 | Ga0075365_103950041 | 53 |
| 114 | 3300006038 | Ga0075365_10536235 | Ga0075365_105362352 | 53 |
| 115 | 3300006038 | Ga0075365_10561011 | Ga0075365_105610112 | 53 |
| 116 | 3300006038 | Ga0075365_10627489 | Ga0075365_106274892 | 53 |
| 117 | 3300006038 | Ga0075365_10834040 | Ga0075365_108340402 | 53 |
| 118 | 3300006038 | Ga0075365_10851019 | Ga0075365_108510192 | 53 |
| 119 | 3300006038 | Ga0075365_10978153 | Ga0075365_109781532 | 53 |
| 120 | 3300006042 | Ga0075368_10093386 | Ga0075368_100933862 | 53 |
| 121 | 3300006042 | Ga0075368_10128283 | Ga0075368_101282832 | 53 |
| 122 | 3300006048 | Ga0075363_100266033 | Ga0075363_1002660332 | 53 |
| 123 | 3300006048 | Ga0075363_100349923 | Ga0075363_1003499232 | 53 |
| 124 | 3300006048 | Ga0075363_100390590 | Ga0075363_1003905902 | 53 |
| 125 | 3300006051 | Ga0075364_10037645 | Ga0075364_100376452 | 53 |
| 126 | 3300006051 | Ga0075364_10394716 | Ga0075364_103947162 | 53 |
| 127 | 3300006051 | Ga0075364_10420223 | Ga0075364_104202232 | 53 |
| 128 | 3300006051 | Ga0075364_10535114 | Ga0075364_105351142 | 53 |
| 129 | 3300006051 | Ga0075364_10669665 | Ga0075364_106696651 | 53 |
| 130 | 3300006051 | Ga0075364_10807253 | Ga0075364_108072532 | 53 |
| 131 | 3300006163 | Ga0070715_10324028 | Ga0070715_103240284 | 53 |
| 132 | 3300006173 | Ga0070716_100712634 | Ga0070716_1007126343 | 53 |
| 133 | 3300006173 | Ga0070716_100906196 | Ga0070716_1009061963 | 53 |
| 134 | 3300006177 | Ga0075362_10575273 | Ga0075362_105752732 | 53 |
| 135 | 3300006178 | Ga0075367_10293775 | Ga0075367_102937752 | 53 |
| 136 | 3300006178 | Ga0075367_10340213 | Ga0075367_103402132 | 53 |
| 137 | 3300006237 | Ga0097621_100641734 | Ga0097621_1006417342 | 53 |
| 138 | 3300006237 | Ga0097621_101223606 | Ga0097621_1012236063 | 53 |
| 139 | 3300006237 | Ga0097621_101596973 | Ga0097621_1015969732 | 53 |
| 140 | 3300006358 | Ga0068871_101455335 | Ga0068871_1014553353 | 53 |
| 141 | 3300006844 | Ga0075428_100000196 | Ga0075428_10000019648 | 53 |
| 142 | 3300006844 | Ga0075428_100046579 | Ga0075428_1000465799 | 53 |
| 143 | 3300006844 | Ga0075428_100072837 | Ga0075428_1000728372 | 53 |
| 144 | 3300006844 | Ga0075428_100287916 | Ga0075428_1002879164 | 53 |
| 145 | 3300006844 | Ga0075428_100346990 | Ga0075428_1003469902 | 53 |
| 146 | 3300006844 | Ga0075428_100539167 | Ga0075428_1005391672 | 53 |
| 147 | 3300006844 | Ga0075428_100737499 | Ga0075428_1007374993 | 53 |
| 148 | 3300006844 | Ga0075428_100849081 | Ga0075428_1008490811 | 53 |
| 149 | 3300006844 | Ga0075428_101203607 | Ga0075428_1012036072 | 53 |
| 150 | 3300006846 | Ga0075430_100012671 | Ga0075430_1000126712 | 53 |
| 151 | 3300006846 | Ga0075430_100049095 | Ga0075430_1000490952 | 53 |
| 152 | 3300006846 | Ga0075430_100070604 | Ga0075430_1000706044 | 53 |
| 153 | 3300006846 | Ga0075430_100127275 | Ga0075430_1001272752 | 53 |
| 154 | 3300006846 | Ga0075430_100192817 | Ga0075430_1001928172 | 53 |
| 155 | 3300006846 | Ga0075430_100202436 | Ga0075430_1002024364 | 53 |
| 156 | 3300006846 | Ga0075430_100270421 | Ga0075430_1002704213 | 53 |
| 157 | 3300006846 | Ga0075430_100377322 | Ga0075430_1003773222 | 53 |
| 158 | 3300006846 | Ga0075430_101189960 | Ga0075430_1011899602 | 53 |
| 159 | 3300006847 | Ga0075431_100161427 | Ga0075431_1001614272 | 53 |
| 160 | 3300006847 | Ga0075431_100211212 | Ga0075431_1002112121 | 53 |
| 161 | 3300006847 | Ga0075431_100277739 | Ga0075431_1002777392 | 53 |
| 162 | 3300006847 | Ga0075431_100822029 | Ga0075431_1008220292 | 53 |
| 163 | 3300006847 | Ga0075431_101055693 | Ga0075431_1010556932 | 53 |
| 164 | 3300006847 | Ga0075431_101521337 | Ga0075431_1015213371 | 53 |
| 165 | 3300006847 | Ga0075431_102014511 | Ga0075431_1020145112 | 53 |
| 166 | 3300006852 | Ga0075433_10492269 | Ga0075433_104922692 | 53 |
| 167 | 3300006852 | Ga0075433_11413122 | Ga0075433_114131222 | 53 |
| 168 | 3300006871 | Ga0075434_100463970 | Ga0075434_1004639703 | 53 |
| 169 | 3300006871 | Ga0075434_101629172 | Ga0075434_1016291721 | 53 |
| 170 | 3300006880 | Ga0075429_100017826 | Ga0075429_1000178262 | 53 |
| 171 | 3300006880 | Ga0075429_100080625 | Ga0075429_1000806257 | 53 |
| 172 | 3300006880 | Ga0075429_100241406 | Ga0075429_1002414064 | 53 |
| 173 | 3300006880 | Ga0075429_100335878 | Ga0075429_1003358782 | 53 |
| 174 | 3300006880 | Ga0075429_100513859 | Ga0075429_1005138593 | 53 |
| 175 | 3300006880 | Ga0075429_101092823 | Ga0075429_1010928231 | 53 |
| 176 | 3300006881 | Ga0068865_100875459 | Ga0068865_1008754594 | 53 |
| 177 | 3300006914 | Ga0075436_100767534 | Ga0075436_1007675342 | 53 |
| 178 | 3300007076 | Ga0075435_100924883 | Ga0075435_1009248832 | 53 |
| 179 | 3300009011 | Ga0105251_10236920 | Ga0105251_102369202 | 53 |
| 180 | 3300009011 | Ga0105251_10648095 | Ga0105251_106480952 | 53 |
| 181 | 3300009036 | Ga0105244_10461297 | Ga0105244_104612973 | 53 |
| 182 | 3300009092 | Ga0105250_10219180 | Ga0105250_102191801 | 53 |
| 183 | 3300009093 | Ga0105240_11596371 | Ga0105240_115963712 | 53 |
| 184 | 3300009093 | Ga0105240_12500623 | Ga0105240_125006232 | 53 |
| 185 | 3300009094 | Ga0111539_10017154 | Ga0111539_100171542 | 53 |
| 186 | 3300009094 | Ga0111539_10135171 | Ga0111539_101351712 | 53 |
| 187 | 3300009094 | Ga0111539_10282169 | Ga0111539_102821694 | 53 |
| 188 | 3300009094 | Ga0111539_10866826 | Ga0111539_108668262 | 53 |
| 189 | 3300009094 | Ga0111539_13121165 | Ga0111539_131211652 | 53 |
| 190 | 3300009094 | Ga0111539_13255030 | Ga0111539_132550302 | 53 |
| 191 | 3300009098 | Ga0105245_10006900 | Ga0105245_1000690013 | 53 |
| 192 | 3300009098 | Ga0105245_10112426 | Ga0105245_101124262 | 53 |
| 193 | 3300009098 | Ga0105245_10125360 | Ga0105245_101253602 | 53 |
| 194 | 3300009098 | Ga0105245_10139433 | Ga0105245_101394334 | 53 |
| 195 | 3300009098 | Ga0105245_10307627 | Ga0105245_103076273 | 53 |
| 196 | 3300009147 | Ga0114129_10033505 | Ga0114129_100335052 | 53 |
| 197 | 3300009147 | Ga0114129_10127753 | Ga0114129_101277537 | 53 |
| 198 | 3300009147 | Ga0114129_10218301 | Ga0114129_102183012 | 53 |
| 199 | 3300009147 | Ga0114129_10322269 | Ga0114129_103222692 | 53 |
| 200 | 3300009147 | Ga0114129_10388883 | Ga0114129_103888832 | 53 |
| 201 | 3300009147 | Ga0114129_10495473 | Ga0114129_104954732 | 53 |
| 202 | 3300009147 | Ga0114129_10506886 | Ga0114129_105068862 | 53 |
| 203 | 3300009147 | Ga0114129_10690356 | Ga0114129_106903564 | 53 |
| 204 | 3300009147 | Ga0114129_11561206 | Ga0114129_115612062 | 53 |
| 205 | 3300009147 | Ga0114129_11744361 | Ga0114129_117443611 | 53 |
| 206 | 3300009148 | Ga0105243_11670745 | Ga0105243_116707452 | 53 |
| 207 | 3300009148 | Ga0105243_11730507 | Ga0105243_117305072 | 53 |
| 208 | 3300009148 | Ga0105243_11846910 | Ga0105243_118469102 | 53 |
| 209 | 3300009148 | Ga0105243_11973607 | Ga0105243_119736072 | 53 |
| 210 | 3300009148 | Ga0105243_12458255 | Ga0105243_124582552 | 53 |
| 211 | 3300009174 | Ga0105241_10106762 | Ga0105241_101067624 | 53 |
| 212 | 3300009176 | Ga0105242_10152954 | Ga0105242_101529546 | 53 |
| 213 | 3300009176 | Ga0105242_11067994 | Ga0105242_110679943 | 53 |
| 214 | 3300009176 | Ga0105242_11358445 | Ga0105242_113584452 | 53 |
| 215 | 3300009545 | Ga0105237_10393022 | Ga0105237_103930222 | 53 |
| 216 | 3300009545 | Ga0105237_10580561 | Ga0105237_105805611 | 53 |
| 217 | 3300009545 | Ga0105237_11699055 | Ga0105237_116990552 | 53 |
| 218 | 3300009551 | Ga0105238_10835170 | Ga0105238_108351702 | 53 |
| 219 | 3300009551 | Ga0105238_12046789 | Ga0105238_120467891 | 53 |
| 220 | 3300009551 | Ga0105238_12755047 | Ga0105238_127550472 | 53 |
| 221 | 3300009553 | Ga0105249_10405330 | Ga0105249_104053301 | 53 |
| 222 | 3300009553 | Ga0105249_11258780 | Ga0105249_112587801 | 53 |
| 223 | 3300010375 | Ga0105239_10784491 | Ga0105239_107844912 | 53 |
| 224 | 3300010375 | Ga0105239_10819270 | Ga0105239_108192702 | 53 |
| 225 | 3300010375 | Ga0105239_11193994 | Ga0105239_111939942 | 53 |
| 226 | 3300010375 | Ga0105239_12897952 | Ga0105239_128979522 | 53 |
| 227 | 3300011119 | Ga0105246_10999416 | Ga0105246_109994164 | 53 |
| 228 | 3300011119 | Ga0105246_11422410 | Ga0105246_114224102 | 53 |
| 229 | 3300011119 | Ga0105246_12056615 | Ga0105246_120566151 | 53 |
| 230 | 3300011119 | Ga0105246_12413287 | Ga0105246_124132872 | 53 |
| 231 | 3300012478 | Ga0157328_1008993 | Ga0157328_10089934 | 53 |
| 232 | 3300012503 | Ga0157313_1034469 | Ga0157313_10344691 | 53 |
| 233 | 3300013059 | Ga0154012_106651 | Ga0154012_1066511 | 53 |
| 234 | 3300013104 | Ga0157370_11747096 | Ga0157370_117470962 | 53 |
| 235 | 3300013105 | Ga0157369_11268793 | Ga0157369_112687933 | 53 |
| 236 | 3300013296 | Ga0157374_10807669 | Ga0157374_108076692 | 53 |
| 237 | 3300013296 | Ga0157374_10873496 | Ga0157374_108734962 | 53 |
| 238 | 3300013296 | Ga0157374_11370466 | Ga0157374_113704662 | 53 |
| 239 | 3300013296 | Ga0157374_11706263 | Ga0157374_117062632 | 53 |
| 240 | 3300013297 | Ga0157378_10510658 | Ga0157378_105106582 | 53 |
| 241 | 3300013297 | Ga0157378_11085654 | Ga0157378_110856541 | 53 |
