F489272

General Info

Members Datasets Scaffolds Average Seq Length
1060 437 1060 54

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_11209769|Ga0307410_112097691
Length 59
Sequence MAKANEKRIAVTLECTTCKRRNYITTKNKVNDRERIEMKKYCRWDRTHTVHKETRLPRR

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
96 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
97 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
115 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
181 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
182 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
183 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
186 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
187 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
210 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
211 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
212 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
244 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
245 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
246 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
247 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
248 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
249 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
250 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
251 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
252 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
253 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
254 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
255 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
256 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
257 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
258 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
259 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
262 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
263 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
264 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
265 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
266 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
267 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
268 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
269 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
270 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
271 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
272 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
273 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
274 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
275 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
276 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
277 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
278 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
279 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
280 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
281 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
282 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
283 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
284 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
285 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
286 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
287 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
290 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
293 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
294 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
298 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
299 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
307 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
308 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
309 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
310 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
313 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
314 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
323 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
324 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
325 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
326 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
327 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
371 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
372 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
373 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
374 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
375 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
378 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
388 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
391 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
392 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
393 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
396 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
397 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
398 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
399 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
402 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
403 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
404 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
405 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
408 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
409 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
410 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
411 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
412 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
413 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
437 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.92
Metatranscriptomes 7.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.09
Nodule 0
Rhizoplane 5.75
Rhizosphere 87.17
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10093413 3300001991 Bacteria 643
2 Ga0007429J51699_1081227 3300003579 Bacteria 502
3 JGI25405J52794_10007263 3300003911 Bacteria 2041
4 Ga0058859_11691400 3300004798 Bacteria 573
5 Ga0058859_11763347 3300004798 Bacteria 575
6 Ga0058863_11901821 3300004799 Bacteria 1305
7 Ga0058863_11937226 3300004799 Bacteria 619
8 Ga0058861_11583168 3300004800 Bacteria 625
9 Ga0058861_11737476 3300004800 Bacteria 560
10 Ga0058862_10114983 3300004803 Bacteria 698
11 Ga0058862_12780895 3300004803 Bacteria 819
12 Ga0070658_10713506 3300005327 Bacteria 871
13 Ga0070658_11060214 3300005327 Bacteria 705
14 Ga0070676_10221914 3300005328 Bacteria 1249
15 Ga0070676_10858029 3300005328 Bacteria 674
16 Ga0070676_11064977 3300005328 Bacteria 610
17 Ga0070676_11195419 3300005328 Bacteria 578
18 Ga0070683_100709232 3300005329 Bacteria 964
19 Ga0070683_100740591 3300005329 Bacteria 942
20 Ga0070683_100829688 3300005329 Bacteria 886
21 Ga0070683_101483179 3300005329 Bacteria 652
22 Ga0070670_102091255 3300005331 Bacteria 522
23 Ga0070670_102213498 3300005331 Bacteria 506
24 Ga0068869_101504766 3300005334 Bacteria 598
25 Ga0068869_101854245 3300005334 Bacteria 540
26 Ga0070666_11446764 3300005335 Bacteria 514
27 Ga0070680_101506011 3300005336 Bacteria 583
28 Ga0070682_100629022 3300005337 Bacteria 851
29 Ga0068868_100034373 3300005338 Bacteria 3913
30 Ga0068868_102064552 3300005338 Bacteria 542
31 Ga0068868_102369881 3300005338 Bacteria 507
32 Ga0070660_101690313 3300005339 Bacteria 539
33 Ga0070689_101005870 3300005340 Bacteria 742
34 Ga0070691_10135160 3300005341 Bacteria 1252
35 Ga0070661_101606993 3300005344 Bacteria 550
36 Ga0070675_100079130 3300005354 Bacteria 2739
37 Ga0070675_100477649 3300005354 Bacteria 1121
38 Ga0070675_101718830 3300005354 Bacteria 579
39 Ga0070671_101862869 3300005355 Bacteria 535
40 Ga0070674_100293369 3300005356 Bacteria 1294
41 Ga0070673_101108487 3300005364 Bacteria 740
42 Ga0070673_101257047 3300005364 Bacteria 695
43 Ga0070688_100719387 3300005365 Bacteria 775
44 Ga0070688_101726998 3300005365 Bacteria 513
45 Ga0070659_101480329 3300005366 Bacteria 605
46 Ga0070667_100664434 3300005367 Bacteria 963
47 Ga0070667_101120607 3300005367 Bacteria 736
48 Ga0070709_10364631 3300005434 Bacteria 1071
49 Ga0070714_101259885 3300005435 Bacteria 722
50 Ga0070714_101342730 3300005435 Bacteria 698
51 Ga0070713_100294117 3300005436 Bacteria 1493
52 Ga0070713_100413850 3300005436 Bacteria 1261
53 Ga0070710_10291202 3300005437 Bacteria 1063
54 Ga0070711_100951950 3300005439 Bacteria 735
55 Ga0070700_100178248 3300005441 Bacteria 1477
56 Ga0070663_100405864 3300005455 Bacteria 1115
57 Ga0070678_100190277 3300005456 Bacteria 1687
58 Ga0070678_100261078 3300005456 Bacteria 1457
59 Ga0070678_100746981 3300005456 Bacteria 885
60 Ga0070707_100924309 3300005468 Bacteria 837
61 Ga0070699_100142068 3300005518 Bacteria 2120
62 Ga0070684_100279708 3300005535 Bacteria 1529
63 Ga0070697_101138362 3300005536 Bacteria 695
64 Ga0070697_101598453 3300005536 Bacteria 583
65 Ga0068853_102304050 3300005539 Bacteria 522
66 Ga0070672_100263217 3300005543 Bacteria 1455
67 Ga0070672_100957358 3300005543 Bacteria 758
68 Ga0070686_100738009 3300005544 Bacteria 789
69 Ga0070686_101101932 3300005544 Bacteria 656
70 Ga0070686_101525749 3300005544 Bacteria 564
71 Ga0070696_100164219 3300005546 Bacteria 1638
72 Ga0070696_100363370 3300005546 Bacteria 1124
73 Ga0070693_100143037 3300005547 Bacteria 1508
74 Ga0070693_101476753 3300005547 Bacteria 531
75 Ga0070704_100356813 3300005549 Bacteria 1236
76 Ga0070704_101839589 3300005549 Bacteria 561
77 Ga0068855_100998116 3300005563 Bacteria 880
78 Ga0068854_100466416 3300005578 Bacteria 1058
79 Ga0068854_100475958 3300005578 Bacteria 1048
80 Ga0068854_101277562 3300005578 Bacteria 660
81 Ga0068856_100095065 3300005614 Bacteria 2968
82 Ga0068856_101316205 3300005614 Bacteria 738
83 Ga0070702_100882345 3300005615 Bacteria 699
84 Ga0070702_101055190 3300005615 Bacteria 647
85 Ga0068864_100874234 3300005618 Bacteria 887
86 Ga0068864_101135432 3300005618 Bacteria 779
87 Ga0068861_101431539 3300005719 Bacteria 676
88 Ga0068861_101601226 3300005719 Bacteria 642
89 Ga0068861_101787042 3300005719 Bacteria 609
90 Ga0068870_11040195 3300005840 Bacteria 586
91 Ga0068863_100957774 3300005841 Bacteria 857
92 Ga0068858_100749462 3300005842 Bacteria 951
93 Ga0068858_100915574 3300005842 Bacteria 858
94 Ga0068860_100779864 3300005843 Bacteria 969
95 Ga0081455_10007316 3300005937 Bacteria 11644
96 Ga0081455_10119047 3300005937 Bacteria 2083
97 Ga0081455_10156224 3300005937 Bacteria 1753
98 Ga0081455_10319132 3300005937 Bacteria 1108
99 Ga0081455_10727658 3300005937 Bacteria 629
100 Ga0081538_10001047 3300005981 Bacteria 29464
101 Ga0081538_10031895 3300005981 Bacteria 3543
102 Ga0081538_10036163 3300005981 Bacteria 3229
103 Ga0081540_1065959 3300005983 Bacteria 1699
104 Ga0081539_10016636 3300005985 Bacteria 5232
105 Ga0070717_10610237 3300006028 Bacteria 990
106 Ga0070717_10624837 3300006028 Bacteria 977
107 Ga0070717_11467929 3300006028 Bacteria 619
108 Ga0075365_10032064 3300006038 Bacteria 3375
109 Ga0075365_10313913 3300006038 Bacteria 1104
110 Ga0075365_10326010 3300006038 Bacteria 1082
111 Ga0075365_10395004 3300006038 Bacteria 976
112 Ga0075365_10536235 3300006038 Bacteria 828
113 Ga0075365_10561011 3300006038 Bacteria 808
114 Ga0075365_10627489 3300006038 Bacteria 760
115 Ga0075365_10834040 3300006038 Bacteria 650
116 Ga0075365_10851019 3300006038 Bacteria 643
117 Ga0075365_10978153 3300006038 Bacteria 596
118 Ga0075368_10093386 3300006042 Bacteria 1231
119 Ga0075368_10128283 3300006042 Bacteria 1053
120 Ga0075363_100266033 3300006048 Bacteria 990
121 Ga0075363_100349923 3300006048 Bacteria 863
122 Ga0075363_100390590 3300006048 Bacteria 817
123 Ga0075364_10037645 3300006051 Bacteria 3133
124 Ga0075364_10394716 3300006051 Bacteria 944
125 Ga0075364_10420223 3300006051 Bacteria 913
126 Ga0075364_10535114 3300006051 Bacteria 801
127 Ga0075364_10669665 3300006051 Bacteria 708
128 Ga0075364_10807253 3300006051 Bacteria 639
129 Ga0070715_10324028 3300006163 Bacteria 833
130 Ga0070716_100712634 3300006173 Bacteria 768
131 Ga0070716_100906196 3300006173 Bacteria 691
132 Ga0075362_10575273 3300006177 Bacteria 581
133 Ga0075367_10293775 3300006178 Bacteria 1022
134 Ga0075367_10340213 3300006178 Bacteria 946
135 Ga0097621_100641734 3300006237 Bacteria 974
136 Ga0097621_101223606 3300006237 Bacteria 708
137 Ga0097621_101596973 3300006237 Bacteria 620
138 Ga0068871_101455335 3300006358 Bacteria 647
139 Ga0075428_100000196 3300006844 Bacteria 57534
140 Ga0075428_100046579 3300006844 Bacteria 4762
141 Ga0075428_100072837 3300006844 Bacteria 3752
142 Ga0075428_100287916 3300006844 Bacteria 1767
143 Ga0075428_100346990 3300006844 Bacteria 1593
144 Ga0075428_100539167 3300006844 Bacteria 1247
145 Ga0075428_100737499 3300006844 Bacteria 1048
146 Ga0075428_100849081 3300006844 Bacteria 969
147 Ga0075428_101203607 3300006844 Bacteria 798
148 Ga0075430_100012671 3300006846 Bacteria 7182
149 Ga0075430_100049095 3300006846 Bacteria 3562
150 Ga0075430_100070604 3300006846 Bacteria 2929
151 Ga0075430_100127275 3300006846 Bacteria 2123
152 Ga0075430_100192817 3300006846 Bacteria 1693
153 Ga0075430_100202436 3300006846 Bacteria 1648
154 Ga0075430_100270421 3300006846 Bacteria 1406
155 Ga0075430_100377322 3300006846 Bacteria 1170
156 Ga0075430_101189960 3300006846 Bacteria 627
157 Ga0075431_100161427 3300006847 Bacteria 2304
158 Ga0075431_100211212 3300006847 Bacteria 1982
159 Ga0075431_100277739 3300006847 Bacteria 1696
160 Ga0075431_100822029 3300006847 Bacteria 902
161 Ga0075431_101055693 3300006847 Bacteria 778
162 Ga0075431_101521337 3300006847 Bacteria 627
163 Ga0075431_102014511 3300006847 Bacteria 532
164 Ga0075433_10492269 3300006852 Bacteria 1080
165 Ga0075433_11413122 3300006852 Bacteria 602
166 Ga0075434_100463970 3300006871 Bacteria 1288
167 Ga0075434_101629172 3300006871 Bacteria 654
168 Ga0075429_100017826 3300006880 Bacteria 6140
169 Ga0075429_100080625 3300006880 Bacteria 2837
170 Ga0075429_100241406 3300006880 Bacteria 1582
171 Ga0075429_100335878 3300006880 Bacteria 1322
172 Ga0075429_100513859 3300006880 Bacteria 1049
173 Ga0075429_101092823 3300006880 Bacteria 696
174 Ga0068865_100875459 3300006881 Bacteria 779
175 Ga0075436_100767534 3300006914 Bacteria 717
176 Ga0075435_100924883 3300007076 Bacteria 761
177 Ga0105251_10236920 3300009011 Bacteria 822
178 Ga0105251_10648095 3300009011 Bacteria 505
179 Ga0105244_10461297 3300009036 Bacteria 584
180 Ga0105250_10219180 3300009092 Bacteria 806
181 Ga0105240_11596371 3300009093 Bacteria 682
182 Ga0105240_12500623 3300009093 Bacteria 534
183 Ga0111539_10017154 3300009094 Bacteria 8963
184 Ga0111539_10135171 3300009094 Bacteria 2888
185 Ga0111539_10282169 3300009094 Bacteria 1933
186 Ga0111539_10866826 3300009094 Bacteria 1050
187 Ga0111539_13121165 3300009094 Bacteria 535
188 Ga0111539_13255030 3300009094 Bacteria 523
189 Ga0105245_10006900 3300009098 Bacteria 9956
190 Ga0105245_10112426 3300009098 Bacteria 2534
191 Ga0105245_10125360 3300009098 Bacteria 2403
192 Ga0105245_10139433 3300009098 Bacteria 2282
193 Ga0105245_10307627 3300009098 Bacteria 1557
194 Ga0114129_10033505 3300009147 Bacteria 7260
195 Ga0114129_10127753 3300009147 Bacteria 3494
196 Ga0114129_10218301 3300009147 Bacteria 2574
197 Ga0114129_10322269 3300009147 Bacteria 2054
198 Ga0114129_10388883 3300009147 Bacteria 1840