| 242 | 3300013297 | Ga0157378_11444784 | Ga0157378_114447842 | 53 |
| 243 | 3300013297 | Ga0157378_11776044 | Ga0157378_117760444 | 53 |
| 244 | 3300013297 | Ga0157378_13121756 | Ga0157378_131217563 | 53 |
| 245 | 3300013306 | Ga0163162_10256092 | Ga0163162_102560922 | 53 |
| 246 | 3300013306 | Ga0163162_10896354 | Ga0163162_108963543 | 53 |
| 247 | 3300013306 | Ga0163162_11083186 | Ga0163162_110831862 | 53 |
| 248 | 3300013308 | Ga0157375_10118551 | Ga0157375_101185513 | 53 |
| 249 | 3300013308 | Ga0157375_10859841 | Ga0157375_108598412 | 53 |
| 250 | 3300013308 | Ga0157375_12064198 | Ga0157375_120641982 | 53 |
| 251 | 3300013308 | Ga0157375_12614855 | Ga0157375_126148552 | 53 |
| 252 | 3300014325 | Ga0163163_10274565 | Ga0163163_102745654 | 53 |
| 253 | 3300014325 | Ga0163163_10321979 | Ga0163163_103219794 | 53 |
| 254 | 3300014325 | Ga0163163_10714793 | Ga0163163_107147934 | 53 |
| 255 | 3300014325 | Ga0163163_12851582 | Ga0163163_128515821 | 53 |
| 256 | 3300014326 | Ga0157380_10765835 | Ga0157380_107658352 | 53 |
| 257 | 3300014326 | Ga0157380_10851850 | Ga0157380_108518502 | 53 |
| 258 | 3300014326 | Ga0157380_11148986 | Ga0157380_111489862 | 53 |
| 259 | 3300014326 | Ga0157380_12580504 | Ga0157380_125805042 | 53 |
| 260 | 3300014326 | Ga0157380_13351225 | Ga0157380_133512252 | 53 |
| 261 | 3300014497 | Ga0182008_10546950 | Ga0182008_105469501 | 53 |
| 262 | 3300014497 | Ga0182008_10817250 | Ga0182008_108172503 | 53 |
| 263 | 3300014745 | Ga0157377_10472271 | Ga0157377_104722711 | 53 |
| 264 | 3300014745 | Ga0157377_10997759 | Ga0157377_109977592 | 53 |
| 265 | 3300014745 | Ga0157377_11097057 | Ga0157377_110970573 | 53 |
| 266 | 3300014745 | Ga0157377_11100809 | Ga0157377_111008092 | 53 |
| 267 | 3300014968 | Ga0157379_10363435 | Ga0157379_103634352 | 53 |
| 268 | 3300014968 | Ga0157379_10651723 | Ga0157379_106517232 | 53 |
| 269 | 3300014968 | Ga0157379_11829252 | Ga0157379_118292523 | 53 |
| 270 | 3300014968 | Ga0157379_11958008 | Ga0157379_119580082 | 53 |
| 271 | 3300014969 | Ga0157376_10483644 | Ga0157376_104836444 | 53 |
| 272 | 3300014969 | Ga0157376_11267536 | Ga0157376_112675362 | 53 |
| 273 | 3300014969 | Ga0157376_11461812 | Ga0157376_114618122 | 53 |
| 274 | 3300014969 | Ga0157376_11589031 | Ga0157376_115890312 | 53 |
| 275 | 3300017792 | Ga0163161_10248945 | Ga0163161_102489455 | 53 |
| 276 | 3300017792 | Ga0163161_10400335 | Ga0163161_104003352 | 53 |
| 277 | 3300017792 | Ga0163161_11864671 | Ga0163161_118646712 | 53 |
| 278 | 3300019190 | Ga0184600_125282 | Ga0184600_1252823 | 53 |
| 279 | 3300020069 | Ga0197907_10247108 | Ga0197907_102471081 | 53 |
| 280 | 3300020069 | Ga0197907_10589538 | Ga0197907_105895382 | 53 |
| 281 | 3300020069 | Ga0197907_11057705 | Ga0197907_110577052 | 53 |
| 282 | 3300020069 | Ga0197907_11125084 | Ga0197907_111250842 | 53 |
| 283 | 3300020070 | Ga0206356_10024041 | Ga0206356_100240415 | 53 |
| 284 | 3300020070 | Ga0206356_10101155 | Ga0206356_101011553 | 53 |
| 285 | 3300020070 | Ga0206356_10167587 | Ga0206356_101675872 | 53 |
| 286 | 3300020070 | Ga0206356_10687454 | Ga0206356_106874542 | 53 |
| 287 | 3300020070 | Ga0206356_11110022 | Ga0206356_111100222 | 53 |
| 288 | 3300020076 | Ga0206355_1032864 | Ga0206355_10328642 | 53 |
| 289 | 3300020076 | Ga0206355_1142256 | Ga0206355_11422564 | 53 |
| 290 | 3300020076 | Ga0206355_1152352 | Ga0206355_11523523 | 53 |
| 291 | 3300020076 | Ga0206355_1381204 | Ga0206355_13812042 | 53 |
| 292 | 3300020077 | Ga0206351_10782374 | Ga0206351_107823742 | 53 |
| 293 | 3300020078 | Ga0206352_10639442 | Ga0206352_106394422 | 53 |
| 294 | 3300020078 | Ga0206352_10974728 | Ga0206352_109747282 | 53 |
| 295 | 3300020080 | Ga0206350_10384629 | Ga0206350_103846291 | 53 |
| 296 | 3300020080 | Ga0206350_10848760 | Ga0206350_108487602 | 53 |
| 297 | 3300020080 | Ga0206350_10938383 | Ga0206350_109383832 | 53 |
| 298 | 3300020081 | Ga0206354_10706372 | Ga0206354_107063725 | 53 |
| 299 | 3300020081 | Ga0206354_11473913 | Ga0206354_114739132 | 53 |
| 300 | 3300020081 | Ga0206354_11479482 | Ga0206354_114794822 | 53 |
| 301 | 3300020082 | Ga0206353_10024359 | Ga0206353_100243595 | 53 |
| 302 | 3300020082 | Ga0206353_10356547 | Ga0206353_103565472 | 53 |
| 303 | 3300020610 | Ga0154015_1400150 | Ga0154015_14001502 | 53 |
| 304 | 3300021358 | Ga0213873_10020965 | Ga0213873_100209653 | 53 |
| 305 | 3300021384 | Ga0213876_10054990 | Ga0213876_100549902 | 53 |
| 306 | 3300021384 | Ga0213876_10110186 | Ga0213876_101101863 | 53 |
| 307 | 3300021441 | Ga0213871_10238896 | Ga0213871_102388962 | 53 |
| 308 | 3300022467 | Ga0224712_10081246 | Ga0224712_100812462 | 53 |
| 309 | 3300022467 | Ga0224712_10331220 | Ga0224712_103312202 | 53 |
| 310 | 3300023547 | Ga0247554_106394 | Ga0247554_1063943 | 53 |
| 311 | 3300025885 | Ga0207653_10235479 | Ga0207653_102354792 | 53 |
| 312 | 3300025898 | Ga0207692_10153231 | Ga0207692_101532315 | 53 |
| 313 | 3300025898 | Ga0207692_10944941 | Ga0207692_109449412 | 53 |
| 314 | 3300025901 | Ga0207688_10046209 | Ga0207688_100462092 | 53 |
| 315 | 3300025901 | Ga0207688_10473460 | Ga0207688_104734603 | 53 |
| 316 | 3300025903 | Ga0207680_10151280 | Ga0207680_101512802 | 53 |
| 317 | 3300025903 | Ga0207680_10316675 | Ga0207680_103166752 | 53 |
| 318 | 3300025903 | Ga0207680_11127254 | Ga0207680_111272542 | 53 |
| 319 | 3300025906 | Ga0207699_10607684 | Ga0207699_106076842 | 53 |
| 320 | 3300025907 | Ga0207645_10685534 | Ga0207645_106855341 | 53 |
| 321 | 3300025907 | Ga0207645_10840308 | Ga0207645_108403082 | 53 |
| 322 | 3300025908 | Ga0207643_10870332 | Ga0207643_108703321 | 53 |
| 323 | 3300025911 | Ga0207654_10452010 | Ga0207654_104520102 | 53 |
| 324 | 3300025915 | Ga0207693_10500037 | Ga0207693_105000372 | 53 |
| 325 | 3300025915 | Ga0207693_11441010 | Ga0207693_114410101 | 53 |
| 326 | 3300025916 | Ga0207663_11216788 | Ga0207663_112167882 | 53 |
| 327 | 3300025917 | Ga0207660_10097116 | Ga0207660_100971163 | 53 |
| 328 | 3300025918 | Ga0207662_11076343 | Ga0207662_110763432 | 53 |
| 329 | 3300025919 | Ga0207657_10337776 | Ga0207657_103377762 | 53 |
| 330 | 3300025920 | Ga0207649_10150883 | Ga0207649_101508832 | 53 |
| 331 | 3300025920 | Ga0207649_10812147 | Ga0207649_108121472 | 53 |
| 332 | 3300025924 | Ga0207694_10178096 | Ga0207694_101780964 | 53 |
| 333 | 3300025924 | Ga0207694_11812244 | Ga0207694_118122442 | 53 |
| 334 | 3300025925 | Ga0207650_10204959 | Ga0207650_102049594 | 53 |
| 335 | 3300025926 | Ga0207659_10059773 | Ga0207659_100597732 | 53 |
| 336 | 3300025927 | Ga0207687_10070235 | Ga0207687_100702352 | 53 |
| 337 | 3300025927 | Ga0207687_11152352 | Ga0207687_111523522 | 53 |
| 338 | 3300025928 | Ga0207700_10419079 | Ga0207700_104190793 | 53 |
| 339 | 3300025928 | Ga0207700_11118174 | Ga0207700_111181742 | 53 |
| 340 | 3300025928 | Ga0207700_11576877 | Ga0207700_115768771 | 53 |
| 341 | 3300025929 | Ga0207664_11572742 | Ga0207664_115727422 | 53 |
| 342 | 3300025933 | Ga0207706_10382544 | Ga0207706_103825442 | 53 |
| 343 | 3300025933 | Ga0207706_10601087 | Ga0207706_106010871 | 53 |
| 344 | 3300025934 | Ga0207686_10064757 | Ga0207686_100647575 | 53 |
| 345 | 3300025935 | Ga0207709_10599467 | Ga0207709_105994672 | 53 |
| 346 | 3300025935 | Ga0207709_10905988 | Ga0207709_109059882 | 53 |
| 347 | 3300025937 | Ga0207669_10159177 | Ga0207669_101591772 | 53 |
| 348 | 3300025937 | Ga0207669_10344540 | Ga0207669_103445402 | 53 |
| 349 | 3300025937 | Ga0207669_10391164 | Ga0207669_103911642 | 53 |
| 350 | 3300025938 | Ga0207704_10095529 | Ga0207704_100955295 | 53 |
| 351 | 3300025938 | Ga0207704_10345537 | Ga0207704_103455373 | 53 |
| 352 | 3300025939 | Ga0207665_11005653 | Ga0207665_110056532 | 53 |
| 353 | 3300025940 | Ga0207691_10156968 | Ga0207691_101569685 | 53 |
| 354 | 3300025940 | Ga0207691_10590833 | Ga0207691_105908332 | 53 |
| 355 | 3300025940 | Ga0207691_10693260 | Ga0207691_106932602 | 53 |
| 356 | 3300025942 | Ga0207689_10681235 | Ga0207689_106812354 | 53 |
| 357 | 3300025942 | Ga0207689_10813246 | Ga0207689_108132462 | 53 |
| 358 | 3300025944 | Ga0207661_11298879 | Ga0207661_112988792 | 53 |
| 359 | 3300025944 | Ga0207661_12000328 | Ga0207661_120003282 | 53 |
| 360 | 3300025945 | Ga0207679_10366534 | Ga0207679_103665342 | 53 |
| 361 | 3300025945 | Ga0207679_10745577 | Ga0207679_107455773 | 53 |
| 362 | 3300025949 | Ga0207667_12036654 | Ga0207667_120366542 | 53 |
| 363 | 3300025960 | Ga0207651_10493412 | Ga0207651_104934124 | 53 |
| 364 | 3300025960 | Ga0207651_10635441 | Ga0207651_106354412 | 53 |
| 365 | 3300025961 | Ga0207712_11343767 | Ga0207712_113437672 | 53 |
| 366 | 3300025972 | Ga0207668_10821566 | Ga0207668_108215662 | 53 |
| 367 | 3300025972 | Ga0207668_11013627 | Ga0207668_110136272 | 53 |
| 368 | 3300025972 | Ga0207668_11921325 | Ga0207668_119213251 | 53 |
| 369 | 3300025981 | Ga0207640_10479508 | Ga0207640_104795082 | 53 |
| 370 | 3300025986 | Ga0207658_10572746 | Ga0207658_105727462 | 53 |
| 371 | 3300026023 | Ga0207677_10344072 | Ga0207677_103440724 | 53 |
| 372 | 3300026035 | Ga0207703_10656406 | Ga0207703_106564063 | 53 |
| 373 | 3300026035 | Ga0207703_11073099 | Ga0207703_110730991 | 53 |
| 374 | 3300026041 | Ga0207639_10786827 | Ga0207639_107868274 | 53 |
| 375 | 3300026067 | Ga0207678_10365034 | Ga0207678_103650343 | 53 |
| 376 | 3300026075 | Ga0207708_10401534 | Ga0207708_104015345 | 53 |
| 377 | 3300026078 | Ga0207702_10670075 | Ga0207702_106700752 | 53 |
| 378 | 3300026089 | Ga0207648_10288269 | Ga0207648_102882692 | 53 |
| 379 | 3300026089 | Ga0207648_10402964 | Ga0207648_104029643 | 53 |
| 380 | 3300026095 | Ga0207676_12080288 | Ga0207676_120802882 | 53 |
| 381 | 3300026118 | Ga0207675_100166244 | Ga0207675_1001662443 | 53 |
| 382 | 3300026118 | Ga0207675_100619327 | Ga0207675_1006193272 | 53 |
| 383 | 3300026118 | Ga0207675_101612586 | Ga0207675_1016125862 | 53 |
| 384 | 3300026121 | Ga0207683_10087312 | Ga0207683_100873125 | 53 |
| 385 | 3300026121 | Ga0207683_10284136 | Ga0207683_102841362 | 53 |
| 386 | 3300026121 | Ga0207683_10646070 | Ga0207683_106460702 | 53 |
| 387 | 3300026121 | Ga0207683_10795452 | Ga0207683_107954521 | 53 |
| 388 | 3300026121 | Ga0207683_11199042 | Ga0207683_111990422 | 53 |
| 389 | 3300026142 | Ga0207698_12335913 | Ga0207698_123359132 | 53 |
| 390 | 3300027717 | Ga0209998_10184219 | Ga0209998_101842191 | 53 |
| 391 | 3300027866 | Ga0209813_10084645 | Ga0209813_100846452 | 53 |
| 392 | 3300027866 | Ga0209813_10109340 | Ga0209813_101093402 | 53 |
| 393 | 3300027907 | Ga0207428_10084908 | Ga0207428_100849082 | 53 |
| 394 | 3300027907 | Ga0207428_10121688 | Ga0207428_101216882 | 53 |
| 395 | 3300027907 | Ga0207428_10390806 | Ga0207428_103908064 | 53 |
| 396 | 3300027907 | Ga0207428_10874862 | Ga0207428_108748622 | 53 |
| 397 | 3300028017 | Ga0265356_1021342 | Ga0265356_10213422 | 53 |
| 398 | 3300028017 | Ga0265356_1027591 | Ga0265356_10275912 | 53 |
| 399 | 3300028379 | Ga0268266_10966333 | Ga0268266_109663331 | 53 |
| 400 | 3300028380 | Ga0268265_10239570 | Ga0268265_102395705 | 53 |
| 401 | 3300028381 | Ga0268264_12316436 | Ga0268264_123164362 | 53 |
| 402 | 3300028558 | Ga0265326_10017736 | Ga0265326_100177362 | 53 |
| 403 | 3300028573 | Ga0265334_10078979 | Ga0265334_100789792 | 53 |
| 404 | 3300028654 | Ga0265322_10137391 | Ga0265322_101373912 | 53 |
| 405 | 3300028666 | Ga0265336_10006068 | Ga0265336_100060685 | 53 |
| 406 | 3300028800 | Ga0265338_10042488 | Ga0265338_100424887 | 53 |
| 407 | 3300028800 | Ga0265338_10307751 | Ga0265338_103077513 | 53 |
| 408 | 3300030733 | Ga0314311_1180737 | Ga0314311_11807372 | 53 |
| 409 | 3300030745 | Ga0316182_1287661 | Ga0316182_12876612 | 53 |
| 410 | 3300030763 | Ga0265763_1004811 | Ga0265763_10048114 | 53 |
| 411 | 3300030836 | Ga0265767_111628 | Ga0265767_1116281 | 53 |
| 412 | 3300030863 | Ga0265766_1006750 | Ga0265766_10067503 | 53 |
| 413 | 3300030878 | Ga0265770_1020187 | Ga0265770_10201871 | 53 |
| 414 | 3300031090 | Ga0265760_10245547 | Ga0265760_102455473 | 53 |
| 415 | 3300031250 | Ga0265331_10394159 | Ga0265331_103941593 | 53 |
| 416 | 3300031251 | Ga0265327_10003346 | Ga0265327_1000334613 | 53 |
| 417 | 3300031251 | Ga0265327_10150414 | Ga0265327_101504141 | 53 |
| 418 | 3300031251 | Ga0265327_10202506 | Ga0265327_102025062 | 53 |
| 419 | 3300031251 | Ga0265327_10211866 | Ga0265327_102118661 | 53 |
| 420 | 3300031251 | Ga0265327_10517721 | Ga0265327_105177212 | 53 |
| 421 | 3300031548 | Ga0307408_100637289 | Ga0307408_1006372892 | 53 |
| 422 | 3300031548 | Ga0307408_101159554 | Ga0307408_1011595541 | 53 |
| 423 | 3300031665 | Ga0316575_10243219 | Ga0316575_102432192 | 53 |
| 424 | 3300031665 | Ga0316575_10524911 | Ga0316575_105249112 | 53 |
| 425 | 3300031711 | Ga0265314_10287627 | Ga0265314_102876272 | 53 |
| 426 | 3300031711 | Ga0265314_10466220 | Ga0265314_104662203 | 53 |
| 427 | 3300031712 | Ga0265342_10390477 | Ga0265342_103904771 | 53 |
| 428 | 3300031727 | Ga0316576_10088062 | Ga0316576_100880625 | 53 |
| 429 | 3300031727 | Ga0316576_10092047 | Ga0316576_100920473 | 53 |
| 430 | 3300031727 | Ga0316576_10105006 | Ga0316576_101050062 | 53 |
| 431 | 3300031731 | Ga0307405_10948525 | Ga0307405_109485252 | 53 |
| 432 | 3300031824 | Ga0307413_10399232 | Ga0307413_103992321 | 53 |
| 433 | 3300031824 | Ga0307413_11054229 | Ga0307413_110542291 | 53 |
| 434 | 3300031852 | Ga0307410_10577870 | Ga0307410_105778702 | 53 |
| 435 | 3300031852 | Ga0307410_11209769 | Ga0307410_112097691 | 53 |
| 436 | 3300031889 | Ga0326468_10071867 | Ga0326468_100718672 | 53 |
| 437 | 3300031901 | Ga0307406_10368945 | Ga0307406_103689452 | 53 |
| 438 | 3300031903 | Ga0307407_10047656 | Ga0307407_100476563 | 53 |
| 439 | 3300031911 | Ga0307412_11892374 | Ga0307412_118923741 | 53 |
| 440 | 3300031995 | Ga0307409_100154336 | Ga0307409_1001543362 | 53 |
| 441 | 3300031995 | Ga0307409_101867695 | Ga0307409_1018676952 | 53 |
| 442 | 3300031995 | Ga0307409_101961637 | Ga0307409_1019616372 | 53 |
| 443 | 3300031995 | Ga0307409_102307722 | Ga0307409_1023077222 | 53 |
| 444 | 3300032002 | Ga0307416_100508282 | Ga0307416_1005082824 | 53 |
| 445 | 3300032002 | Ga0307416_100623445 | Ga0307416_1006234452 | 53 |
| 446 | 3300032002 | Ga0307416_101048050 | Ga0307416_1010480502 | 53 |
| 447 | 3300032002 | Ga0307416_101445333 | Ga0307416_1014453332 | 53 |
| 448 | 3300032126 | Ga0307415_100170571 | Ga0307415_1001705712 | 53 |
| 449 | 3300032126 | Ga0307415_100361133 | Ga0307415_1003611333 | 53 |
| 450 | 3300032126 | Ga0307415_100679024 | Ga0307415_1006790242 | 53 |
| 451 | 3300032126 | Ga0307415_101078465 | Ga0307415_1010784652 | 53 |
| 452 | 3300032126 | Ga0307415_101542307 | Ga0307415_1015423072 | 53 |
| 453 | 3300032133 | Ga0316583_10025279 | Ga0316583_100252791 | 53 |
| 454 | 3300034820 | Ga0373959_0218525 | Ga0373959_0218525_33_194 | 53 |
| 455 | 3300035083 | Ga0373926_0143683 | Ga0373926_0143683_711_875 | 53 |
| 456 | 3300035084 | Ga0373928_0104417 | Ga0373928_0104417_250_411 | 53 |
| 457 | 3300035089 | Ga0373944_0160046 | Ga0373944_0160046_502_666 | 53 |
| 458 | 3300035113 | Ga0373936_0259042 | Ga0373936_0259042_244_411 | 53 |
| 459 | 3300035115 | Ga0373941_0122679 | Ga0373941_0122679_415_579 | 53 |
| 460 | 3300035115 | Ga0373941_0485803 | Ga0373941_0485803_46_207 | 53 |
| 461 | 3300035117 | Ga0373953_0535639 | Ga0373953_0535639_27_188 | 53 |
| 462 | 3300035118 | Ga0373954_0192125 | Ga0373954_0192125_185_352 | 53 |
| 463 | 3300035118 | Ga0373954_0659212 | Ga0373954_0659212_338_499 | 53 |
| 464 | 3300035119 | Ga0373956_0570298 | Ga0373956_0570298_285_446 | 53 |
| 465 | 3300035120 | Ga0373957_0075203 | Ga0373957_0075203_1012_1179 | 53 |
| 466 | 3300035170 | Ga0373943_0165986 | Ga0373943_0165986_154_318 | 53 |
| 467 | 3300035170 | Ga0373943_0787598 | Ga0373943_0787598_109_270 | 53 |
| 468 | 3300035172 | Ga0373955_0019862 | Ga0373955_0019862_2631_2798 | 53 |
| 469 | 3300035172 | Ga0373955_0722610 | Ga0373955_0722610_23_193 | 53 |
| 470 | 3300035172 | Ga0373955_0902131 | Ga0373955_0902131_167_328 | 53 |
| 471 | 3300035241 | Ga0373961_0320769 | Ga0373961_0320769_340_510 | 53 |
| 472 | 3300035242 | Ga0373962_0387606 | Ga0373962_0387606_324_485 | 53 |
| 473 | 3300035398 | Ga0316574_0119753 | Ga0316574_0119753_1105_1266 | 53 |
| 474 | 3300035398 | Ga0316574_0310356 | Ga0316574_0310356_178_339 | 53 |
| 475 | 3300035691 | Ga0373931_0087405 | Ga0373931_0087405_166_327 | 53 |
| 476 | 3300035691 | Ga0373931_1203545 | Ga0373931_1203545_164_325 | 53 |
| 477 | 3300035692 | Ga0373935_0978227 | Ga0373935_0978227_357_524 | 53 |
| 478 | 3300035692 | Ga0373935_1009759 | Ga0373935_1009759_436_600 | 53 |
| 479 | 3300035692 | Ga0373935_1027252 | Ga0373935_1027252_268_429 | 53 |
| 480 | 3300035695 | Ga0373927_0002910 | Ga0373927_0002910_7642_7806 | 53 |
| 481 | 3300035724 | Ga0373933_0272575 | Ga0373933_0272575_127_294 | 53 |
| 482 | 3300035724 | Ga0373933_0404241 | Ga0373933_0404241_493_654 | 53 |
| 483 | 3300035725 | Ga0373947_0145011 | Ga0373947_0145011_619_789 | 53 |
| 484 | 3300035725 | Ga0373947_0745119 | Ga0373947_0745119_74_238 | 53 |
| 485 | 3300036401 | Ga0373937_0054860 | Ga0373937_0054860_2630_2797 | 53 |
| 486 | 3300036401 | Ga0373937_0116611 | Ga0373937_0116611_1425_1595 | 53 |
| 487 | 3300036401 | Ga0373937_0580766 | Ga0373937_0580766_241_411 | 53 |
| 488 | 3300036401 | Ga0373937_0616501 | Ga0373937_0616501_163_327 | 53 |
| 489 | 3300036401 | Ga0373937_1420592 | Ga0373937_1420592_152_313 | 53 |
| 490 | 3300036401 | Ga0373937_1669340 | Ga0373937_1669340_244_405 | 53 |
| 491 | 3300036401 | Ga0373937_1783256 | Ga0373937_1783256_78_239 | 53 |
| 492 | 3300036401 | Ga0373937_1828365 | Ga0373937_1828365_147_314 | 53 |
| 493 | 3300036401 | Ga0373937_1870122 | Ga0373937_1870122_260_427 | 53 |
| 494 | 3300036457 | Ga0265778_029342 | Ga0265778_029342_197_361 | 53 |
| 495 | 3300036647 | Ga0316582_0020691 | Ga0316582_0020691_1657_1821 | 53 |
| 496 | 3300036712 | Ga0316584_0090261 | Ga0316584_0090261_111_275 | 53 |