199 Ga0114129_10495473 3300009147 Bacteria 1596
200 Ga0114129_10506886 3300009147 Bacteria 1575
201 Ga0114129_10690356 3300009147 Bacteria 1313
202 Ga0114129_11561206 3300009147 Bacteria 809
203 Ga0114129_11744361 3300009147 Bacteria 759
204 Ga0105243_11670745 3300009148 Bacteria 665
205 Ga0105243_11730507 3300009148 Bacteria 655
206 Ga0105243_11846910 3300009148 Bacteria 636
207 Ga0105243_11973607 3300009148 Bacteria 617
208 Ga0105243_12458255 3300009148 Bacteria 560
209 Ga0105241_10106762 3300009174 Bacteria 2235
210 Ga0105242_10152954 3300009176 Bacteria 2013
211 Ga0105242_11067994 3300009176 Bacteria 819
212 Ga0105242_11358445 3300009176 Bacteria 736
213 Ga0105237_10393022 3300009545 Bacteria 1391
214 Ga0105237_10580561 3300009545 Bacteria 1128
215 Ga0105237_11231884 3300009545 Bacteria 755
216 Ga0105237_11699055 3300009545 Bacteria 638
217 Ga0105238_10835170 3300009551 Bacteria 938
218 Ga0105238_12046789 3300009551 Bacteria 606
219 Ga0105238_12755047 3300009551 Bacteria 528
220 Ga0105249_10405330 3300009553 Bacteria 1395
221 Ga0105249_11258780 3300009553 Bacteria 811
222 Ga0105239_10784491 3300010375 Bacteria 1091
223 Ga0105239_10819270 3300010375 Bacteria 1067
224 Ga0105239_11193994 3300010375 Bacteria 877
225 Ga0105239_12897952 3300010375 Bacteria 560
226 Ga0105246_10999416 3300011119 Bacteria 757
227 Ga0105246_11422410 3300011119 Bacteria 648
228 Ga0105246_12056615 3300011119 Bacteria 552
229 Ga0105246_12413287 3300011119 Bacteria 516
230 Ga0157328_1008993 3300012478 Bacteria 664
231 Ga0157313_1034469 3300012503 Bacteria 592
232 Ga0154012_106651 3300013059 Bacteria 1134
233 Ga0157370_11747096 3300013104 Bacteria 558
234 Ga0157369_11268793 3300013105 Bacteria 751
235 Ga0157374_10807669 3300013296 Bacteria 954
236 Ga0157374_10873496 3300013296 Bacteria 916
237 Ga0157374_11370466 3300013296 Bacteria 730
238 Ga0157374_11706263 3300013296 Bacteria 655
239 Ga0157378_10510658 3300013297 Bacteria 1202
240 Ga0157378_11085654 3300013297 Bacteria 837
241 Ga0157378_11444784 3300013297 Bacteria 731
242 Ga0157378_11776044 3300013297 Bacteria 665
243 Ga0157378_13121756 3300013297 Bacteria 514
244 Ga0163162_10256092 3300013306 Bacteria 1882
245 Ga0163162_10896354 3300013306 Unclassified 1000
246 Ga0163162_11083186 3300013306 Bacteria 908
247 Ga0157375_10118551 3300013308 Bacteria 2753
248 Ga0157375_10859841 3300013308 Bacteria 1053
249 Ga0157375_12064198 3300013308 Bacteria 678
250 Ga0157375_12614855 3300013308 Bacteria 603
251 Ga0163163_10274565 3300014325 Bacteria 1737
252 Ga0163163_10321979 3300014325 Bacteria 1600
253 Ga0163163_10714793 3300014325 Bacteria 1065
254 Ga0163163_12851582 3300014325 Bacteria 539
255 Ga0157380_10765835 3300014326 Bacteria 978
256 Ga0157380_10851850 3300014326 Bacteria 933
257 Ga0157380_11148986 3300014326 Bacteria 818
258 Ga0157380_12580504 3300014326 Bacteria 574
259 Ga0157380_13351225 3300014326 Bacteria 512
260 Ga0182008_10546950 3300014497 Bacteria 643
261 Ga0182008_10817250 3300014497 Bacteria 542
262 Ga0157377_10472271 3300014745 Bacteria 871
263 Ga0157377_10997759 3300014745 Bacteria 634
264 Ga0157377_11097057 3300014745 Bacteria 609
265 Ga0157377_11100809 3300014745 Bacteria 609
266 Ga0157379_10363435 3300014968 Bacteria 1327
267 Ga0157379_10651723 3300014968 Bacteria 986
268 Ga0157379_11829252 3300014968 Bacteria 597
269 Ga0157379_11958008 3300014968 Bacteria 578
270 Ga0157376_10483644 3300014969 Bacteria 1214
271 Ga0157376_11267536 3300014969 Bacteria 766
272 Ga0157376_11461812 3300014969 Bacteria 716
273 Ga0157376_11589031 3300014969 Bacteria 688
274 Ga0163161_10248945 3300017792 Bacteria 1384
275 Ga0163161_10400335 3300017792 Bacteria 1101
276 Ga0163161_11864671 3300017792 Bacteria 535
277 Ga0184600_125282 3300019190 Bacteria 626
278 Ga0197907_10247108 3300020069 Bacteria 505
279 Ga0197907_10589538 3300020069 Bacteria 2583
280 Ga0197907_11057705 3300020069 Bacteria 1334
281 Ga0197907_11125084 3300020069 Bacteria 1156
282 Ga0206356_10024041 3300020070 Bacteria 1200
283 Ga0206356_10101155 3300020070 Bacteria 756
284 Ga0206356_10167587 3300020070 Bacteria 1044
285 Ga0206356_10687454 3300020070 Bacteria 728
286 Ga0206356_11110022 3300020070 Bacteria 1225
287 Ga0206355_1032864 3300020076 Bacteria 573
288 Ga0206355_1142256 3300020076 Bacteria 2736
289 Ga0206355_1152352 3300020076 Bacteria 598
290 Ga0206355_1381204 3300020076 Bacteria 521
291 Ga0206351_10782374 3300020077 Bacteria 632
292 Ga0206352_10639442 3300020078 Bacteria 511
293 Ga0206352_10974728 3300020078 Bacteria 963
294 Ga0206350_10384629 3300020080 Bacteria 606
295 Ga0206350_10848760 3300020080 Bacteria 858
296 Ga0206350_10938383 3300020080 Bacteria 510
297 Ga0206354_10706372 3300020081 Bacteria 2268
298 Ga0206354_11473913 3300020081 Bacteria 962
299 Ga0206354_11479482 3300020081 Bacteria 909
300 Ga0206353_10024359 3300020082 Bacteria 1893
301 Ga0206353_10356547 3300020082 Bacteria 786
302 Ga0154015_1400150 3300020610 Bacteria 557
303 Ga0213873_10020965 3300021358 Bacteria 1533
304 Ga0213876_10054990 3300021384 Bacteria 2101
305 Ga0213876_10110186 3300021384 Bacteria 1461
306 Ga0213871_10238896 3300021441 Bacteria 575
307 Ga0224712_10081246 3300022467 Bacteria 1338
308 Ga0224712_10331220 3300022467 Bacteria 717
309 Ga0247554_106394 3300023547 Bacteria 510
310 Ga0207653_10235479 3300025885 Bacteria 698
311 Ga0207692_10153231 3300025898 Bacteria 1322
312 Ga0207692_10944941 3300025898 Bacteria 568
313 Ga0207688_10046209 3300025901 Bacteria 2430
314 Ga0207688_10473460 3300025901 Bacteria 783
315 Ga0207680_10151280 3300025903 Bacteria 1547
316 Ga0207680_10316675 3300025903 Bacteria 1090
317 Ga0207680_11127254 3300025903 Bacteria 560
318 Ga0207699_10607684 3300025906 Bacteria 796
319 Ga0207645_10685534 3300025907 Bacteria 696
320 Ga0207645_10840308 3300025907 Bacteria 624
321 Ga0207643_10870332 3300025908 Bacteria 584
322 Ga0207654_10452010 3300025911 Bacteria 901
323 Ga0207693_10500037 3300025915 Bacteria 949
324 Ga0207693_11441010 3300025915 Bacteria 510
325 Ga0207663_11216788 3300025916 Bacteria 606
326 Ga0207660_10097116 3300025917 Bacteria 2195
327 Ga0207662_11076343 3300025918 Bacteria 571
328 Ga0207657_10337776 3300025919 Bacteria 1189
329 Ga0207649_10150883 3300025920 Bacteria 1600
330 Ga0207649_10812147 3300025920 Bacteria 730
331 Ga0207694_10178096 3300025924 Bacteria 1723
332 Ga0207694_11812244 3300025924 Bacteria 513
333 Ga0207650_10204959 3300025925 Bacteria 1581
334 Ga0207659_10059773 3300025926 Bacteria 2741
335 Ga0207687_10070235 3300025927 Bacteria 2500
336 Ga0207687_11122156 3300025927 Bacteria 675
337 Ga0207687_11152352 3300025927 Bacteria 666
338 Ga0207700_10419079 3300025928 Bacteria 1176
339 Ga0207700_11118174 3300025928 Bacteria 704
340 Ga0207700_11576877 3300025928 Bacteria 581
341 Ga0207664_11572742 3300025929 Bacteria 579
342 Ga0207706_10382544 3300025933 Bacteria 1221
343 Ga0207706_10601087 3300025933 Bacteria 945
344 Ga0207686_10064757 3300025934 Bacteria 2328
345 Ga0207709_10599467 3300025935 Bacteria 872
346 Ga0207709_10905988 3300025935 Bacteria 717
347 Ga0207669_10159177 3300025937 Bacteria 1593
348 Ga0207669_10344540 3300025937 Bacteria 1149
349 Ga0207669_10391164 3300025937 Bacteria 1086
350 Ga0207704_10095529 3300025938 Bacteria 1965
351 Ga0207704_10345537 3300025938 Bacteria 1156
352 Ga0207665_11005653 3300025939 Bacteria 663
353 Ga0207691_10156968 3300025940 Bacteria 1998
354 Ga0207691_10590833 3300025940 Bacteria 940
355 Ga0207691_10693260 3300025940 Bacteria 859
356 Ga0207689_10681235 3300025942 Bacteria 867
357 Ga0207689_10813246 3300025942 Bacteria 789
358 Ga0207661_11298879 3300025944 Bacteria 669
359 Ga0207661_12000328 3300025944 Bacteria 525
360 Ga0207679_10366534 3300025945 Bacteria 1260
361 Ga0207679_10745577 3300025945 Bacteria 890
362 Ga0207667_12036654 3300025949 Bacteria 534
363 Ga0207651_10493412 3300025960 Bacteria 1057
364 Ga0207651_10635441 3300025960 Bacteria 936
365 Ga0207712_11343767 3300025961 Bacteria 639
366 Ga0207668_10821566 3300025972 Bacteria 824
367 Ga0207668_11013627 3300025972 Bacteria 742
368 Ga0207668_11921325 3300025972 Bacteria 534
369 Ga0207640_10479508 3300025981 Bacteria 1031
370 Ga0207658_10572746 3300025986 Bacteria 1012
371 Ga0207677_10344072 3300026023 Bacteria 1247
372 Ga0207703_10656406 3300026035 Bacteria 995
373 Ga0207703_11073099 3300026035 Bacteria 773
374 Ga0207639_10786827 3300026041 Bacteria 886
375 Ga0207678_10365034 3300026067 Bacteria 1246
376 Ga0207708_10401534 3300026075 Bacteria 1133
377 Ga0207702_10670075 3300026078 Bacteria 1021
378 Ga0207648_10288269 3300026089 Bacteria 1469
379 Ga0207648_10402964 3300026089 Bacteria 1240
380 Ga0207676_12080288 3300026095 Bacteria 566
381 Ga0207675_100166244 3300026118 Bacteria 2107
382 Ga0207675_100619327 3300026118 Bacteria 1087
383 Ga0207675_101612586 3300026118 Bacteria 669
384 Ga0207683_10087312 3300026121 Bacteria 2773
385 Ga0207683_10284136 3300026121 Bacteria 1512
386 Ga0207683_10646070 3300026121 Bacteria 980
387 Ga0207683_10795452 3300026121 Bacteria 878
388 Ga0207683_11199042 3300026121 Bacteria 704
389 Ga0207698_12335913 3300026142 Bacteria 546
390 Ga0209998_10184219 3300027717 Bacteria 543
391 Ga0209813_10084645 3300027866 Bacteria 1054
392 Ga0209813_10109340 3300027866 Bacteria 950
393 Ga0207428_10084908 3300027907 Bacteria 2466
394 Ga0207428_10121688 3300027907 Bacteria 2001
395 Ga0207428_10390806 3300027907 Bacteria 1019
396 Ga0207428_10874862 3300027907 Bacteria 636
397 Ga0265356_1021342 3300028017 Bacteria 701
398 Ga0265356_1027591 3300028017 Bacteria 616
399 Ga0268266_10966333 3300028379 Bacteria 824
400 Ga0268265_10239570 3300028380 Bacteria 1600
401 Ga0268264_12316436 3300028381 Bacteria 544
402 Ga0265326_10017736 3300028558 Bacteria 2052
403 Ga0265334_10078979 3300028573 Bacteria 1215
404 Ga0265322_10137391 3300028654 Bacteria 698
405 Ga0265336_10006068 3300028666 Bacteria 4390
406 Ga0265338_10042488 3300028800 Bacteria 4232
407 Ga0265338_10307751 3300028800 Bacteria 1150
408 Ga0314311_1180737 3300030733 Bacteria 560
409 Ga0316182_1287661 3300030745 Bacteria 677
410 Ga0265763_1004811 3300030763 Bacteria 1116
411 Ga0265767_111628 3300030836 Bacteria 599
412 Ga0265766_1006750 3300030863 Bacteria 758
413 Ga0265770_1020187 3300030878 Bacteria 1051
414 Ga0265760_10245547 3300031090 Bacteria 618
415 Ga0265331_10394159 3300031250 Bacteria 621
416 Ga0265327_10003346 3300031251 Bacteria 15471
417 Ga0265327_10150414 3300031251 Bacteria 1081
418 Ga0265327_10202506 3300031251 Bacteria 898
419 Ga0265327_10211866 3300031251 Bacteria 874
420 Ga0265327_10517721 3300031251 Bacteria 514
421 Ga0307408_100637289 3300031548 Bacteria 951
422 Ga0307408_101159554 3300031548 Bacteria 719
423 Ga0316575_10243219 3300031665 Bacteria 754
424 Ga0316575_10524911 3300031665 Bacteria 515
425 Ga0265314_10287627 3300031711 Bacteria 927
426 Ga0265314_10466220 3300031711 Bacteria 670
427 Ga0265342_10390477 3300031712 Bacteria 720
428 Ga0316576_10088062 3300031727 Bacteria 2311
429 Ga0316576_10092047 3300031727 Bacteria 2259
430 Ga0316576_10105006 3300031727 Bacteria 2114
431 Ga0307405_10948525 3300031731 Bacteria 731
432 Ga0307413_10399232 3300031824 Bacteria 1077
433 Ga0307413_11054229 3300031824 Bacteria 700
434 Ga0307410_10577870 3300031852 Bacteria 935
435 Ga0307410_11209769 3300031852 Bacteria 658
436 Ga0326468_10071867 3300031889 Bacteria 577
437 Ga0307406_10368945 3300031901 Bacteria 1128
438 Ga0307407_10047656 3300031903 Bacteria 2434
439 Ga0307412_11892374 3300031911 Bacteria 550
440 Ga0307409_100154336 3300031995 Bacteria 1998
441 Ga0307409_101867695 3300031995 Bacteria 630
442 Ga0307409_101961637 3300031995 Bacteria 615
443 Ga0307409_102307722 3300031995 Bacteria 567
444 Ga0307416_100508282 3300032002 Bacteria 1271
445 Ga0307416_100623445 3300032002 Bacteria 1161
446 Ga0307416_101048050 3300032002 Bacteria 919
447 Ga0307416_101445333 3300032002 Bacteria 793
448 Ga0307415_100170571 3300032126 Bacteria 1696
449 Ga0307415_100361133 3300032126 Bacteria 1226
450 Ga0307415_100679024 3300032126 Bacteria 927
451 Ga0307415_101078465 3300032126 Bacteria 751
452 Ga0307415_101542307 3300032126 Bacteria 637
453 Ga0316583_10025279 3300032133 Bacteria 2121
454 Ga0373959_0218525 3300034820 Bacteria 510
455 Ga0373926_0143683 3300035083 Bacteria 907
456 Ga0373928_0104417 3300035084 Bacteria 743
457 Ga0373944_0160046 3300035089 Bacteria 798
458 Ga0373936_0259042 3300035113 Bacteria 778
459 Ga0373941_0122679 3300035115 Bacteria 928
460 Ga0373941_0485803 3300035115 Bacteria 523
461 Ga0373953_0535639 3300035117 Bacteria 520
462 Ga0373954_0192125 3300035118 Bacteria 1002
463 Ga0373954_0659212 3300035118 Bacteria 519
464 Ga0373956_0570298 3300035119 Bacteria 540
465 Ga0373957_0075203 3300035120 Bacteria 1327
466 Ga0373943_0165986 3300035170 Bacteria 1205
467 Ga0373943_0787598 3300035170 Bacteria 565
468 Ga0373955_0019862 3300035172 Bacteria 3367
469 Ga0373955_0722610 3300035172 Bacteria 612
470 Ga0373955_0902131 3300035172 Bacteria 544
471 Ga0373961_0320769 3300035241 Bacteria 578
472 Ga0373962_0387606 3300035242 Bacteria 512
473 Ga0316574_0119753 3300035398 Bacteria 1690
474 Ga0316574_0310356 3300035398 Bacteria 1002
475 Ga0373931_0087405 3300035691 Bacteria 1731
476 Ga0373931_1203545 3300035691 Bacteria 519
477 Ga0373935_0978227 3300035692 Bacteria 628
478 Ga0373935_1009759 3300035692 Bacteria 618
479 Ga0373935_1027252 3300035692 Bacteria 613
480 Ga0373927_0002910 3300035695 Bacteria 12450
481 Ga0373933_0272575 3300035724 Bacteria 1092
482 Ga0373933_0404241 3300035724 Bacteria 891
483 Ga0373947_0145011 3300035725 Bacteria 1526
484 Ga0373947_0745119 3300035725 Bacteria 668
485 Ga0373937_0054860 3300036401 Bacteria 3657
486 Ga0373937_0116611 3300036401 Bacteria 2487
487 Ga0373937_0580766 3300036401 Bacteria 1064
488 Ga0373937_0616501 3300036401 Bacteria 1030
489 Ga0373937_1420592 3300036401 Bacteria 642
490 Ga0373937_1669340 3300036401 Bacteria 584
491 Ga0373937_1783256 3300036401 Bacteria 562
492 Ga0373937_1828365 3300036401 Bacteria 554
493 Ga0373937_1870122 3300036401 Bacteria 547
494 Ga0265778_029342 3300036457 Bacteria 707
495 Ga0316582_0020691 3300036647 Bacteria 3874
496 Ga0316584_0090261 3300036712 Bacteria 2294
497 Ga0316584_0090430 3300036712 Bacteria 2291
498 Ga0316584_0871483 3300036712 Bacteria 608
499 Ga0373925_0074969 3300037068 Bacteria 2563
500 Ga0373925_0273612 3300037068 Bacteria 1359
501 Ga0373925_0716708 3300037068 Bacteria 825
502 Ga0395905_0349343 3300037471 Bacteria 1371
503 Ga0436364_1339422 3300037853 Bacteria 1303
504 Ga0395901_0292595 3300038443 Bacteria 1690
505 Ga0436365_0864646 3300039437 Bacteria 2079
506 Ga0436365_1137434 3300039437 Bacteria 5368
507 Ga0436360_0398486 3300039438 Bacteria 1376
508 Ga0436360_1025531 3300039438 Bacteria 1739
509 Ga0436361_0347571 3300039447 Bacteria 520
510 Ga0436361_0363213 3300039447 Bacteria 723
511 Ga0436363_0158754 3300039450 Bacteria 638
512 Ga0436362_0452528 3300039453 Bacteria 1305
513 Ga0436362_0574409 3300039453 Bacteria 878
514 Ga0436362_0610963 3300039453 Bacteria 683
515 Ga0436362_0926769 3300039453 Bacteria 6312
516 Ga0436362_1267422 3300039453 Bacteria 670
517 Ga0439438_087931 3300041405 Bacteria 759
518 Ga0439447_082074 3300041407 Bacteria 744
519 Ga0439447_144531 3300041407 Bacteria 547
520 Ga0439466_0060806 3300041411 Bacteria 1217
521 Ga0439465_0115468 3300041413 Bacteria 938
522 Ga0439465_0185422 3300041413 Bacteria 754
523 Ga0451789_0295635 3300041443 Bacteria 587