| 497 | 3300036712 | Ga0316584_0090430 | Ga0316584_0090430_892_1056 | 53 |
| 498 | 3300036712 | Ga0316584_0871483 | Ga0316584_0871483_254_415 | 53 |
| 499 | 3300037068 | Ga0373925_0074969 | Ga0373925_0074969_109_273 | 53 |
| 500 | 3300037068 | Ga0373925_0273612 | Ga0373925_0273612_376_537 | 53 |
| 501 | 3300037068 | Ga0373925_0716708 | Ga0373925_0716708_221_382 | 53 |
| 502 | 3300037471 | Ga0395905_0349343 | Ga0395905_0349343_664_828 | 53 |
| 503 | 3300037853 | Ga0436364_1339422 | Ga0436364_1339422_931_1095 | 53 |
| 504 | 3300038443 | Ga0395901_0292595 | Ga0395901_0292595_1425_1592 | 53 |
| 505 | 3300039437 | Ga0436365_0864646 | Ga0436365_0864646_841_1005 | 53 |
| 506 | 3300039437 | Ga0436365_1137434 | Ga0436365_1137434_4208_4372 | 53 |
| 507 | 3300039438 | Ga0436360_0398486 | Ga0436360_0398486_980_1144 | 53 |
| 508 | 3300039438 | Ga0436360_1025531 | Ga0436360_1025531_279_443 | 53 |
| 509 | 3300039447 | Ga0436361_0347571 | Ga0436361_0347571_104_268 | 53 |
| 510 | 3300039447 | Ga0436361_0363213 | Ga0436361_0363213_57_221 | 53 |
| 511 | 3300039450 | Ga0436363_0158754 | Ga0436363_0158754_446_616 | 53 |
| 512 | 3300039453 | Ga0436362_0452528 | Ga0436362_0452528_50_214 | 53 |
| 513 | 3300039453 | Ga0436362_0574409 | Ga0436362_0574409_55_219 | 53 |
| 514 | 3300039453 | Ga0436362_0610963 | Ga0436362_0610963_96_260 | 53 |
| 515 | 3300039453 | Ga0436362_0926769 | Ga0436362_0926769_4708_4872 | 53 |
| 516 | 3300039453 | Ga0436362_1267422 | Ga0436362_1267422_254_421 | 53 |
| 517 | 3300041405 | Ga0439438_087931 | Ga0439438_087931_453_620 | 53 |
| 518 | 3300041407 | Ga0439447_082074 | Ga0439447_082074_17_181 | 53 |
| 519 | 3300041407 | Ga0439447_144531 | Ga0439447_144531_114_281 | 53 |
| 520 | 3300041411 | Ga0439466_0060806 | Ga0439466_0060806_303_470 | 53 |
| 521 | 3300041413 | Ga0439465_0115468 | Ga0439465_0115468_92_259 | 53 |
| 522 | 3300041413 | Ga0439465_0185422 | Ga0439465_0185422_555_722 | 53 |
| 523 | 3300041443 | Ga0451789_0295635 | Ga0451789_0295635_181_345 | 53 |
| 524 | 3300041443 | Ga0451789_0691516 | Ga0451789_0691516_400_561 | 53 |
| 525 | 3300041443 | Ga0451789_1001237 | Ga0451789_1001237_317_481 | 53 |
| 526 | 3300041452 | Ga0451793_0786865 | Ga0451793_0786865_45_212 | 53 |
| 527 | 3300041452 | Ga0451793_0888147 | Ga0451793_0888147_94_261 | 53 |
| 528 | 3300041459 | Ga0451800_0557038 | Ga0451800_0557038_289_456 | 53 |
| 529 | 3300041459 | Ga0451800_1560776 | Ga0451800_1560776_248_409 | 53 |
| 530 | 3300041460 | Ga0451802_0727857 | Ga0451802_0727857_329_496 | 53 |
| 531 | 3300041463 | Ga0451804_0322183 | Ga0451804_0322183_160_324 | 53 |
| 532 | 3300041486 | Ga0451807_0805328 | Ga0451807_0805328_36_197 | 53 |
| 533 | 3300041491 | Ga0451833_0476916 | Ga0451833_0476916_135_296 | 53 |
| 534 | 3300041492 | Ga0451835_0236827 | Ga0451835_0236827_349_513 | 53 |
| 535 | 3300041494 | Ga0451837_0284750 | Ga0451837_0284750_281_442 | 53 |
| 536 | 3300041494 | Ga0451837_1331350 | Ga0451837_1331350_217_381 | 53 |
| 537 | 3300041498 | Ga0451841_1231041 | Ga0451841_1231041_292_453 | 53 |
| 538 | 3300041501 | Ga0451845_0696073 | Ga0451845_0696073_399_566 | 53 |
| 539 | 3300041501 | Ga0451845_0849781 | Ga0451845_0849781_189_353 | 53 |
| 540 | 3300041509 | Ga0451843_0421569 | Ga0451843_0421569_192_359 | 53 |
| 541 | 3300041511 | Ga0451855_0451382 | Ga0451855_0451382_518_679 | 53 |
| 542 | 3300041511 | Ga0451855_0993140 | Ga0451855_0993140_121_285 | 53 |
| 543 | 3300041511 | Ga0451855_1220682 | Ga0451855_1220682_293_457 | 53 |
| 544 | 3300041512 | Ga0451853_3989981 | Ga0451853_3989981_153_314 | 53 |
| 545 | 3300041512 | Ga0451853_3990262 | Ga0451853_3990262_241_402 | 53 |
| 546 | 3300042003 | Ga0439443_003376 | Ga0439443_003376_333_500 | 53 |
| 547 | 3300042005 | Ga0439448_0016232 | Ga0439448_0016232_900_1067 | 53 |
| 548 | 3300042006 | Ga0439432_097560 | Ga0439432_097560_445_612 | 53 |
| 549 | 3300042008 | Ga0439450_004279 | Ga0439450_004279_2136_2303 | 53 |
| 550 | 3300042009 | Ga0439451_015259 | Ga0439451_015259_639_806 | 53 |
| 551 | 3300042010 | Ga0439452_048599 | Ga0439452_048599_206_373 | 53 |
| 552 | 3300042011 | Ga0439454_012781 | Ga0439454_012781_36_203 | 53 |
| 553 | 3300042012 | Ga0439455_0003578 | Ga0439455_0003578_910_1077 | 53 |
| 554 | 3300042013 | Ga0439456_069019 | Ga0439456_069019_376_543 | 53 |
| 555 | 3300042015 | Ga0439462_0060113 | Ga0439462_0060113_704_871 | 53 |
| 556 | 3300042016 | Ga0439463_001797 | Ga0439463_001797_4910_5077 | 53 |
| 557 | 3300042118 | Ga0450914_013191 | Ga0450914_013191_29_196 | 53 |
| 558 | 3300042122 | Ga0450920_091232 | Ga0450920_091232_199_366 | 53 |
| 559 | 3300042125 | Ga0450923_064275 | Ga0450923_064275_79_246 | 53 |
| 560 | 3300042156 | Ga0439446_0233382 | Ga0439446_0233382_307_474 | 53 |
| 561 | 3300042435 | Ga0439434_0076777 | Ga0439434_0076777_206_373 | 53 |
| 562 | 3300042436 | Ga0439435_0115736 | Ga0439435_0115736_649_816 | 53 |
| 563 | 3300042437 | Ga0439444_0000757 | Ga0439444_0000757_2601_2768 | 53 |
| 564 | 3300042439 | Ga0439464_0003182 | Ga0439464_0003182_1198_1365 | 53 |
| 565 | 3300042439 | Ga0439464_0126431 | Ga0439464_0126431_601_768 | 53 |
| 566 | 3300042461 | Ga0439460_0002253 | Ga0439460_0002253_3532_3699 | 53 |
| 567 | 3300042533 | Ga0450901_003463 | Ga0450901_003463_747_914 | 53 |
| 568 | 3300042993 | Ga0439440_0041725 | Ga0439440_0041725_43_210 | 53 |
| 569 | 3300044683 | Ga0466965_0834830 | Ga0466965_0834830_77_244 | 53 |
| 570 | 3300044684 | Ga0466966_0037227 | Ga0466966_0037227_719_883 | 53 |
| 571 | 3300044693 | Ga0466961_0355835 | Ga0466961_0355835_580_744 | 53 |
| 572 | 3300044735 | Ga0466968_0087216 | Ga0466968_0087216_18_179 | 53 |
| 573 | 3300044842 | Ga0466957_0581686 | Ga0466957_0581686_295_459 | 53 |
| 574 | 3300045049 | Ga0466959_0180664 | Ga0466959_0180664_1059_1223 | 53 |
| 575 | 3300045836 | Ga0466958_0602654 | Ga0466958_0602654_283_447 | 53 |
| 576 | 3300045976 | Ga0466967_0656943 | Ga0466967_0656943_484_651 | 53 |
| 577 | 3300045976 | Ga0466967_2067220 | Ga0466967_2067220_109_279 | 53 |
| 578 | 3300046454 | Ga0495592_0128998 | Ga0495592_0128998_1400_1564 | 53 |
| 579 | 3300046454 | Ga0495592_0151325 | Ga0495592_0151325_500_661 | 53 |
| 580 | 3300046454 | Ga0495592_0355136 | Ga0495592_0355136_618_785 | 53 |
| 581 | 3300046455 | Ga0495603_0624689 | Ga0495603_0624689_351_521 | 53 |
| 582 | 3300046459 | Ga0495629_0481440 | Ga0495629_0481440_345_512 | 53 |
| 583 | 3300046459 | Ga0495629_0664506 | Ga0495629_0664506_160_330 | 53 |
| 584 | 3300046461 | Ga0495641_0021235 | Ga0495641_0021235_660_821 | 53 |
| 585 | 3300046461 | Ga0495641_0104193 | Ga0495641_0104193_447_608 | 53 |
| 586 | 3300046461 | Ga0495641_0201483 | Ga0495641_0201483_232_393 | 53 |
| 587 | 3300046462 | Ga0495651_0005682 | Ga0495651_0005682_4415_4582 | 53 |
| 588 | 3300046462 | Ga0495651_0391713 | Ga0495651_0391713_378_548 | 53 |
| 589 | 3300046462 | Ga0495651_0513824 | Ga0495651_0513824_115_276 | 53 |
| 590 | 3300046462 | Ga0495651_0597985 | Ga0495651_0597985_364_528 | 53 |
| 591 | 3300046462 | Ga0495651_0895033 | Ga0495651_0895033_222_383 | 53 |
| 592 | 3300046463 | Ga0495653_0058564 | Ga0495653_0058564_2612_2776 | 53 |
| 593 | 3300046463 | Ga0495653_0533690 | Ga0495653_0533690_279_443 | 53 |
| 594 | 3300046463 | Ga0495653_0550953 | Ga0495653_0550953_451_618 | 53 |
| 595 | 3300046473 | Ga0495582_0176399 | Ga0495582_0176399_820_981 | 53 |
| 596 | 3300046473 | Ga0495582_0454066 | Ga0495582_0454066_10_171 | 53 |
| 597 | 3300046473 | Ga0495582_0748203 | Ga0495582_0748203_246_407 | 53 |
| 598 | 3300046476 | Ga0495662_0200332 | Ga0495662_0200332_192_353 | 53 |
| 599 | 3300046477 | Ga0495664_0084408 | Ga0495664_0084408_908_1075 | 53 |
| 600 | 3300046492 | Ga0495585_0311439 | Ga0495585_0311439_56_220 | 53 |
| 601 | 3300046499 | Ga0495594_0641089 | Ga0495594_0641089_265_426 | 53 |
| 602 | 3300046499 | Ga0495594_0679396 | Ga0495594_0679396_95_256 | 53 |
| 603 | 3300046499 | Ga0495594_0823113 | Ga0495594_0823113_144_305 | 53 |
| 604 | 3300046511 | Ga0495608_0069453 | Ga0495608_0069453_1993_2160 | 53 |
| 605 | 3300046511 | Ga0495608_0420908 | Ga0495608_0420908_148_309 | 53 |
| 606 | 3300046511 | Ga0495608_0625484 | Ga0495608_0625484_34_204 | 53 |
| 607 | 3300046514 | Ga0495618_0097683 | Ga0495618_0097683_227_388 | 53 |
| 608 | 3300046514 | Ga0495618_0314173 | Ga0495618_0314173_748_909 | 53 |
| 609 | 3300046516 | Ga0495628_0019367 | Ga0495628_0019367_2127_2288 | 53 |
| 610 | 3300046516 | Ga0495628_0168479 | Ga0495628_0168479_1384_1545 | 53 |
| 611 | 3300046516 | Ga0495628_0231487 | Ga0495628_0231487_225_392 | 53 |
| 612 | 3300046516 | Ga0495628_1210942 | Ga0495628_1210942_251_418 | 53 |
| 613 | 3300046517 | Ga0495630_0028174 | Ga0495630_0028174_985_1146 | 53 |
| 614 | 3300046517 | Ga0495630_0113574 | Ga0495630_0113574_1238_1399 | 53 |
| 615 | 3300046517 | Ga0495630_0140615 | Ga0495630_0140615_118_288 | 53 |
| 616 | 3300046517 | Ga0495630_0352319 | Ga0495630_0352319_58_219 | 53 |
| 617 | 3300046517 | Ga0495630_0528407 | Ga0495630_0528407_285_449 | 53 |