524 Ga0451789_0691516 3300041443 Bacteria 687
525 Ga0451789_1001237 3300041443 Bacteria 606
526 Ga0451793_0786865 3300041452 Bacteria 516
527 Ga0451793_0888147 3300041452 Bacteria 674
528 Ga0451800_0557038 3300041459 Bacteria 595
529 Ga0451800_1560776 3300041459 Bacteria 627
530 Ga0451802_0727857 3300041460 Bacteria 557
531 Ga0451804_0322183 3300041463 Bacteria 505
532 Ga0451807_0805328 3300041486 Bacteria 1026
533 Ga0451833_0476916 3300041491 Bacteria 590
534 Ga0451835_0236827 3300041492 Bacteria 810
535 Ga0451837_0284750 3300041494 Bacteria 669
536 Ga0451837_1331350 3300041494 Bacteria 1115
537 Ga0451841_1231041 3300041498 Bacteria 665
538 Ga0451845_0696073 3300041501 Bacteria 606
539 Ga0451845_0849781 3300041501 Bacteria 591
540 Ga0451843_0421569 3300041509 Bacteria 500
541 Ga0451855_0451382 3300041511 Bacteria 748
542 Ga0451855_0993140 3300041511 Bacteria 693
543 Ga0451855_1220682 3300041511 Bacteria 517
544 Ga0451853_3989981 3300041512 Bacteria 534
545 Ga0451853_3990262 3300041512 Bacteria 554
546 Ga0439443_003376 3300042003 Bacteria 2008
547 Ga0439448_0016232 3300042005 Bacteria 2264
548 Ga0439432_097560 3300042006 Bacteria 881
549 Ga0439450_004279 3300042008 Bacteria 2427
550 Ga0439451_015259 3300042009 Bacteria 1548
551 Ga0439452_048599 3300042010 Bacteria 978
552 Ga0439454_012781 3300042011 Bacteria 1143
553 Ga0439455_0003578 3300042012 Bacteria 2987
554 Ga0439456_069019 3300042013 Bacteria 782
555 Ga0439462_0060113 3300042015 Bacteria 1028
556 Ga0439463_001797 3300042016 Bacteria 5582
557 Ga0450914_013191 3300042118 Bacteria 838
558 Ga0450920_091232 3300042122 Bacteria 629
559 Ga0450923_064275 3300042125 Bacteria 805
560 Ga0439446_0233382 3300042156 Bacteria 630
561 Ga0439434_0076777 3300042435 Bacteria 1056
562 Ga0439435_0115736 3300042436 Bacteria 836
563 Ga0439444_0000757 3300042437 Bacteria 3846
564 Ga0439464_0003182 3300042439 Bacteria 4117
565 Ga0439464_0126431 3300042439 Bacteria 790
566 Ga0439460_0002253 3300042461 Bacteria 4636
567 Ga0450901_003463 3300042533 Bacteria 1644
568 Ga0439440_0041725 3300042993 Bacteria 1120
569 Ga0466965_0834830 3300044683 Bacteria 535
570 Ga0466966_0037227 3300044684 Bacteria 3139
571 Ga0466961_0355835 3300044693 Bacteria 891
572 Ga0466968_0087216 3300044735 Bacteria 1378
573 Ga0466957_0581686 3300044842 Bacteria 783
574 Ga0466959_0180664 3300045049 Bacteria 1476
575 Ga0466958_0602654 3300045836 Bacteria 714
576 Ga0466967_0656943 3300045976 Bacteria 1037
577 Ga0466967_2067220 3300045976 Bacteria 566
578 Ga0495592_0128998 3300046454 Bacteria 1771
579 Ga0495592_0151325 3300046454 Bacteria 1604
580 Ga0495592_0355136 3300046454 Bacteria 939
581 Ga0495603_0624689 3300046455 Bacteria 617
582 Ga0495629_0481440 3300046459 Bacteria 838
583 Ga0495629_0664506 3300046459 Bacteria 693
584 Ga0495641_0021235 3300046461 Bacteria 3270
585 Ga0495641_0104193 3300046461 Bacteria 1266
586 Ga0495641_0201483 3300046461 Bacteria 892
587 Ga0495651_0005682 3300046462 Bacteria 9506
588 Ga0495651_0391713 3300046462 Bacteria 909
589 Ga0495651_0513824 3300046462 Bacteria 765
590 Ga0495651_0597985 3300046462 Bacteria 696
591 Ga0495651_0895033 3300046462 Bacteria 543
592 Ga0495653_0058564 3300046463 Bacteria 2928
593 Ga0495653_0533690 3300046463 Bacteria 728
594 Ga0495653_0550953 3300046463 Bacteria 713
595 Ga0495582_0176399 3300046473 Bacteria 1217
596 Ga0495582_0454066 3300046473 Bacteria 740
597 Ga0495582_0748203 3300046473 Bacteria 566
598 Ga0495662_0200332 3300046476 Bacteria 984
599 Ga0495664_0084408 3300046477 Bacteria 1906
600 Ga0495585_0311439 3300046492 Bacteria 772
601 Ga0495594_0641089 3300046499 Bacteria 602
602 Ga0495594_0679396 3300046499 Bacteria 582
603 Ga0495594_0823113 3300046499 Bacteria 523
604 Ga0495608_0069453 3300046511 Bacteria 2301
605 Ga0495608_0420908 3300046511 Bacteria 815
606 Ga0495608_0625484 3300046511 Bacteria 645
607 Ga0495618_0097683 3300046514 Bacteria 1879
608 Ga0495618_0314173 3300046514 Unclassified 971
609 Ga0495628_0019367 3300046516 Bacteria 5627
610 Ga0495628_0168479 3300046516 Bacteria 1661
611 Ga0495628_0231487 3300046516 Bacteria 1385
612 Ga0495628_1210942 3300046516 Bacteria 512
613 Ga0495630_0028174 3300046517 Bacteria 4173
614 Ga0495630_0113574 3300046517 Bacteria 2052
615 Ga0495630_0140615 3300046517 Bacteria 1835
616 Ga0495630_0352319 3300046517 Unclassified 1127
617 Ga0495630_0528407 3300046517 Bacteria 905
618 Ga0495630_1087710 3300046517 Bacteria 606
619 Ga0495666_0291138 3300046526 Bacteria 739
620 Ga0495642_0069434 3300046528 Bacteria 1472
621 Ga0495652_0374333 3300046529 Bacteria 1014
622 Ga0495652_0527843 3300046529 Bacteria 815
623 Ga0495652_0698763 3300046529 Bacteria 683
624 Ga0495640_0056994 3300046533 Bacteria 2667
625 Ga0495640_0076340 3300046533 Bacteria 2236
626 Ga0495640_0087602 3300046533 Bacteria 2059
627 Ga0495640_0800607 3300046533 Bacteria 562
628 Ga0495586_0464037 3300046535 Bacteria 730
629 Ga0495586_0680193 3300046535 Bacteria 594
630 Ga0495587_0132627 3300046536 Bacteria 1423
631 Ga0495587_0205073 3300046536 Bacteria 1114
632 Ga0495587_0770909 3300046536 Bacteria 526
633 Ga0495621_0245483 3300046539 Bacteria 730
634 Ga0495645_0323489 3300046543 Bacteria 1001
635 Ga0495645_0559553 3300046543 Bacteria 708
636 Ga0495622_0291670 3300046557 Unclassified 712
637 Ga0495667_0015268 3300046559 Bacteria 5186
638 Ga0495667_0068099 3300046559 Bacteria 2325
639 Ga0495667_0259101 3300046559 Bacteria 1106
640 Ga0495667_0304783 3300046559 Bacteria 1009
641 Ga0495667_0359884 3300046559 Bacteria 919
642 Ga0495667_0396329 3300046559 Bacteria 870
643 Ga0495634_0209614 3300046642 Bacteria 1207
644 Ga0495634_0424011 3300046642 Bacteria 788
645 Ga0495634_0553314 3300046642 Bacteria 671
646 Ga0495634_0799176 3300046642 Bacteria 538
647 Ga0495635_0046466 3300046663 Bacteria 2995
648 Ga0495635_0280918 3300046663 Bacteria 1118
649 Ga0495635_0565278 3300046663 Bacteria 745
650 Ga0495635_0778175 3300046663 Bacteria 618
651 Ga0495635_1080304 3300046663 Unclassified 508
652 Ga0495657_0017051 3300046675 Bacteria 5279
653 Ga0495657_0096798 3300046675 Bacteria 1885
654 Ga0495657_0184591 3300046675 Bacteria 1278
655 Ga0495657_0278600 3300046675 Bacteria 1001
656 Ga0495657_0361019 3300046675 Bacteria 858
657 Ga0495599_0091479 3300046678 Bacteria 1898
658 Ga0495599_0295148 3300046678 Bacteria 979
659 Ga0495599_0480960 3300046678 Bacteria 733
660 Ga0495623_0248087 3300046679 Bacteria 1002
661 Ga0495646_0237372 3300046680 Bacteria 981
662 Ga0495647_0132473 3300046681 Bacteria 1057
663 Ga0495658_0014297 3300046683 Bacteria 4053
664 Ga0495658_0062617 3300046683 Bacteria 2139
665 Ga0495658_0086682 3300046683 Bacteria 1848
666 Ga0495658_0951589 3300046683 Bacteria 549
667 Ga0495658_1059420 3300046683 Bacteria 517
668 Ga0495613_0653299 3300046689 Bacteria 696
669 Ga0495613_0732338 3300046689 Bacteria 649
670 Ga0495624_0285218 3300046690 Bacteria 997
671 Ga0495624_0356056 3300046690 Bacteria 880
672 Ga0495624_0375872 3300046690 Bacteria 854
673 Ga0495624_0475863 3300046690 Bacteria 748
674 Ga0495649_0641251 3300046694 Bacteria 523
675 Ga0495600_0028453 3300046809 Bacteria 3616
676 Ga0495600_0190559 3300046809 Unclassified 1319
677 Ga0495581_0383626 3300047315 Bacteria 820
678 Ga0495604_0042560 3300047317 Bacteria 3559
679 Ga0495604_0089881 3300047317 Bacteria 2282
680 Ga0495604_0410140 3300047317 Bacteria 891
681 Ga0495604_0600100 3300047317 Bacteria 706
682 Ga0495604_0808674 3300047317 Bacteria 590
683 Ga0495674_0163881 3300047319 Bacteria 1859
684 Ga0495674_0267012 3300047319 Bacteria 1405
685 Ga0495674_0285311 3300047319 Bacteria 1352
686 Ga0495674_0969493 3300047319 Bacteria 653
687 Ga0495676_0177237 3300047321 Bacteria 1496
688 Ga0495676_0324421 3300047321 Bacteria 1034
689 Ga0495676_0475446 3300047321 Bacteria 822
690 Ga0495680_0065023 3300047322 Bacteria 2795
691 Ga0495680_0089549 3300047322 Bacteria 2310
692 Ga0495680_0117332 3300047322 Bacteria 1967
693 Ga0495680_0204490 3300047322 Bacteria 1415
694 Ga0495680_0566005 3300047322 Bacteria 764
695 Ga0495680_0591023 3300047322 Unclassified 744
696 Ga0495680_0939472 3300047322 Bacteria 556
697 Ga0495675_0079892 3300047444 Bacteria 2060
698 Ga0495684_0283136 3300047471 Unclassified 1195
699 Ga0495684_0322488 3300047471 Bacteria 1104
700 Ga0495593_0661103 3300047673 Bacteria 525
701 Ga0495602_0264127 3300048088 Bacteria 1275
702 Ga0495602_0300801 3300048088 Bacteria 1174
703 Ga0495602_0653655 3300048088 Bacteria 718
704 Ga0495614_0125970 3300048089 Bacteria 1132
705 Ga0495614_0225853 3300048089 Bacteria 852
706 Ga0496100_0077946 3300048903 Bacteria 2229
707 Ga0496100_0617189 3300048903 Bacteria 843
708 Ga0496101_0055641 3300048904 Bacteria 2858
709 Ga0496101_1225117 3300048904 Bacteria 588
710 Ga0496101_1268418 3300048904 Bacteria 577
711 Ga0496102_0027272 3300048905 Bacteria 5100
712 Ga0496102_0295812 3300048905 Bacteria 1526
713 Ga0496102_0772597 3300048905 Bacteria 883
714 Ga0496102_1120588 3300048905 Bacteria 707
715 Ga0496102_1181124 3300048905 Bacteria 685
716 Ga0496103_0105389 3300048906 Bacteria 1788
717 Ga0496103_0484622 3300048906 Bacteria 792
718 Ga0496103_0860057 3300048906 Bacteria 570
719 Ga0496104_0089203 3300048907 Bacteria 2946
720 Ga0496104_0335185 3300048907 Bacteria 1425
721 Ga0496104_0563723 3300048907 Bacteria 1050
722 Ga0496104_0876480 3300048907 Bacteria 803
723 Ga0496105_0016968 3300048908 Bacteria 5826
724 Ga0496105_0411240 3300048908 Bacteria 1072
725 Ga0496105_0456126 3300048908 Bacteria 1008
726 Ga0496105_0560820 3300048908 Bacteria 890
727 Ga0496106_0446383 3300048909 Bacteria 1039
728 Ga0496107_0058190 3300048910 Bacteria 2795
729 Ga0496107_0637306 3300048910 Bacteria 786
730 Ga0496107_0914307 3300048910 Bacteria 639
731 Ga0496108_0040002 3300048911 Bacteria 3907
732 Ga0496108_0420159 3300048911 Bacteria 1168
733 Ga0496108_0647265 3300048911 Bacteria 919
734 Ga0496108_0975395 3300048911 Bacteria 725
735 Ga0496109_0013733 3300048912 Bacteria 7037
736 Ga0496109_0627674 3300048912 Bacteria 1011
737 Ga0496109_0669716 3300048912 Bacteria 975
738 Ga0496109_1585368 3300048912 Bacteria 589
739 Ga0496110_0080430 3300048913 Bacteria 2904
740 Ga0496110_0082566 3300048913 Bacteria 2866
741 Ga0496110_0148681 3300048913 Bacteria 2120
742 Ga0496110_0172957 3300048913 Bacteria 1960
743 Ga0496110_1609556 3300048913 Bacteria 560
744 Ga0496111_0295235 3300048914 Bacteria 1201
745 Ga0496111_0558261 3300048914 Bacteria 840
746 Ga0496111_0766280 3300048914 Bacteria 699
747 Ga0496111_1079274 3300048914 Bacteria 573
748 Ga0496112_0164772 3300048915 Bacteria 2183
749 Ga0496112_0660004 3300048915 Bacteria 975
750 Ga0496112_1077872 3300048915 Bacteria 722
751 Ga0496113_1075158 3300048916 Bacteria 632
752 Ga0496114_0124845 3300048917 Bacteria 2218
753 Ga0496114_0169930 3300048917 Bacteria 1899
754 Ga0496114_1411923 3300048917 Bacteria 583
755 Ga0496115_0005604 3300048918 Bacteria 9139
756 Ga0496115_0585738 3300048918 Bacteria 888
757 Ga0501307_062365 3300049162 Bacteria 581
758 Ga0501031_0029061 3300049568 Bacteria 3605
759 Ga0501031_0055955 3300049568 Bacteria 2570
760 Ga0501032_0018194 3300049569 Bacteria 4925
761 Ga0501032_0075987 3300049569 Bacteria 2237
762 Ga0501032_0144989 3300049569 Bacteria 1563
763 Ga0501032_0326977 3300049569 Bacteria 989
764 Ga0501032_0992414 3300049569 Bacteria 528
765 Ga0501033_0010017 3300049570 Bacteria 7280
766 Ga0501033_0052492 3300049570 Bacteria 3021
767 Ga0501033_0068083 3300049570 Bacteria 2618
768 Ga0501034_0001825 3300049571 Bacteria 27031
769 Ga0501034_0011458 3300049571 Bacteria 9188
770 Ga0501034_0026359 3300049571 Bacteria 5919
771 Ga0501034_0070102 3300049571 Bacteria 3517
772 Ga0501036_0007041 3300049572 Bacteria 9150
773 Ga0501036_0008564 3300049572 Bacteria 8389
774 Ga0501036_0201044 3300049572 Bacteria 1676
775 Ga0501036_0253788 3300049572 Bacteria 1473
776 Ga0501036_0280132 3300049572 Bacteria 1395
777 Ga0501036_1534181 3300049572 Bacteria 539
778 Ga0501037_0070950 3300049573 Bacteria 2534
779 Ga0501037_0181099 3300049573 Bacteria 1495
780 Ga0501038_0041698 3300049574 Bacteria 4002
781 Ga0501038_0116577 3300049574 Bacteria 2207
782 Ga0501038_0830753 3300049574 Bacteria 685
783 Ga0501038_1143385 3300049574 Bacteria 567
784 Ga0501039_0005221 3300049575 Bacteria 9835
785 Ga0501039_0141812 3300049575 Bacteria 1887
786 Ga0501039_0776674 3300049575 Bacteria 748
787 Ga0501039_0799519 3300049575 Bacteria 736
788 Ga0501040_0015352 3300049576 Bacteria 5064
789 Ga0501040_0021776 3300049576 Bacteria 4285
790 Ga0501040_0099512 3300049576 Bacteria 2027
791 Ga0501040_0702640 3300049576 Bacteria 731
792 Ga0501041_0152846 3300049577 Bacteria 1441
793 Ga0501041_0578227 3300049577 Bacteria 717
794 Ga0501042_0058389 3300049578 Bacteria 2754
795 Ga0501042_0069895 3300049578 Bacteria 2511
796 Ga0501042_0099595 3300049578 Bacteria 2089
797 Ga0501042_0210980 3300049578 Bacteria 1401
798 Ga0501042_0211014 3300049578 Bacteria 1401
799 Ga0501042_1062975 3300049578 Bacteria 590
800 Ga0501043_0028890 3300049579 Bacteria 4352
801 Ga0501043_0093630 3300049579 Bacteria 2362
802 Ga0501043_0207850 3300049579 Bacteria 1517
803 Ga0501043_0329824 3300049579 Bacteria 1162
804 Ga0501043_0589583 3300049579 Bacteria 822
805 Ga0501046_0054622 3300049580 Bacteria 3141
806 Ga0501046_0074182 3300049580 Bacteria 2640
807 Ga0501046_0088527 3300049580 Bacteria 2384
808 Ga0501046_0142775 3300049580 Bacteria 1810
809 Ga0501046_0841276 3300049580 Bacteria 642
810 Ga0501047_0021371 3300049581 Bacteria 6211
811 Ga0501047_0810406 3300049581 Bacteria 751
812 Ga0501047_1051915 3300049581 Bacteria 627
813 Ga0501048_0007282 3300049582 Bacteria 8389
814 Ga0501048_0012084 3300049582 Bacteria 6434
815 Ga0501048_0273325 3300049582 Bacteria 1201
816 Ga0501048_0879075 3300049582 Bacteria 644
817 Ga0501048_1032031 3300049582 Bacteria 591
818 Ga0501067_0073272 3300049583 Bacteria 1897
819 Ga0501067_0181187 3300049583 Bacteria 1173
820 Ga0501067_0849989 3300049583 Bacteria 514
821 Ga0501068_0060472 3300049584 Bacteria 2301
822 Ga0501068_0085482 3300049584 Bacteria 1941
823 Ga0501068_0110537 3300049584 Bacteria 1708
824 Ga0501068_0310000 3300049584 Bacteria 1011
825 Ga0501068_0353617 3300049584 Bacteria 944
826 Ga0501068_0417811 3300049584 Bacteria 866
827 Ga0501068_0463350 3300049584 Bacteria 821
828 Ga0501068_0743945 3300049584 Bacteria 642
829 Ga0501069_0024577 3300049585 Bacteria 3286
830 Ga0501069_0456180 3300049585 Bacteria 760
831 Ga0501069_0944532 3300049585 Bacteria 525
832 Ga0501070_0015834 3300049586 Bacteria 6339
833 Ga0501070_0081767 3300049586 Bacteria 2673
834 Ga0501070_0128945 3300049586 Bacteria 2090
835 Ga0501070_0237407 3300049586 Bacteria 1492
836 Ga0501070_0273055 3300049586 Bacteria 1380
837 Ga0501070_0421131 3300049586 Bacteria 1078
838 Ga0501070_0456456 3300049586 Bacteria 1030
839 Ga0501070_0548211 3300049586 Bacteria 926
840 Ga0501071_0007079 3300049587 Bacteria 7328
841 Ga0501071_0008766 3300049587 Bacteria 6699
842 Ga0501071_0025765 3300049587 Bacteria 4121
843 Ga0501071_0086358 3300049587 Bacteria 2301
844 Ga0501071_0311569 3300049587 Bacteria 1194
845 Ga0501071_0321234 3300049587 Bacteria 1176
846 Ga0501071_0775276 3300049587 Bacteria 739
847 Ga0501071_1014368 3300049587 Bacteria 641
848 Ga0501071_1049934 3300049587 Bacteria 629
849 Ga0501071_1470997 3300049587 Bacteria 526
850 Ga0501072_0003175 3300049588 Bacteria 12358
851 Ga0501072_0019717 3300049588 Bacteria 5216
852 Ga0501072_0044698 3300049588 Bacteria 3482
853 Ga0501072_0630461 3300049588 Bacteria 844
854 Ga0501072_0723299 3300049588 Bacteria 782
855 Ga0501073_0041651 3300049589 Bacteria 3245
856 Ga0501073_0273544 3300049589 Bacteria 1165
857 Ga0501073_0357846 3300049589 Bacteria 1008
858 Ga0501073_0367927 3300049589 Bacteria 993
859 Ga0501073_0445568 3300049589 Bacteria 895
860 Ga0501073_0828433 3300049589 Bacteria 638
861 Ga0501073_0864369 3300049589 Bacteria 623
862 Ga0501074_0006817 3300049590 Bacteria 8251
863 Ga0501074_0155300 3300049590 Bacteria 1635
864 Ga0501074_0176379 3300049590 Bacteria 1525
865 Ga0501074_0855272 3300049590 Bacteria 640
866 Ga0501074_1016374 3300049590 Bacteria 583
867 Ga0501074_1101261 3300049590 Bacteria 558
868 Ga0501075_0005970 3300049591 Bacteria 8338
869 Ga0501075_0071170 3300049591 Bacteria 2628
870 Ga0501075_0138700 3300049591 Bacteria 1853
871 Ga0501075_0231786 3300049591 Bacteria 1408
872 Ga0501075_0739177 3300049591 Bacteria 749
873 Ga0501075_0956393 3300049591 Bacteria 651
874 Ga0501076_0057523 3300049592 Bacteria 3087
875 Ga0501076_0217698 3300049592 Bacteria 1561
876 Ga0501076_0269045 3300049592 Bacteria 1395
877 Ga0501076_0703038 3300049592 Bacteria 834
878 Ga0501076_1147524 3300049592 Bacteria 640
879 Ga0501076_1342508 3300049592 Bacteria 588
880 Ga0501076_1459667 3300049592 Bacteria 562
881 Ga0501077_0000888 3300049593 Bacteria 17971
882 Ga0501077_0036713 3300049593 Bacteria 3122
883 Ga0501077_0099061 3300049593 Bacteria 1847
884 Ga0501077_0198886 3300049593 Bacteria 1273
885 Ga0501077_0329397 3300049593 Bacteria 974
886 Ga0501077_0552288 3300049593 Bacteria 739
887 Ga0501077_0824762 3300049593 Bacteria 596
888 Ga0501079_0059945 3300049741 Bacteria 2935
889 Ga0501079_0099422 3300049741 Bacteria 2254
890 Ga0501079_0250713 3300049741 Bacteria 1383
891 Ga0501079_0576496 3300049741 Bacteria 885
892 Ga0501079_1262226 3300049741 Bacteria 582
893 Ga0501080_0030535 3300049742 Bacteria 5021
894 Ga0501080_0054028 3300049742 Bacteria 3741
895 Ga0501080_0068025 3300049742 Bacteria 3313
896 Ga0501080_0545144 3300049742 Bacteria 1033
897 Ga0501080_0629606 3300049742 Bacteria 950
898 Ga0501080_1444151 3300049742 Bacteria 586
899 Ga0501081_0067020 3300049743 Bacteria 2497
900 Ga0501081_0103227 3300049743 Bacteria 2017
901 Ga0501081_0335613 3300049743 Bacteria 1113
902 Ga0501081_0575787 3300049743 Bacteria 842
903 Ga0501083_0045532 3300049744 Bacteria 2968
904 Ga0501083_0157882 3300049744 Bacteria 1484
905 Ga0501083_0327849 3300049744 Bacteria 995
906 Ga0501083_0768758 3300049744 Bacteria 627
907 Ga0501083_0989165 3300049744 Bacteria 547
908 Ga0501035_0092379 3300049822 Bacteria 2663
909 Ga0501035_0093954 3300049822 Bacteria 2638
910 Ga0501035_0710222 3300049822 Bacteria 810
911 Ga0501035_1544683 3300049822 Bacteria 505
912 Ga0501044_0005604 3300049823 Bacteria 13944
913 Ga0501044_0145682 3300049823 Bacteria 2354
914 Ga0501044_0188172 3300049823 Bacteria 2028
915 Ga0501044_0305364 3300049823 Bacteria 1519
916 Ga0501045_0001378 3300049824 Bacteria 16195
917 Ga0501045_0037014 3300049824 Bacteria 3546
918 Ga0501045_0389523 3300049824 Bacteria 1037
919 Ga0501045_1330946 3300049824 Bacteria 522
920 nmdc:mga03n38_329755_c1 3300050490 Bacteria 826
921 nmdc:mga03n38_750734_c1 3300050490 Bacteria 565
922 nmdc:mga00v17_4409_c2 3300050491 Bacteria 4086
923 nmdc:mga00v17_457492_c1 3300050491 Bacteria 828
924 nmdc:mga00v17_521782_c1 3300050491 Bacteria 769
925 nmdc:mga00v17_598768_c1 3300050491 Bacteria 711
926 nmdc:mga00v17_665503_c1 3300050491 Bacteria 669
927 nmdc:mga0yw44_1054667_c1 3300050492 Bacteria 550
928 nmdc:mga0yw44_122103_c1 3300050492 Bacteria 1679
929 nmdc:mga0yw44_130682_c1 3300050492 Bacteria 1625
930 nmdc:mga0yw44_248776_c1 3300050492 Bacteria 1183
931 nmdc:mga0yw44_369192_c1 3300050492 Bacteria 968
932 nmdc:mga0yw44_514509_c1 3300050492 Bacteria 812
933 nmdc:mga0yw44_567209_c1 3300050492 Bacteria 771
934 nmdc:mga0yw44_70933_c1 3300050492 Bacteria 2161
935 nmdc:mga0yw44_894416_c1 3300050492 Bacteria 602
936 nmdc:mga0yw44_937358_c1 3300050492 Bacteria 587
937 nmdc:mga0yw44_972161_c1 3300050492 Bacteria 575
938 nmdc:mga06z11_109726_c1 3300050494 Bacteria 1526
939 nmdc:mga06z11_232365_c1 3300050494 Bacteria 1081
940 nmdc:mga06z11_929077_c1 3300050494 Bacteria 530
941 nmdc:mga04h51_5332_c1 3300050495 Bacteria 3271
942 nmdc:mga07m45_489654_c1 3300050496 Bacteria 712
943 nmdc:mga05p37_1282483_c1 3300050507 Bacteria 748
944 nmdc:mga05p37_168911_c1 3300050507 Bacteria 2669
945 nmdc:mga05p37_169986_c1 3300050507 Bacteria 2659
946 nmdc:mga05p37_248599_c1 3300050507 Bacteria 2134
947 nmdc:mga05p37_31336_c1 3300050507 Bacteria 6495
948 nmdc:mga05p37_48432_c1 3300050507 Bacteria 5227
949 nmdc:mga05p37_486603_c1 3300050507 Bacteria 1420
950 nmdc:mga09592_1174618_c1 3300050508 Bacteria 635
951 nmdc:mga09592_1363859_c1 3300050508 Bacteria 581
952 nmdc:mga09592_14153_c1 3300050508 Bacteria 6507
953 nmdc:mga09592_1601914_c1 3300050508 Bacteria 527
954 nmdc:mga09592_174787_c1 3300050508 Bacteria 1858
955 nmdc:mga09592_22064_c1 3300050508 Bacteria 5253
956 nmdc:mga09592_537208_c1 3300050508 Bacteria 1005
957 nmdc:mga09592_58268_c1 3300050508 Bacteria 3266
958 nmdc:mga0qj67_10020_c1 3300050509 Bacteria 7069
959 nmdc:mga0qj67_1097172_c1 3300050509 Bacteria 622
960 nmdc:mga0qj67_25091_c1 3300050509 Bacteria 4602
961 nmdc:mga0qj67_2958_c1 3300050509 Bacteria 12183
962 nmdc:mga0qj67_321947_c1 3300050509 Bacteria 1252
963 nmdc:mga0qj67_352488_c1 3300050509 Bacteria 1190
964 nmdc:mga0qj67_80075_c1 3300050509 Bacteria 2617
965 nmdc:mga06r32_1401943_c1 3300050510 Bacteria 641
966 nmdc:mga06r32_14563_c1 3300050510 Bacteria 7140
967 nmdc:mga06r32_59926_c1 3300050510 Bacteria 3662
968 nmdc:mga06r32_651_c1 3300050510 Bacteria 30303
969 nmdc:mga06r32_973452_c1 3300050510 Bacteria 802
970 nmdc:mga08y16_1055347_c1 3300050511 Bacteria 790
971 nmdc:mga08y16_269645_c1 3300050511 Bacteria 1757
972 nmdc:mga08y16_310310_c1 3300050511 Bacteria 1625
973 nmdc:mga08y16_37553_c1 3300050511 Bacteria 5086
974 nmdc:mga08y16_707484_c1 3300050511 Bacteria 1007
975 nmdc:mga08y16_796174_c1 3300050511 Bacteria 938
976 nmdc:mga08y16_847065_c1 3300050511 Bacteria 904
977 nmdc:mga0n895_1445398_c1 3300050512 Bacteria 655
978 nmdc:mga0n895_367000_c1 3300050512 Bacteria 1457
979 nmdc:mga0n895_445221_c1 3300050512 Bacteria 1308
980 nmdc:mga08x19_1087417_c1 3300050514 Bacteria 567
981 nmdc:mga0a205_1136598_c1 3300050515 Bacteria 628
982 nmdc:mga0a205_1378073_c1 3300050515 Bacteria 553
983 nmdc:mga0a205_371807_c1 3300050515 Bacteria 1295
984 nmdc:mga0sz30_542253_c1 3300050516 Bacteria 524
985 Ga0495601_0010480 3300053077 Bacteria 5518
986 Ga0495601_0075683 3300053077 Bacteria 2155
987 Ga0495601_0279975 3300053077 Bacteria 1087
988 Ga0495601_0283967 3300053077 Bacteria 1079
989 Ga0495601_0603686 3300053077 Bacteria 704
990 Ga0495601_0810885 3300053077 Bacteria 594
991 Ga0495612_0205550 3300053078 Bacteria 869
992 Ga0495612_0249303 3300053078 Bacteria 790
993 Ga0495612_0539124 3300053078 Bacteria 537
994 Ga0495595_0013597 3300053084 Bacteria 3441
995 Ga0495595_0016457 3300053084 Bacteria 3164
996 Ga0495595_0064141 3300053084 Bacteria 1726
997 Ga0495595_0064440 3300053084 Bacteria 1722
998 Ga0495595_0150260 3300053084 Bacteria 1146
999 Ga0495595_0310277 3300053084 Bacteria 794
1000 Ga0495595_0558807 3300053084 Bacteria 584
1001 Ga0495595_0569265 3300053084 Bacteria 579
1002 Ga0495619_0017532 3300053085 Bacteria 4535
1003 Ga0495619_0039309 3300053085 Bacteria 3088
1004 Ga0495619_0069369 3300053085 Bacteria 2356
1005 Ga0495619_0097429 3300053085 Bacteria 1998
1006 Ga0495619_0115619 3300053085 Bacteria 1836
1007 Ga0495619_0183421 3300053085 Bacteria 1448
1008 Ga0495619_0203239 3300053085 Bacteria 1372
1009 Ga0495619_0321426 3300053085 Bacteria 1071
1010 Ga0495619_0401455 3300053085 Bacteria 946
1011 Ga0495619_0602496 3300053085 Bacteria 752
1012 Ga0500646_0029483 3300053090 Bacteria 1503
1013 Ga0500566_0117497 3300053094 Bacteria 1438
1014 Ga0500641_0332521 3300053096 Bacteria 615
1015 Ga0500555_021658 3300053103 Bacteria 1851
1016 Ga0501084_0000009 3300054114 Bacteria 194961
1017 Ga0501084_0003886 3300054114 Bacteria 12158
1018 Ga0501084_0012833 3300054114 Bacteria 6940
1019 Ga0501084_0245432 3300054114 Bacteria 1511
1020 Ga0501084_1122865 3300054114 Bacteria 660
1021 Ga0501084_1355937 3300054114 Bacteria 596
1022 Ga0590075_014969 3300059424 Bacteria 1900
1023 Ga0587070_076971 3300059491 Bacteria 724
1024 Ga0587073_0271416 3300059492 Bacteria 540
1025 Ga0587077_140525 3300059493 Bacteria 622
1026 Ga0587080_120358 3300059503 Bacteria 581
1027 Ga0587082_077902 3300059504 Bacteria 685
1028 Ga0587085_151913 3300059506 Bacteria 535
1029 Ga0587090_052905 3300059510 Bacteria 749
1030 Ga0587092_099521 3300059512 Bacteria 597
1031 Ga0587106_081501 3300059605 Bacteria 631
1032 Ga0587131_006986 3300059609 Bacteria 743
1033 Ga0587099_055129 3300059622 Bacteria 538
1034 Ga0587101_055735 3300059623 Bacteria 693
1035 Ga0587109_115649 3300059624 Bacteria 632
1036 Ga0587109_150584 3300059624 Bacteria 575
1037 Ga0587109_196162 3300059624 Bacteria 523
1038 Ga0587115_091690 3300059626 Bacteria 552
1039 Ga0587115_102224 3300059626 Bacteria 533
1040 Ga0587128_142288 3300059630 Bacteria 540
1041 Ga0587128_168329 3300059630 Bacteria 510
1042 Ga0587062_054287 3300059639 Bacteria 687
1043 Ga0587068_154557 3300059641 Bacteria 521
1044 Ga0587078_049683 3300059646 Bacteria 612
1045 Ga0587079_183250 3300059647 Bacteria 562
1046 Ga0587079_249224 3300059647 Bacteria 505
1047 Ga0587110_031230 3300059654 Bacteria 650
1048 Ga0587114_057106 3300059655 Bacteria 675
1049 Ga0587120_030716 3300059659 Bacteria 548
1050 Ga0587111_0082208 3300060346 Bacteria 772
1051 Ga0587111_0103217 3300060346 Bacteria 713
1052 Ga0501082_0016297 3300060353 Bacteria 6397
1053 Ga0501082_0112758 3300060353 Bacteria 2354
1054 Ga0501082_1189056 3300060353 Bacteria 666
1055 Ga0501082_1384996 3300060353 Bacteria 614
1056 Ga0501082_1551492 3300060353 Bacteria 578
1057 Ga0530510_0019158 3300061734 Bacteria 4854
1058 Ga0530510_0058612 3300061734 Bacteria 2784
1059 Ga0530510_0143446 3300061734 Bacteria 1760
1060 Ga0530510_0426184 3300061734 Bacteria 1002

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025927 Ga0207687_11122156 Ga0207687_111221561 49
2 3300009545 Ga0105237_11231884 Ga0105237_112318842 51
3 3300001991 JGI24743J22301_10093413 JGI24743J22301_100934133 53
4 3300003579 Ga0007429J51699_1081227 Ga0007429J51699_10812272 53
5 3300003911 JGI25405J52794_10007263 JGI25405J52794_100072632 53
6 3300004798 Ga0058859_11691400 Ga0058859_116914002 53
7 3300004798 Ga0058859_11763347 Ga0058859_117633472 53
8 3300004799 Ga0058863_11901821 Ga0058863_119018212 53
9 3300004799 Ga0058863_11937226 Ga0058863_119372262 53
10 3300004800 Ga0058861_11583168 Ga0058861_115831682 53
11 3300004800 Ga0058861_11737476 Ga0058861_117374762 53
12 3300004803 Ga0058862_10114983 Ga0058862_101149832 53
13 3300004803 Ga0058862_12780895 Ga0058862_127808951 53
14 3300005327 Ga0070658_10713506 Ga0070658_107135064 53
15 3300005327 Ga0070658_11060214 Ga0070658_110602141 53
16 3300005328 Ga0070676_10221914 Ga0070676_102219142 53
17 3300005328 Ga0070676_10858029 Ga0070676_108580292 53
18 3300005328 Ga0070676_11064977 Ga0070676_110649773 53
19 3300005328 Ga0070676_11195419 Ga0070676_111954191 53
20 3300005329 Ga0070683_100709232 Ga0070683_1007092322 53
21 3300005329 Ga0070683_100740591 Ga0070683_1007405912 53
22 3300005329 Ga0070683_100829688 Ga0070683_1008296882 53
23 3300005329 Ga0070683_101483179 Ga0070683_1014831791 53
24 3300005331 Ga0070670_102091255 Ga0070670_1020912552 53
25 3300005331 Ga0070670_102213498 Ga0070670_1022134982 53
26 3300005334 Ga0068869_101504766 Ga0068869_1015047661 53
27 3300005334 Ga0068869_101854245 Ga0068869_1018542451 53
28 3300005335 Ga0070666_11446764 Ga0070666_114467641 53
29 3300005336 Ga0070680_101506011 Ga0070680_1015060112 53
30 3300005337 Ga0070682_100629022 Ga0070682_1006290224 53
31 3300005338 Ga0068868_100034373 Ga0068868_1000343734 53
32 3300005338 Ga0068868_102064552 Ga0068868_1020645522 53
33 3300005338 Ga0068868_102369881 Ga0068868_1023698812 53
34 3300005339 Ga0070660_101690313 Ga0070660_1016903132 53
35 3300005340 Ga0070689_101005870 Ga0070689_1010058701 53
36 3300005341 Ga0070691_10135160 Ga0070691_101351602 53
37 3300005344 Ga0070661_101606993 Ga0070661_1016069931 53
38 3300005354 Ga0070675_100079130 Ga0070675_1000791302 53
39 3300005354 Ga0070675_100477649 Ga0070675_1004776492 53
40 3300005354 Ga0070675_101718830 Ga0070675_1017188301 53
41 3300005355 Ga0070671_101862869 Ga0070671_1018628692 53
42 3300005356 Ga0070674_100293369 Ga0070674_1002933692 53
43 3300005364 Ga0070673_101108487 Ga0070673_1011084872 53
44 3300005364 Ga0070673_101257047 Ga0070673_1012570472 53
45 3300005365 Ga0070688_100719387 Ga0070688_1007193872 53
46 3300005365 Ga0070688_101726998 Ga0070688_1017269981 53
47 3300005366 Ga0070659_101480329 Ga0070659_1014803293 53
48 3300005367 Ga0070667_100664434 Ga0070667_1006644341 53
49 3300005367 Ga0070667_101120607 Ga0070667_1011206072 53
50 3300005434 Ga0070709_10364631 Ga0070709_103646313 53
51 3300005435 Ga0070714_101259885 Ga0070714_1012598852 53
52 3300005435 Ga0070714_101342730 Ga0070714_1013427301 53
53 3300005436 Ga0070713_100294117 Ga0070713_1002941174 53
54 3300005436 Ga0070713_100413850 Ga0070713_1004138501 53
55 3300005437 Ga0070710_10291202 Ga0070710_102912022 53
56 3300005439 Ga0070711_100951950 Ga0070711_1009519501 53
57 3300005441 Ga0070700_100178248 Ga0070700_1001782485 53
58 3300005455 Ga0070663_100405864 Ga0070663_1004058642 53
59 3300005456 Ga0070678_100190277 Ga0070678_1001902774 53
60 3300005456 Ga0070678_100261078 Ga0070678_1002610784 53
61 3300005456 Ga0070678_100746981 Ga0070678_1007469813 53
62 3300005468 Ga0070707_100924309 Ga0070707_1009243092 53
63 3300005518 Ga0070699_100142068 Ga0070699_1001420685 53
64 3300005535 Ga0070684_100279708 Ga0070684_1002797084 53
65 3300005536 Ga0070697_101138362 Ga0070697_1011383622 53
66 3300005536 Ga0070697_101598453 Ga0070697_1015984532 53
67 3300005539 Ga0068853_102304050 Ga0068853_1023040502 53
68 3300005543 Ga0070672_100263217 Ga0070672_1002632173 53
69 3300005543 Ga0070672_100957358 Ga0070672_1009573582 53
70 3300005544 Ga0070686_100738009 Ga0070686_1007380092 53
71 3300005544 Ga0070686_101101932 Ga0070686_1011019321 53
72 3300005544 Ga0070686_101525749 Ga0070686_1015257492 53
73 3300005546 Ga0070696_100164219 Ga0070696_1001642194 53
74 3300005546 Ga0070696_100363370 Ga0070696_1003633703 53
75 3300005547 Ga0070693_100143037 Ga0070693_1001430373 53
76 3300005547 Ga0070693_101476753 Ga0070693_1014767532 53
77 3300005549 Ga0070704_100356813 Ga0070704_1003568133 53
78 3300005549 Ga0070704_101839589 Ga0070704_1018395892 53
79 3300005563 Ga0068855_100998116 Ga0068855_1009981162 53
80 3300005578 Ga0068854_100466416 Ga0068854_1004664162 53
81 3300005578 Ga0068854_100475958 Ga0068854_1004759582 53
82 3300005578 Ga0068854_101277562 Ga0068854_1012775623 53
83 3300005614 Ga0068856_100095065 Ga0068856_1000950656 53
84 3300005614 Ga0068856_101316205 Ga0068856_1013162052 53
85 3300005615 Ga0070702_100882345 Ga0070702_1008823454 53
86 3300005615 Ga0070702_101055190 Ga0070702_1010551901 53
87 3300005618 Ga0068864_100874234 Ga0068864_1008742342 53
88 3300005618 Ga0068864_101135432 Ga0068864_1011354324 53
89 3300005719 Ga0068861_101431539 Ga0068861_1014315392 53
90 3300005719 Ga0068861_101601226 Ga0068861_1016012261 53