| 618 | 3300046517 | Ga0495630_1087710 | Ga0495630_1087710_239_409 | 53 |
| 619 | 3300046526 | Ga0495666_0291138 | Ga0495666_0291138_159_320 | 53 |
| 620 | 3300046528 | Ga0495642_0069434 | Ga0495642_0069434_1167_1337 | 53 |
| 621 | 3300046529 | Ga0495652_0374333 | Ga0495652_0374333_693_860 | 53 |
| 622 | 3300046529 | Ga0495652_0527843 | Ga0495652_0527843_339_500 | 53 |
| 623 | 3300046529 | Ga0495652_0698763 | Ga0495652_0698763_129_290 | 53 |
| 624 | 3300046533 | Ga0495640_0056994 | Ga0495640_0056994_1690_1851 | 53 |
| 625 | 3300046533 | Ga0495640_0076340 | Ga0495640_0076340_799_966 | 53 |
| 626 | 3300046533 | Ga0495640_0087602 | Ga0495640_0087602_1770_1931 | 53 |
| 627 | 3300046533 | Ga0495640_0800607 | Ga0495640_0800607_357_527 | 53 |
| 628 | 3300046535 | Ga0495586_0464037 | Ga0495586_0464037_36_200 | 53 |
| 629 | 3300046535 | Ga0495586_0680193 | Ga0495586_0680193_13_183 | 53 |
| 630 | 3300046536 | Ga0495587_0132627 | Ga0495587_0132627_690_857 | 53 |
| 631 | 3300046536 | Ga0495587_0205073 | Ga0495587_0205073_79_240 | 53 |
| 632 | 3300046536 | Ga0495587_0770909 | Ga0495587_0770909_97_258 | 53 |
| 633 | 3300046539 | Ga0495621_0245483 | Ga0495621_0245483_160_327 | 53 |
| 634 | 3300046543 | Ga0495645_0323489 | Ga0495645_0323489_709_876 | 53 |
| 635 | 3300046543 | Ga0495645_0559553 | Ga0495645_0559553_250_414 | 53 |
| 636 | 3300046557 | Ga0495622_0291670 | Ga0495622_0291670_90_251 | 53 |
| 637 | 3300046559 | Ga0495667_0015268 | Ga0495667_0015268_151_318 | 53 |
| 638 | 3300046559 | Ga0495667_0068099 | Ga0495667_0068099_1193_1354 | 53 |
| 639 | 3300046559 | Ga0495667_0259101 | Ga0495667_0259101_131_292 | 53 |
| 640 | 3300046559 | Ga0495667_0304783 | Ga0495667_0304783_724_885 | 53 |
| 641 | 3300046559 | Ga0495667_0359884 | Ga0495667_0359884_339_503 | 53 |
| 642 | 3300046559 | Ga0495667_0396329 | Ga0495667_0396329_132_302 | 53 |
| 643 | 3300046642 | Ga0495634_0209614 | Ga0495634_0209614_67_234 | 53 |
| 644 | 3300046642 | Ga0495634_0424011 | Ga0495634_0424011_568_729 | 53 |
| 645 | 3300046642 | Ga0495634_0553314 | Ga0495634_0553314_152_316 | 53 |
| 646 | 3300046642 | Ga0495634_0799176 | Ga0495634_0799176_325_495 | 53 |
| 647 | 3300046663 | Ga0495635_0046466 | Ga0495635_0046466_2681_2848 | 53 |
| 648 | 3300046663 | Ga0495635_0280918 | Ga0495635_0280918_668_829 | 53 |
| 649 | 3300046663 | Ga0495635_0565278 | Ga0495635_0565278_46_210 | 53 |
| 650 | 3300046663 | Ga0495635_0778175 | Ga0495635_0778175_394_555 | 53 |
| 651 | 3300046663 | Ga0495635_1080304 | Ga0495635_1080304_37_198 | 53 |
| 652 | 3300046675 | Ga0495657_0017051 | Ga0495657_0017051_4964_5131 | 53 |
| 653 | 3300046675 | Ga0495657_0096798 | Ga0495657_0096798_1628_1789 | 53 |
| 654 | 3300046675 | Ga0495657_0184591 | Ga0495657_0184591_728_898 | 53 |
| 655 | 3300046675 | Ga0495657_0278600 | Ga0495657_0278600_344_508 | 53 |
| 656 | 3300046675 | Ga0495657_0361019 | Ga0495657_0361019_137_298 | 53 |
| 657 | 3300046678 | Ga0495599_0091479 | Ga0495599_0091479_1717_1887 | 53 |
| 658 | 3300046678 | Ga0495599_0295148 | Ga0495599_0295148_148_309 | 53 |
| 659 | 3300046678 | Ga0495599_0480960 | Ga0495599_0480960_202_366 | 53 |
| 660 | 3300046679 | Ga0495623_0248087 | Ga0495623_0248087_693_860 | 53 |
| 661 | 3300046680 | Ga0495646_0237372 | Ga0495646_0237372_273_434 | 53 |
| 662 | 3300046681 | Ga0495647_0132473 | Ga0495647_0132473_262_432 | 53 |
| 663 | 3300046683 | Ga0495658_0014297 | Ga0495658_0014297_335_496 | 53 |
| 664 | 3300046683 | Ga0495658_0062617 | Ga0495658_0062617_922_1083 | 53 |
| 665 | 3300046683 | Ga0495658_0086682 | Ga0495658_0086682_1471_1641 | 53 |
| 666 | 3300046683 | Ga0495658_0951589 | Ga0495658_0951589_228_392 | 53 |
| 667 | 3300046683 | Ga0495658_1059420 | Ga0495658_1059420_285_446 | 53 |
| 668 | 3300046689 | Ga0495613_0653299 | Ga0495613_0653299_385_555 | 53 |
| 669 | 3300046689 | Ga0495613_0732338 | Ga0495613_0732338_190_360 | 53 |
| 670 | 3300046690 | Ga0495624_0285218 | Ga0495624_0285218_281_442 | 53 |
| 671 | 3300046690 | Ga0495624_0356056 | Ga0495624_0356056_271_432 | 53 |
| 672 | 3300046690 | Ga0495624_0375872 | Ga0495624_0375872_164_325 | 53 |
| 673 | 3300046690 | Ga0495624_0475863 | Ga0495624_0475863_127_297 | 53 |
| 674 | 3300046694 | Ga0495649_0641251 | Ga0495649_0641251_176_337 | 53 |
| 675 | 3300046809 | Ga0495600_0028453 | Ga0495600_0028453_3295_3462 | 53 |
| 676 | 3300046809 | Ga0495600_0190559 | Ga0495600_0190559_1138_1299 | 53 |
| 677 | 3300047315 | Ga0495581_0383626 | Ga0495581_0383626_54_215 | 53 |
| 678 | 3300047317 | Ga0495604_0042560 | Ga0495604_0042560_1534_1695 | 53 |
| 679 | 3300047317 | Ga0495604_0089881 | Ga0495604_0089881_716_883 | 53 |
| 680 | 3300047317 | Ga0495604_0410140 | Ga0495604_0410140_471_632 | 53 |
| 681 | 3300047317 | Ga0495604_0600100 | Ga0495604_0600100_104_268 | 53 |
| 682 | 3300047317 | Ga0495604_0808674 | Ga0495604_0808674_276_437 | 53 |
| 683 | 3300047319 | Ga0495674_0163881 | Ga0495674_0163881_1101_1268 | 53 |
| 684 | 3300047319 | Ga0495674_0267012 | Ga0495674_0267012_1027_1191 | 53 |
| 685 | 3300047319 | Ga0495674_0285311 | Ga0495674_0285311_1074_1235 | 53 |
| 686 | 3300047319 | Ga0495674_0969493 | Ga0495674_0969493_83_253 | 53 |
| 687 | 3300047321 | Ga0495676_0177237 | Ga0495676_0177237_1044_1205 | 53 |
| 688 | 3300047321 | Ga0495676_0324421 | Ga0495676_0324421_231_401 | 53 |
| 689 | 3300047321 | Ga0495676_0475446 | Ga0495676_0475446_133_303 | 53 |
| 690 | 3300047322 | Ga0495680_0065023 | Ga0495680_0065023_209_370 | 53 |
| 691 | 3300047322 | Ga0495680_0089549 | Ga0495680_0089549_1859_2020 | 53 |
| 692 | 3300047322 | Ga0495680_0117332 | Ga0495680_0117332_54_218 | 53 |
| 693 | 3300047322 | Ga0495680_0204490 | Ga0495680_0204490_1094_1261 | 53 |
| 694 | 3300047322 | Ga0495680_0566005 | Ga0495680_0566005_254_424 | 53 |
| 695 | 3300047322 | Ga0495680_0591023 | Ga0495680_0591023_566_727 | 53 |
| 696 | 3300047322 | Ga0495680_0939472 | Ga0495680_0939472_121_285 | 53 |
| 697 | 3300047444 | Ga0495675_0079892 | Ga0495675_0079892_426_587 | 53 |
| 698 | 3300047471 | Ga0495684_0283136 | Ga0495684_0283136_1003_1164 | 53 |
| 699 | 3300047471 | Ga0495684_0322488 | Ga0495684_0322488_795_959 | 53 |
| 700 | 3300047673 | Ga0495593_0661103 | Ga0495593_0661103_207_368 | 53 |
| 701 | 3300048088 | Ga0495602_0264127 | Ga0495602_0264127_958_1125 | 53 |
| 702 | 3300048088 | Ga0495602_0300801 | Ga0495602_0300801_115_279 | 53 |
| 703 | 3300048088 | Ga0495602_0653655 | Ga0495602_0653655_392_556 | 53 |
| 704 | 3300048089 | Ga0495614_0125970 | Ga0495614_0125970_954_1121 | 53 |
| 705 | 3300048089 | Ga0495614_0225853 | Ga0495614_0225853_329_499 | 53 |
| 706 | 3300048903 | Ga0496100_0077946 | Ga0496100_0077946_475_636 | 53 |
| 707 | 3300048903 | Ga0496100_0617189 | Ga0496100_0617189_584_748 | 53 |
| 708 | 3300048904 | Ga0496101_0055641 | Ga0496101_0055641_2102_2263 | 53 |
| 709 | 3300048904 | Ga0496101_1225117 | Ga0496101_1225117_182_343 | 53 |
| 710 | 3300048904 | Ga0496101_1268418 | Ga0496101_1268418_394_555 | 53 |
| 711 | 3300048905 | Ga0496102_0027272 | Ga0496102_0027272_1814_1975 | 53 |
| 712 | 3300048905 | Ga0496102_0295812 | Ga0496102_0295812_766_927 | 53 |
| 713 | 3300048905 | Ga0496102_0772597 | Ga0496102_0772597_349_510 | 53 |
| 714 | 3300048905 | Ga0496102_1120588 | Ga0496102_1120588_37_201 | 53 |
| 715 | 3300048905 | Ga0496102_1181124 | Ga0496102_1181124_67_237 | 53 |
| 716 | 3300048906 | Ga0496103_0105389 | Ga0496103_0105389_1287_1448 | 53 |
| 717 | 3300048906 | Ga0496103_0484622 | Ga0496103_0484622_538_699 | 53 |
| 718 | 3300048906 | Ga0496103_0860057 | Ga0496103_0860057_360_521 | 53 |
| 719 | 3300048907 | Ga0496104_0089203 | Ga0496104_0089203_2074_2235 | 53 |
| 720 | 3300048907 | Ga0496104_0335185 | Ga0496104_0335185_964_1125 | 53 |
| 721 | 3300048907 | Ga0496104_0563723 | Ga0496104_0563723_836_997 | 53 |
| 722 | 3300048907 | Ga0496104_0876480 | Ga0496104_0876480_310_474 | 53 |
| 723 | 3300048908 | Ga0496105_0016968 | Ga0496105_0016968_995_1156 | 53 |
| 724 | 3300048908 | Ga0496105_0411240 | Ga0496105_0411240_55_216 | 53 |
| 725 | 3300048908 | Ga0496105_0456126 | Ga0496105_0456126_539_700 | 53 |
| 726 | 3300048908 | Ga0496105_0560820 | Ga0496105_0560820_709_870 | 53 |
| 727 | 3300048909 | Ga0496106_0446383 | Ga0496106_0446383_145_306 | 53 |
| 728 | 3300048910 | Ga0496107_0058190 | Ga0496107_0058190_85_246 | 53 |
| 729 | 3300048910 | Ga0496107_0637306 | Ga0496107_0637306_476_637 | 53 |
| 730 | 3300048910 | Ga0496107_0914307 | Ga0496107_0914307_274_435 | 53 |
| 731 | 3300048911 | Ga0496108_0040002 | Ga0496108_0040002_1830_1991 | 53 |
| 732 | 3300048911 | Ga0496108_0420159 | Ga0496108_0420159_908_1069 | 53 |
| 733 | 3300048911 | Ga0496108_0647265 | Ga0496108_0647265_202_366 | 53 |
| 734 | 3300048911 | Ga0496108_0975395 | Ga0496108_0975395_463_627 | 53 |
| 735 | 3300048912 | Ga0496109_0013733 | Ga0496109_0013733_5095_5256 | 53 |
| 736 | 3300048912 | Ga0496109_0627674 | Ga0496109_0627674_467_628 | 53 |
| 737 | 3300048912 | Ga0496109_0669716 | Ga0496109_0669716_54_218 | 53 |
| 738 | 3300048912 | Ga0496109_1585368 | Ga0496109_1585368_313_474 | 53 |
| 739 | 3300048913 | Ga0496110_0080430 | Ga0496110_0080430_2268_2429 | 53 |
| 740 | 3300048913 | Ga0496110_0082566 | Ga0496110_0082566_1818_1982 | 53 |
| 741 | 3300048913 | Ga0496110_0148681 | Ga0496110_0148681_1725_1886 | 53 |
| 742 | 3300048913 | Ga0496110_0172957 | Ga0496110_0172957_1537_1698 | 53 |
| 743 | 3300048913 | Ga0496110_1609556 | Ga0496110_1609556_148_309 | 53 |
| 744 | 3300048914 | Ga0496111_0295235 | Ga0496111_0295235_1006_1167 | 53 |
| 745 | 3300048914 | Ga0496111_0558261 | Ga0496111_0558261_161_322 | 53 |
| 746 | 3300048914 | Ga0496111_0766280 | Ga0496111_0766280_19_183 | 53 |
| 747 | 3300048914 | Ga0496111_1079274 | Ga0496111_1079274_122_283 | 53 |
| 748 | 3300048915 | Ga0496112_0164772 | Ga0496112_0164772_1035_1196 | 53 |
| 749 | 3300048915 | Ga0496112_0660004 | Ga0496112_0660004_541_702 | 53 |
| 750 | 3300048915 | Ga0496112_1077872 | Ga0496112_1077872_108_272 | 53 |
| 751 | 3300048916 | Ga0496113_1075158 | Ga0496113_1075158_313_474 | 53 |
| 752 | 3300048917 | Ga0496114_0124845 | Ga0496114_0124845_658_819 | 53 |
| 753 | 3300048917 | Ga0496114_0169930 | Ga0496114_0169930_533_694 | 53 |
| 754 | 3300048917 | Ga0496114_1411923 | Ga0496114_1411923_59_220 | 53 |
| 755 | 3300048918 | Ga0496115_0005604 | Ga0496115_0005604_3487_3648 | 53 |
| 756 | 3300048918 | Ga0496115_0585738 | Ga0496115_0585738_430_591 | 53 |
| 757 | 3300049162 | Ga0501307_062365 | Ga0501307_062365_356_523 | 53 |
| 758 | 3300049568 | Ga0501031_0029061 | Ga0501031_0029061_2030_2197 | 53 |
| 759 | 3300049568 | Ga0501031_0055955 | Ga0501031_0055955_2294_2461 | 53 |
| 760 | 3300049569 | Ga0501032_0018194 | Ga0501032_0018194_2210_2371 | 53 |
| 761 | 3300049569 | Ga0501032_0075987 | Ga0501032_0075987_543_710 | 53 |
| 762 | 3300049569 | Ga0501032_0144989 | Ga0501032_0144989_160_327 | 53 |
| 763 | 3300049569 | Ga0501032_0326977 | Ga0501032_0326977_811_972 | 53 |
| 764 | 3300049569 | Ga0501032_0992414 | Ga0501032_0992414_249_416 | 53 |
| 765 | 3300049570 | Ga0501033_0010017 | Ga0501033_0010017_3430_3591 | 53 |
| 766 | 3300049570 | Ga0501033_0052492 | Ga0501033_0052492_2839_3006 | 53 |
| 767 | 3300049570 | Ga0501033_0068083 | Ga0501033_0068083_76_243 | 53 |
| 768 | 3300049571 | Ga0501034_0001825 | Ga0501034_0001825_26596_26763 | 53 |
| 769 | 3300049571 | Ga0501034_0011458 | Ga0501034_0011458_493_657 | 53 |
| 770 | 3300049571 | Ga0501034_0026359 | Ga0501034_0026359_2730_2891 | 53 |
| 771 | 3300049571 | Ga0501034_0070102 | Ga0501034_0070102_1623_1784 | 53 |
| 772 | 3300049572 | Ga0501036_0007041 | Ga0501036_0007041_4025_4186 | 53 |
| 773 | 3300049572 | Ga0501036_0008564 | Ga0501036_0008564_2619_2786 | 53 |
| 774 | 3300049572 | Ga0501036_0201044 | Ga0501036_0201044_1228_1389 | 53 |
| 775 | 3300049572 | Ga0501036_0253788 | Ga0501036_0253788_1176_1343 | 53 |
| 776 | 3300049572 | Ga0501036_0280132 | Ga0501036_0280132_84_251 | 53 |
| 777 | 3300049572 | Ga0501036_1534181 | Ga0501036_1534181_340_507 | 53 |
| 778 | 3300049573 | Ga0501037_0070950 | Ga0501037_0070950_2070_2231 | 53 |
| 779 | 3300049573 | Ga0501037_0181099 | Ga0501037_0181099_372_533 | 53 |
| 780 | 3300049574 | Ga0501038_0041698 | Ga0501038_0041698_1687_1848 | 53 |
| 781 | 3300049574 | Ga0501038_0116577 | Ga0501038_0116577_1908_2075 | 53 |
| 782 | 3300049574 | Ga0501038_0830753 | Ga0501038_0830753_183_344 | 53 |
| 783 | 3300049574 | Ga0501038_1143385 | Ga0501038_1143385_329_496 | 53 |
| 784 | 3300049575 | Ga0501039_0005221 | Ga0501039_0005221_6711_6878 | 53 |
| 785 | 3300049575 | Ga0501039_0141812 | Ga0501039_0141812_1170_1337 | 53 |
| 786 | 3300049575 | Ga0501039_0776674 | Ga0501039_0776674_134_295 | 53 |
| 787 | 3300049575 | Ga0501039_0799519 | Ga0501039_0799519_227_391 | 53 |
| 788 | 3300049576 | Ga0501040_0015352 | Ga0501040_0015352_2314_2481 | 53 |
| 789 | 3300049576 | Ga0501040_0021776 | Ga0501040_0021776_4004_4171 | 53 |
| 790 | 3300049576 | Ga0501040_0099512 | Ga0501040_0099512_641_808 | 53 |
| 791 | 3300049576 | Ga0501040_0702640 | Ga0501040_0702640_224_391 | 53 |
| 792 | 3300049577 | Ga0501041_0152846 | Ga0501041_0152846_1118_1285 | 53 |
| 793 | 3300049577 | Ga0501041_0578227 | Ga0501041_0578227_446_607 | 53 |
| 794 | 3300049578 | Ga0501042_0058389 | Ga0501042_0058389_968_1135 | 53 |
| 795 | 3300049578 | Ga0501042_0069895 | Ga0501042_0069895_2219_2386 | 53 |
| 796 | 3300049578 | Ga0501042_0099595 | Ga0501042_0099595_725_892 | 53 |
| 797 | 3300049578 | Ga0501042_0210980 | Ga0501042_0210980_1115_1276 | 53 |
| 798 | 3300049578 | Ga0501042_0211014 | Ga0501042_0211014_1091_1258 | 53 |
| 799 | 3300049578 | Ga0501042_1062975 | Ga0501042_1062975_53_220 | 53 |
| 800 | 3300049579 | Ga0501043_0028890 | Ga0501043_0028890_2364_2525 | 53 |
| 801 | 3300049579 | Ga0501043_0093630 | Ga0501043_0093630_1155_1322 | 53 |
| 802 | 3300049579 | Ga0501043_0207850 | Ga0501043_0207850_119_286 | 53 |
| 803 | 3300049579 | Ga0501043_0329824 | Ga0501043_0329824_137_298 | 53 |
| 804 | 3300049579 | Ga0501043_0589583 | Ga0501043_0589583_137_298 | 53 |
| 805 | 3300049580 | Ga0501046_0054622 | Ga0501046_0054622_387_548 | 53 |
| 806 | 3300049580 | Ga0501046_0074182 | Ga0501046_0074182_862_1023 | 53 |
| 807 | 3300049580 | Ga0501046_0088527 | Ga0501046_0088527_1820_1987 | 53 |
| 808 | 3300049580 | Ga0501046_0142775 | Ga0501046_0142775_625_792 | 53 |
| 809 | 3300049580 | Ga0501046_0841276 | Ga0501046_0841276_187_348 | 53 |
| 810 | 3300049581 | Ga0501047_0021371 | Ga0501047_0021371_2238_2399 | 53 |
| 811 | 3300049581 | Ga0501047_0810406 | Ga0501047_0810406_322_483 | 53 |
| 812 | 3300049581 | Ga0501047_1051915 | Ga0501047_1051915_435_596 | 53 |
| 813 | 3300049582 | Ga0501048_0007282 | Ga0501048_0007282_1190_1357 | 53 |
| 814 | 3300049582 | Ga0501048_0012084 | Ga0501048_0012084_3955_4122 | 53 |
| 815 | 3300049582 | Ga0501048_0273325 | Ga0501048_0273325_386_553 | 53 |
| 816 | 3300049582 | Ga0501048_0879075 | Ga0501048_0879075_271_432 | 53 |
| 817 | 3300049582 | Ga0501048_1032031 | Ga0501048_1032031_406_573 | 53 |
| 818 | 3300049583 | Ga0501067_0073272 | Ga0501067_0073272_840_1004 | 53 |
| 819 | 3300049583 | Ga0501067_0181187 | Ga0501067_0181187_233_403 | 53 |
| 820 | 3300049583 | Ga0501067_0849989 | Ga0501067_0849989_41_208 | 53 |
| 821 | 3300049584 | Ga0501068_0060472 | Ga0501068_0060472_2029_2196 | 53 |
| 822 | 3300049584 | Ga0501068_0085482 | Ga0501068_0085482_630_797 | 53 |
| 823 | 3300049584 | Ga0501068_0110537 | Ga0501068_0110537_1506_1667 | 53 |
| 824 | 3300049584 | Ga0501068_0310000 | Ga0501068_0310000_652_813 | 53 |
| 825 | 3300049584 | Ga0501068_0353617 | Ga0501068_0353617_654_821 | 53 |
| 826 | 3300049584 | Ga0501068_0417811 | Ga0501068_0417811_379_540 | 53 |
| 827 | 3300049584 | Ga0501068_0463350 | Ga0501068_0463350_591_758 | 53 |
| 828 | 3300049584 | Ga0501068_0743945 | Ga0501068_0743945_341_508 | 53 |
| 829 | 3300049585 | Ga0501069_0024577 | Ga0501069_0024577_2914_3081 | 53 |
| 830 | 3300049585 | Ga0501069_0456180 | Ga0501069_0456180_117_278 | 53 |
| 831 | 3300049585 | Ga0501069_0944532 | Ga0501069_0944532_205_375 | 53 |
| 832 | 3300049586 | Ga0501070_0015834 | Ga0501070_0015834_446_607 | 53 |
| 833 | 3300049586 | Ga0501070_0081767 | Ga0501070_0081767_2355_2522 | 53 |
| 834 | 3300049586 | Ga0501070_0128945 | Ga0501070_0128945_303_464 | 53 |
| 835 | 3300049586 | Ga0501070_0237407 | Ga0501070_0237407_415_576 | 53 |
| 836 | 3300049586 | Ga0501070_0273055 | Ga0501070_0273055_914_1081 | 53 |
| 837 | 3300049586 | Ga0501070_0421131 | Ga0501070_0421131_141_308 | 53 |
| 838 | 3300049586 | Ga0501070_0456456 | Ga0501070_0456456_732_899 | 53 |
| 839 | 3300049586 | Ga0501070_0548211 | Ga0501070_0548211_520_681 | 53 |
| 840 | 3300049587 | Ga0501071_0007079 | Ga0501071_0007079_4625_4792 | 53 |
| 841 | 3300049587 | Ga0501071_0008766 | Ga0501071_0008766_2314_2481 | 53 |
| 842 | 3300049587 | Ga0501071_0025765 | Ga0501071_0025765_2213_2380 | 53 |
| 843 | 3300049587 | Ga0501071_0086358 | Ga0501071_0086358_1274_1441 | 53 |
| 844 | 3300049587 | Ga0501071_0311569 | Ga0501071_0311569_973_1140 | 53 |
| 845 | 3300049587 | Ga0501071_0321234 | Ga0501071_0321234_880_1041 | 53 |
| 846 | 3300049587 | Ga0501071_0775276 | Ga0501071_0775276_98_262 | 53 |
| 847 | 3300049587 | Ga0501071_1014368 | Ga0501071_1014368_177_338 | 53 |
| 848 | 3300049587 | Ga0501071_1049934 | Ga0501071_1049934_318_485 | 53 |
| 849 | 3300049587 | Ga0501071_1470997 | Ga0501071_1470997_88_249 | 53 |
| 850 | 3300049588 | Ga0501072_0003175 | Ga0501072_0003175_11686_11853 | 53 |
| 851 | 3300049588 | Ga0501072_0019717 | Ga0501072_0019717_144_311 | 53 |
| 852 | 3300049588 | Ga0501072_0044698 | Ga0501072_0044698_1208_1375 | 53 |
| 853 | 3300049588 | Ga0501072_0630461 | Ga0501072_0630461_293_454 | 53 |
| 854 | 3300049588 | Ga0501072_0723299 | Ga0501072_0723299_591_752 | 53 |
| 855 | 3300049589 | Ga0501073_0041651 | Ga0501073_0041651_106_273 | 53 |
| 856 | 3300049589 | Ga0501073_0273544 | Ga0501073_0273544_125_292 | 53 |