91 3300005719 Ga0068861_101787042 Ga0068861_1017870422 53
92 3300005840 Ga0068870_11040195 Ga0068870_110401952 53
93 3300005841 Ga0068863_100957774 Ga0068863_1009577744 53
94 3300005842 Ga0068858_100749462 Ga0068858_1007494622 53
95 3300005842 Ga0068858_100915574 Ga0068858_1009155742 53
96 3300005843 Ga0068860_100779864 Ga0068860_1007798642 53
97 3300005937 Ga0081455_10007316 Ga0081455_100073163 53
98 3300005937 Ga0081455_10119047 Ga0081455_101190472 53
99 3300005937 Ga0081455_10156224 Ga0081455_101562242 53
100 3300005937 Ga0081455_10319132 Ga0081455_103191322 53
101 3300005937 Ga0081455_10727658 Ga0081455_107276581 53
102 3300005981 Ga0081538_10001047 Ga0081538_1000104725 53
103 3300005981 Ga0081538_10031895 Ga0081538_100318959 53
104 3300005981 Ga0081538_10036163 Ga0081538_100361632 53
105 3300005983 Ga0081540_1065959 Ga0081540_10659594 53
106 3300005985 Ga0081539_10016636 Ga0081539_100166367 53
107 3300006028 Ga0070717_10610237 Ga0070717_106102372 53
108 3300006028 Ga0070717_10624837 Ga0070717_106248372 53
109 3300006028 Ga0070717_11467929 Ga0070717_114679292 53
110 3300006038 Ga0075365_10032064 Ga0075365_100320643 53
111 3300006038 Ga0075365_10313913 Ga0075365_103139131 53
112 3300006038 Ga0075365_10326010 Ga0075365_103260102 53
113 3300006038 Ga0075365_10395004 Ga0075365_103950041 53
114 3300006038 Ga0075365_10536235 Ga0075365_105362352 53
115 3300006038 Ga0075365_10561011 Ga0075365_105610112 53
116 3300006038 Ga0075365_10627489 Ga0075365_106274892 53
117 3300006038 Ga0075365_10834040 Ga0075365_108340402 53
118 3300006038 Ga0075365_10851019 Ga0075365_108510192 53
119 3300006038 Ga0075365_10978153 Ga0075365_109781532 53
120 3300006042 Ga0075368_10093386 Ga0075368_100933862 53
121 3300006042 Ga0075368_10128283 Ga0075368_101282832 53
122 3300006048 Ga0075363_100266033 Ga0075363_1002660332 53
123 3300006048 Ga0075363_100349923 Ga0075363_1003499232 53
124 3300006048 Ga0075363_100390590 Ga0075363_1003905902 53
125 3300006051 Ga0075364_10037645 Ga0075364_100376452 53
126 3300006051 Ga0075364_10394716 Ga0075364_103947162 53
127 3300006051 Ga0075364_10420223 Ga0075364_104202232 53
128 3300006051 Ga0075364_10535114 Ga0075364_105351142 53
129 3300006051 Ga0075364_10669665 Ga0075364_106696651 53
130 3300006051 Ga0075364_10807253 Ga0075364_108072532 53
131 3300006163 Ga0070715_10324028 Ga0070715_103240284 53
132 3300006173 Ga0070716_100712634 Ga0070716_1007126343 53
133 3300006173 Ga0070716_100906196 Ga0070716_1009061963 53
134 3300006177 Ga0075362_10575273 Ga0075362_105752732 53
135 3300006178 Ga0075367_10293775 Ga0075367_102937752 53
136 3300006178 Ga0075367_10340213 Ga0075367_103402132 53
137 3300006237 Ga0097621_100641734 Ga0097621_1006417342 53
138 3300006237 Ga0097621_101223606 Ga0097621_1012236063 53
139 3300006237 Ga0097621_101596973 Ga0097621_1015969732 53
140 3300006358 Ga0068871_101455335 Ga0068871_1014553353 53
141 3300006844 Ga0075428_100000196 Ga0075428_10000019648 53
142 3300006844 Ga0075428_100046579 Ga0075428_1000465799 53
143 3300006844 Ga0075428_100072837 Ga0075428_1000728372 53
144 3300006844 Ga0075428_100287916 Ga0075428_1002879164 53
145 3300006844 Ga0075428_100346990 Ga0075428_1003469902 53
146 3300006844 Ga0075428_100539167 Ga0075428_1005391672 53
147 3300006844 Ga0075428_100737499 Ga0075428_1007374993 53
148 3300006844 Ga0075428_100849081 Ga0075428_1008490811 53
149 3300006844 Ga0075428_101203607 Ga0075428_1012036072 53
150 3300006846 Ga0075430_100012671 Ga0075430_1000126712 53
151 3300006846 Ga0075430_100049095 Ga0075430_1000490952 53
152 3300006846 Ga0075430_100070604 Ga0075430_1000706044 53
153 3300006846 Ga0075430_100127275 Ga0075430_1001272752 53
154 3300006846 Ga0075430_100192817 Ga0075430_1001928172 53
155 3300006846 Ga0075430_100202436 Ga0075430_1002024364 53
156 3300006846 Ga0075430_100270421 Ga0075430_1002704213 53
157 3300006846 Ga0075430_100377322 Ga0075430_1003773222 53
158 3300006846 Ga0075430_101189960 Ga0075430_1011899602 53
159 3300006847 Ga0075431_100161427 Ga0075431_1001614272 53
160 3300006847 Ga0075431_100211212 Ga0075431_1002112121 53
161 3300006847 Ga0075431_100277739 Ga0075431_1002777392 53
162 3300006847 Ga0075431_100822029 Ga0075431_1008220292 53
163 3300006847 Ga0075431_101055693 Ga0075431_1010556932 53
164 3300006847 Ga0075431_101521337 Ga0075431_1015213371 53
165 3300006847 Ga0075431_102014511 Ga0075431_1020145112 53
166 3300006852 Ga0075433_10492269 Ga0075433_104922692 53
167 3300006852 Ga0075433_11413122 Ga0075433_114131222 53
168 3300006871 Ga0075434_100463970 Ga0075434_1004639703 53
169 3300006871 Ga0075434_101629172 Ga0075434_1016291721 53
170 3300006880 Ga0075429_100017826 Ga0075429_1000178262 53
171 3300006880 Ga0075429_100080625 Ga0075429_1000806257 53
172 3300006880 Ga0075429_100241406 Ga0075429_1002414064 53
173 3300006880 Ga0075429_100335878 Ga0075429_1003358782 53
174 3300006880 Ga0075429_100513859 Ga0075429_1005138593 53
175 3300006880 Ga0075429_101092823 Ga0075429_1010928231 53
176 3300006881 Ga0068865_100875459 Ga0068865_1008754594 53
177 3300006914 Ga0075436_100767534 Ga0075436_1007675342 53
178 3300007076 Ga0075435_100924883 Ga0075435_1009248832 53
179 3300009011 Ga0105251_10236920 Ga0105251_102369202 53
180 3300009011 Ga0105251_10648095 Ga0105251_106480952 53
181 3300009036 Ga0105244_10461297 Ga0105244_104612973 53
182 3300009092 Ga0105250_10219180 Ga0105250_102191801 53
183 3300009093 Ga0105240_11596371 Ga0105240_115963712 53
184 3300009093 Ga0105240_12500623 Ga0105240_125006232 53
185 3300009094 Ga0111539_10017154 Ga0111539_100171542 53
186 3300009094 Ga0111539_10135171 Ga0111539_101351712 53
187 3300009094 Ga0111539_10282169 Ga0111539_102821694 53
188 3300009094 Ga0111539_10866826 Ga0111539_108668262 53
189 3300009094 Ga0111539_13121165 Ga0111539_131211652 53
190 3300009094 Ga0111539_13255030 Ga0111539_132550302 53
191 3300009098 Ga0105245_10006900 Ga0105245_1000690013 53
192 3300009098 Ga0105245_10112426 Ga0105245_101124262 53
193 3300009098 Ga0105245_10125360 Ga0105245_101253602 53
194 3300009098 Ga0105245_10139433 Ga0105245_101394334 53
195 3300009098 Ga0105245_10307627 Ga0105245_103076273 53
196 3300009147 Ga0114129_10033505 Ga0114129_100335052 53
197 3300009147 Ga0114129_10127753 Ga0114129_101277537 53
198 3300009147 Ga0114129_10218301 Ga0114129_102183012 53
199 3300009147 Ga0114129_10322269 Ga0114129_103222692 53
200 3300009147 Ga0114129_10388883 Ga0114129_103888832 53
201 3300009147 Ga0114129_10495473 Ga0114129_104954732 53
202 3300009147 Ga0114129_10506886 Ga0114129_105068862 53
203 3300009147 Ga0114129_10690356 Ga0114129_106903564 53
204 3300009147 Ga0114129_11561206 Ga0114129_115612062 53
205 3300009147 Ga0114129_11744361 Ga0114129_117443611 53
206 3300009148 Ga0105243_11670745 Ga0105243_116707452 53
207 3300009148 Ga0105243_11730507 Ga0105243_117305072 53
208 3300009148 Ga0105243_11846910 Ga0105243_118469102 53
209 3300009148 Ga0105243_11973607 Ga0105243_119736072 53
210 3300009148 Ga0105243_12458255 Ga0105243_124582552 53
211 3300009174 Ga0105241_10106762 Ga0105241_101067624 53
212 3300009176 Ga0105242_10152954 Ga0105242_101529546 53
213 3300009176 Ga0105242_11067994 Ga0105242_110679943 53
214 3300009176 Ga0105242_11358445 Ga0105242_113584452 53
215 3300009545 Ga0105237_10393022 Ga0105237_103930222 53
216 3300009545 Ga0105237_10580561 Ga0105237_105805611 53
217 3300009545 Ga0105237_11699055 Ga0105237_116990552 53
218 3300009551 Ga0105238_10835170 Ga0105238_108351702 53
219 3300009551 Ga0105238_12046789 Ga0105238_120467891 53
220 3300009551 Ga0105238_12755047 Ga0105238_127550472 53
221 3300009553 Ga0105249_10405330 Ga0105249_104053301 53
222 3300009553 Ga0105249_11258780 Ga0105249_112587801 53
223 3300010375 Ga0105239_10784491 Ga0105239_107844912 53
224 3300010375 Ga0105239_10819270 Ga0105239_108192702 53
225 3300010375 Ga0105239_11193994 Ga0105239_111939942 53
226 3300010375 Ga0105239_12897952 Ga0105239_128979522 53
227 3300011119 Ga0105246_10999416 Ga0105246_109994164 53
228 3300011119 Ga0105246_11422410 Ga0105246_114224102 53
229 3300011119 Ga0105246_12056615 Ga0105246_120566151 53
230 3300011119 Ga0105246_12413287 Ga0105246_124132872 53
231 3300012478 Ga0157328_1008993 Ga0157328_10089934 53
232 3300012503 Ga0157313_1034469 Ga0157313_10344691 53
233 3300013059 Ga0154012_106651 Ga0154012_1066511 53
234 3300013104 Ga0157370_11747096 Ga0157370_117470962 53
235 3300013105 Ga0157369_11268793 Ga0157369_112687933 53
236 3300013296 Ga0157374_10807669 Ga0157374_108076692 53
237 3300013296 Ga0157374_10873496 Ga0157374_108734962 53
238 3300013296 Ga0157374_11370466 Ga0157374_113704662 53
239 3300013296 Ga0157374_11706263 Ga0157374_117062632 53
240 3300013297 Ga0157378_10510658 Ga0157378_105106582 53
241 3300013297 Ga0157378_11085654 Ga0157378_110856541 53
242 3300013297 Ga0157378_11444784 Ga0157378_114447842 53
243 3300013297 Ga0157378_11776044 Ga0157378_117760444 53
244 3300013297 Ga0157378_13121756 Ga0157378_131217563 53
245 3300013306 Ga0163162_10256092 Ga0163162_102560922 53
246 3300013306 Ga0163162_10896354 Ga0163162_108963543 53
247 3300013306 Ga0163162_11083186 Ga0163162_110831862 53
248 3300013308 Ga0157375_10118551 Ga0157375_101185513 53
249 3300013308 Ga0157375_10859841 Ga0157375_108598412 53
250 3300013308 Ga0157375_12064198 Ga0157375_120641982 53
251 3300013308 Ga0157375_12614855 Ga0157375_126148552 53
252 3300014325 Ga0163163_10274565 Ga0163163_102745654 53
253 3300014325 Ga0163163_10321979 Ga0163163_103219794 53
254 3300014325 Ga0163163_10714793 Ga0163163_107147934 53
255 3300014325 Ga0163163_12851582 Ga0163163_128515821 53
256 3300014326 Ga0157380_10765835 Ga0157380_107658352 53
257 3300014326 Ga0157380_10851850 Ga0157380_108518502 53
258 3300014326 Ga0157380_11148986 Ga0157380_111489862 53
259 3300014326 Ga0157380_12580504 Ga0157380_125805042 53
260 3300014326 Ga0157380_13351225 Ga0157380_133512252 53
261 3300014497 Ga0182008_10546950 Ga0182008_105469501 53
262 3300014497 Ga0182008_10817250 Ga0182008_108172503 53
263 3300014745 Ga0157377_10472271 Ga0157377_104722711 53
264 3300014745 Ga0157377_10997759 Ga0157377_109977592 53
265 3300014745 Ga0157377_11097057 Ga0157377_110970573 53
266 3300014745 Ga0157377_11100809 Ga0157377_111008092 53
267 3300014968 Ga0157379_10363435 Ga0157379_103634352 53
268 3300014968 Ga0157379_10651723 Ga0157379_106517232 53
269 3300014968 Ga0157379_11829252 Ga0157379_118292523 53
270 3300014968 Ga0157379_11958008 Ga0157379_119580082 53
271 3300014969 Ga0157376_10483644 Ga0157376_104836444 53
272 3300014969 Ga0157376_11267536 Ga0157376_112675362 53
273 3300014969 Ga0157376_11461812 Ga0157376_114618122 53
274 3300014969 Ga0157376_11589031 Ga0157376_115890312 53
275 3300017792 Ga0163161_10248945 Ga0163161_102489455 53
276 3300017792 Ga0163161_10400335 Ga0163161_104003352 53
277 3300017792 Ga0163161_11864671 Ga0163161_118646712 53
278 3300019190 Ga0184600_125282 Ga0184600_1252823 53
279 3300020069 Ga0197907_10247108 Ga0197907_102471081 53
280 3300020069 Ga0197907_10589538 Ga0197907_105895382 53
281 3300020069 Ga0197907_11057705 Ga0197907_110577052 53
282 3300020069 Ga0197907_11125084 Ga0197907_111250842 53
283 3300020070 Ga0206356_10024041 Ga0206356_100240415 53
284 3300020070 Ga0206356_10101155 Ga0206356_101011553 53
285 3300020070 Ga0206356_10167587 Ga0206356_101675872 53
286 3300020070 Ga0206356_10687454 Ga0206356_106874542 53
287 3300020070 Ga0206356_11110022 Ga0206356_111100222 53
288 3300020076 Ga0206355_1032864 Ga0206355_10328642 53
289 3300020076 Ga0206355_1142256 Ga0206355_11422564 53
290 3300020076 Ga0206355_1152352 Ga0206355_11523523 53
291 3300020076 Ga0206355_1381204 Ga0206355_13812042 53
292 3300020077 Ga0206351_10782374 Ga0206351_107823742 53
293 3300020078 Ga0206352_10639442 Ga0206352_106394422 53
294 3300020078 Ga0206352_10974728 Ga0206352_109747282 53
295 3300020080 Ga0206350_10384629 Ga0206350_103846291 53
296 3300020080 Ga0206350_10848760 Ga0206350_108487602 53
297 3300020080 Ga0206350_10938383 Ga0206350_109383832 53
298 3300020081 Ga0206354_10706372 Ga0206354_107063725 53
299 3300020081 Ga0206354_11473913 Ga0206354_114739132 53
300 3300020081 Ga0206354_11479482 Ga0206354_114794822 53
301 3300020082 Ga0206353_10024359 Ga0206353_100243595 53
302 3300020082 Ga0206353_10356547 Ga0206353_103565472 53
303 3300020610 Ga0154015_1400150 Ga0154015_14001502 53
304 3300021358 Ga0213873_10020965 Ga0213873_100209653 53
305 3300021384 Ga0213876_10054990 Ga0213876_100549902 53
306 3300021384 Ga0213876_10110186 Ga0213876_101101863 53
307 3300021441 Ga0213871_10238896 Ga0213871_102388962 53
308 3300022467 Ga0224712_10081246 Ga0224712_100812462 53
309 3300022467 Ga0224712_10331220 Ga0224712_103312202 53
310 3300023547 Ga0247554_106394 Ga0247554_1063943 53
311 3300025885 Ga0207653_10235479 Ga0207653_102354792 53
312 3300025898 Ga0207692_10153231 Ga0207692_101532315 53
313 3300025898 Ga0207692_10944941 Ga0207692_109449412 53
314 3300025901 Ga0207688_10046209 Ga0207688_100462092 53
315 3300025901 Ga0207688_10473460 Ga0207688_104734603 53
316 3300025903 Ga0207680_10151280 Ga0207680_101512802 53
317 3300025903 Ga0207680_10316675 Ga0207680_103166752 53
318 3300025903 Ga0207680_11127254 Ga0207680_111272542 53
319 3300025906 Ga0207699_10607684 Ga0207699_106076842 53
320 3300025907 Ga0207645_10685534 Ga0207645_106855341 53
321 3300025907 Ga0207645_10840308 Ga0207645_108403082 53
322 3300025908 Ga0207643_10870332 Ga0207643_108703321 53
323 3300025911 Ga0207654_10452010 Ga0207654_104520102 53
324 3300025915 Ga0207693_10500037 Ga0207693_105000372 53
325 3300025915 Ga0207693_11441010 Ga0207693_114410101 53
326 3300025916 Ga0207663_11216788 Ga0207663_112167882 53
327 3300025917 Ga0207660_10097116 Ga0207660_100971163 53
328 3300025918 Ga0207662_11076343 Ga0207662_110763432 53
329 3300025919 Ga0207657_10337776 Ga0207657_103377762 53
330 3300025920 Ga0207649_10150883 Ga0207649_101508832 53
331 3300025920 Ga0207649_10812147 Ga0207649_108121472 53
332 3300025924 Ga0207694_10178096 Ga0207694_101780964 53
333 3300025924 Ga0207694_11812244 Ga0207694_118122442 53
334 3300025925 Ga0207650_10204959 Ga0207650_102049594 53
335 3300025926 Ga0207659_10059773 Ga0207659_100597732 53
336 3300025927 Ga0207687_10070235 Ga0207687_100702352 53
337 3300025927 Ga0207687_11152352 Ga0207687_111523522 53
338 3300025928 Ga0207700_10419079 Ga0207700_104190793 53
339 3300025928 Ga0207700_11118174 Ga0207700_111181742 53
340 3300025928 Ga0207700_11576877 Ga0207700_115768771 53
341 3300025929 Ga0207664_11572742 Ga0207664_115727422 53
342 3300025933 Ga0207706_10382544 Ga0207706_103825442 53
343 3300025933 Ga0207706_10601087 Ga0207706_106010871 53
344 3300025934 Ga0207686_10064757 Ga0207686_100647575 53
345 3300025935 Ga0207709_10599467 Ga0207709_105994672 53
346 3300025935 Ga0207709_10905988 Ga0207709_109059882 53
347 3300025937 Ga0207669_10159177 Ga0207669_101591772 53
348 3300025937 Ga0207669_10344540 Ga0207669_103445402 53
349 3300025937 Ga0207669_10391164 Ga0207669_103911642 53
350 3300025938 Ga0207704_10095529 Ga0207704_100955295 53
351 3300025938 Ga0207704_10345537 Ga0207704_103455373 53
352 3300025939 Ga0207665_11005653 Ga0207665_110056532 53
353 3300025940 Ga0207691_10156968 Ga0207691_101569685 53
354 3300025940 Ga0207691_10590833 Ga0207691_105908332 53
355 3300025940 Ga0207691_10693260 Ga0207691_106932602 53
356 3300025942 Ga0207689_10681235 Ga0207689_106812354 53
357 3300025942 Ga0207689_10813246 Ga0207689_108132462 53