| 857 | 3300049589 | Ga0501073_0357846 | Ga0501073_0357846_681_842 | 53 |
| 858 | 3300049589 | Ga0501073_0367927 | Ga0501073_0367927_227_394 | 53 |
| 859 | 3300049589 | Ga0501073_0445568 | Ga0501073_0445568_631_798 | 53 |
| 860 | 3300049589 | Ga0501073_0828433 | Ga0501073_0828433_456_626 | 53 |
| 861 | 3300049589 | Ga0501073_0864369 | Ga0501073_0864369_173_340 | 53 |
| 862 | 3300049590 | Ga0501074_0006817 | Ga0501074_0006817_7538_7705 | 53 |
| 863 | 3300049590 | Ga0501074_0155300 | Ga0501074_0155300_51_218 | 53 |
| 864 | 3300049590 | Ga0501074_0176379 | Ga0501074_0176379_322_483 | 53 |
| 865 | 3300049590 | Ga0501074_0855272 | Ga0501074_0855272_439_606 | 53 |
| 866 | 3300049590 | Ga0501074_1016374 | Ga0501074_1016374_304_474 | 53 |
| 867 | 3300049590 | Ga0501074_1101261 | Ga0501074_1101261_148_312 | 53 |
| 868 | 3300049591 | Ga0501075_0005970 | Ga0501075_0005970_226_393 | 53 |
| 869 | 3300049591 | Ga0501075_0071170 | Ga0501075_0071170_139_306 | 53 |
| 870 | 3300049591 | Ga0501075_0138700 | Ga0501075_0138700_1671_1838 | 53 |
| 871 | 3300049591 | Ga0501075_0231786 | Ga0501075_0231786_152_319 | 53 |
| 872 | 3300049591 | Ga0501075_0739177 | Ga0501075_0739177_357_518 | 53 |
| 873 | 3300049591 | Ga0501075_0956393 | Ga0501075_0956393_300_461 | 53 |
| 874 | 3300049592 | Ga0501076_0057523 | Ga0501076_0057523_2721_2888 | 53 |
| 875 | 3300049592 | Ga0501076_0217698 | Ga0501076_0217698_965_1132 | 53 |
| 876 | 3300049592 | Ga0501076_0269045 | Ga0501076_0269045_1008_1175 | 53 |
| 877 | 3300049592 | Ga0501076_0703038 | Ga0501076_0703038_649_816 | 53 |
| 878 | 3300049592 | Ga0501076_1147524 | Ga0501076_1147524_345_515 | 53 |
| 879 | 3300049592 | Ga0501076_1342508 | Ga0501076_1342508_166_336 | 53 |
| 880 | 3300049592 | Ga0501076_1459667 | Ga0501076_1459667_287_454 | 53 |
| 881 | 3300049593 | Ga0501077_0000888 | Ga0501077_0000888_2357_2524 | 53 |
| 882 | 3300049593 | Ga0501077_0036713 | Ga0501077_0036713_342_509 | 53 |
| 883 | 3300049593 | Ga0501077_0099061 | Ga0501077_0099061_1116_1283 | 53 |
| 884 | 3300049593 | Ga0501077_0198886 | Ga0501077_0198886_573_734 | 53 |
| 885 | 3300049593 | Ga0501077_0329397 | Ga0501077_0329397_87_248 | 53 |
| 886 | 3300049593 | Ga0501077_0552288 | Ga0501077_0552288_162_326 | 53 |
| 887 | 3300049593 | Ga0501077_0824762 | Ga0501077_0824762_187_348 | 53 |
| 888 | 3300049741 | Ga0501079_0059945 | Ga0501079_0059945_125_292 | 53 |
| 889 | 3300049741 | Ga0501079_0099422 | Ga0501079_0099422_1939_2106 | 53 |
| 890 | 3300049741 | Ga0501079_0250713 | Ga0501079_0250713_1188_1355 | 53 |
| 891 | 3300049741 | Ga0501079_0576496 | Ga0501079_0576496_386_547 | 53 |
| 892 | 3300049741 | Ga0501079_1262226 | Ga0501079_1262226_277_444 | 53 |
| 893 | 3300049742 | Ga0501080_0030535 | Ga0501080_0030535_3582_3743 | 53 |
| 894 | 3300049742 | Ga0501080_0054028 | Ga0501080_0054028_3565_3726 | 53 |
| 895 | 3300049742 | Ga0501080_0068025 | Ga0501080_0068025_2094_2258 | 53 |
| 896 | 3300049742 | Ga0501080_0545144 | Ga0501080_0545144_571_738 | 53 |
| 897 | 3300049742 | Ga0501080_0629606 | Ga0501080_0629606_141_308 | 53 |
| 898 | 3300049742 | Ga0501080_1444151 | Ga0501080_1444151_144_311 | 53 |
| 899 | 3300049743 | Ga0501081_0067020 | Ga0501081_0067020_370_537 | 53 |
| 900 | 3300049743 | Ga0501081_0103227 | Ga0501081_0103227_227_394 | 53 |
| 901 | 3300049743 | Ga0501081_0335613 | Ga0501081_0335613_120_287 | 53 |
| 902 | 3300049743 | Ga0501081_0575787 | Ga0501081_0575787_118_285 | 53 |
| 903 | 3300049744 | Ga0501083_0045532 | Ga0501083_0045532_1594_1761 | 53 |
| 904 | 3300049744 | Ga0501083_0157882 | Ga0501083_0157882_336_503 | 53 |
| 905 | 3300049744 | Ga0501083_0327849 | Ga0501083_0327849_643_810 | 53 |
| 906 | 3300049744 | Ga0501083_0768758 | Ga0501083_0768758_386_547 | 53 |
| 907 | 3300049744 | Ga0501083_0989165 | Ga0501083_0989165_134_295 | 53 |
| 908 | 3300049822 | Ga0501035_0092379 | Ga0501035_0092379_935_1096 | 53 |
| 909 | 3300049822 | Ga0501035_0093954 | Ga0501035_0093954_2410_2577 | 53 |
| 910 | 3300049822 | Ga0501035_0710222 | Ga0501035_0710222_389_556 | 53 |
| 911 | 3300049822 | Ga0501035_1544683 | Ga0501035_1544683_212_373 | 53 |
| 912 | 3300049823 | Ga0501044_0005604 | Ga0501044_0005604_573_734 | 53 |
| 913 | 3300049823 | Ga0501044_0145682 | Ga0501044_0145682_227_388 | 53 |
| 914 | 3300049823 | Ga0501044_0188172 | Ga0501044_0188172_16_177 | 53 |
| 915 | 3300049823 | Ga0501044_0305364 | Ga0501044_0305364_1204_1371 | 53 |
| 916 | 3300049824 | Ga0501045_0001378 | Ga0501045_0001378_12372_12539 | 53 |
| 917 | 3300049824 | Ga0501045_0037014 | Ga0501045_0037014_3241_3408 | 53 |
| 918 | 3300049824 | Ga0501045_0389523 | Ga0501045_0389523_415_576 | 53 |
| 919 | 3300049824 | Ga0501045_1330946 | Ga0501045_1330946_43_210 | 53 |
| 920 | 3300050490 | nmdc:mga03n38_329755_c1 | nmdc:mga03n38_329755_c1_249_416 | 53 |
| 921 | 3300050490 | nmdc:mga03n38_750734_c1 | nmdc:mga03n38_750734_c1_58_219 | 53 |
| 922 | 3300050491 | nmdc:mga00v17_4409_c2 | nmdc:mga00v17_4409_c2_488_655 | 53 |
| 923 | 3300050491 | nmdc:mga00v17_457492_c1 | nmdc:mga00v17_457492_c1_277_444 | 53 |
| 924 | 3300050491 | nmdc:mga00v17_521782_c1 | nmdc:mga00v17_521782_c1_533_700 | 53 |
| 925 | 3300050491 | nmdc:mga00v17_598768_c1 | nmdc:mga00v17_598768_c1_196_363 | 53 |
| 926 | 3300050491 | nmdc:mga00v17_665503_c1 | nmdc:mga00v17_665503_c1_374_544 | 53 |
| 927 | 3300050492 | nmdc:mga0yw44_1054667_c1 | nmdc:mga0yw44_1054667_c1_243_410 | 53 |
| 928 | 3300050492 | nmdc:mga0yw44_122103_c1 | nmdc:mga0yw44_122103_c1_1229_1396 | 53 |
| 929 | 3300050492 | nmdc:mga0yw44_130682_c1 | nmdc:mga0yw44_130682_c1_198_365 | 53 |
| 930 | 3300050492 | nmdc:mga0yw44_248776_c1 | nmdc:mga0yw44_248776_c1_26_190 | 53 |
| 931 | 3300050492 | nmdc:mga0yw44_369192_c1 | nmdc:mga0yw44_369192_c1_63_233 | 53 |
| 932 | 3300050492 | nmdc:mga0yw44_514509_c1 | nmdc:mga0yw44_514509_c1_459_623 | 53 |
| 933 | 3300050492 | nmdc:mga0yw44_567209_c1 | nmdc:mga0yw44_567209_c1_374_541 | 53 |
| 934 | 3300050492 | nmdc:mga0yw44_70933_c1 | nmdc:mga0yw44_70933_c1_447_617 | 53 |
| 935 | 3300050492 | nmdc:mga0yw44_894416_c1 | nmdc:mga0yw44_894416_c1_100_261 | 53 |
| 936 | 3300050492 | nmdc:mga0yw44_937358_c1 | nmdc:mga0yw44_937358_c1_350_517 | 53 |
| 937 | 3300050492 | nmdc:mga0yw44_972161_c1 | nmdc:mga0yw44_972161_c1_345_512 | 53 |
| 938 | 3300050494 | nmdc:mga06z11_109726_c1 | nmdc:mga06z11_109726_c1_1110_1277 | 53 |
| 939 | 3300050494 | nmdc:mga06z11_232365_c1 | nmdc:mga06z11_232365_c1_623_790 | 53 |
| 940 | 3300050494 | nmdc:mga06z11_929077_c1 | nmdc:mga06z11_929077_c1_172_336 | 53 |
| 941 | 3300050495 | nmdc:mga04h51_5332_c1 | nmdc:mga04h51_5332_c1_174_338 | 53 |
| 942 | 3300050496 | nmdc:mga07m45_489654_c1 | nmdc:mga07m45_489654_c1_365_532 | 53 |
| 943 | 3300050507 | nmdc:mga05p37_1282483_c1 | nmdc:mga05p37_1282483_c1_180_341 | 53 |
| 944 | 3300050507 | nmdc:mga05p37_168911_c1 | nmdc:mga05p37_168911_c1_993_1163 | 53 |
| 945 | 3300050507 | nmdc:mga05p37_169986_c1 | nmdc:mga05p37_169986_c1_233_400 | 53 |
| 946 | 3300050507 | nmdc:mga05p37_248599_c1 | nmdc:mga05p37_248599_c1_134_301 | 53 |
| 947 | 3300050507 | nmdc:mga05p37_31336_c1 | nmdc:mga05p37_31336_c1_156_326 | 53 |
| 948 | 3300050507 | nmdc:mga05p37_48432_c1 | nmdc:mga05p37_48432_c1_111_278 | 53 |
| 949 | 3300050507 | nmdc:mga05p37_486603_c1 | nmdc:mga05p37_486603_c1_1200_1367 | 53 |
| 950 | 3300050508 | nmdc:mga09592_1174618_c1 | nmdc:mga09592_1174618_c1_238_408 | 53 |
| 951 | 3300050508 | nmdc:mga09592_1363859_c1 | nmdc:mga09592_1363859_c1_364_531 | 53 |
| 952 | 3300050508 | nmdc:mga09592_14153_c1 | nmdc:mga09592_14153_c1_200_367 | 53 |
| 953 | 3300050508 | nmdc:mga09592_1601914_c1 | nmdc:mga09592_1601914_c1_117_281 | 53 |
| 954 | 3300050508 | nmdc:mga09592_174787_c1 | nmdc:mga09592_174787_c1_390_560 | 53 |
| 955 | 3300050508 | nmdc:mga09592_22064_c1 | nmdc:mga09592_22064_c1_137_304 | 53 |
| 956 | 3300050508 | nmdc:mga09592_537208_c1 | nmdc:mga09592_537208_c1_695_865 | 53 |
| 957 | 3300050508 | nmdc:mga09592_58268_c1 | nmdc:mga09592_58268_c1_145_312 | 53 |
| 958 | 3300050509 | nmdc:mga0qj67_10020_c1 | nmdc:mga0qj67_10020_c1_5705_5872 | 53 |
| 959 | 3300050509 | nmdc:mga0qj67_1097172_c1 | nmdc:mga0qj67_1097172_c1_223_390 | 53 |
| 960 | 3300050509 | nmdc:mga0qj67_25091_c1 | nmdc:mga0qj67_25091_c1_2893_3060 | 53 |
| 961 | 3300050509 | nmdc:mga0qj67_2958_c1 | nmdc:mga0qj67_2958_c1_7789_7956 | 53 |
| 962 | 3300050509 | nmdc:mga0qj67_321947_c1 | nmdc:mga0qj67_321947_c1_980_1150 | 53 |
| 963 | 3300050509 | nmdc:mga0qj67_352488_c1 | nmdc:mga0qj67_352488_c1_894_1061 | 53 |
| 964 | 3300050509 | nmdc:mga0qj67_80075_c1 | nmdc:mga0qj67_80075_c1_1989_2156 | 53 |
| 965 | 3300050510 | nmdc:mga06r32_1401943_c1 | nmdc:mga06r32_1401943_c1_197_364 | 53 |
| 966 | 3300050510 | nmdc:mga06r32_14563_c1 | nmdc:mga06r32_14563_c1_1851_2021 | 53 |
| 967 | 3300050510 | nmdc:mga06r32_59926_c1 | nmdc:mga06r32_59926_c1_3359_3526 | 53 |
| 968 | 3300050510 | nmdc:mga06r32_651_c1 | nmdc:mga06r32_651_c1_19277_19444 | 53 |