358 3300025944 Ga0207661_11298879 Ga0207661_112988792 53
359 3300025944 Ga0207661_12000328 Ga0207661_120003282 53
360 3300025945 Ga0207679_10366534 Ga0207679_103665342 53
361 3300025945 Ga0207679_10745577 Ga0207679_107455773 53
362 3300025949 Ga0207667_12036654 Ga0207667_120366542 53
363 3300025960 Ga0207651_10493412 Ga0207651_104934124 53
364 3300025960 Ga0207651_10635441 Ga0207651_106354412 53
365 3300025961 Ga0207712_11343767 Ga0207712_113437672 53
366 3300025972 Ga0207668_10821566 Ga0207668_108215662 53
367 3300025972 Ga0207668_11013627 Ga0207668_110136272 53
368 3300025972 Ga0207668_11921325 Ga0207668_119213251 53
369 3300025981 Ga0207640_10479508 Ga0207640_104795082 53
370 3300025986 Ga0207658_10572746 Ga0207658_105727462 53
371 3300026023 Ga0207677_10344072 Ga0207677_103440724 53
372 3300026035 Ga0207703_10656406 Ga0207703_106564063 53
373 3300026035 Ga0207703_11073099 Ga0207703_110730991 53
374 3300026041 Ga0207639_10786827 Ga0207639_107868274 53
375 3300026067 Ga0207678_10365034 Ga0207678_103650343 53
376 3300026075 Ga0207708_10401534 Ga0207708_104015345 53
377 3300026078 Ga0207702_10670075 Ga0207702_106700752 53
378 3300026089 Ga0207648_10288269 Ga0207648_102882692 53
379 3300026089 Ga0207648_10402964 Ga0207648_104029643 53
380 3300026095 Ga0207676_12080288 Ga0207676_120802882 53
381 3300026118 Ga0207675_100166244 Ga0207675_1001662443 53
382 3300026118 Ga0207675_100619327 Ga0207675_1006193272 53
383 3300026118 Ga0207675_101612586 Ga0207675_1016125862 53
384 3300026121 Ga0207683_10087312 Ga0207683_100873125 53
385 3300026121 Ga0207683_10284136 Ga0207683_102841362 53
386 3300026121 Ga0207683_10646070 Ga0207683_106460702 53
387 3300026121 Ga0207683_10795452 Ga0207683_107954521 53
388 3300026121 Ga0207683_11199042 Ga0207683_111990422 53
389 3300026142 Ga0207698_12335913 Ga0207698_123359132 53
390 3300027717 Ga0209998_10184219 Ga0209998_101842191 53
391 3300027866 Ga0209813_10084645 Ga0209813_100846452 53
392 3300027866 Ga0209813_10109340 Ga0209813_101093402 53
393 3300027907 Ga0207428_10084908 Ga0207428_100849082 53
394 3300027907 Ga0207428_10121688 Ga0207428_101216882 53
395 3300027907 Ga0207428_10390806 Ga0207428_103908064 53
396 3300027907 Ga0207428_10874862 Ga0207428_108748622 53
397 3300028017 Ga0265356_1021342 Ga0265356_10213422 53
398 3300028017 Ga0265356_1027591 Ga0265356_10275912 53
399 3300028379 Ga0268266_10966333 Ga0268266_109663331 53
400 3300028380 Ga0268265_10239570 Ga0268265_102395705 53
401 3300028381 Ga0268264_12316436 Ga0268264_123164362 53
402 3300028558 Ga0265326_10017736 Ga0265326_100177362 53
403 3300028573 Ga0265334_10078979 Ga0265334_100789792 53
404 3300028654 Ga0265322_10137391 Ga0265322_101373912 53
405 3300028666 Ga0265336_10006068 Ga0265336_100060685 53
406 3300028800 Ga0265338_10042488 Ga0265338_100424887 53
407 3300028800 Ga0265338_10307751 Ga0265338_103077513 53
408 3300030733 Ga0314311_1180737 Ga0314311_11807372 53
409 3300030745 Ga0316182_1287661 Ga0316182_12876612 53
410 3300030763 Ga0265763_1004811 Ga0265763_10048114 53
411 3300030836 Ga0265767_111628 Ga0265767_1116281 53
412 3300030863 Ga0265766_1006750 Ga0265766_10067503 53
413 3300030878 Ga0265770_1020187 Ga0265770_10201871 53
414 3300031090 Ga0265760_10245547 Ga0265760_102455473 53
415 3300031250 Ga0265331_10394159 Ga0265331_103941593 53
416 3300031251 Ga0265327_10003346 Ga0265327_1000334613 53
417 3300031251 Ga0265327_10150414 Ga0265327_101504141 53
418 3300031251 Ga0265327_10202506 Ga0265327_102025062 53
419 3300031251 Ga0265327_10211866 Ga0265327_102118661 53
420 3300031251 Ga0265327_10517721 Ga0265327_105177212 53
421 3300031548 Ga0307408_100637289 Ga0307408_1006372892 53
422 3300031548 Ga0307408_101159554 Ga0307408_1011595541 53
423 3300031665 Ga0316575_10243219 Ga0316575_102432192 53
424 3300031665 Ga0316575_10524911 Ga0316575_105249112 53
425 3300031711 Ga0265314_10287627 Ga0265314_102876272 53
426 3300031711 Ga0265314_10466220 Ga0265314_104662203 53
427 3300031712 Ga0265342_10390477 Ga0265342_103904771 53
428 3300031727 Ga0316576_10088062 Ga0316576_100880625 53
429 3300031727 Ga0316576_10092047 Ga0316576_100920473 53
430 3300031727 Ga0316576_10105006 Ga0316576_101050062 53
431 3300031731 Ga0307405_10948525 Ga0307405_109485252 53
432 3300031824 Ga0307413_10399232 Ga0307413_103992321 53
433 3300031824 Ga0307413_11054229 Ga0307413_110542291 53
434 3300031852 Ga0307410_10577870 Ga0307410_105778702 53
435 3300031852 Ga0307410_11209769 Ga0307410_112097691 53
436 3300031889 Ga0326468_10071867 Ga0326468_100718672 53
437 3300031901 Ga0307406_10368945 Ga0307406_103689452 53
438 3300031903 Ga0307407_10047656 Ga0307407_100476563 53
439 3300031911 Ga0307412_11892374 Ga0307412_118923741 53
440 3300031995 Ga0307409_100154336 Ga0307409_1001543362 53
441 3300031995 Ga0307409_101867695 Ga0307409_1018676952 53
442 3300031995 Ga0307409_101961637 Ga0307409_1019616372 53
443 3300031995 Ga0307409_102307722 Ga0307409_1023077222 53
444 3300032002 Ga0307416_100508282 Ga0307416_1005082824 53
445 3300032002 Ga0307416_100623445 Ga0307416_1006234452 53
446 3300032002 Ga0307416_101048050 Ga0307416_1010480502 53
447 3300032002 Ga0307416_101445333 Ga0307416_1014453332 53
448 3300032126 Ga0307415_100170571 Ga0307415_1001705712 53
449 3300032126 Ga0307415_100361133 Ga0307415_1003611333 53
450 3300032126 Ga0307415_100679024 Ga0307415_1006790242 53
451 3300032126 Ga0307415_101078465 Ga0307415_1010784652 53
452 3300032126 Ga0307415_101542307 Ga0307415_1015423072 53
453 3300032133 Ga0316583_10025279 Ga0316583_100252791 53
454 3300034820 Ga0373959_0218525 Ga0373959_0218525_33_194 53
455 3300035083 Ga0373926_0143683 Ga0373926_0143683_711_875 53
456 3300035084 Ga0373928_0104417 Ga0373928_0104417_250_411 53
457 3300035089 Ga0373944_0160046 Ga0373944_0160046_502_666 53
458 3300035113 Ga0373936_0259042 Ga0373936_0259042_244_411 53
459 3300035115 Ga0373941_0122679 Ga0373941_0122679_415_579 53
460 3300035115 Ga0373941_0485803 Ga0373941_0485803_46_207 53
461 3300035117 Ga0373953_0535639 Ga0373953_0535639_27_188 53
462 3300035118 Ga0373954_0192125 Ga0373954_0192125_185_352 53
463 3300035118 Ga0373954_0659212 Ga0373954_0659212_338_499 53
464 3300035119 Ga0373956_0570298 Ga0373956_0570298_285_446 53
465 3300035120 Ga0373957_0075203 Ga0373957_0075203_1012_1179 53
466 3300035170 Ga0373943_0165986 Ga0373943_0165986_154_318 53
467 3300035170 Ga0373943_0787598 Ga0373943_0787598_109_270 53
468 3300035172 Ga0373955_0019862 Ga0373955_0019862_2631_2798 53
469 3300035172 Ga0373955_0722610 Ga0373955_0722610_23_193 53
470 3300035172 Ga0373955_0902131 Ga0373955_0902131_167_328 53
471 3300035241 Ga0373961_0320769 Ga0373961_0320769_340_510 53
472 3300035242 Ga0373962_0387606 Ga0373962_0387606_324_485 53
473 3300035398 Ga0316574_0119753 Ga0316574_0119753_1105_1266 53
474 3300035398 Ga0316574_0310356 Ga0316574_0310356_178_339 53
475 3300035691 Ga0373931_0087405 Ga0373931_0087405_166_327 53
476 3300035691 Ga0373931_1203545 Ga0373931_1203545_164_325 53
477 3300035692 Ga0373935_0978227 Ga0373935_0978227_357_524 53
478 3300035692 Ga0373935_1009759 Ga0373935_1009759_436_600 53
479 3300035692 Ga0373935_1027252 Ga0373935_1027252_268_429 53
480 3300035695 Ga0373927_0002910 Ga0373927_0002910_7642_7806 53
481 3300035724 Ga0373933_0272575 Ga0373933_0272575_127_294 53
482 3300035724 Ga0373933_0404241 Ga0373933_0404241_493_654 53
483 3300035725 Ga0373947_0145011 Ga0373947_0145011_619_789 53
484 3300035725 Ga0373947_0745119 Ga0373947_0745119_74_238 53
485 3300036401 Ga0373937_0054860 Ga0373937_0054860_2630_2797 53
486 3300036401 Ga0373937_0116611 Ga0373937_0116611_1425_1595 53
487 3300036401 Ga0373937_0580766 Ga0373937_0580766_241_411 53
488 3300036401 Ga0373937_0616501 Ga0373937_0616501_163_327 53
489 3300036401 Ga0373937_1420592 Ga0373937_1420592_152_313 53
490 3300036401 Ga0373937_1669340 Ga0373937_1669340_244_405 53
491 3300036401 Ga0373937_1783256 Ga0373937_1783256_78_239 53
492 3300036401 Ga0373937_1828365 Ga0373937_1828365_147_314 53
493 3300036401 Ga0373937_1870122 Ga0373937_1870122_260_427 53
494 3300036457 Ga0265778_029342 Ga0265778_029342_197_361 53
495 3300036647 Ga0316582_0020691 Ga0316582_0020691_1657_1821 53
496 3300036712 Ga0316584_0090261 Ga0316584_0090261_111_275 53
497 3300036712 Ga0316584_0090430 Ga0316584_0090430_892_1056 53
498 3300036712 Ga0316584_0871483 Ga0316584_0871483_254_415 53
499 3300037068 Ga0373925_0074969 Ga0373925_0074969_109_273 53
500 3300037068 Ga0373925_0273612 Ga0373925_0273612_376_537 53
501 3300037068 Ga0373925_0716708 Ga0373925_0716708_221_382 53
502 3300037471 Ga0395905_0349343 Ga0395905_0349343_664_828 53
503 3300037853 Ga0436364_1339422 Ga0436364_1339422_931_1095 53
504 3300038443 Ga0395901_0292595 Ga0395901_0292595_1425_1592 53
505 3300039437 Ga0436365_0864646 Ga0436365_0864646_841_1005 53
506 3300039437 Ga0436365_1137434 Ga0436365_1137434_4208_4372 53
507 3300039438 Ga0436360_0398486 Ga0436360_0398486_980_1144 53
508 3300039438 Ga0436360_1025531 Ga0436360_1025531_279_443 53
509 3300039447 Ga0436361_0347571 Ga0436361_0347571_104_268 53
510 3300039447 Ga0436361_0363213 Ga0436361_0363213_57_221 53
511 3300039450 Ga0436363_0158754 Ga0436363_0158754_446_616 53
512 3300039453 Ga0436362_0452528 Ga0436362_0452528_50_214 53
513 3300039453 Ga0436362_0574409 Ga0436362_0574409_55_219 53
514 3300039453 Ga0436362_0610963 Ga0436362_0610963_96_260 53
515 3300039453 Ga0436362_0926769 Ga0436362_0926769_4708_4872 53
516 3300039453 Ga0436362_1267422 Ga0436362_1267422_254_421 53
517 3300041405 Ga0439438_087931 Ga0439438_087931_453_620 53
518 3300041407 Ga0439447_082074 Ga0439447_082074_17_181 53
519 3300041407 Ga0439447_144531 Ga0439447_144531_114_281 53
520 3300041411 Ga0439466_0060806 Ga0439466_0060806_303_470 53
521 3300041413 Ga0439465_0115468 Ga0439465_0115468_92_259 53
522 3300041413 Ga0439465_0185422 Ga0439465_0185422_555_722 53
523 3300041443 Ga0451789_0295635 Ga0451789_0295635_181_345 53
524 3300041443 Ga0451789_0691516 Ga0451789_0691516_400_561 53
525 3300041443 Ga0451789_1001237 Ga0451789_1001237_317_481 53
526 3300041452 Ga0451793_0786865 Ga0451793_0786865_45_212 53
527 3300041452 Ga0451793_0888147 Ga0451793_0888147_94_261 53
528 3300041459 Ga0451800_0557038 Ga0451800_0557038_289_456 53
529 3300041459 Ga0451800_1560776 Ga0451800_1560776_248_409 53
530 3300041460 Ga0451802_0727857 Ga0451802_0727857_329_496 53
531 3300041463 Ga0451804_0322183 Ga0451804_0322183_160_324 53
532 3300041486 Ga0451807_0805328 Ga0451807_0805328_36_197 53
533 3300041491 Ga0451833_0476916 Ga0451833_0476916_135_296 53
534 3300041492 Ga0451835_0236827 Ga0451835_0236827_349_513 53
535 3300041494 Ga0451837_0284750 Ga0451837_0284750_281_442 53
536 3300041494 Ga0451837_1331350 Ga0451837_1331350_217_381 53
537 3300041498 Ga0451841_1231041 Ga0451841_1231041_292_453 53
538 3300041501 Ga0451845_0696073 Ga0451845_0696073_399_566 53
539 3300041501 Ga0451845_0849781 Ga0451845_0849781_189_353 53
540 3300041509 Ga0451843_0421569 Ga0451843_0421569_192_359 53
541 3300041511 Ga0451855_0451382 Ga0451855_0451382_518_679 53
542 3300041511 Ga0451855_0993140 Ga0451855_0993140_121_285 53
543 3300041511 Ga0451855_1220682 Ga0451855_1220682_293_457 53
544 3300041512 Ga0451853_3989981 Ga0451853_3989981_153_314 53
545 3300041512 Ga0451853_3990262 Ga0451853_3990262_241_402 53
546 3300042003 Ga0439443_003376 Ga0439443_003376_333_500 53
547 3300042005 Ga0439448_0016232 Ga0439448_0016232_900_1067 53
548 3300042006 Ga0439432_097560 Ga0439432_097560_445_612 53
549 3300042008 Ga0439450_004279 Ga0439450_004279_2136_2303 53
550 3300042009 Ga0439451_015259 Ga0439451_015259_639_806 53
551 3300042010 Ga0439452_048599 Ga0439452_048599_206_373 53
552 3300042011 Ga0439454_012781 Ga0439454_012781_36_203 53
553 3300042012 Ga0439455_0003578 Ga0439455_0003578_910_1077 53
554 3300042013 Ga0439456_069019 Ga0439456_069019_376_543 53
555 3300042015 Ga0439462_0060113 Ga0439462_0060113_704_871 53
556 3300042016 Ga0439463_001797 Ga0439463_001797_4910_5077 53
557 3300042118 Ga0450914_013191 Ga0450914_013191_29_196 53
558 3300042122 Ga0450920_091232 Ga0450920_091232_199_366 53
559 3300042125 Ga0450923_064275 Ga0450923_064275_79_246 53
560 3300042156 Ga0439446_0233382 Ga0439446_0233382_307_474 53
561 3300042435 Ga0439434_0076777 Ga0439434_0076777_206_373 53
562 3300042436 Ga0439435_0115736 Ga0439435_0115736_649_816 53
563 3300042437 Ga0439444_0000757 Ga0439444_0000757_2601_2768 53
564 3300042439 Ga0439464_0003182 Ga0439464_0003182_1198_1365 53
565 3300042439 Ga0439464_0126431 Ga0439464_0126431_601_768 53
566 3300042461 Ga0439460_0002253 Ga0439460_0002253_3532_3699 53
567 3300042533 Ga0450901_003463 Ga0450901_003463_747_914 53
568 3300042993 Ga0439440_0041725 Ga0439440_0041725_43_210 53
569 3300044683 Ga0466965_0834830 Ga0466965_0834830_77_244 53
570 3300044684 Ga0466966_0037227 Ga0466966_0037227_719_883 53
571 3300044693 Ga0466961_0355835 Ga0466961_0355835_580_744 53
572 3300044735 Ga0466968_0087216 Ga0466968_0087216_18_179 53
573 3300044842 Ga0466957_0581686 Ga0466957_0581686_295_459 53
574 3300045049 Ga0466959_0180664 Ga0466959_0180664_1059_1223 53
575 3300045836 Ga0466958_0602654 Ga0466958_0602654_283_447 53
576 3300045976 Ga0466967_0656943 Ga0466967_0656943_484_651 53
577 3300045976 Ga0466967_2067220 Ga0466967_2067220_109_279 53
578 3300046454 Ga0495592_0128998 Ga0495592_0128998_1400_1564 53
579 3300046454 Ga0495592_0151325 Ga0495592_0151325_500_661 53
580 3300046454 Ga0495592_0355136 Ga0495592_0355136_618_785 53
581 3300046455 Ga0495603_0624689 Ga0495603_0624689_351_521 53
582 3300046459 Ga0495629_0481440 Ga0495629_0481440_345_512 53
583 3300046459 Ga0495629_0664506 Ga0495629_0664506_160_330 53
584 3300046461 Ga0495641_0021235 Ga0495641_0021235_660_821 53
585 3300046461 Ga0495641_0104193 Ga0495641_0104193_447_608 53
586 3300046461 Ga0495641_0201483 Ga0495641_0201483_232_393 53
587 3300046462 Ga0495651_0005682 Ga0495651_0005682_4415_4582 53
588 3300046462 Ga0495651_0391713 Ga0495651_0391713_378_548 53
589 3300046462 Ga0495651_0513824 Ga0495651_0513824_115_276 53
590 3300046462 Ga0495651_0597985 Ga0495651_0597985_364_528 53
591 3300046462 Ga0495651_0895033 Ga0495651_0895033_222_383 53
592 3300046463 Ga0495653_0058564 Ga0495653_0058564_2612_2776 53
593 3300046463 Ga0495653_0533690 Ga0495653_0533690_279_443 53
594 3300046463 Ga0495653_0550953 Ga0495653_0550953_451_618 53
595 3300046473 Ga0495582_0176399 Ga0495582_0176399_820_981 53
596 3300046473 Ga0495582_0454066 Ga0495582_0454066_10_171 53
597 3300046473 Ga0495582_0748203 Ga0495582_0748203_246_407 53
598 3300046476 Ga0495662_0200332 Ga0495662_0200332_192_353 53
599 3300046477 Ga0495664_0084408 Ga0495664_0084408_908_1075 53
600 3300046492 Ga0495585_0311439 Ga0495585_0311439_56_220 53
601 3300046499 Ga0495594_0641089 Ga0495594_0641089_265_426 53
602 3300046499 Ga0495594_0679396 Ga0495594_0679396_95_256 53
603 3300046499 Ga0495594_0823113 Ga0495594_0823113_144_305 53
604 3300046511 Ga0495608_0069453 Ga0495608_0069453_1993_2160 53
605 3300046511 Ga0495608_0420908 Ga0495608_0420908_148_309 53
606 3300046511 Ga0495608_0625484 Ga0495608_0625484_34_204 53
607 3300046514 Ga0495618_0097683 Ga0495618_0097683_227_388 53
608 3300046514 Ga0495618_0314173 Ga0495618_0314173_748_909 53
609 3300046516 Ga0495628_0019367 Ga0495628_0019367_2127_2288 53
610 3300046516 Ga0495628_0168479 Ga0495628_0168479_1384_1545 53
611 3300046516 Ga0495628_0231487 Ga0495628_0231487_225_392 53
612 3300046516 Ga0495628_1210942 Ga0495628_1210942_251_418 53
613 3300046517 Ga0495630_0028174 Ga0495630_0028174_985_1146 53
614 3300046517 Ga0495630_0113574 Ga0495630_0113574_1238_1399 53
615 3300046517 Ga0495630_0140615 Ga0495630_0140615_118_288 53
616 3300046517 Ga0495630_0352319 Ga0495630_0352319_58_219 53
617 3300046517 Ga0495630_0528407 Ga0495630_0528407_285_449 53
618 3300046517 Ga0495630_1087710 Ga0495630_1087710_239_409 53
619 3300046526 Ga0495666_0291138 Ga0495666_0291138_159_320 53
620 3300046528 Ga0495642_0069434 Ga0495642_0069434_1167_1337 53
621 3300046529 Ga0495652_0374333 Ga0495652_0374333_693_860 53
622 3300046529 Ga0495652_0527843 Ga0495652_0527843_339_500 53
623 3300046529 Ga0495652_0698763 Ga0495652_0698763_129_290 53
624 3300046533 Ga0495640_0056994 Ga0495640_0056994_1690_1851 53
625 3300046533 Ga0495640_0076340 Ga0495640_0076340_799_966 53
626 3300046533 Ga0495640_0087602 Ga0495640_0087602_1770_1931 53
627 3300046533 Ga0495640_0800607 Ga0495640_0800607_357_527 53
628 3300046535 Ga0495586_0464037 Ga0495586_0464037_36_200 53
629 3300046535 Ga0495586_0680193 Ga0495586_0680193_13_183 53
630 3300046536 Ga0495587_0132627 Ga0495587_0132627_690_857 53
631 3300046536 Ga0495587_0205073 Ga0495587_0205073_79_240 53
632 3300046536 Ga0495587_0770909 Ga0495587_0770909_97_258 53
633 3300046539 Ga0495621_0245483 Ga0495621_0245483_160_327 53
634 3300046543 Ga0495645_0323489 Ga0495645_0323489_709_876 53
635 3300046543 Ga0495645_0559553 Ga0495645_0559553_250_414 53
636 3300046557 Ga0495622_0291670 Ga0495622_0291670_90_251 53
637 3300046559 Ga0495667_0015268 Ga0495667_0015268_151_318 53
638 3300046559 Ga0495667_0068099 Ga0495667_0068099_1193_1354 53
639 3300046559 Ga0495667_0259101 Ga0495667_0259101_131_292 53
640 3300046559 Ga0495667_0304783 Ga0495667_0304783_724_885 53
641 3300046559 Ga0495667_0359884 Ga0495667_0359884_339_503 53
642 3300046559 Ga0495667_0396329 Ga0495667_0396329_132_302 53
643 3300046642 Ga0495634_0209614 Ga0495634_0209614_67_234 53
644 3300046642 Ga0495634_0424011 Ga0495634_0424011_568_729 53
645 3300046642 Ga0495634_0553314 Ga0495634_0553314_152_316 53
646 3300046642 Ga0495634_0799176 Ga0495634_0799176_325_495 53
647 3300046663 Ga0495635_0046466 Ga0495635_0046466_2681_2848 53
648 3300046663 Ga0495635_0280918 Ga0495635_0280918_668_829 53
649 3300046663 Ga0495635_0565278 Ga0495635_0565278_46_210 53
650 3300046663 Ga0495635_0778175 Ga0495635_0778175_394_555 53
651 3300046663 Ga0495635_1080304 Ga0495635_1080304_37_198 53
652 3300046675 Ga0495657_0017051 Ga0495657_0017051_4964_5131 53
653 3300046675 Ga0495657_0096798 Ga0495657_0096798_1628_1789 53
654 3300046675 Ga0495657_0184591 Ga0495657_0184591_728_898 53
655 3300046675 Ga0495657_0278600 Ga0495657_0278600_344_508 53
656 3300046675 Ga0495657_0361019 Ga0495657_0361019_137_298 53
657 3300046678 Ga0495599_0091479 Ga0495599_0091479_1717_1887 53
658 3300046678 Ga0495599_0295148 Ga0495599_0295148_148_309 53
659 3300046678 Ga0495599_0480960 Ga0495599_0480960_202_366 53
660 3300046679 Ga0495623_0248087 Ga0495623_0248087_693_860 53
661 3300046680 Ga0495646_0237372 Ga0495646_0237372_273_434 53
662 3300046681 Ga0495647_0132473 Ga0495647_0132473_262_432 53
663 3300046683 Ga0495658_0014297 Ga0495658_0014297_335_496 53
664 3300046683 Ga0495658_0062617 Ga0495658_0062617_922_1083 53
665 3300046683 Ga0495658_0086682 Ga0495658_0086682_1471_1641 53
666 3300046683 Ga0495658_0951589 Ga0495658_0951589_228_392 53
667 3300046683 Ga0495658_1059420 Ga0495658_1059420_285_446 53
668 3300046689 Ga0495613_0653299 Ga0495613_0653299_385_555 53
669 3300046689 Ga0495613_0732338 Ga0495613_0732338_190_360 53
670 3300046690 Ga0495624_0285218 Ga0495624_0285218_281_442 53
671 3300046690 Ga0495624_0356056 Ga0495624_0356056_271_432 53
672 3300046690 Ga0495624_0375872 Ga0495624_0375872_164_325 53
673 3300046690 Ga0495624_0475863 Ga0495624_0475863_127_297 53
674 3300046694 Ga0495649_0641251 Ga0495649_0641251_176_337 53
675 3300046809 Ga0495600_0028453 Ga0495600_0028453_3295_3462 53
676 3300046809 Ga0495600_0190559 Ga0495600_0190559_1138_1299 53
677 3300047315 Ga0495581_0383626 Ga0495581_0383626_54_215 53
678 3300047317 Ga0495604_0042560 Ga0495604_0042560_1534_1695 53
679 3300047317 Ga0495604_0089881 Ga0495604_0089881_716_883 53
680 3300047317 Ga0495604_0410140 Ga0495604_0410140_471_632 53
681 3300047317 Ga0495604_0600100 Ga0495604_0600100_104_268 53
682 3300047317 Ga0495604_0808674 Ga0495604_0808674_276_437 53
683 3300047319 Ga0495674_0163881 Ga0495674_0163881_1101_1268 53
684 3300047319 Ga0495674_0267012 Ga0495674_0267012_1027_1191 53
685 3300047319 Ga0495674_0285311 Ga0495674_0285311_1074_1235 53
686 3300047319 Ga0495674_0969493 Ga0495674_0969493_83_253 53
687 3300047321 Ga0495676_0177237 Ga0495676_0177237_1044_1205 53
688 3300047321 Ga0495676_0324421 Ga0495676_0324421_231_401 53
689 3300047321 Ga0495676_0475446 Ga0495676_0475446_133_303 53
690 3300047322 Ga0495680_0065023 Ga0495680_0065023_209_370 53
691 3300047322 Ga0495680_0089549 Ga0495680_0089549_1859_2020 53
692 3300047322 Ga0495680_0117332 Ga0495680_0117332_54_218 53
693 3300047322 Ga0495680_0204490 Ga0495680_0204490_1094_1261 53
694 3300047322 Ga0495680_0566005 Ga0495680_0566005_254_424 53
695 3300047322 Ga0495680_0591023 Ga0495680_0591023_566_727 53
696 3300047322 Ga0495680_0939472 Ga0495680_0939472_121_285 53
697 3300047444 Ga0495675_0079892 Ga0495675_0079892_426_587 53
698 3300047471 Ga0495684_0283136 Ga0495684_0283136_1003_1164 53
699 3300047471 Ga0495684_0322488 Ga0495684_0322488_795_959 53
700 3300047673 Ga0495593_0661103 Ga0495593_0661103_207_368 53
701 3300048088 Ga0495602_0264127 Ga0495602_0264127_958_1125 53
702 3300048088 Ga0495602_0300801 Ga0495602_0300801_115_279 53
703 3300048088 Ga0495602_0653655 Ga0495602_0653655_392_556 53
704 3300048089 Ga0495614_0125970 Ga0495614_0125970_954_1121 53
705 3300048089 Ga0495614_0225853 Ga0495614_0225853_329_499 53
706 3300048903 Ga0496100_0077946 Ga0496100_0077946_475_636 53
707 3300048903 Ga0496100_0617189 Ga0496100_0617189_584_748 53
708 3300048904 Ga0496101_0055641 Ga0496101_0055641_2102_2263 53
709 3300048904 Ga0496101_1225117 Ga0496101_1225117_182_343 53
710 3300048904 Ga0496101_1268418 Ga0496101_1268418_394_555 53
711 3300048905 Ga0496102_0027272 Ga0496102_0027272_1814_1975 53
712 3300048905 Ga0496102_0295812 Ga0496102_0295812_766_927 53
713 3300048905 Ga0496102_0772597 Ga0496102_0772597_349_510 53
714 3300048905 Ga0496102_1120588 Ga0496102_1120588_37_201 53
715 3300048905 Ga0496102_1181124 Ga0496102_1181124_67_237 53
716 3300048906 Ga0496103_0105389 Ga0496103_0105389_1287_1448 53
717 3300048906 Ga0496103_0484622 Ga0496103_0484622_538_699 53
718 3300048906 Ga0496103_0860057 Ga0496103_0860057_360_521 53
719 3300048907 Ga0496104_0089203 Ga0496104_0089203_2074_2235 53
720 3300048907 Ga0496104_0335185 Ga0496104_0335185_964_1125 53
721 3300048907 Ga0496104_0563723 Ga0496104_0563723_836_997 53
722 3300048907 Ga0496104_0876480 Ga0496104_0876480_310_474 53
723 3300048908 Ga0496105_0016968 Ga0496105_0016968_995_1156 53
724 3300048908 Ga0496105_0411240 Ga0496105_0411240_55_216 53
725 3300048908 Ga0496105_0456126 Ga0496105_0456126_539_700 53
726 3300048908 Ga0496105_0560820 Ga0496105_0560820_709_870 53
727 3300048909 Ga0496106_0446383 Ga0496106_0446383_145_306 53
728 3300048910 Ga0496107_0058190 Ga0496107_0058190_85_246 53
729 3300048910 Ga0496107_0637306 Ga0496107_0637306_476_637 53
730 3300048910 Ga0496107_0914307 Ga0496107_0914307_274_435 53
731 3300048911 Ga0496108_0040002 Ga0496108_0040002_1830_1991 53
732 3300048911 Ga0496108_0420159 Ga0496108_0420159_908_1069 53
733 3300048911 Ga0496108_0647265 Ga0496108_0647265_202_366 53
734 3300048911 Ga0496108_0975395 Ga0496108_0975395_463_627 53
735 3300048912 Ga0496109_0013733 Ga0496109_0013733_5095_5256 53
736 3300048912 Ga0496109_0627674 Ga0496109_0627674_467_628 53
737 3300048912 Ga0496109_0669716 Ga0496109_0669716_54_218 53
738 3300048912 Ga0496109_1585368 Ga0496109_1585368_313_474 53
739 3300048913 Ga0496110_0080430 Ga0496110_0080430_2268_2429 53
740 3300048913 Ga0496110_0082566 Ga0496110_0082566_1818_1982 53
741 3300048913 Ga0496110_0148681 Ga0496110_0148681_1725_1886 53
742 3300048913 Ga0496110_0172957 Ga0496110_0172957_1537_1698 53
743 3300048913 Ga0496110_1609556 Ga0496110_1609556_148_309 53
744 3300048914 Ga0496111_0295235 Ga0496111_0295235_1006_1167 53
745 3300048914 Ga0496111_0558261 Ga0496111_0558261_161_322 53
746 3300048914 Ga0496111_0766280 Ga0496111_0766280_19_183 53
747 3300048914 Ga0496111_1079274 Ga0496111_1079274_122_283 53
748 3300048915 Ga0496112_0164772 Ga0496112_0164772_1035_1196 53
749 3300048915 Ga0496112_0660004 Ga0496112_0660004_541_702 53
750 3300048915 Ga0496112_1077872 Ga0496112_1077872_108_272 53
751 3300048916 Ga0496113_1075158 Ga0496113_1075158_313_474 53
752 3300048917 Ga0496114_0124845 Ga0496114_0124845_658_819 53
753 3300048917 Ga0496114_0169930 Ga0496114_0169930_533_694 53
754 3300048917 Ga0496114_1411923 Ga0496114_1411923_59_220 53
755 3300048918 Ga0496115_0005604 Ga0496115_0005604_3487_3648 53
756 3300048918 Ga0496115_0585738 Ga0496115_0585738_430_591 53
757 3300049162 Ga0501307_062365 Ga0501307_062365_356_523 53
758 3300049568 Ga0501031_0029061 Ga0501031_0029061_2030_2197 53
759 3300049568 Ga0501031_0055955 Ga0501031_0055955_2294_2461 53
760 3300049569 Ga0501032_0018194 Ga0501032_0018194_2210_2371 53
761 3300049569 Ga0501032_0075987 Ga0501032_0075987_543_710 53
762 3300049569 Ga0501032_0144989 Ga0501032_0144989_160_327 53
763 3300049569 Ga0501032_0326977 Ga0501032_0326977_811_972 53
764 3300049569 Ga0501032_0992414 Ga0501032_0992414_249_416 53
765 3300049570 Ga0501033_0010017 Ga0501033_0010017_3430_3591 53
766 3300049570 Ga0501033_0052492 Ga0501033_0052492_2839_3006 53
767 3300049570 Ga0501033_0068083 Ga0501033_0068083_76_243 53
768 3300049571 Ga0501034_0001825 Ga0501034_0001825_26596_26763 53
769 3300049571 Ga0501034_0011458 Ga0501034_0011458_493_657 53
770 3300049571 Ga0501034_0026359 Ga0501034_0026359_2730_2891 53
771 3300049571 Ga0501034_0070102 Ga0501034_0070102_1623_1784 53
772 3300049572 Ga0501036_0007041 Ga0501036_0007041_4025_4186 53
773 3300049572 Ga0501036_0008564 Ga0501036_0008564_2619_2786 53
774 3300049572 Ga0501036_0201044 Ga0501036_0201044_1228_1389 53
775 3300049572 Ga0501036_0253788 Ga0501036_0253788_1176_1343 53
776 3300049572 Ga0501036_0280132 Ga0501036_0280132_84_251 53
777 3300049572 Ga0501036_1534181 Ga0501036_1534181_340_507 53
778 3300049573 Ga0501037_0070950 Ga0501037_0070950_2070_2231 53
779 3300049573 Ga0501037_0181099 Ga0501037_0181099_372_533 53
780 3300049574 Ga0501038_0041698 Ga0501038_0041698_1687_1848 53
781 3300049574 Ga0501038_0116577 Ga0501038_0116577_1908_2075 53
782 3300049574 Ga0501038_0830753 Ga0501038_0830753_183_344 53
783 3300049574 Ga0501038_1143385 Ga0501038_1143385_329_496 53
784 3300049575 Ga0501039_0005221 Ga0501039_0005221_6711_6878 53
785 3300049575 Ga0501039_0141812 Ga0501039_0141812_1170_1337 53
786 3300049575 Ga0501039_0776674 Ga0501039_0776674_134_295 53
787 3300049575 Ga0501039_0799519 Ga0501039_0799519_227_391 53
788 3300049576 Ga0501040_0015352 Ga0501040_0015352_2314_2481 53
789 3300049576 Ga0501040_0021776 Ga0501040_0021776_4004_4171 53
790 3300049576 Ga0501040_0099512 Ga0501040_0099512_641_808 53
791 3300049576 Ga0501040_0702640 Ga0501040_0702640_224_391 53
792 3300049577 Ga0501041_0152846 Ga0501041_0152846_1118_1285 53
793 3300049577 Ga0501041_0578227 Ga0501041_0578227_446_607 53
794 3300049578 Ga0501042_0058389 Ga0501042_0058389_968_1135 53
795 3300049578 Ga0501042_0069895 Ga0501042_0069895_2219_2386 53
796 3300049578 Ga0501042_0099595 Ga0501042_0099595_725_892 53
797 3300049578 Ga0501042_0210980 Ga0501042_0210980_1115_1276 53
798 3300049578 Ga0501042_0211014 Ga0501042_0211014_1091_1258 53
799 3300049578 Ga0501042_1062975 Ga0501042_1062975_53_220 53
800 3300049579 Ga0501043_0028890 Ga0501043_0028890_2364_2525 53
801 3300049579 Ga0501043_0093630 Ga0501043_0093630_1155_1322 53
802 3300049579 Ga0501043_0207850 Ga0501043_0207850_119_286 53
803 3300049579 Ga0501043_0329824 Ga0501043_0329824_137_298 53
804 3300049579 Ga0501043_0589583 Ga0501043_0589583_137_298 53
805 3300049580 Ga0501046_0054622 Ga0501046_0054622_387_548 53
806 3300049580 Ga0501046_0074182 Ga0501046_0074182_862_1023 53
807 3300049580 Ga0501046_0088527 Ga0501046_0088527_1820_1987 53
808 3300049580 Ga0501046_0142775 Ga0501046_0142775_625_792 53
809 3300049580 Ga0501046_0841276 Ga0501046_0841276_187_348 53
810 3300049581 Ga0501047_0021371 Ga0501047_0021371_2238_2399 53
811 3300049581 Ga0501047_0810406 Ga0501047_0810406_322_483 53
812 3300049581 Ga0501047_1051915 Ga0501047_1051915_435_596 53
813 3300049582 Ga0501048_0007282 Ga0501048_0007282_1190_1357 53
814 3300049582 Ga0501048_0012084 Ga0501048_0012084_3955_4122 53
815 3300049582 Ga0501048_0273325 Ga0501048_0273325_386_553 53
816 3300049582 Ga0501048_0879075 Ga0501048_0879075_271_432 53
817 3300049582 Ga0501048_1032031 Ga0501048_1032031_406_573 53
818 3300049583 Ga0501067_0073272 Ga0501067_0073272_840_1004 53
819 3300049583 Ga0501067_0181187 Ga0501067_0181187_233_403 53
820 3300049583 Ga0501067_0849989 Ga0501067_0849989_41_208 53
821 3300049584 Ga0501068_0060472 Ga0501068_0060472_2029_2196 53
822 3300049584 Ga0501068_0085482 Ga0501068_0085482_630_797 53
823 3300049584 Ga0501068_0110537 Ga0501068_0110537_1506_1667 53
824 3300049584 Ga0501068_0310000 Ga0501068_0310000_652_813 53
825 3300049584 Ga0501068_0353617 Ga0501068_0353617_654_821 53
826 3300049584 Ga0501068_0417811 Ga0501068_0417811_379_540 53
827 3300049584 Ga0501068_0463350 Ga0501068_0463350_591_758 53
828 3300049584 Ga0501068_0743945 Ga0501068_0743945_341_508 53
829 3300049585 Ga0501069_0024577 Ga0501069_0024577_2914_3081 53
830 3300049585 Ga0501069_0456180 Ga0501069_0456180_117_278 53
831 3300049585 Ga0501069_0944532 Ga0501069_0944532_205_375 53
832 3300049586 Ga0501070_0015834 Ga0501070_0015834_446_607 53
833 3300049586 Ga0501070_0081767 Ga0501070_0081767_2355_2522 53
834 3300049586 Ga0501070_0128945 Ga0501070_0128945_303_464 53
835 3300049586 Ga0501070_0237407 Ga0501070_0237407_415_576 53
836 3300049586 Ga0501070_0273055 Ga0501070_0273055_914_1081 53
837 3300049586 Ga0501070_0421131 Ga0501070_0421131_141_308 53
838 3300049586 Ga0501070_0456456 Ga0501070_0456456_732_899 53
839 3300049586 Ga0501070_0548211 Ga0501070_0548211_520_681 53
840 3300049587 Ga0501071_0007079 Ga0501071_0007079_4625_4792 53
841 3300049587 Ga0501071_0008766 Ga0501071_0008766_2314_2481 53
842 3300049587 Ga0501071_0025765 Ga0501071_0025765_2213_2380 53
843 3300049587 Ga0501071_0086358 Ga0501071_0086358_1274_1441 53
844 3300049587 Ga0501071_0311569 Ga0501071_0311569_973_1140 53
845 3300049587 Ga0501071_0321234 Ga0501071_0321234_880_1041 53
846 3300049587 Ga0501071_0775276 Ga0501071_0775276_98_262 53
847 3300049587 Ga0501071_1014368 Ga0501071_1014368_177_338 53
848 3300049587 Ga0501071_1049934 Ga0501071_1049934_318_485 53
849 3300049587 Ga0501071_1470997 Ga0501071_1470997_88_249 53
850 3300049588 Ga0501072_0003175 Ga0501072_0003175_11686_11853 53
851 3300049588 Ga0501072_0019717 Ga0501072_0019717_144_311 53
852 3300049588 Ga0501072_0044698 Ga0501072_0044698_1208_1375 53
853 3300049588 Ga0501072_0630461 Ga0501072_0630461_293_454 53
854 3300049588 Ga0501072_0723299 Ga0501072_0723299_591_752 53
855 3300049589 Ga0501073_0041651 Ga0501073_0041651_106_273 53
856 3300049589 Ga0501073_0273544 Ga0501073_0273544_125_292 53
857 3300049589 Ga0501073_0357846 Ga0501073_0357846_681_842 53
858 3300049589 Ga0501073_0367927 Ga0501073_0367927_227_394 53
859 3300049589 Ga0501073_0445568 Ga0501073_0445568_631_798 53
860 3300049589 Ga0501073_0828433 Ga0501073_0828433_456_626 53
861 3300049589 Ga0501073_0864369 Ga0501073_0864369_173_340 53
862 3300049590 Ga0501074_0006817 Ga0501074_0006817_7538_7705 53
863 3300049590 Ga0501074_0155300 Ga0501074_0155300_51_218 53
864 3300049590 Ga0501074_0176379 Ga0501074_0176379_322_483 53
865 3300049590 Ga0501074_0855272 Ga0501074_0855272_439_606 53
866 3300049590 Ga0501074_1016374 Ga0501074_1016374_304_474 53
867 3300049590 Ga0501074_1101261 Ga0501074_1101261_148_312 53
868 3300049591 Ga0501075_0005970 Ga0501075_0005970_226_393 53
869 3300049591 Ga0501075_0071170 Ga0501075_0071170_139_306 53
870 3300049591 Ga0501075_0138700 Ga0501075_0138700_1671_1838 53
871 3300049591 Ga0501075_0231786 Ga0501075_0231786_152_319 53
872 3300049591 Ga0501075_0739177 Ga0501075_0739177_357_518 53
873 3300049591 Ga0501075_0956393 Ga0501075_0956393_300_461 53
874 3300049592 Ga0501076_0057523 Ga0501076_0057523_2721_2888 53
875 3300049592 Ga0501076_0217698 Ga0501076_0217698_965_1132 53
876 3300049592 Ga0501076_0269045 Ga0501076_0269045_1008_1175 53
877 3300049592 Ga0501076_0703038 Ga0501076_0703038_649_816 53
878 3300049592 Ga0501076_1147524 Ga0501076_1147524_345_515 53
879 3300049592 Ga0501076_1342508 Ga0501076_1342508_166_336 53
880 3300049592 Ga0501076_1459667 Ga0501076_1459667_287_454 53
881 3300049593 Ga0501077_0000888 Ga0501077_0000888_2357_2524 53
882 3300049593 Ga0501077_0036713 Ga0501077_0036713_342_509 53
883 3300049593 Ga0501077_0099061 Ga0501077_0099061_1116_1283 53
884 3300049593 Ga0501077_0198886 Ga0501077_0198886_573_734 53
885 3300049593 Ga0501077_0329397 Ga0501077_0329397_87_248 53
886 3300049593 Ga0501077_0552288 Ga0501077_0552288_162_326 53
887 3300049593 Ga0501077_0824762 Ga0501077_0824762_187_348 53
888 3300049741 Ga0501079_0059945 Ga0501079_0059945_125_292 53
889 3300049741 Ga0501079_0099422 Ga0501079_0099422_1939_2106 53
890 3300049741 Ga0501079_0250713 Ga0501079_0250713_1188_1355 53
891 3300049741 Ga0501079_0576496 Ga0501079_0576496_386_547 53
892 3300049741 Ga0501079_1262226 Ga0501079_1262226_277_444 53
893 3300049742 Ga0501080_0030535 Ga0501080_0030535_3582_3743 53
894 3300049742 Ga0501080_0054028 Ga0501080_0054028_3565_3726 53
895 3300049742 Ga0501080_0068025 Ga0501080_0068025_2094_2258 53
896 3300049742 Ga0501080_0545144 Ga0501080_0545144_571_738 53
897 3300049742 Ga0501080_0629606 Ga0501080_0629606_141_308 53
898 3300049742 Ga0501080_1444151 Ga0501080_1444151_144_311 53
899 3300049743 Ga0501081_0067020 Ga0501081_0067020_370_537 53
900 3300049743 Ga0501081_0103227 Ga0501081_0103227_227_394 53
901 3300049743 Ga0501081_0335613 Ga0501081_0335613_120_287 53
902 3300049743 Ga0501081_0575787 Ga0501081_0575787_118_285 53
903 3300049744 Ga0501083_0045532 Ga0501083_0045532_1594_1761 53
904 3300049744 Ga0501083_0157882 Ga0501083_0157882_336_503 53
905 3300049744 Ga0501083_0327849 Ga0501083_0327849_643_810 53
906 3300049744 Ga0501083_0768758 Ga0501083_0768758_386_547 53
907 3300049744 Ga0501083_0989165 Ga0501083_0989165_134_295 53
908 3300049822 Ga0501035_0092379 Ga0501035_0092379_935_1096 53
909 3300049822 Ga0501035_0093954 Ga0501035_0093954_2410_2577 53
910 3300049822 Ga0501035_0710222 Ga0501035_0710222_389_556 53
911 3300049822 Ga0501035_1544683 Ga0501035_1544683_212_373 53
912 3300049823 Ga0501044_0005604 Ga0501044_0005604_573_734 53
913 3300049823 Ga0501044_0145682 Ga0501044_0145682_227_388 53
914 3300049823 Ga0501044_0188172 Ga0501044_0188172_16_177 53
915 3300049823 Ga0501044_0305364 Ga0501044_0305364_1204_1371 53
916 3300049824 Ga0501045_0001378 Ga0501045_0001378_12372_12539 53
917 3300049824 Ga0501045_0037014 Ga0501045_0037014_3241_3408 53
918 3300049824 Ga0501045_0389523 Ga0501045_0389523_415_576 53
919 3300049824 Ga0501045_1330946 Ga0501045_1330946_43_210 53
920 3300050490 nmdc:mga03n38_329755_c1 nmdc:mga03n38_329755_c1_249_416 53
921 3300050490 nmdc:mga03n38_750734_c1 nmdc:mga03n38_750734_c1_58_219 53
922 3300050491 nmdc:mga00v17_4409_c2 nmdc:mga00v17_4409_c2_488_655 53
923 3300050491 nmdc:mga00v17_457492_c1 nmdc:mga00v17_457492_c1_277_444 53
924 3300050491 nmdc:mga00v17_521782_c1 nmdc:mga00v17_521782_c1_533_700 53
925 3300050491 nmdc:mga00v17_598768_c1 nmdc:mga00v17_598768_c1_196_363 53
926 3300050491 nmdc:mga00v17_665503_c1 nmdc:mga00v17_665503_c1_374_544 53
927 3300050492 nmdc:mga0yw44_1054667_c1 nmdc:mga0yw44_1054667_c1_243_410 53
928 3300050492 nmdc:mga0yw44_122103_c1 nmdc:mga0yw44_122103_c1_1229_1396 53
929 3300050492 nmdc:mga0yw44_130682_c1 nmdc:mga0yw44_130682_c1_198_365 53
930 3300050492 nmdc:mga0yw44_248776_c1 nmdc:mga0yw44_248776_c1_26_190 53
931 3300050492 nmdc:mga0yw44_369192_c1 nmdc:mga0yw44_369192_c1_63_233 53
932 3300050492 nmdc:mga0yw44_514509_c1 nmdc:mga0yw44_514509_c1_459_623 53
933 3300050492 nmdc:mga0yw44_567209_c1 nmdc:mga0yw44_567209_c1_374_541 53
934 3300050492 nmdc:mga0yw44_70933_c1 nmdc:mga0yw44_70933_c1_447_617 53
935 3300050492 nmdc:mga0yw44_894416_c1 nmdc:mga0yw44_894416_c1_100_261 53
936 3300050492 nmdc:mga0yw44_937358_c1 nmdc:mga0yw44_937358_c1_350_517 53
937 3300050492 nmdc:mga0yw44_972161_c1 nmdc:mga0yw44_972161_c1_345_512 53
938 3300050494 nmdc:mga06z11_109726_c1 nmdc:mga06z11_109726_c1_1110_1277 53
939 3300050494 nmdc:mga06z11_232365_c1 nmdc:mga06z11_232365_c1_623_790 53
940 3300050494 nmdc:mga06z11_929077_c1 nmdc:mga06z11_929077_c1_172_336 53
941 3300050495 nmdc:mga04h51_5332_c1 nmdc:mga04h51_5332_c1_174_338 53
942 3300050496 nmdc:mga07m45_489654_c1 nmdc:mga07m45_489654_c1_365_532 53
943 3300050507 nmdc:mga05p37_1282483_c1 nmdc:mga05p37_1282483_c1_180_341 53
944 3300050507 nmdc:mga05p37_168911_c1 nmdc:mga05p37_168911_c1_993_1163 53
945 3300050507 nmdc:mga05p37_169986_c1 nmdc:mga05p37_169986_c1_233_400 53
946 3300050507 nmdc:mga05p37_248599_c1 nmdc:mga05p37_248599_c1_134_301 53
947 3300050507 nmdc:mga05p37_31336_c1 nmdc:mga05p37_31336_c1_156_326 53
948 3300050507 nmdc:mga05p37_48432_c1 nmdc:mga05p37_48432_c1_111_278 53
949 3300050507 nmdc:mga05p37_486603_c1 nmdc:mga05p37_486603_c1_1200_1367 53
950 3300050508 nmdc:mga09592_1174618_c1 nmdc:mga09592_1174618_c1_238_408 53
951 3300050508 nmdc:mga09592_1363859_c1 nmdc:mga09592_1363859_c1_364_531 53
952 3300050508 nmdc:mga09592_14153_c1 nmdc:mga09592_14153_c1_200_367 53
953 3300050508 nmdc:mga09592_1601914_c1 nmdc:mga09592_1601914_c1_117_281 53
954 3300050508 nmdc:mga09592_174787_c1 nmdc:mga09592_174787_c1_390_560 53
955 3300050508 nmdc:mga09592_22064_c1 nmdc:mga09592_22064_c1_137_304 53
956 3300050508 nmdc:mga09592_537208_c1 nmdc:mga09592_537208_c1_695_865 53
957 3300050508 nmdc:mga09592_58268_c1 nmdc:mga09592_58268_c1_145_312 53
958 3300050509 nmdc:mga0qj67_10020_c1 nmdc:mga0qj67_10020_c1_5705_5872 53
959 3300050509 nmdc:mga0qj67_1097172_c1 nmdc:mga0qj67_1097172_c1_223_390 53
960 3300050509 nmdc:mga0qj67_25091_c1 nmdc:mga0qj67_25091_c1_2893_3060 53
961 3300050509 nmdc:mga0qj67_2958_c1 nmdc:mga0qj67_2958_c1_7789_7956 53
962 3300050509 nmdc:mga0qj67_321947_c1 nmdc:mga0qj67_321947_c1_980_1150 53
963 3300050509 nmdc:mga0qj67_352488_c1 nmdc:mga0qj67_352488_c1_894_1061 53
964 3300050509 nmdc:mga0qj67_80075_c1 nmdc:mga0qj67_80075_c1_1989_2156 53
965 3300050510 nmdc:mga06r32_1401943_c1 nmdc:mga06r32_1401943_c1_197_364 53
966 3300050510 nmdc:mga06r32_14563_c1 nmdc:mga06r32_14563_c1_1851_2021 53
967 3300050510 nmdc:mga06r32_59926_c1 nmdc:mga06r32_59926_c1_3359_3526 53
968 3300050510 nmdc:mga06r32_651_c1 nmdc:mga06r32_651_c1_19277_19444 53
969 3300050510 nmdc:mga06r32_973452_c1 nmdc:mga06r32_973452_c1_37_204 53
970 3300050511 nmdc:mga08y16_1055347_c1 nmdc:mga08y16_1055347_c1_329_490 53
971 3300050511 nmdc:mga08y16_269645_c1 nmdc:mga08y16_269645_c1_924_1088 53
972 3300050511 nmdc:mga08y16_310310_c1 nmdc:mga08y16_310310_c1_201_371 53
973 3300050511 nmdc:mga08y16_37553_c1 nmdc:mga08y16_37553_c1_2205_2372 53
974 3300050511 nmdc:mga08y16_707484_c1 nmdc:mga08y16_707484_c1_137_307 53
975 3300050511 nmdc:mga08y16_796174_c1 nmdc:mga08y16_796174_c1_256_423 53
976 3300050511 nmdc:mga08y16_847065_c1 nmdc:mga08y16_847065_c1_179_340 53
977 3300050512 nmdc:mga0n895_1445398_c1 nmdc:mga0n895_1445398_c1_80_250 53
978 3300050512 nmdc:mga0n895_367000_c1 nmdc:mga0n895_367000_c1_430_594 53
979 3300050512 nmdc:mga0n895_445221_c1 nmdc:mga0n895_445221_c1_1049_1210 53
980 3300050514 nmdc:mga08x19_1087417_c1 nmdc:mga08x19_1087417_c1_56_226 53
981 3300050515 nmdc:mga0a205_1136598_c1 nmdc:mga0a205_1136598_c1_218_379 53
982 3300050515 nmdc:mga0a205_1378073_c1 nmdc:mga0a205_1378073_c1_46_213 53
983 3300050515 nmdc:mga0a205_371807_c1 nmdc:mga0a205_371807_c1_996_1166 53
984 3300050516 nmdc:mga0sz30_542253_c1 nmdc:mga0sz30_542253_c1_15_179 53
985 3300053077 Ga0495601_0010480 Ga0495601_0010480_5326_5487 53
986 3300053077 Ga0495601_0075683 Ga0495601_0075683_1183_1344 53
987 3300053077 Ga0495601_0279975 Ga0495601_0279975_116_277 53
988 3300053077 Ga0495601_0283967 Ga0495601_0283967_589_753 53
989 3300053077 Ga0495601_0603686 Ga0495601_0603686_33_197 53
990 3300053077 Ga0495601_0810885 Ga0495601_0810885_172_339 53
991 3300053078 Ga0495612_0205550 Ga0495612_0205550_373_534 53
992 3300053078 Ga0495612_0249303 Ga0495612_0249303_79_240 53
993 3300053078 Ga0495612_0539124 Ga0495612_0539124_17_187 53
994 3300053084 Ga0495595_0013597 Ga0495595_0013597_129_290 53
995 3300053084 Ga0495595_0016457 Ga0495595_0016457_148_315 53
996 3300053084 Ga0495595_0064141 Ga0495595_0064141_667_837 53
997 3300053084 Ga0495595_0064440 Ga0495595_0064440_150_311 53
998 3300053084 Ga0495595_0150260 Ga0495595_0150260_156_317 53
999 3300053084 Ga0495595_0310277 Ga0495595_0310277_611_781 53
1000 3300053084 Ga0495595_0558807 Ga0495595_0558807_130_291 53
1001 3300053084 Ga0495595_0569265 Ga0495595_0569265_171_332 53
1002 3300053085 Ga0495619_0017532 Ga0495619_0017532_94_261 53
1003 3300053085 Ga0495619_0039309 Ga0495619_0039309_2796_2957 53
1004 3300053085 Ga0495619_0069369 Ga0495619_0069369_2082_2252 53
1005 3300053085 Ga0495619_0097429 Ga0495619_0097429_144_305 53
1006 3300053085 Ga0495619_0115619 Ga0495619_0115619_372_533 53
1007 3300053085 Ga0495619_0183421 Ga0495619_0183421_1067_1231 53
1008 3300053085 Ga0495619_0203239 Ga0495619_0203239_313_477 53
1009 3300053085 Ga0495619_0321426 Ga0495619_0321426_787_948 53
1010 3300053085 Ga0495619_0401455 Ga0495619_0401455_661_822 53
1011 3300053085 Ga0495619_0602496 Ga0495619_0602496_35_199 53
1012 3300053090 Ga0500646_0029483 Ga0500646_0029483_209_373 53
1013 3300053094 Ga0500566_0117497 Ga0500566_0117497_468_629 53
1014 3300053096 Ga0500641_0332521 Ga0500641_0332521_358_519 53
1015 3300053103 Ga0500555_021658 Ga0500555_021658_504_671 53
1016 3300054114 Ga0501084_0000009 Ga0501084_0000009_54384_54545 53
1017 3300054114 Ga0501084_0003886 Ga0501084_0003886_10787_10954 53
1018 3300054114 Ga0501084_0012833 Ga0501084_0012833_6303_6470 53
1019 3300054114 Ga0501084_0245432 Ga0501084_0245432_121_288 53
1020 3300054114 Ga0501084_1122865 Ga0501084_1122865_378_539 53
1021 3300054114 Ga0501084_1355937 Ga0501084_1355937_403_570 53
1022 3300059424 Ga0590075_014969 Ga0590075_014969_770_937 53
1023 3300059491 Ga0587070_076971 Ga0587070_076971_254_415 53
1024 3300059492 Ga0587073_0271416 Ga0587073_0271416_199_360 53
1025 3300059493 Ga0587077_140525 Ga0587077_140525_354_515 53
1026 3300059503 Ga0587080_120358 Ga0587080_120358_200_361 53
1027 3300059504 Ga0587082_077902 Ga0587082_077902_200_361 53
1028 3300059506 Ga0587085_151913 Ga0587085_151913_194_355 53
1029 3300059510 Ga0587090_052905 Ga0587090_052905_392_553 53
1030 3300059512 Ga0587092_099521 Ga0587092_099521_239_400 53
1031 3300059605 Ga0587106_081501 Ga0587106_081501_140_304 53
1032 3300059609 Ga0587131_006986 Ga0587131_006986_258_419 53
1033 3300059622 Ga0587099_055129 Ga0587099_055129_135_299 53
1034 3300059623 Ga0587101_055735 Ga0587101_055735_48_212 53
1035 3300059624 Ga0587109_115649 Ga0587109_115649_232_393 53
1036 3300059624 Ga0587109_150584 Ga0587109_150584_324_494 53
1037 3300059624 Ga0587109_196162 Ga0587109_196162_232_393 53
1038 3300059626 Ga0587115_091690 Ga0587115_091690_220_381 53
1039 3300059626 Ga0587115_102224 Ga0587115_102224_181_342 53
1040 3300059630 Ga0587128_142288 Ga0587128_142288_199_360 53
1041 3300059630 Ga0587128_168329 Ga0587128_168329_252_416 53
1042 3300059639 Ga0587062_054287 Ga0587062_054287_337_498 53
1043 3300059641 Ga0587068_154557 Ga0587068_154557_189_350 53
1044 3300059646 Ga0587078_049683 Ga0587078_049683_85_252 53
1045 3300059647 Ga0587079_183250 Ga0587079_183250_185_346 53
1046 3300059647 Ga0587079_249224 Ga0587079_249224_91_255 53
1047 3300059654 Ga0587110_031230 Ga0587110_031230_258_419 53
1048 3300059655 Ga0587114_057106 Ga0587114_057106_333_494 53
1049 3300059659 Ga0587120_030716 Ga0587120_030716_187_348 53
1050 3300060346 Ga0587111_0082208 Ga0587111_0082208_197_358 53
1051 3300060346 Ga0587111_0103217 Ga0587111_0103217_153_314 53
1052 3300060353 Ga0501082_0016297 Ga0501082_0016297_5181_5348 53
1053 3300060353 Ga0501082_0112758 Ga0501082_0112758_227_394 53
1054 3300060353 Ga0501082_1189056 Ga0501082_1189056_367_531 53
1055 3300060353 Ga0501082_1384996 Ga0501082_1384996_216_377 53
1056 3300060353 Ga0501082_1551492 Ga0501082_1551492_257_421 53
1057 3300061734 Ga0530510_0019158 Ga0530510_0019158_2152_2319 53
1058 3300061734 Ga0530510_0058612 Ga0530510_0058612_226_393 53
1059 3300061734 Ga0530510_0143446 Ga0530510_0143446_1455_1622 53
1060 3300061734 Ga0530510_0426184 Ga0530510_0426184_34_201 53

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00471

Ribosomal_L33

Ribosomal protein L33

9

55

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a63-assembly1.cif.gz_6 cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.9182 6 52
8cvm-assembly1.cif.gz_0 cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9176 6 53
7nhn-assembly1.cif.gz_6 vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9158 6 52
6ha1-assembly1.cif.gz_1 cryo-em structure of a 70s bacillus subtilis ribosome translating the ermd leader peptide in complex with telithromycin 0.9139 7 52
7y41-assembly1.cif.gz_c mycobacterium smegmatis 50s ribosomal subunit from log phase of growth 0.9093 6 52
ID Description Score Start End Superfamily
6dddO00 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.9045 6 50 2.20.28.120
4qcn600 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.9023 6 53 2.20.28.120
af_Q9W4L1_1_64_2.20.28.120 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.8986 7 53 2.20.28.120
6ddgO00 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.8809 7 50 2.20.28.120
5v7q100 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.8788 8 52 2.20.28.120
ID Description Score Start End GO Terms
AF-A0A4R6BI07-F1-model_v4 Large ribosomal subunit protein bL33 0.9594 7 53 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A0R1U8L0-F1-model_v4 Large ribosomal subunit protein bL33 0.9554 5 53 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A1S9M5M9-F1-model_v4 Large ribosomal subunit protein bL33 0.9346 7 53 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A3A6NG62-F1-model_v4 Large ribosomal subunit protein bL33 0.9303 6 53 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A537XBQ3-F1-model_v4 Large ribosomal subunit protein bL33 0.9299 6 53 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
81.52 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map