| 969 | 3300050510 | nmdc:mga06r32_973452_c1 | nmdc:mga06r32_973452_c1_37_204 | 53 |
| 970 | 3300050511 | nmdc:mga08y16_1055347_c1 | nmdc:mga08y16_1055347_c1_329_490 | 53 |
| 971 | 3300050511 | nmdc:mga08y16_269645_c1 | nmdc:mga08y16_269645_c1_924_1088 | 53 |
| 972 | 3300050511 | nmdc:mga08y16_310310_c1 | nmdc:mga08y16_310310_c1_201_371 | 53 |
| 973 | 3300050511 | nmdc:mga08y16_37553_c1 | nmdc:mga08y16_37553_c1_2205_2372 | 53 |
| 974 | 3300050511 | nmdc:mga08y16_707484_c1 | nmdc:mga08y16_707484_c1_137_307 | 53 |
| 975 | 3300050511 | nmdc:mga08y16_796174_c1 | nmdc:mga08y16_796174_c1_256_423 | 53 |
| 976 | 3300050511 | nmdc:mga08y16_847065_c1 | nmdc:mga08y16_847065_c1_179_340 | 53 |
| 977 | 3300050512 | nmdc:mga0n895_1445398_c1 | nmdc:mga0n895_1445398_c1_80_250 | 53 |
| 978 | 3300050512 | nmdc:mga0n895_367000_c1 | nmdc:mga0n895_367000_c1_430_594 | 53 |
| 979 | 3300050512 | nmdc:mga0n895_445221_c1 | nmdc:mga0n895_445221_c1_1049_1210 | 53 |
| 980 | 3300050514 | nmdc:mga08x19_1087417_c1 | nmdc:mga08x19_1087417_c1_56_226 | 53 |
| 981 | 3300050515 | nmdc:mga0a205_1136598_c1 | nmdc:mga0a205_1136598_c1_218_379 | 53 |
| 982 | 3300050515 | nmdc:mga0a205_1378073_c1 | nmdc:mga0a205_1378073_c1_46_213 | 53 |
| 983 | 3300050515 | nmdc:mga0a205_371807_c1 | nmdc:mga0a205_371807_c1_996_1166 | 53 |
| 984 | 3300050516 | nmdc:mga0sz30_542253_c1 | nmdc:mga0sz30_542253_c1_15_179 | 53 |
| 985 | 3300053077 | Ga0495601_0010480 | Ga0495601_0010480_5326_5487 | 53 |
| 986 | 3300053077 | Ga0495601_0075683 | Ga0495601_0075683_1183_1344 | 53 |
| 987 | 3300053077 | Ga0495601_0279975 | Ga0495601_0279975_116_277 | 53 |
| 988 | 3300053077 | Ga0495601_0283967 | Ga0495601_0283967_589_753 | 53 |
| 989 | 3300053077 | Ga0495601_0603686 | Ga0495601_0603686_33_197 | 53 |
| 990 | 3300053077 | Ga0495601_0810885 | Ga0495601_0810885_172_339 | 53 |
| 991 | 3300053078 | Ga0495612_0205550 | Ga0495612_0205550_373_534 | 53 |
| 992 | 3300053078 | Ga0495612_0249303 | Ga0495612_0249303_79_240 | 53 |
| 993 | 3300053078 | Ga0495612_0539124 | Ga0495612_0539124_17_187 | 53 |
| 994 | 3300053084 | Ga0495595_0013597 | Ga0495595_0013597_129_290 | 53 |
| 995 | 3300053084 | Ga0495595_0016457 | Ga0495595_0016457_148_315 | 53 |
| 996 | 3300053084 | Ga0495595_0064141 | Ga0495595_0064141_667_837 | 53 |
| 997 | 3300053084 | Ga0495595_0064440 | Ga0495595_0064440_150_311 | 53 |
| 998 | 3300053084 | Ga0495595_0150260 | Ga0495595_0150260_156_317 | 53 |
| 999 | 3300053084 | Ga0495595_0310277 | Ga0495595_0310277_611_781 | 53 |
| 1000 | 3300053084 | Ga0495595_0558807 | Ga0495595_0558807_130_291 | 53 |
| 1001 | 3300053084 | Ga0495595_0569265 | Ga0495595_0569265_171_332 | 53 |
| 1002 | 3300053085 | Ga0495619_0017532 | Ga0495619_0017532_94_261 | 53 |
| 1003 | 3300053085 | Ga0495619_0039309 | Ga0495619_0039309_2796_2957 | 53 |
| 1004 | 3300053085 | Ga0495619_0069369 | Ga0495619_0069369_2082_2252 | 53 |
| 1005 | 3300053085 | Ga0495619_0097429 | Ga0495619_0097429_144_305 | 53 |
| 1006 | 3300053085 | Ga0495619_0115619 | Ga0495619_0115619_372_533 | 53 |
| 1007 | 3300053085 | Ga0495619_0183421 | Ga0495619_0183421_1067_1231 | 53 |
| 1008 | 3300053085 | Ga0495619_0203239 | Ga0495619_0203239_313_477 | 53 |
| 1009 | 3300053085 | Ga0495619_0321426 | Ga0495619_0321426_787_948 | 53 |
| 1010 | 3300053085 | Ga0495619_0401455 | Ga0495619_0401455_661_822 | 53 |
| 1011 | 3300053085 | Ga0495619_0602496 | Ga0495619_0602496_35_199 | 53 |
| 1012 | 3300053090 | Ga0500646_0029483 | Ga0500646_0029483_209_373 | 53 |
| 1013 | 3300053094 | Ga0500566_0117497 | Ga0500566_0117497_468_629 | 53 |
| 1014 | 3300053096 | Ga0500641_0332521 | Ga0500641_0332521_358_519 | 53 |
| 1015 | 3300053103 | Ga0500555_021658 | Ga0500555_021658_504_671 | 53 |
| 1016 | 3300054114 | Ga0501084_0000009 | Ga0501084_0000009_54384_54545 | 53 |
| 1017 | 3300054114 | Ga0501084_0003886 | Ga0501084_0003886_10787_10954 | 53 |
| 1018 | 3300054114 | Ga0501084_0012833 | Ga0501084_0012833_6303_6470 | 53 |
| 1019 | 3300054114 | Ga0501084_0245432 | Ga0501084_0245432_121_288 | 53 |
| 1020 | 3300054114 | Ga0501084_1122865 | Ga0501084_1122865_378_539 | 53 |
| 1021 | 3300054114 | Ga0501084_1355937 | Ga0501084_1355937_403_570 | 53 |
| 1022 | 3300059424 | Ga0590075_014969 | Ga0590075_014969_770_937 | 53 |
| 1023 | 3300059491 | Ga0587070_076971 | Ga0587070_076971_254_415 | 53 |
| 1024 | 3300059492 | Ga0587073_0271416 | Ga0587073_0271416_199_360 | 53 |
| 1025 | 3300059493 | Ga0587077_140525 | Ga0587077_140525_354_515 | 53 |
| 1026 | 3300059503 | Ga0587080_120358 | Ga0587080_120358_200_361 | 53 |
| 1027 | 3300059504 | Ga0587082_077902 | Ga0587082_077902_200_361 | 53 |
| 1028 | 3300059506 | Ga0587085_151913 | Ga0587085_151913_194_355 | 53 |
| 1029 | 3300059510 | Ga0587090_052905 | Ga0587090_052905_392_553 | 53 |
| 1030 | 3300059512 | Ga0587092_099521 | Ga0587092_099521_239_400 | 53 |
| 1031 | 3300059605 | Ga0587106_081501 | Ga0587106_081501_140_304 | 53 |
| 1032 | 3300059609 | Ga0587131_006986 | Ga0587131_006986_258_419 | 53 |
| 1033 | 3300059622 | Ga0587099_055129 | Ga0587099_055129_135_299 | 53 |
| 1034 | 3300059623 | Ga0587101_055735 | Ga0587101_055735_48_212 | 53 |
| 1035 | 3300059624 | Ga0587109_115649 | Ga0587109_115649_232_393 | 53 |
| 1036 | 3300059624 | Ga0587109_150584 | Ga0587109_150584_324_494 | 53 |
| 1037 | 3300059624 | Ga0587109_196162 | Ga0587109_196162_232_393 | 53 |
| 1038 | 3300059626 | Ga0587115_091690 | Ga0587115_091690_220_381 | 53 |
| 1039 | 3300059626 | Ga0587115_102224 | Ga0587115_102224_181_342 | 53 |
| 1040 | 3300059630 | Ga0587128_142288 | Ga0587128_142288_199_360 | 53 |
| 1041 | 3300059630 | Ga0587128_168329 | Ga0587128_168329_252_416 | 53 |
| 1042 | 3300059639 | Ga0587062_054287 | Ga0587062_054287_337_498 | 53 |
| 1043 | 3300059641 | Ga0587068_154557 | Ga0587068_154557_189_350 | 53 |
| 1044 | 3300059646 | Ga0587078_049683 | Ga0587078_049683_85_252 | 53 |
| 1045 | 3300059647 | Ga0587079_183250 | Ga0587079_183250_185_346 | 53 |
| 1046 | 3300059647 | Ga0587079_249224 | Ga0587079_249224_91_255 | 53 |
| 1047 | 3300059654 | Ga0587110_031230 | Ga0587110_031230_258_419 | 53 |
| 1048 | 3300059655 | Ga0587114_057106 | Ga0587114_057106_333_494 | 53 |
| 1049 | 3300059659 | Ga0587120_030716 | Ga0587120_030716_187_348 | 53 |
| 1050 | 3300060346 | Ga0587111_0082208 | Ga0587111_0082208_197_358 | 53 |
| 1051 | 3300060346 | Ga0587111_0103217 | Ga0587111_0103217_153_314 | 53 |
| 1052 | 3300060353 | Ga0501082_0016297 | Ga0501082_0016297_5181_5348 | 53 |
| 1053 | 3300060353 | Ga0501082_0112758 | Ga0501082_0112758_227_394 | 53 |
| 1054 | 3300060353 | Ga0501082_1189056 | Ga0501082_1189056_367_531 | 53 |
| 1055 | 3300060353 | Ga0501082_1384996 | Ga0501082_1384996_216_377 | 53 |
| 1056 | 3300060353 | Ga0501082_1551492 | Ga0501082_1551492_257_421 | 53 |
| 1057 | 3300061734 | Ga0530510_0019158 | Ga0530510_0019158_2152_2319 | 53 |
| 1058 | 3300061734 | Ga0530510_0058612 | Ga0530510_0058612_226_393 | 53 |
| 1059 | 3300061734 | Ga0530510_0143446 | Ga0530510_0143446_1455_1622 | 53 |
| 1060 | 3300061734 | Ga0530510_0426184 | Ga0530510_0426184_34_201 | 53 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a63-assembly1.cif.gz_6 | cryo-em structure of listeria monocytogenes 50s ribosomal subunit. | 0.9182 | 6 | 52 |
| 8cvm-assembly1.cif.gz_0 | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9176 | 6 | 53 |
| 7nhn-assembly1.cif.gz_6 | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9158 | 6 | 52 |
| 6ha1-assembly1.cif.gz_1 | cryo-em structure of a 70s bacillus subtilis ribosome translating the ermd leader peptide in complex with telithromycin | 0.9139 | 7 | 52 |
| 7y41-assembly1.cif.gz_c | mycobacterium smegmatis 50s ribosomal subunit from log phase of growth | 0.9093 | 6 | 52 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6dddO00 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 | 0.9045 | 6 | 50 | 2.20.28.120 |
| 4qcn600 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 | 0.9023 | 6 | 53 | 2.20.28.120 |
| af_Q9W4L1_1_64_2.20.28.120 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 | 0.8986 | 7 | 53 | 2.20.28.120 |
| 6ddgO00 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 | 0.8809 | 7 | 50 | 2.20.28.120 |
| 5v7q100 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 | 0.8788 | 8 | 52 | 2.20.28.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R6BI07-F1-model_v4 | Large ribosomal subunit protein bL33 | 0.9594 | 7 | 53 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A0R1U8L0-F1-model_v4 | Large ribosomal subunit protein bL33 | 0.9554 | 5 | 53 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A1S9M5M9-F1-model_v4 | Large ribosomal subunit protein bL33 | 0.9346 | 7 | 53 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A3A6NG62-F1-model_v4 | Large ribosomal subunit protein bL33 | 0.9303 | 6 | 53 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A537XBQ3-F1-model_v4 | Large ribosomal subunit protein bL33 | 0.9299 | 6 | 53 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar