F489235

General Info

Members Datasets Scaffolds Average Seq Length
1058 355 2116 155

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0452521|Ga0466961_0452521_51_614
Length 187
Sequence MTCAREGIGHTMPTTSGAAVHLGATEPRMTFMNDARRGNYDSGEDFVLEYGELRFTFNERDFRERCEQAANKLGFVAGRLDDPELEDLVTLSVNGEIQEPASALGEHVNDCWPELVGPSDRSLVHWLRRLVFRSAWLDQRVKEGELDVIFDAESASFQYVQPDRDGEPVELAPEPSWGRVAYVSRGL

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
99 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
100 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
101 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
178 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
179 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
180 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
181 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
198 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
199 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
223 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
224 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
225 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
226 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
229 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
230 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
231 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
232 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
233 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
234 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
238 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
256 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
323 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
324 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
325 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
326 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
345 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
346 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
349 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 10.87
Rhizosphere 86.58
Stem 0
Stem Tuber 0
Unclassified 2.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0452521 3300044693 Bacteria 777
2 JGI24737J22298_10058275 3300001990 Bacteria 1165
3 JGI24745J21846_1039372 3300002073 Bacteria 583
4 JGI24738J21930_10103557 3300002075 Bacteria 609
5 JGI25406J46586_10028901 3300003203 Bacteria 2106
6 JGI25406J46586_10148322 3300003203 Bacteria 685
7 JGI25407J50210_10006535 3300003373 Bacteria 2906
8 JGI25407J50210_10013279 3300003373 Bacteria 2117
9 JGI25407J50210_10020743 3300003373 Bacteria 1708
10 JGI25407J50210_10107698 3300003373 Bacteria 688
11 Ga0070658_10289737 3300005327 Bacteria 1395
12 Ga0070658_10597104 3300005327 Bacteria 957
13 Ga0070676_10328782 3300005328 Bacteria 1045
14 Ga0070676_11171692 3300005328 Unclassified 583
15 Ga0070683_100041020 3300005329 Bacteria 4256
16 Ga0070683_100096170 3300005329 Bacteria 2785
17 Ga0070683_100136242 3300005329 Bacteria 2325
18 Ga0070683_100136557 3300005329 Bacteria 2322
19 Ga0070683_100320709 3300005329 Bacteria 1475
20 Ga0070683_100403712 3300005329 Bacteria 1303
21 Ga0070683_100548021 3300005329 Bacteria 1106
22 Ga0070683_100835974 3300005329 Bacteria 883
23 Ga0070690_100119887 3300005330 Bacteria 1765
24 Ga0068869_100528075 3300005334 Bacteria 989
25 Ga0070680_100174839 3300005336 Bacteria 1808
26 Ga0070680_100922241 3300005336 Bacteria 754
27 Ga0070682_100051333 3300005337 Bacteria 2577
28 Ga0070682_100163190 3300005337 Bacteria 1541
29 Ga0070682_100193425 3300005337 Bacteria 1430
30 Ga0070682_100533153 3300005337 Bacteria 915
31 Ga0070682_101165143 3300005337 Bacteria 649
32 Ga0068868_100154996 3300005338 Bacteria 1889
33 Ga0068868_100183164 3300005338 Bacteria 1738
34 Ga0068868_100710743 3300005338 Bacteria 900
35 Ga0070660_100007118 3300005339 Bacteria 7775
36 Ga0070660_100247656 3300005339 Bacteria 1453
37 Ga0070660_100479364 3300005339 Bacteria 1034
38 Ga0070660_100572922 3300005339 Bacteria 943
39 Ga0070689_100034455 3300005340 Bacteria 3863
40 Ga0070689_100113530 3300005340 Bacteria 2157
41 Ga0070689_101016924 3300005340 Bacteria 738
42 Ga0070687_100379371 3300005343 Bacteria 921
43 Ga0070687_100402753 3300005343 Bacteria 898
44 Ga0070687_100414022 3300005343 Bacteria 887
45 Ga0070661_100090391 3300005344 Bacteria 2268
46 Ga0070661_100166954 3300005344 Bacteria 1670
47 Ga0070692_10262576 3300005345 Bacteria 1039
48 Ga0070668_100071660 3300005347 Bacteria 2700
49 Ga0070668_100164924 3300005347 Bacteria 1800
50 Ga0070668_100463266 3300005347 Bacteria 1092
51 Ga0070669_100057390 3300005353 Bacteria 2856
52 Ga0070669_100779297 3300005353 Bacteria 812
53 Ga0070675_101065639 3300005354 Bacteria 743
54 Ga0070671_101169610 3300005355 Bacteria 676
55 Ga0070671_101441844 3300005355 Bacteria 609
56 Ga0070673_100409571 3300005364 Bacteria 1214
57 Ga0070659_100000053 3300005366 Bacteria 90608
58 Ga0070659_100198485 3300005366 Bacteria 1651
59 Ga0070659_100386489 3300005366 Bacteria 1179
60 Ga0070659_100394437 3300005366 Bacteria 1167
61 Ga0070659_100640557 3300005366 Bacteria 916
62 Ga0070659_100672768 3300005366 Unclassified 894
63 Ga0070659_100730699 3300005366 Bacteria 858
64 Ga0070659_100996954 3300005366 Bacteria 735
65 Ga0070667_100319091 3300005367 Bacteria 1402
66 Ga0070667_100571701 3300005367 Bacteria 1040
67 Ga0070709_10216707 3300005434 Bacteria 1363
68 Ga0070714_100000131 3300005435 Bacteria 59070
69 Ga0070714_100000262 3300005435 Bacteria 40897
70 Ga0070714_100051744 3300005435 Bacteria 3503
71 Ga0070710_10000003 3300005437 Bacteria 277772
72 Ga0070710_10017605 3300005437 Bacteria 3661
73 Ga0070710_10509423 3300005437 Bacteria 825
74 Ga0070705_100000843 3300005440 Bacteria 17198
75 Ga0070705_100055720 3300005440 Bacteria 2325
76 Ga0070705_100096475 3300005440 Bacteria 1856
77 Ga0070705_100276003 3300005440 Bacteria 1193
78 Ga0070700_100248590 3300005441 Bacteria 1274
79 Ga0070700_100374710 3300005441 Bacteria 1063
80 Ga0070700_100539154 3300005441 Bacteria 904
81 Ga0070700_100986472 3300005441 Bacteria 692
82 Ga0070700_101203021 3300005441 Bacteria 633
83 Ga0070694_100219611 3300005444 Bacteria 1425
84 Ga0070694_100746614 3300005444 Bacteria 799
85 Ga0070663_100234648 3300005455 Bacteria 1446
86 Ga0070663_100315395 3300005455 Bacteria 1256
87 Ga0070678_100031100 3300005456 Bacteria 3677
88 Ga0070678_100172758 3300005456 Bacteria 1762
89 Ga0070678_100877677 3300005456 Bacteria 819
90 Ga0070662_100044630 3300005457 Bacteria 3176
91 Ga0070662_100173796 3300005457 Bacteria 1694
92 Ga0070662_100302983 3300005457 Bacteria 1299
93 Ga0070662_100339353 3300005457 Bacteria 1229
94 Ga0068867_100156723 3300005459 Bacteria 1793
95 Ga0068867_100191676 3300005459 Bacteria 1631
96 Ga0068867_101019195 3300005459 Bacteria 752
97 Ga0068867_101468721 3300005459 Unclassified 634
98 Ga0070685_10168787 3300005466 Bacteria 1401
99 Ga0070685_10223555 3300005466 Bacteria 1235
100 Ga0070685_10330228 3300005466 Bacteria 1036
101 Ga0070685_10342374 3300005466 Bacteria 1020
102 Ga0070679_100157187 3300005530 Bacteria 2248
103 Ga0070679_100425170 3300005530 Bacteria 1274
104 Ga0070684_100006522 3300005535 Bacteria 9033
105 Ga0070684_100092528 3300005535 Bacteria 2691
106 Ga0070684_100167839 3300005535 Bacteria 1993
107 Ga0070684_100685597 3300005535 Bacteria 955
108 Ga0070672_100373553 3300005543 Bacteria 1219
109 Ga0070672_100901331 3300005543 Bacteria 781
110 Ga0070686_100303452 3300005544 Bacteria 1185
111 Ga0070686_100448268 3300005544 Bacteria 991
112 Ga0070686_100513431 3300005544 Bacteria 932
113 Ga0070695_100057420 3300005545 Bacteria 2515
114 Ga0070695_100144960 3300005545 Bacteria 1651
115 Ga0070695_100961922 3300005545 Bacteria 693
116 Ga0070695_101282814 3300005545 Bacteria 605
117 Ga0070693_100347153 3300005547 Bacteria 1015
118 Ga0070693_101074015 3300005547 Bacteria 613
119 Ga0070665_100008460 3300005548 Bacteria 10408
120 Ga0070704_100285333 3300005549 Bacteria 1370
121 Ga0070704_100572835 3300005549 Bacteria 989
122 Ga0070704_101012189 3300005549 Bacteria 752
123 Ga0070704_101136147 3300005549 Bacteria 711
124 Ga0068855_101753620 3300005563 Bacteria 632
125 Ga0070664_100116852 3300005564 Bacteria 2333
126 Ga0070664_100138731 3300005564 Bacteria 2140
127 Ga0070664_100511525 3300005564 Bacteria 1107
128 Ga0070664_100599318 3300005564 Bacteria 1022
129 Ga0070664_100698422 3300005564 Bacteria 945
130 Ga0068857_100050329 3300005577 Bacteria 3696
131 Ga0068857_100299568 3300005577 Bacteria 1482
132 Ga0068857_100614968 3300005577 Bacteria 1028
133 Ga0068854_100041936 3300005578 Bacteria 3236
134 Ga0068854_100876162 3300005578 Bacteria 788
135 Ga0068856_100174167 3300005614 Bacteria 2164
136 Ga0068856_100254292 3300005614 Bacteria 1772
137 Ga0068856_100527708 3300005614 Bacteria 1202
138 Ga0068856_100670468 3300005614 Bacteria 1058
139 Ga0070702_100153051 3300005615 Bacteria 1483
140 Ga0070702_100417243 3300005615 Unclassified 965
141 Ga0070702_100666629 3300005615 Bacteria 789
142 Ga0070702_101134433 3300005615 Bacteria 626
143 Ga0070702_101623184 3300005615 Bacteria 535
144 Ga0068852_100252724 3300005616 Bacteria 1689
145 Ga0068852_101795180 3300005616 Bacteria 636
146 Ga0068859_100082004 3300005617 Bacteria 3268
147 Ga0068859_100621979 3300005617 Bacteria 1172
148 Ga0068864_100090742 3300005618 Bacteria 2694
149 Ga0068864_100376986 3300005618 Bacteria 1343
150 Ga0068864_100722102 3300005618 Bacteria 975
151 Ga0068866_10049579 3300005718 Bacteria 2128
152 Ga0068866_10157917 3300005718 Bacteria 1320
153 Ga0068861_100014964 3300005719 Bacteria 5455
154 Ga0068861_100082999 3300005719 Bacteria 2513
155 Ga0068861_100096790 3300005719 Bacteria 2340
156 Ga0068861_100201302 3300005719 Bacteria 1671
157 Ga0068861_100359565 3300005719 Bacteria 1280
158 Ga0068851_10235805 3300005834 Bacteria 1033
159 Ga0068870_10056125 3300005840 Bacteria 2101
160 Ga0068870_10069224 3300005840 Bacteria 1920
161 Ga0068870_10164595 3300005840 Bacteria 1318
162 Ga0068870_10214030 3300005840 Bacteria 1176
163 Ga0068863_100288411 3300005841 Bacteria 1591
164 Ga0068863_101330561 3300005841 Bacteria 726
165 Ga0068858_100204526 3300005842 Bacteria 1868
166 Ga0068858_100991790 3300005842 Bacteria 823
167 Ga0068858_101790668 3300005842 Bacteria 607
168 Ga0068860_100288918 3300005843 Bacteria 1604
169 Ga0068862_100412392 3300005844 Bacteria 1266
170 Ga0081455_10012508 3300005937 Bacteria 8466
171 Ga0081455_10056394 3300005937 Bacteria 3335
172 Ga0081455_10063451 3300005937 Bacteria 3100
173 Ga0081455_10131233 3300005937 Bacteria 1959
174 Ga0081538_10000035 3300005981 Bacteria 120009
175 Ga0081538_10000868 3300005981 Bacteria 32618
176 Ga0081538_10001050 3300005981 Bacteria 29447
177 Ga0081538_10002142 3300005981 Bacteria 19656
178 Ga0081538_10016218 3300005981 Bacteria 5725
179 Ga0081538_10049160 3300005981 Bacteria 2561
180 Ga0081538_10058261 3300005981 Bacteria 2242
181 Ga0081538_10066700 3300005981 Bacteria 2015
182 Ga0081538_10125073 3300005981 Bacteria 1225
183 Ga0081538_10181884 3300005981 Bacteria 898
184 Ga0081538_10225208 3300005981 Bacteria 739
185 Ga0081540_1006587 3300005983 Bacteria 8428
186 Ga0081540_1042404 3300005983 Bacteria 2347
187 Ga0081540_1113699 3300005983 Bacteria 1138
188 Ga0081539_10002427 3300005985 Bacteria 26320
189 Ga0081539_10023180 3300005985 Bacteria 4074
190 Ga0081539_10050141 3300005985 Bacteria 2364
191 Ga0070717_10000001 3300006028 Bacteria 465573
192 Ga0075365_10206805 3300006038 Bacteria 1376
193 Ga0075365_10310772 3300006038 Bacteria 1109
194 Ga0075365_10764898 3300006038 Bacteria 682
195 Ga0075365_10866774 3300006038 Bacteria 637
196 Ga0075432_10070767 3300006058 Bacteria 1253
197 Ga0070715_10086149 3300006163 Bacteria 1436
198 Ga0070712_100000002 3300006175 Bacteria 288475
199 Ga0070712_100026678 3300006175 Bacteria 3852
200 Ga0070712_100413062 3300006175 Bacteria 1117
201 Ga0097621_100678896 3300006237 Bacteria 947
202 Ga0075428_100022758 3300006844 Bacteria 6933
203 Ga0075428_100030040 3300006844 Bacteria 6011
204 Ga0075428_100040035 3300006844 Bacteria 5157
205 Ga0075428_100267574 3300006844 Bacteria 1839
206 Ga0075428_100315818 3300006844 Bacteria 1679
207 Ga0075428_100861516 3300006844 Bacteria 962
208 Ga0075430_100003813 3300006846 Bacteria 12690
209 Ga0075430_100038412 3300006846 Bacteria 4054
210 Ga0075430_100038542 3300006846 Bacteria 4047
211 Ga0075430_100163229 3300006846 Bacteria 1854
212 Ga0075431_100027293 3300006847 Bacteria 5857
213 Ga0075431_100043908 3300006847 Bacteria 4610
214 Ga0075431_100684196 3300006847 Bacteria 1004
215 Ga0075433_10022137 3300006852 Bacteria 5335
216 Ga0075433_10656386 3300006852 Bacteria 920
217 Ga0075434_100010467 3300006871 Bacteria 8696
218 Ga0075434_100563620 3300006871 Bacteria 1159
219 Ga0075434_100605474 3300006871 Bacteria 1115
220 Ga0075434_101417195 3300006871 Bacteria 705
221 Ga0075429_100019109 3300006880 Bacteria 5936
222 Ga0075429_100026710 3300006880 Bacteria 5013
223 Ga0075429_100143171 3300006880 Bacteria 2093
224 Ga0075429_100526001 3300006880 Bacteria 1036
225 Ga0068865_100072177 3300006881 Bacteria 2451
226 Ga0068865_100100035 3300006881 Bacteria 2121
227 Ga0068865_100113849 3300006881 Bacteria 2000
228 Ga0068865_100937772 3300006881 Bacteria 755
229 Ga0097620_100082004 3300006931 Bacteria 3268
230 Ga0097620_100621990 3300006931 Bacteria 1172
231 Ga0075435_100499007 3300007076 Bacteria 1052
232 Ga0075435_100834449 3300007076 Bacteria 803
233 Ga0099795_10339187 3300007788 Bacteria 670
234 Ga0105250_10512690 3300009092 Bacteria 546
235 Ga0105240_11139289 3300009093 Bacteria 828
236 Ga0105240_11673838 3300009093 Bacteria 665
237 Ga0105240_12130333 3300009093 Bacteria 582
238 Ga0111539_10100997 3300009094 Bacteria 3387
239 Ga0111539_10178914 3300009094 Bacteria 2477
240 Ga0111539_10179715 3300009094 Bacteria 2472
241 Ga0111539_10190750 3300009094 Bacteria 2391
242 Ga0111539_10357442 3300009094 Bacteria 1700
243 Ga0111539_10406931 3300009094 Bacteria 1585
244 Ga0111539_10441724 3300009094 Bacteria 1515
245 Ga0111539_10570519 3300009094 Bacteria 1318
246 Ga0111539_10972416 3300009094 Unclassified 987
247 Ga0111539_11671008 3300009094 Bacteria 738
248 Ga0111539_11676643 3300009094 Bacteria 737
249 Ga0111539_12785277 3300009094 Bacteria 566
250 Ga0105245_10002712 3300009098 Bacteria 15936
251 Ga0105245_10022533 3300009098 Bacteria 5529
252 Ga0105245_10029370 3300009098 Bacteria 4856
253 Ga0105245_10092446 3300009098 Bacteria 2786
254 Ga0105245_10198752 3300009098 Bacteria 1924
255 Ga0105245_10262684 3300009098 Bacteria 1681
256 Ga0105245_10287041 3300009098 Bacteria 1610
257 Ga0105245_10289230 3300009098 Bacteria 1605
258 Ga0105245_10551147 3300009098 Bacteria 1175
259 Ga0105245_10865414 3300009098 Bacteria 944
260 Ga0105245_11044120 3300009098 Bacteria 862
261 Ga0105245_12881430 3300009098 Bacteria 533
262 Ga0105247_10049121 3300009101 Bacteria 2594
263 Ga0105247_10079737 3300009101 Bacteria 2061
264 Ga0105247_10355670 3300009101 Bacteria 1031
265 Ga0105247_10497472 3300009101 Bacteria 888
266 Ga0114129_10052170 3300009147 Bacteria 5740
267 Ga0114129_10151887 3300009147 Bacteria 3169
268 Ga0114129_10602507 3300009147 Bacteria 1423
269 Ga0114129_10610292 3300009147 Bacteria 1412
270 Ga0114129_11645930 3300009147 Bacteria 785
271 Ga0114129_11808026 3300009147 Bacteria 743
272 Ga0105243_10082025 3300009148 Bacteria 2634
273 Ga0105243_10110788 3300009148 Bacteria 2296
274 Ga0105243_10136628 3300009148 Bacteria 2086
275 Ga0105243_10260986 3300009148 Bacteria 1551
276 Ga0105241_10343998 3300009174 Bacteria 1293
277 Ga0105241_10378751 3300009174 Bacteria 1236
278 Ga0105241_10841145 3300009174 Bacteria 848
279 Ga0105241_11118461 3300009174 Bacteria 743
280 Ga0105242_10340125 3300009176 Bacteria 1383
281 Ga0105242_10388786 3300009176 Bacteria 1299
282 Ga0105242_10513895 3300009176 Bacteria 1141
283 Ga0105242_10775015 3300009176 Bacteria 947
284 Ga0105242_10789181 3300009176 Bacteria 939
285 Ga0105242_10857898 3300009176 Bacteria 904
286 Ga0105242_11035891 3300009176 Bacteria 831
287 Ga0105242_11620285 3300009176 Bacteria 681
288 Ga0105248_10127326 3300009177 Bacteria 2873
289 Ga0105248_10161070 3300009177 Bacteria 2531
290 Ga0105248_11415490 3300009177 Bacteria 787
291 Ga0105248_12179969 3300009177 Bacteria 630
292 Ga0105248_12696221 3300009177 Bacteria 567
293 Ga0105237_11085588 3300009545 Unclassified 807
294 Ga0105238_10511918 3300009551 Bacteria 1202
295 Ga0105249_10138570 3300009553 Bacteria 2330
296 Ga0105249_10166120 3300009553 Bacteria 2136
297 Ga0105249_10256687 3300009553 Bacteria 1735
298 Ga0105249_10294363 3300009553 Bacteria 1626
299 Ga0105249_10633082 3300009553 Bacteria 1126
300 Ga0105249_10656781 3300009553 Bacteria 1106
301 Ga0105249_11130168 3300009553 Bacteria 854
302 Ga0105249_12121229 3300009553 Bacteria 635
303 Ga0105239_10055446 3300010375 Bacteria 4347
304 Ga0105239_10097768 3300010375 Bacteria 3245
305 Ga0105239_10104027 3300010375 Bacteria 3143
306 Ga0105239_10220330 3300010375 Bacteria 2128
307 Ga0105239_10416324 3300010375 Bacteria 1522
308 Ga0105239_10792865 3300010375 Bacteria 1085
309 Ga0105246_10012719 3300011119 Bacteria 5259
310 Ga0105246_10032994 3300011119 Bacteria 3438
311 Ga0105246_10679808 3300011119 Bacteria 899
312 Ga0157340_1007908 3300012473 Bacteria 700
313 Ga0157336_1004211 3300012477 Bacteria 898
314 Ga0157347_1033510 3300012502 Bacteria 653
315 Ga0157313_1020658 3300012503 Bacteria 669
316 Ga0157371_10572078 3300013102 Unclassified 839
317 Ga0157371_11122178 3300013102 Bacteria 604
318 Ga0157369_10298937 3300013105 Bacteria 1675
319 Ga0157369_10722272 3300013105 Bacteria 1025
320 Ga0157369_11010165 3300013105 Bacteria 851
321 Ga0157369_11864825 3300013105 Bacteria 610
322 Ga0157374_10166943 3300013296 Bacteria 2146
323 Ga0157378_10372705 3300013297 Bacteria 1400
324 Ga0157378_11025494 3300013297 Bacteria 860
325 Ga0157378_11469033 3300013297 Bacteria 726
326 Ga0157378_11532684 3300013297 Bacteria 711
327 Ga0163162_10068643 3300013306 Bacteria 3596
328 Ga0163162_10410521 3300013306 Bacteria 1487
329 Ga0163162_10908872 3300013306 Bacteria 993
330 Ga0163162_11357013 3300013306 Bacteria 808
331 Ga0163162_12210819 3300013306 Bacteria 632
332 Ga0157372_10161447 3300013307 Bacteria 2590
333 Ga0157372_10375778 3300013307 Bacteria 1656
334 Ga0157372_10408809 3300013307 Bacteria 1582
335 Ga0157372_10420825 3300013307 Bacteria 1557
336 Ga0157372_11018261 3300013307 Bacteria 959
337 Ga0157372_12762676 3300013307 Bacteria 563
338 Ga0157375_10024908 3300013308 Bacteria 5547
339 Ga0157375_10336138 3300013308 Bacteria 1675
340 Ga0157375_11406512 3300013308 Bacteria 822
341 Ga0163163_10115455 3300014325 Bacteria 2716
342 Ga0163163_10153122 3300014325 Bacteria 2349
343 Ga0163163_10166525 3300014325 Bacteria 2250
344 Ga0163163_10540222 3300014325 Bacteria 1228
345 Ga0163163_10776426 3300014325 Bacteria 1021
346 Ga0163163_11092381 3300014325 Bacteria 861
347 Ga0163163_11317932 3300014325 Bacteria 784
348 Ga0157380_10054656 3300014326 Bacteria 3169
349 Ga0157380_10056745 3300014326 Bacteria 3116
350 Ga0157380_10411463 3300014326 Bacteria 1286
351 Ga0157380_10920043 3300014326 Bacteria 902
352 Ga0157380_11044168 3300014326 Bacteria 853
353 Ga0157380_11091900 3300014326 Bacteria 836
354 Ga0182008_10103582 3300014497 Bacteria 1408
355 Ga0157377_10006889 3300014745 Bacteria 5451
356 Ga0157377_10016883 3300014745 Bacteria 3764
357 Ga0157377_10374462 3300014745 Bacteria 962
358 Ga0157377_10836149 3300014745 Bacteria 682
359 Ga0157379_10004659 3300014968 Bacteria 11764
360 Ga0157379_10380669 3300014968 Bacteria 1295
361 Ga0157379_10553891 3300014968 Bacteria 1070
362 Ga0157379_10604740 3300014968 Bacteria 1024
363 Ga0157379_10651870 3300014968 Bacteria 986
364 Ga0157379_11048265 3300014968 Bacteria 779
365 Ga0157376_10049954 3300014969 Bacteria 3467
366 Ga0157376_10084593 3300014969 Bacteria 2731
367 Ga0157376_10200509 3300014969 Bacteria 1836
368 Ga0157376_10351530 3300014969 Bacteria 1411
369 Ga0157376_10415842 3300014969 Bacteria 1304
370 Ga0157376_12102928 3300014969 Bacteria 603
371 Ga0182005_1077842 3300015265 Bacteria 914
372 Ga0163161_10415052 3300017792 Bacteria 1082
373 Ga0163161_10723335 3300017792 Bacteria 831
374 Ga0206353_10430043 3300020082 Bacteria 879
375 Ga0207656_10073827 3300025321 Bacteria 1521
376 Ga0207653_10090276 3300025885 Bacteria 1072
377 Ga0207692_10001632 3300025898 Bacteria 8471
378 Ga0207692_10017199 3300025898 Bacteria 3220
379 Ga0207642_10712355 3300025899 Bacteria 633
380 Ga0207710_10104858 3300025900 Bacteria 1337
381 Ga0207710_10196092 3300025900 Bacteria 996
382 Ga0207688_10002064 3300025901 Bacteria 10795
383 Ga0207688_10043787 3300025901 Bacteria 2493
384 Ga0207645_10098908 3300025907 Bacteria 1881
385 Ga0207643_10021384 3300025908 Bacteria 3554
386 Ga0207643_10142872 3300025908 Bacteria 1431
387 Ga0207643_10201444 3300025908 Bacteria 1212
388 Ga0207705_10093612 3300025909 Bacteria 2203
389 Ga0207705_10248802 3300025909 Bacteria 1355
390 Ga0207707_10488393 3300025912 Bacteria 1051
391 Ga0207671_10114954 3300025914 Bacteria 2051
392 Ga0207693_10000014 3300025915 Bacteria 148984
393 Ga0207693_10016460 3300025915 Bacteria 5908
394 Ga0207693_10016977 3300025915 Bacteria 5814
395 Ga0207693_10329405 3300025915 Bacteria 1195
396 Ga0207660_10056371 3300025917 Bacteria 2811
397 Ga0207660_10380835 3300025917 Bacteria 1134
398 Ga0207662_10089039 3300025918 Bacteria 1896
399 Ga0207662_10362818 3300025918 Bacteria 975
400 Ga0207657_10013267 3300025919 Bacteria 8084
401 Ga0207657_10028661 3300025919 Bacteria 5074
402 Ga0207657_10044821 3300025919 Bacteria 3886
403 Ga0207657_10075365 3300025919 Bacteria 2847
404 Ga0207657_10267657 3300025919 Bacteria 1359
405 Ga0207657_10665644 3300025919 Bacteria 810
406 Ga0207649_10430354 3300025920 Bacteria 992
407 Ga0207652_10089212 3300025921 Bacteria 2707
408 Ga0207652_10496344 3300025921 Bacteria 1099
409 Ga0207652_10510858 3300025921 Bacteria 1081
410 Ga0207681_10012368 3300025923 Bacteria 5266
411 Ga0207681_10863991 3300025923 Bacteria 757
412 Ga0207681_11426787 3300025923 Bacteria 581
413 Ga0207694_10078744 3300025924 Bacteria 2584
414 Ga0207650_10188130 3300025925 Bacteria 1648
415 Ga0207650_10293562 3300025925 Bacteria 1326
416 Ga0207659_10730623 3300025926 Bacteria 849
417 Ga0207687_10039129 3300025927 Bacteria 3245
418 Ga0207687_10097453 3300025927 Bacteria 2157
419 Ga0207687_10130733 3300025927 Bacteria 1892
420 Ga0207687_10533062 3300025927 Bacteria 983
421 Ga0207687_10626337 3300025927 Bacteria 909
422 Ga0207687_10921404 3300025927 Bacteria 748
423 Ga0207664_10000057 3300025929 Bacteria 122177
424 Ga0207664_10000522 3300025929 Bacteria 27347
425 Ga0207664_10070074 3300025929 Bacteria 2821
426 Ga0207644_10989524 3300025931 Bacteria 706
427 Ga0207644_11144117 3300025931 Bacteria 654
428 Ga0207690_10000081 3300025932 Bacteria 81082
429 Ga0207690_10015170 3300025932 Bacteria 4665
430 Ga0207690_10113906 3300025932 Bacteria 1952
431 Ga0207690_10534518 3300025932 Bacteria 951
432 Ga0207690_10641251 3300025932 Bacteria 870
433 Ga0207690_10783931 3300025932 Bacteria 787
434 Ga0207706_10072135 3300025933 Bacteria 3037
435 Ga0207706_10210912 3300025933 Bacteria 1703
436 Ga0207706_10248275 3300025933 Bacteria 1555
437 Ga0207706_11169311 3300025933 Bacteria 640
438 Ga0207686_10234499 3300025934 Bacteria 1332
439 Ga0207686_10280569 3300025934 Bacteria 1230
440 Ga0207686_10730797 3300025934 Bacteria 789
441 Ga0207686_11005549 3300025934 Bacteria 677
442 Ga0207709_10069612 3300025935 Bacteria 2228
443 Ga0207709_10167905 3300025935 Bacteria 1537
444 Ga0207709_10178061 3300025935 Bacteria 1499
445 Ga0207709_10181835 3300025935 Bacteria 1485
446 Ga0207709_10288029 3300025935 Bacteria 1216
447 Ga0207709_10758351 3300025935 Bacteria 780
448 Ga0207670_10076166 3300025936 Bacteria 2334
449 Ga0207670_10501807 3300025936 Bacteria 985
450 Ga0207670_11004994 3300025936 Bacteria 702
451 Ga0207669_10014878 3300025937 Bacteria 3912
452 Ga0207669_10170896 3300025937 Bacteria 1547
453 Ga0207669_10357253 3300025937 Bacteria 1131
454 Ga0207669_10367439 3300025937 Bacteria 1117
455 Ga0207704_10047473 3300025938 Bacteria 2567
456 Ga0207704_10053874 3300025938 Bacteria 2448
457 Ga0207704_10124106 3300025938 Bacteria 1774
458 Ga0207704_10219688 3300025938 Bacteria 1405
459 Ga0207704_10437001 3300025938 Bacteria 1041
460 Ga0207704_10579289 3300025938 Bacteria 916
461 Ga0207704_10718426 3300025938 Bacteria 829
462 Ga0207704_10936297 3300025938 Bacteria 730
463 Ga0207691_10078403 3300025940 Bacteria 2974
464 Ga0207691_10361722 3300025940 Bacteria 1241
465 Ga0207691_10836641 3300025940 Bacteria 772
466 Ga0207691_10997485 3300025940 Bacteria 699
467 Ga0207711_11609694 3300025941 Bacteria 593
468 Ga0207689_10033303 3300025942 Bacteria 4282
469 Ga0207689_10176030 3300025942 Bacteria 1764
470 Ga0207689_10493721 3300025942 Bacteria 1025
471 Ga0207661_10052161 3300025944 Bacteria 3266
472 Ga0207661_10460768 3300025944 Bacteria 1159
473 Ga0207661_10539032 3300025944 Bacteria 1068
474 Ga0207661_10670339 3300025944 Bacteria 953
475 Ga0207661_10710200 3300025944 Bacteria 925
476 Ga0207661_11115301 3300025944 Bacteria 726
477 Ga0207661_11161928 3300025944 Bacteria 710
478 Ga0207661_11480118 3300025944 Bacteria 622
479 Ga0207679_10679497 3300025945 Bacteria 933
480 Ga0207679_10705377 3300025945 Bacteria 916
481 Ga0207679_11258235 3300025945 Bacteria 679
482 Ga0207667_11796126 3300025949 Bacteria 577
483 Ga0207651_10087818 3300025960 Bacteria 2265
484 Ga0207651_10131842 3300025960 Bacteria 1915
485 Ga0207712_10118030 3300025961 Bacteria 2002
486 Ga0207712_10121501 3300025961 Bacteria 1977
487 Ga0207712_10179326 3300025961 Bacteria 1663
488 Ga0207712_10703050 3300025961 Bacteria 882
489 Ga0207668_10181194 3300025972 Bacteria 1662
490 Ga0207668_10299312 3300025972 Bacteria 1327
491 Ga0207668_10373820 3300025972 Bacteria 1198
492 Ga0207668_10901722 3300025972 Bacteria 787
493 Ga0207668_11646955 3300025972 Bacteria 579
494 Ga0207640_10184553 3300025981 Bacteria 1567
495 Ga0207640_10190055 3300025981 Bacteria 1547
496 Ga0207640_10209665 3300025981 Bacteria 1483
497 Ga0207640_10510668 3300025981 Bacteria 1002
498 Ga0207658_10536450 3300025986 Bacteria 1046
499 Ga0207677_10017431 3300026023 Bacteria 4281
500 Ga0207677_10022655 3300026023 Bacteria 3864
501 Ga0207677_10259067 3300026023 Bacteria 1417
502 Ga0207677_10376174 3300026023 Bacteria 1197
503 Ga0207677_10730588 3300026023 Bacteria 881
504 Ga0207677_10930506 3300026023 Bacteria 785
505 Ga0207677_11533848 3300026023 Bacteria 616
506 Ga0207703_10193899 3300026035 Bacteria 1801
507 Ga0207703_10626196 3300026035 Bacteria 1019
508 Ga0207703_11073458 3300026035 Bacteria 773
509 Ga0207703_11440470 3300026035 Bacteria 663
510 Ga0207639_10097721 3300026041 Bacteria 2365
511 Ga0207639_10242118 3300026041 Bacteria 1569
512 Ga0207639_10270346 3300026041 Bacteria 1491
513 Ga0207678_10032759 3300026067 Bacteria 4529
514 Ga0207678_10226085 3300026067 Bacteria 1602
515 Ga0207678_10250791 3300026067 Bacteria 1516
516 Ga0207678_10367885 3300026067 Bacteria 1242
517 Ga0207678_10408241 3300026067 Bacteria 1177
518 Ga0207678_10459758 3300026067 Bacteria 1107
519 Ga0207678_10473464 3300026067 Bacteria 1090
520 Ga0207678_11150899 3300026067 Bacteria 687
521 Ga0207708_10012288 3300026075 Bacteria 6382
522 Ga0207708_10055029 3300026075 Bacteria 3033
523 Ga0207708_10089587 3300026075 Bacteria 2371
524 Ga0207708_10100954 3300026075 Bacteria 2233
525 Ga0207708_10122781 3300026075 Bacteria 2025
526 Ga0207708_10146655 3300026075 Bacteria 1855
527 Ga0207708_10391124 3300026075 Bacteria 1148
528 Ga0207708_10398408 3300026075 Bacteria 1138
529 Ga0207708_10552546 3300026075 Bacteria 971
530 Ga0207708_10991456 3300026075 Bacteria 730
531 Ga0207708_11041367 3300026075 Bacteria 712
532 Ga0207708_11172470 3300026075 Bacteria 671
533 Ga0207702_10050975 3300026078 Bacteria 3496
534 Ga0207702_10486804 3300026078 Bacteria 1201
535 Ga0207702_10509524 3300026078 Bacteria 1174
536 Ga0207702_10859186 3300026078 Bacteria 898
537 Ga0207702_11728337 3300026078 Bacteria 618
538 Ga0207641_10248692 3300026088 Bacteria 1660
539 Ga0207648_10014783 3300026089 Bacteria 7201
540 Ga0207648_10174383 3300026089 Bacteria 1901
541 Ga0207648_10422751 3300026089 Bacteria 1210
542 Ga0207676_10075999 3300026095 Bacteria 2712
543 Ga0207676_10084497 3300026095 Bacteria 2588
544 Ga0207676_10229351 3300026095 Bacteria 1659
545 Ga0207674_10061387 3300026116 Bacteria 3798
546 Ga0207674_10063806 3300026116 Bacteria 3717
547 Ga0207674_10216842 3300026116 Bacteria 1862
548 Ga0207674_10355020 3300026116 Bacteria 1417
549 Ga0207674_10930427 3300026116 Bacteria 838
550 Ga0207675_100014391 3300026118 Bacteria 7375
551 Ga0207675_100030014 3300026118 Bacteria 5061
552 Ga0207675_100054223 3300026118 Bacteria 3740
553 Ga0207675_100216099 3300026118 Bacteria 1846
554 Ga0207675_100796800 3300026118 Bacteria 958
555 Ga0207683_10073916 3300026121 Bacteria 3016
556 Ga0207683_10102860 3300026121 Bacteria 2551
557 Ga0207683_10234582 3300026121 Bacteria 1673
558 Ga0207698_10145145 3300026142 Bacteria 2051
559 Ga0207698_10155788 3300026142 Bacteria 1990
560 Ga0207698_10823898 3300026142 Bacteria 932
561 Ga0207428_10054987 3300027907 Bacteria 3167
562 Ga0207428_10131812 3300027907 Bacteria 1912
563 Ga0207428_10342116 3300027907 Bacteria 1102
564 Ga0207428_10889352 3300027907 Bacteria 630
565 Ga0268266_10031677 3300028379 Bacteria 4491
566 Ga0268266_10382601 3300028379 Bacteria 1328
567 Ga0268265_10362451 3300028380 Bacteria 1327
568 Ga0268264_10242639 3300028381 Bacteria 1670
569 Ga0268264_10742789 3300028381 Bacteria 977
570 Ga0265326_10000006 3300028558 Bacteria 233392
571 Ga0265319_1003953 3300028563 Bacteria 7526
572 Ga0265334_10000245 3300028573 Bacteria 31274
573 Ga0265318_10100873 3300028577 Bacteria 1062
574 Ga0265336_10016363 3300028666 Bacteria 2425
575 Ga0265338_10011026 3300028800 Bacteria 10493
576 Ga0265324_10002704 3300029957 Bacteria 8849
577 Ga0265320_10088417 3300031240 Bacteria 1437
578 Ga0307408_100199276 3300031548 Bacteria 1619
579 Ga0307408_100310745 3300031548 Bacteria 1324
580 Ga0307408_100806788 3300031548 Bacteria 852
581 Ga0307405_10095359 3300031731 Bacteria 1981
582 Ga0307405_10456430 3300031731 Bacteria 1014
583 Ga0307405_11457348 3300031731 Bacteria 600
584 Ga0307413_10356752 3300031824 Bacteria 1130
585 Ga0307413_10576181 3300031824 Bacteria 917
586 Ga0307413_10868687 3300031824 Bacteria 764
587 Ga0307413_11005401 3300031824 Bacteria 715
588 Ga0307413_11068407 3300031824 Bacteria 695
589 Ga0307410_10041390 3300031852 Bacteria 3038
590 Ga0307410_10071388 3300031852 Bacteria 2408
591 Ga0307410_10244092 3300031852 Bacteria 1393
592 Ga0307410_10384855 3300031852 Bacteria 1129
593 Ga0307406_10021780 3300031901 Bacteria 3796
594 Ga0307406_10079939 3300031901 Bacteria 2169
595 Ga0307406_10281673 3300031901 Bacteria 1268
596 Ga0307406_10826696 3300031901 Bacteria 784
597 Ga0307407_10037093 3300031903 Bacteria 2691
598 Ga0307407_10043214 3300031903 Bacteria 2532
599 Ga0307407_10046307 3300031903 Bacteria 2462
600 Ga0307407_10384481 3300031903 Bacteria 1003
601 Ga0307412_10904481 3300031911 Bacteria 774
602 Ga0307409_100014990 3300031995 Bacteria 5067
603 Ga0307409_100307641 3300031995 Bacteria 1477
604 Ga0307409_100526792 3300031995 Bacteria 1155
605 Ga0307409_100672142 3300031995 Bacteria 1032
606 Ga0307409_100814137 3300031995 Bacteria 942
607 Ga0307409_101076973 3300031995 Bacteria 824
608 Ga0307409_101108743 3300031995 Bacteria 813
609 Ga0307416_100029352 3300032002 Bacteria 4107
610 Ga0307416_100035150 3300032002 Bacteria 3823
611 Ga0307416_100131603 3300032002 Bacteria 2253
612 Ga0307416_100146977 3300032002 Bacteria 2154
613 Ga0307416_100159027 3300032002 Bacteria 2085
614 Ga0307416_100559456 3300032002 Bacteria 1218
615 Ga0307416_100744761 3300032002 Bacteria 1072
616 Ga0307416_100795414 3300032002 Bacteria 1041
617 Ga0307414_10062801 3300032004 Bacteria 2638
618 Ga0307414_10300875 3300032004 Bacteria 1357
619 Ga0307414_10625639 3300032004 Bacteria 968
620 Ga0307411_10202059 3300032005 Bacteria 1527
621 Ga0307411_10361341 3300032005 Bacteria 1187
622 Ga0307411_10574001 3300032005 Bacteria 966
623 Ga0307415_100072104 3300032126 Bacteria 2431
624 Ga0307415_100091393 3300032126 Bacteria 2204
625 Ga0307415_100131596 3300032126 Bacteria 1895
626 Ga0307415_100133935 3300032126 Bacteria 1881
627 Ga0307415_100412879 3300032126 Bacteria 1156
628 Ga0307415_100542898 3300032126 Bacteria 1024
629 Ga0307415_100939352 3300032126 Bacteria 800
630 Ga0373930_0112005 3300034816 Bacteria 658
631 Ga0373938_0126502 3300034957 Bacteria 663
632 Ga0373928_0152932 3300035084 Bacteria 640
633 Ga0373928_0175202 3300035084 Bacteria 607
634 Ga0373944_0346289 3300035089 Bacteria 565
635 Ga0373932_0030809 3300035112 Bacteria 1490
636 Ga0373939_0156575 3300035114 Bacteria 833
637 Ga0373941_0003041 3300035115 Bacteria 3755
638 Ga0373960_0025422 3300035121 Bacteria 1610
639 Ga0373960_0054765 3300035121 Bacteria 1194
640 Ga0373946_0149088 3300035171 Bacteria 1090
641 Ga0373946_0436230 3300035171 Bacteria 665
642 Ga0373942_0146895 3300035207 Bacteria 755
643 Ga0373961_0149140 3300035241 Bacteria 795
644 Ga0373962_0205989 3300035242 Bacteria 668
645 Ga0373931_0592583 3300035691 Bacteria 724
646 Ga0373935_0487104 3300035692 Bacteria 894
647 Ga0373927_0810470 3300035695 Bacteria 618
648 Ga0395899_0591481 3300037312 Bacteria 708
649 Ga0395899_0737358 3300037312 Unclassified 614
650 Ga0395899_0830544 3300037312 Bacteria 569
651 Ga0395900_0104932 3300037418 Bacteria 2904
652 Ga0395900_0226672 3300037418 Bacteria 1881
653 Ga0395900_0278555 3300037418 Bacteria 1665
654 Ga0395900_0656794 3300037418 Bacteria 985
655 Ga0395900_0933313 3300037418 Bacteria 790
656 Ga0395900_1274231 3300037418 Bacteria 649
657 Ga0395898_0069317 3300037466 Bacteria 3412
658 Ga0395898_0240819 3300037466 Bacteria 1725
659 Ga0395898_0245845 3300037466 Bacteria 1706
660 Ga0395898_0338759 3300037466 Bacteria 1434
661 Ga0395898_0388855 3300037466 Bacteria 1330
662 Ga0395898_1062362 3300037466 Bacteria 744
663 Ga0395898_1544612 3300037466 Bacteria 589
664 Ga0395898_1649867 3300037466 Bacteria 565
665 Ga0395905_0047391 3300037471 Bacteria 4028
666 Ga0395905_0093024 3300037471 Bacteria 2828
667 Ga0395905_0587158 3300037471 Bacteria 1016
668 Ga0395905_0618737 3300037471 Bacteria 985
669 Ga0395905_0827579 3300037471 Bacteria 829
670 Ga0395905_1072710 3300037471 Bacteria 709
671 Ga0436364_1489748 3300037853 Bacteria 827
672 Ga0395901_0110486 3300038443 Bacteria 2886
673 Ga0395901_0121241 3300038443 Bacteria 2748
674 Ga0395901_0229973 3300038443 Bacteria 1936
675 Ga0395901_0298699 3300038443 Bacteria 1670
676 Ga0395901_0344459 3300038443 Bacteria 1539
677 Ga0395901_0435964 3300038443 Bacteria 1342
678 Ga0395901_0443081 3300038443 Bacteria 1329
679 Ga0395901_0607634 3300038443 Bacteria 1102
680 Ga0395901_0673550 3300038443 Bacteria 1035
681 Ga0395901_0679609 3300038443 Bacteria 1029
682 Ga0395901_0703900 3300038443 Bacteria 1007
683 Ga0395901_1048296 3300038443 Bacteria 789
684 Ga0395901_1386336 3300038443 Bacteria 662
685 Ga0436365_0226686 3300039437 Bacteria 867
686 Ga0436365_0668736 3300039437 Unclassified 1560
687 Ga0436360_0805047 3300039438 Bacteria 1724
688 Ga0436363_0590901 3300039450 Bacteria 821
689 Ga0436362_0882791 3300039453 Bacteria 763
690 Ga0451789_0360271 3300041443 Bacteria 620
691 Ga0451791_0083592 3300041451 Bacteria 590
692 Ga0451795_1445687 3300041456 Bacteria 979
693 Ga0451802_1632828 3300041460 Bacteria 706
694 Ga0451837_1641471 3300041494 Bacteria 573
695 Ga0451853_0431845 3300041512 Bacteria 715
696 Ga0451853_2408925 3300041512 Bacteria 854
697 Ga0451853_2555167 3300041512 Bacteria 583
698 Ga0439455_0224701 3300042012 Bacteria 546
699 Ga0439463_048564 3300042016 Unclassified 1081
700 Ga0439460_0054787 3300042461 Bacteria 1204
701 Ga0439460_0206293 3300042461 Bacteria 671
702 Ga0450893_0031157 3300042532 Bacteria 952
703 Ga0450901_031704 3300042533 Bacteria 585
704 Ga0466972_0274317 3300044658 Unclassified 788
705 Ga0466965_0171154 3300044683 Bacteria 1143
706 Ga0466965_0185347 3300044683 Bacteria 1099
707 Ga0466965_0313157 3300044683 Bacteria 854
708 Ga0466966_0090781 3300044684 Bacteria 1897
709 Ga0466961_0048728 3300044693 Bacteria 2708
710 Ga0466961_0802134 3300044693 Bacteria 562
711 Ga0466963_0027649 3300044694 Bacteria 3634
712 Ga0466963_0067837 3300044694 Bacteria 2395
713 Ga0466963_0102367 3300044694 Bacteria 1961
714 Ga0466963_0208788 3300044694 Bacteria 1366
715 Ga0466963_1030688 3300044694 Bacteria 579
716 Ga0466964_0052318 3300044706 Bacteria 1679
717 Ga0466964_0573177 3300044706 Bacteria 616
718 Ga0466971_0056179 3300044719 Bacteria 1775
719 Ga0466971_0168774 3300044719 Bacteria 1026
720 Ga0466968_0173984 3300044735 Bacteria 999
721 Ga0466970_0126872 3300044765 Bacteria 1400
722 Ga0466970_0215606 3300044765 Bacteria 1070
723 Ga0466960_0000153 3300044901 Bacteria 23450
724 Ga0466960_0113381 3300044901 Bacteria 1411
725 Ga0466960_0139960 3300044901 Bacteria 1285
726 Ga0466960_0146010 3300044901 Bacteria 1260
727 Ga0466960_0258893 3300044901 Bacteria 969
728 Ga0466960_0347951 3300044901 Bacteria 845
729 Ga0466960_0813396 3300044901 Bacteria 566
730 Ga0466960_0839732 3300044901 Bacteria 558
731 Ga0466959_0048882 3300045049 Bacteria 3108
732 Ga0466959_0208828 3300045049 Bacteria 1357
733 Ga0466959_0309101 3300045049 Bacteria 1082
734 Ga0466958_0080257 3300045836 Bacteria 2007
735 Ga0466958_0351392 3300045836 Bacteria 949
736 Ga0466958_0506396 3300045836 Bacteria 783
737 Ga0466967_0010593 3300045976 Bacteria 6926
738 Ga0466967_0055102 3300045976 Bacteria 3502
739 Ga0466967_0059076 3300045976 Bacteria 3392
740 Ga0466967_0085023 3300045976 Bacteria 2864
741 Ga0466967_0089864 3300045976 Bacteria 2789
742 Ga0466967_0100274 3300045976 Bacteria 2646
743 Ga0466967_0141249 3300045976 Bacteria 2243
744 Ga0466967_0148499 3300045976 Bacteria 2189
745 Ga0466967_0159932 3300045976 Bacteria 2113
746 Ga0466967_0165106 3300045976 Bacteria 2080
747 Ga0466967_0181651 3300045976 Bacteria 1985
748 Ga0466967_0263371 3300045976 Bacteria 1650
749 Ga0466967_0374364 3300045976 Bacteria 1382
750 Ga0466967_0394301 3300045976 Bacteria 1346
751 Ga0466967_0588784 3300045976 Bacteria 1097
752 Ga0466967_0683196 3300045976 Bacteria 1016
753 Ga0466967_0711191 3300045976 Bacteria 995
754 Ga0466967_0772776 3300045976 Bacteria 953
755 Ga0466967_0851012 3300045976 Bacteria 906
756 Ga0466967_1042973 3300045976 Bacteria 814
757 Ga0466967_1045067 3300045976 Bacteria 813
758 Ga0466967_1112944 3300045976 Bacteria 787
759 Ga0466967_1242194 3300045976 Bacteria 742
760 Ga0466967_1371181 3300045976 Bacteria 704
761 Ga0466967_1552669 3300045976 Bacteria 659
762 Ga0466967_1602422 3300045976 Bacteria 648
763 Ga0466967_1764797 3300045976 Bacteria 616
764 Ga0495603_0137714 3300046455 Unclassified 1421
765 Ga0495590_0216625 3300046457 Bacteria 707
766 Ga0495629_0806338 3300046459 Unclassified 619
767 Ga0495641_0000718 3300046461 Bacteria 28069
768 Ga0495641_0034067 3300046461 Bacteria 2411
769 Ga0495580_0505283 3300046472 Bacteria 807
770 Ga0495582_0297112 3300046473 Bacteria 928
771 Ga0495605_0191583 3300046474 Bacteria 894
772 Ga0495639_0143228 3300046475 Bacteria 1150
773 Ga0495639_0421779 3300046475 Unclassified 676
774 Ga0495584_0356804 3300046491 Bacteria 743
775 Ga0495584_0656070 3300046491 Bacteria 535
776 Ga0495594_0464234 3300046499 Bacteria 720
777 Ga0495596_0019659 3300046500 Bacteria 2772
778 Ga0495596_0034987 3300046500 Bacteria 1993
779 Ga0495596_0204124 3300046500 Bacteria 768
780 Ga0495596_0358658 3300046500 Bacteria 568
781 Ga0495616_0131594 3300046513 Bacteria 1146
782 Ga0495630_0100285 3300046517 Bacteria 2191
783 Ga0495630_0157424 3300046517 Unclassified 1729
784 Ga0495631_0053610 3300046518 Bacteria 1760
785 Ga0495631_0337679 3300046518 Bacteria 641
786 Ga0495637_0084360 3300046520 Bacteria 1262
787 Ga0495644_0008525 3300046523 Bacteria 3949
788 Ga0495644_0125366 3300046523 Bacteria 978
789 Ga0495644_0155601 3300046523 Bacteria 876
790 Ga0495663_0110879 3300046525 Bacteria 912
791 Ga0495665_0196985 3300046531 Bacteria 1045
792 Ga0495598_0273553 3300046537 Bacteria 632
793 Ga0495609_0260415 3300046538 Bacteria 713
794 Ga0495597_0146841 3300046542 Bacteria 970
795 Ga0495656_0014794 3300046615 Bacteria 2933
796 Ga0495656_0038831 3300046615 Bacteria 1974
797 Ga0495656_0175576 3300046615 Bacteria 1050
798 Ga0495668_0305786 3300046616 Bacteria 872
799 Ga0495668_0375978 3300046616 Bacteria 780
800 Ga0495634_0096592 3300046642 Bacteria 1913
801 Ga0495634_0354715 3300046642 Unclassified 878
802 Ga0495661_0320349 3300046665 Bacteria 771
803 Ga0495588_0283026 3300046674 Bacteria 874
804 Ga0495657_0121794 3300046675 Bacteria 1642
805 Ga0495657_0560498 3300046675 Bacteria 663
806 Ga0495658_0107790 3300046683 Bacteria 1671
807 Ga0495658_0112709 3300046683 Bacteria 1637
808 Ga0495669_0479201 3300046684 Bacteria 605
809 Ga0495670_0189929 3300046691 Bacteria 1086
810 Ga0495589_0214168 3300046794 Bacteria 906
811 Ga0495672_0006135 3300047320 Bacteria 9377
812 Ga0495672_0078865 3300047320 Bacteria 1841
813 Ga0495676_0448135 3300047321 Bacteria 852
814 Ga0495680_0131447 3300047322 Bacteria 1839
815 Ga0495677_0142628 3300047445 Bacteria 920
816 Ga0495686_0000020 3300047472 Bacteria 429191
817 Ga0495686_0042903 3300047472 Unclassified 2872
818 Ga0496100_0005856 3300048903 Bacteria 6652
819 Ga0496100_0016521 3300048903 Bacteria 4336
820 Ga0496100_0237625 3300048903 Bacteria 1343
821 Ga0496100_0301210 3300048903 Bacteria 1200
822 Ga0496100_1192937 3300048903 Bacteria 600
823 Ga0496101_0019765 3300048904 Bacteria 4605
824 Ga0496101_0040882 3300048904 Bacteria 3303
825 Ga0496101_0133499 3300048904 Bacteria 1887
826 Ga0496101_0137927 3300048904 Bacteria 1857
827 Ga0496101_0217221 3300048904 Bacteria 1483
828 Ga0496101_0266035 3300048904 Bacteria 1338
829 Ga0496101_0441989 3300048904 Bacteria 1026
830 Ga0496101_0734010 3300048904 Bacteria 779
831 Ga0496101_0834370 3300048904 Bacteria 726
832 Ga0496101_1356280 3300048904 Bacteria 555
833 Ga0496102_0059664 3300048905 Bacteria 3489
834 Ga0496102_0111078 3300048905 Bacteria 2555
835 Ga0496102_0212419 3300048905 Bacteria 1824
836 Ga0496102_0227926 3300048905 Bacteria 1757
837 Ga0496103_0217426 3300048906 Bacteria 1229
838 Ga0496103_0373252 3300048906 Bacteria 917
839 Ga0496103_0442450 3300048906 Bacteria 834
840 Ga0496104_0046426 3300048907 Bacteria 4091
841 Ga0496104_0056585 3300048907 Bacteria 3709
842 Ga0496104_0103096 3300048907 Bacteria 2733
843 Ga0496104_0528731 3300048907 Bacteria 1090
844 Ga0496104_0791084 3300048907 Bacteria 855
845 Ga0496104_0970716 3300048907 Bacteria 754
846 Ga0496105_0003850 3300048908 Bacteria 11207
847 Ga0496105_0050885 3300048908 Bacteria 3423
848 Ga0496105_0097377 3300048908 Bacteria 2430
849 Ga0496105_0441723 3300048908 Bacteria 1028
850 Ga0496105_1349333 3300048908 Bacteria 519
851 Ga0496106_0095354 3300048909 Bacteria 2301
852 Ga0496106_0167494 3300048909 Bacteria 1740
853 Ga0496106_0172353 3300048909 Bacteria 1715
854 Ga0496106_0183144 3300048909 Bacteria 1663
855 Ga0496106_0204283 3300048909 Bacteria 1573
856 Ga0496106_0310379 3300048909 Bacteria 1265
857 Ga0496106_0583920 3300048909 Bacteria 895
858 Ga0496106_0658970 3300048909 Bacteria 836
859 Ga0496106_1226644 3300048909 Bacteria 584
860 Ga0496107_0108764 3300048910 Bacteria 2036
861 Ga0496107_0120682 3300048910 Bacteria 1931
862 Ga0496107_0124634 3300048910 Bacteria 1899
863 Ga0496107_0166610 3300048910 Bacteria 1634
864 Ga0496107_0300758 3300048910 Bacteria 1194
865 Ga0496107_0516555 3300048910 Bacteria 886
866 Ga0496107_0783680 3300048910 Bacteria 698
867 Ga0496108_0028255 3300048911 Bacteria 4640
868 Ga0496108_0171813 3300048911 Bacteria 1875
869 Ga0496108_0191106 3300048911 Bacteria 1774
870 Ga0496108_0242395 3300048911 Bacteria 1568
871 Ga0496108_0376791 3300048911 Bacteria 1239
872 Ga0496108_0399495 3300048911 Bacteria 1200
873 Ga0496108_0517433 3300048911 Bacteria 1042
874 Ga0496108_1276281 3300048911 Unclassified 618
875 Ga0496109_0007531 3300048912 Bacteria 9225
876 Ga0496109_0014197 3300048912 Bacteria 6927
877 Ga0496109_0060210 3300048912 Bacteria 3469
878 Ga0496109_0180512 3300048912 Bacteria 1982
879 Ga0496109_0183449 3300048912 Bacteria 1966
880 Ga0496109_0233815 3300048912 Bacteria 1729
881 Ga0496109_0278118 3300048912 Bacteria 1577
882 Ga0496109_0313599 3300048912 Bacteria 1480
883 Ga0496109_0416680 3300048912 Bacteria 1269
884 Ga0496109_0446059 3300048912 Bacteria 1222
885 Ga0496109_0502592 3300048912 Bacteria 1144
886 Ga0496109_0946411 3300048912 Bacteria 799
887 Ga0496109_1476720 3300048912 Bacteria 615
888 Ga0496110_0062947 3300048913 Bacteria 3278
889 Ga0496110_0132373 3300048913 Bacteria 2252
890 Ga0496110_0153411 3300048913 Bacteria 2086
891 Ga0496110_0252100 3300048913 Bacteria 1606
892 Ga0496110_0318107 3300048913 Bacteria 1417
893 Ga0496110_0515275 3300048913 Bacteria 1088
894 Ga0496110_1107710 3300048913 Bacteria 700
895 Ga0496111_0175832 3300048914 Bacteria 1591
896 Ga0496111_0346687 3300048914 Bacteria 1099
897 Ga0496111_0400586 3300048914 Bacteria 1014
898 Ga0496111_0585906 3300048914 Bacteria 817
899 Ga0496111_0697035 3300048914 Bacteria 739
900 Ga0496111_0720130 3300048914 Bacteria 725
901 Ga0496111_0770521 3300048914 Bacteria 697
902 Ga0496111_1145068 3300048914 Bacteria 553
903 Ga0496111_1146969 3300048914 Bacteria 552
904 Ga0496112_0017261 3300048915 Bacteria 6776
905 Ga0496112_0031376 3300048915 Bacteria 5154
906 Ga0496112_0056139 3300048915 Bacteria 3875
907 Ga0496112_0084982 3300048915 Bacteria 3130
908 Ga0496112_0097829 3300048915 Bacteria 2905
909 Ga0496112_0112292 3300048915 Bacteria 2695
910 Ga0496112_0347406 3300048915 Bacteria 1426
911 Ga0496112_0403027 3300048915 Bacteria 1308
912 Ga0496112_0489218 3300048915 Bacteria 1166
913 Ga0496112_0537568 3300048915 Unclassified 1103
914 Ga0496112_0688578 3300048915 Bacteria 950
915 Ga0496112_0812623 3300048915 Bacteria 859
916 Ga0496112_0865354 3300048915 Bacteria 827
917 Ga0496113_0031787 3300048916 Bacteria 3833
918 Ga0496113_0073617 3300048916 Bacteria 2603
919 Ga0496113_0099312 3300048916 Bacteria 2254
920 Ga0496113_0113780 3300048916 Bacteria 2109
921 Ga0496113_0244170 3300048916 Bacteria 1433
922 Ga0496113_0279079 3300048916 Bacteria 1336
923 Ga0496113_1022495 3300048916 Bacteria 650
924 Ga0496114_0214849 3300048917 Bacteria 1687
925 Ga0496114_0338885 3300048917 Bacteria 1329
926 Ga0496114_0580905 3300048917 Bacteria 989
927 Ga0496114_0843578 3300048917 Bacteria 796
928 Ga0496115_0085254 3300048918 Bacteria 2576
929 Ga0496117_0488623 3300048920 Bacteria 600
930 Ga0496119_0324187 3300048922 Bacteria 753
931 Ga0496121_0024549 3300048924 Bacteria 5760
932 Ga0496121_0091033 3300048924 Bacteria 2383
933 Ga0496124_0153174 3300048927 Bacteria 1806
934 Ga0496124_0191425 3300048927 Bacteria 1565
935 Ga0496125_0618432 3300048928 Bacteria 588
936 Ga0501031_0050881 3300049568 Bacteria 2698
937 Ga0501031_0064483 3300049568 Bacteria 2386
938 Ga0501032_0161252 3300049569 Bacteria 1472
939 Ga0501033_0064178 3300049570 Bacteria 2702
940 Ga0501034_0299292 3300049571 Bacteria 1545
941 Ga0501036_0098487 3300049572 Bacteria 2472
942 Ga0501037_0044331 3300049573 Bacteria 3266
943 Ga0501037_0317031 3300049573 Bacteria 1080
944 Ga0501038_0064421 3300049574 Bacteria 3125
945 Ga0501039_0006815 3300049575 Bacteria 8690
946 Ga0501041_0128400 3300049577 Bacteria 1579
947 Ga0501041_0201261 3300049577 Bacteria 1248
948 Ga0501042_0059981 3300049578 Bacteria 2717
949 Ga0501042_0126733 3300049578 Bacteria 1839
950 Ga0501042_0529938 3300049578 Bacteria 856
951 Ga0501043_0017649 3300049579 Bacteria 5596
952 Ga0501043_0203530 3300049579 Bacteria 1536
953 Ga0501046_0029028 3300049580 Bacteria 4501
954 Ga0501046_0735960 3300049580 Bacteria 693
955 Ga0501047_0188083 3300049581 Bacteria 1929
956 Ga0501048_0117757 3300049582 Bacteria 1876
957 Ga0501048_0146166 3300049582 Bacteria 1672
958 Ga0501067_0089089 3300049583 Bacteria 1712
959 Ga0501067_0462542 3300049583 Bacteria 709
960 Ga0501068_0205443 3300049584 Bacteria 1250
961 Ga0501069_0030726 3300049585 Bacteria 2951
962 Ga0501069_0454118 3300049585 Bacteria 762
963 Ga0501069_0523137 3300049585 Bacteria 708
964 Ga0501069_0712365 3300049585 Bacteria 606
965 Ga0501070_0139909 3300049586 Bacteria 1998
966 Ga0501071_0384696 3300049587 Bacteria 1070
967 Ga0501071_1174747 3300049587 Bacteria 593
968 Ga0501072_0125940 3300049588 Bacteria 2041
969 Ga0501074_0039394 3300049590 Bacteria 3423
970 Ga0501074_0057969 3300049590 Bacteria 2790
971 Ga0501075_0085499 3300049591 Bacteria 2390
972 Ga0501075_0272822 3300049591 Bacteria 1289
973 Ga0501076_0089544 3300049592 Bacteria 2474
974 Ga0501076_0159018 3300049592 Bacteria 1840
975 Ga0501077_0228544 3300049593 Bacteria 1183
976 Ga0501217_067240 3300049661 Bacteria 969
977 Ga0501079_0026126 3300049741 Bacteria 4478
978 Ga0501080_0035685 3300049742 Bacteria 4641
979 Ga0501080_0053581 3300049742 Bacteria 3756
980 Ga0501080_0714673 3300049742 Bacteria 883
981 Ga0501081_0468748 3300049743 Bacteria 937
982 Ga0501083_0143219 3300049744 Bacteria 1565
983 Ga0501083_0191672 3300049744 Bacteria 1334
984 Ga0501035_0093610 3300049822 Bacteria 2644
985 Ga0501044_0250907 3300049823 Bacteria 1710
986 Ga0501045_0455490 3300049824 Bacteria 951
987 nmdc:mga03n38_764928_c1 3300050490 Bacteria 560
988 nmdc:mga0yw44_586656_c1 3300050492 Bacteria 757
989 nmdc:mga0yw44_793758_c1 3300050492 Bacteria 643
990 nmdc:mga05p37_1042252_c1 3300050507 Bacteria 864
991 nmdc:mga05p37_1103539_c1 3300050507 Bacteria 830
992 nmdc:mga05p37_255723_c1 3300050507 Bacteria 2099
993 nmdc:mga05p37_395820_c1 3300050507 Unclassified 1614
994 nmdc:mga05p37_4922_c1 3300050507 Bacteria 15649
995 nmdc:mga05p37_534995_c1 3300050507 Bacteria 1337
996 nmdc:mga05p37_599007_c1 3300050507 Bacteria 1244
997 nmdc:mga05p37_677138_c1 3300050507 Bacteria 1150
998 nmdc:mga05p37_71078_c1 3300050507 Bacteria 4281
999 nmdc:mga09592_14891_c1 3300050508 Bacteria 6351
1000 nmdc:mga09592_1671928_c1 3300050508 Bacteria 514
1001 nmdc:mga09592_188182_c1 3300050508 Bacteria 1787
1002 nmdc:mga09592_770579_c1 3300050508 Bacteria 815
1003 nmdc:mga09592_80361_c1 3300050508 Bacteria 2776
1004 nmdc:mga0qj67_64751_c1 3300050509 Bacteria 2909
1005 nmdc:mga0qj67_9191_c1 3300050509 Bacteria 7340
1006 nmdc:mga0qj67_99555_c1 3300050509 Bacteria 2342
1007 nmdc:mga06r32_1493479_c1 3300050510 Bacteria 616
1008 nmdc:mga06r32_1528221_c1 3300050510 Bacteria 607
1009 nmdc:mga06r32_362346_c1 3300050510 Bacteria 1433
1010 nmdc:mga06r32_444047_c1 3300050510 Bacteria 1277
1011 nmdc:mga06r32_719242_c1 3300050510 Bacteria 963
1012 nmdc:mga06r32_86123_c1 3300050510 Bacteria 3064
1013 nmdc:mga06r32_99604_c1 3300050510 Bacteria 2851
1014 nmdc:mga08y16_1311683_c1 3300050511 Bacteria 690
1015 nmdc:mga08y16_151757_c1 3300050511 Bacteria 2408
1016 nmdc:mga08y16_192770_c1 3300050511 Bacteria 2113
1017 nmdc:mga08y16_241550_c1 3300050511 Bacteria 1867
1018 nmdc:mga08y16_343013_c1 3300050511 Bacteria 1535
1019 nmdc:mga08y16_412792_c1 3300050511 Bacteria 1380
1020 nmdc:mga08y16_468919_c1 3300050511 Bacteria 1282
1021 nmdc:mga08y16_67035_c1 3300050511 Bacteria 3745
1022 nmdc:mga08y16_734100_c1 3300050511 Bacteria 985
1023 nmdc:mga08y16_79157_c1 3300050511 Bacteria 3425
1024 nmdc:mga08y16_98367_c1 3300050511 Bacteria 3047
1025 nmdc:mga0n895_425484_c1 3300050512 Bacteria 1342
1026 nmdc:mga0n895_488196_c1 3300050512 Bacteria 1242
1027 nmdc:mga0n895_539946_c1 3300050512 Bacteria 1172
1028 nmdc:mga0n895_613336_c1 3300050512 Unclassified 1089
1029 nmdc:mga0n895_949928_c1 3300050512 Bacteria 843
1030 nmdc:mga0rr50_146331_c1 3300050513 Bacteria 1905
1031 nmdc:mga0rr50_147011_c1 3300050513 Bacteria 1901
1032 nmdc:mga0rr50_454925_c1 3300050513 Bacteria 1085
1033 nmdc:mga0rr50_575502_c1 3300050513 Bacteria 959
1034 nmdc:mga08x19_34334_c1 3300050514 Bacteria 3205
1035 nmdc:mga08x19_411369_c1 3300050514 Bacteria 949
1036 nmdc:mga08x19_978819_c1 3300050514 Bacteria 601
1037 nmdc:mga0a205_1268634_c1 3300050515 Bacteria 584
1038 nmdc:mga0a205_383720_c1 3300050515 Bacteria 1270
1039 nmdc:mga0a205_582310_c1 3300050515 Unclassified 973
1040 Ga0495601_0382694 3300053077 Bacteria 913
1041 Ga0495655_0218274 3300053083 Bacteria 630
1042 Ga0495619_0156825 3300053085 Bacteria 1571
1043 Ga0500572_255235 3300053111 Bacteria 570
1044 Ga0500628_012956 3300053129 Unclassified 1547
1045 Ga0500628_122671 3300053129 Bacteria 707
1046 Ga0500616_0036915 3300053153 Bacteria 2648
1047 Ga0500599_005317 3300053736 Bacteria 1615
1048 Ga0501084_0742587 3300054114 Bacteria 827
1049 Ga0501082_0229510 3300060353 Bacteria 1615
1050 Ga0501082_0442825 3300060353 Bacteria 1135
1051 Ga0501082_0460447 3300060353 Bacteria 1111
1052 Ga0466962_0030424 3300061719 Bacteria 2586
1053 Ga0466962_0146541 3300061719 Bacteria 1145
1054 Ga0466962_0222918 3300061719 Bacteria 924
1055 Ga0466962_0755888 3300061719 Bacteria 500
1056 Ga0530510_0302932 3300061734 Bacteria 1196
1057 Ga0530510_1169650 3300061734 Bacteria 590
1058 Ga0530510_1419624 3300061734 Bacteria 533
1059 Ga0466961_0452521
1060 JGI24737J22298_10058275
1061 JGI24745J21846_1039372
1062 JGI24738J21930_10103557
1063 JGI25406J46586_10028901
1064 JGI25406J46586_10148322
1065 JGI25407J50210_10006535
1066 JGI25407J50210_10013279
1067 JGI25407J50210_10020743
1068 JGI25407J50210_10107698
1069 Ga0070658_10289737
1070 Ga0070658_10597104
1071 Ga0070676_10328782
1072 Ga0070676_11171692
1073 Ga0070683_100041020
1074 Ga0070683_100096170
1075 Ga0070683_100136242
1076 Ga0070683_100136557
1077 Ga0070683_100320709
1078 Ga0070683_100403712
1079 Ga0070683_100548021
1080 Ga0070683_100835974
1081 Ga0070690_100119887
1082 Ga0068869_100528075
1083 Ga0070680_100174839
1084 Ga0070680_100922241
1085 Ga0070682_100051333
1086 Ga0070682_100163190
1087 Ga0070682_100193425
1088 Ga0070682_100533153
1089 Ga0070682_101165143
1090 Ga0068868_100154996
1091 Ga0068868_100183164
1092 Ga0068868_100710743
1093 Ga0070660_100007118
1094 Ga0070660_100247656
1095 Ga0070660_100479364
1096 Ga0070660_100572922
1097 Ga0070689_100034455
1098 Ga0070689_100113530
1099 Ga0070689_101016924
1100 Ga0070687_100379371
1101 Ga0070687_100402753
1102 Ga0070687_100414022
1103 Ga0070661_100090391
1104 Ga0070661_100166954
1105 Ga0070692_10262576
1106 Ga0070668_100071660
1107 Ga0070668_100164924
1108 Ga0070668_100463266
1109 Ga0070669_100057390
1110 Ga0070669_100779297
1111 Ga0070675_101065639
1112 Ga0070671_101169610
1113 Ga0070671_101441844
1114 Ga0070673_100409571
1115 Ga0070659_100000053
1116 Ga0070659_100198485
1117 Ga0070659_100386489
1118 Ga0070659_100394437
1119 Ga0070659_100640557
1120 Ga0070659_100672768
1121 Ga0070659_100730699
1122 Ga0070659_100996954
1123 Ga0070667_100319091
1124 Ga0070667_100571701
1125 Ga0070709_10216707
1126 Ga0070714_100000131
1127 Ga0070714_100000262
1128 Ga0070714_100051744
1129 Ga0070710_10000003
1130 Ga0070710_10017605
1131 Ga0070710_10509423
1132 Ga0070705_100000843
1133 Ga0070705_100055720
1134 Ga0070705_100096475
1135 Ga0070705_100276003
1136 Ga0070700_100248590
1137 Ga0070700_100374710
1138 Ga0070700_100539154
1139 Ga0070700_100986472
1140 Ga0070700_101203021
1141 Ga0070694_100219611
1142 Ga0070694_100746614
1143 Ga0070663_100234648
1144 Ga0070663_100315395
1145 Ga0070678_100031100
1146 Ga0070678_100172758
1147 Ga0070678_100877677
1148 Ga0070662_100044630
1149 Ga0070662_100173796
1150 Ga0070662_100302983
1151 Ga0070662_100339353
1152 Ga0068867_100156723
1153 Ga0068867_100191676
1154 Ga0068867_101019195
1155 Ga0068867_101468721
1156 Ga0070685_10168787
1157 Ga0070685_10223555
1158 Ga0070685_10330228
1159 Ga0070685_10342374
1160 Ga0070679_100157187
1161 Ga0070679_100425170
1162 Ga0070684_100006522
1163 Ga0070684_100092528
1164 Ga0070684_100167839
1165 Ga0070684_100685597
1166 Ga0070672_100373553
1167 Ga0070672_100901331
1168 Ga0070686_100303452
1169 Ga0070686_100448268
1170 Ga0070686_100513431
1171 Ga0070695_100057420
1172 Ga0070695_100144960
1173 Ga0070695_100961922
1174 Ga0070695_101282814
1175 Ga0070693_100347153
1176 Ga0070693_101074015
1177 Ga0070665_100008460
1178 Ga0070704_100285333
1179 Ga0070704_100572835
1180 Ga0070704_101012189
1181 Ga0070704_101136147
1182 Ga0068855_101753620
1183 Ga0070664_100116852
1184 Ga0070664_100138731
1185 Ga0070664_100511525
1186 Ga0070664_100599318
1187 Ga0070664_100698422
1188 Ga0068857_100050329
1189 Ga0068857_100299568
1190 Ga0068857_100614968
1191 Ga0068854_100041936
1192 Ga0068854_100876162
1193 Ga0068856_100174167
1194 Ga0068856_100254292
1195 Ga0068856_100527708
1196 Ga0068856_100670468
1197 Ga0070702_100153051
1198 Ga0070702_100417243
1199 Ga0070702_100666629
1200 Ga0070702_101134433
1201 Ga0070702_101623184
1202 Ga0068852_100252724
1203 Ga0068852_101795180
1204 Ga0068859_100082004
1205 Ga0068859_100621979
1206 Ga0068864_100090742
1207 Ga0068864_100376986
1208 Ga0068864_100722102
1209 Ga0068866_10049579
1210 Ga0068866_10157917
1211 Ga0068861_100014964
1212 Ga0068861_100082999
1213 Ga0068861_100096790
1214 Ga0068861_100201302
1215 Ga0068861_100359565
1216 Ga0068851_10235805
1217 Ga0068870_10056125
1218 Ga0068870_10069224
1219 Ga0068870_10164595
1220 Ga0068870_10214030
1221 Ga0068863_100288411
1222 Ga0068863_101330561
1223 Ga0068858_100204526
1224 Ga0068858_100991790
1225 Ga0068858_101790668
1226 Ga0068860_100288918
1227 Ga0068862_100412392
1228 Ga0081455_10012508
1229 Ga0081455_10056394
1230 Ga0081455_10063451
1231 Ga0081455_10131233
1232 Ga0081538_10000035
1233 Ga0081538_10000868
1234 Ga0081538_10001050
1235 Ga0081538_10002142
1236 Ga0081538_10016218
1237 Ga0081538_10049160
1238 Ga0081538_10058261
1239 Ga0081538_10066700
1240 Ga0081538_10125073
1241 Ga0081538_10181884
1242 Ga0081538_10225208
1243 Ga0081540_1006587
1244 Ga0081540_1042404
1245 Ga0081540_1113699
1246 Ga0081539_10002427
1247 Ga0081539_10023180
1248 Ga0081539_10050141
1249 Ga0070717_10000001
1250 Ga0075365_10206805
1251 Ga0075365_10310772
1252 Ga0075365_10764898
1253 Ga0075365_10866774
1254 Ga0075432_10070767
1255 Ga0070715_10086149
1256 Ga0070712_100000002
1257 Ga0070712_100026678
1258 Ga0070712_100413062
1259 Ga0097621_100678896
1260 Ga0075428_100022758
1261 Ga0075428_100030040
1262 Ga0075428_100040035
1263 Ga0075428_100267574
1264 Ga0075428_100315818
1265 Ga0075428_100861516
1266 Ga0075430_100003813
1267 Ga0075430_100038412
1268 Ga0075430_100038542
1269 Ga0075430_100163229
1270 Ga0075431_100027293
1271 Ga0075431_100043908
1272 Ga0075431_100684196
1273 Ga0075433_10022137
1274 Ga0075433_10656386
1275 Ga0075434_100010467
1276 Ga0075434_100563620
1277 Ga0075434_100605474
1278 Ga0075434_101417195
1279 Ga0075429_100019109
1280 Ga0075429_100026710
1281 Ga0075429_100143171
1282 Ga0075429_100526001
1283 Ga0068865_100072177
1284 Ga0068865_100100035
1285 Ga0068865_100113849
1286 Ga0068865_100937772
1287 Ga0097620_100082004
1288 Ga0097620_100621990
1289 Ga0075435_100499007
1290 Ga0075435_100834449
1291 Ga0099795_10339187
1292 Ga0105250_10512690
1293 Ga0105240_11139289
1294 Ga0105240_11673838
1295 Ga0105240_12130333
1296 Ga0111539_10100997
1297 Ga0111539_10178914
1298 Ga0111539_10179715
1299 Ga0111539_10190750
1300 Ga0111539_10357442
1301 Ga0111539_10406931
1302 Ga0111539_10441724
1303 Ga0111539_10570519
1304 Ga0111539_10972416
1305 Ga0111539_11671008
1306 Ga0111539_11676643
1307 Ga0111539_12785277
1308 Ga0105245_10002712
1309 Ga0105245_10022533
1310 Ga0105245_10029370
1311 Ga0105245_10092446
1312 Ga0105245_10198752
1313 Ga0105245_10262684
1314 Ga0105245_10287041
1315 Ga0105245_10289230
1316 Ga0105245_10551147
1317 Ga0105245_10865414
1318 Ga0105245_11044120
1319 Ga0105245_12881430
1320 Ga0105247_10049121
1321 Ga0105247_10079737
1322 Ga0105247_10355670
1323 Ga0105247_10497472
1324 Ga0114129_10052170
1325 Ga0114129_10151887
1326 Ga0114129_10602507
1327 Ga0114129_10610292
1328 Ga0114129_11645930
1329 Ga0114129_11808026
1330 Ga0105243_10082025
1331 Ga0105243_10110788
1332 Ga0105243_10136628
1333 Ga0105243_10260986
1334 Ga0105241_10343998
1335 Ga0105241_10378751
1336 Ga0105241_10841145
1337 Ga0105241_11118461
1338 Ga0105242_10340125
1339 Ga0105242_10388786
1340 Ga0105242_10513895
1341 Ga0105242_10775015
1342 Ga0105242_10789181
1343 Ga0105242_10857898
1344 Ga0105242_11035891
1345 Ga0105242_11620285
1346 Ga0105248_10127326
1347 Ga0105248_10161070
1348 Ga0105248_11415490
1349 Ga0105248_12179969
1350 Ga0105248_12696221
1351 Ga0105237_11085588
1352 Ga0105238_10511918
1353 Ga0105249_10138570
1354 Ga0105249_10166120
1355 Ga0105249_10256687
1356 Ga0105249_10294363
1357 Ga0105249_10633082
1358 Ga0105249_10656781
1359 Ga0105249_11130168
1360 Ga0105249_12121229
1361 Ga0105239_10055446
1362 Ga0105239_10097768
1363 Ga0105239_10104027
1364 Ga0105239_10220330
1365 Ga0105239_10416324
1366 Ga0105239_10792865
1367 Ga0105246_10012719
1368 Ga0105246_10032994
1369 Ga0105246_10679808
1370 Ga0157340_1007908
1371 Ga0157336_1004211
1372 Ga0157347_1033510
1373 Ga0157313_1020658
1374 Ga0157371_10572078
1375 Ga0157371_11122178
1376 Ga0157369_10298937
1377 Ga0157369_10722272
1378 Ga0157369_11010165
1379 Ga0157369_11864825
1380 Ga0157374_10166943
1381 Ga0157378_10372705
1382 Ga0157378_11025494
1383 Ga0157378_11469033
1384 Ga0157378_11532684
1385 Ga0163162_10068643
1386 Ga0163162_10410521
1387 Ga0163162_10908872
1388 Ga0163162_11357013
1389 Ga0163162_12210819
1390 Ga0157372_10161447
1391 Ga0157372_10375778
1392 Ga0157372_10408809
1393 Ga0157372_10420825
1394 Ga0157372_11018261
1395 Ga0157372_12762676
1396 Ga0157375_10024908
1397 Ga0157375_10336138
1398 Ga0157375_11406512
1399 Ga0163163_10115455
1400 Ga0163163_10153122
1401 Ga0163163_10166525
1402 Ga0163163_10540222
1403 Ga0163163_10776426
1404 Ga0163163_11092381
1405 Ga0163163_11317932
1406 Ga0157380_10054656
1407 Ga0157380_10056745
1408 Ga0157380_10411463
1409 Ga0157380_10920043
1410 Ga0157380_11044168
1411 Ga0157380_11091900
1412 Ga0182008_10103582
1413 Ga0157377_10006889
1414 Ga0157377_10016883
1415 Ga0157377_10374462
1416 Ga0157377_10836149
1417 Ga0157379_10004659
1418 Ga0157379_10380669
1419 Ga0157379_10553891
1420 Ga0157379_10604740
1421 Ga0157379_10651870
1422 Ga0157379_11048265
1423 Ga0157376_10049954
1424 Ga0157376_10084593
1425 Ga0157376_10200509
1426 Ga0157376_10351530
1427 Ga0157376_10415842
1428 Ga0157376_12102928
1429 Ga0182005_1077842
1430 Ga0163161_10415052
1431 Ga0163161_10723335
1432 Ga0206353_10430043
1433 Ga0207656_10073827
1434 Ga0207653_10090276
1435 Ga0207692_10001632
1436 Ga0207692_10017199
1437 Ga0207642_10712355
1438 Ga0207710_10104858
1439 Ga0207710_10196092
1440 Ga0207688_10002064
1441 Ga0207688_10043787
1442 Ga0207645_10098908
1443 Ga0207643_10021384
1444 Ga0207643_10142872
1445 Ga0207643_10201444
1446 Ga0207705_10093612
1447 Ga0207705_10248802
1448 Ga0207707_10488393
1449 Ga0207671_10114954
1450 Ga0207693_10000014
1451 Ga0207693_10016460
1452 Ga0207693_10016977
1453 Ga0207693_10329405
1454 Ga0207660_10056371
1455 Ga0207660_10380835
1456 Ga0207662_10089039
1457 Ga0207662_10362818
1458 Ga0207657_10013267
1459 Ga0207657_10028661
1460 Ga0207657_10044821
1461 Ga0207657_10075365
1462 Ga0207657_10267657
1463 Ga0207657_10665644
1464 Ga0207649_10430354
1465 Ga0207652_10089212
1466 Ga0207652_10496344
1467 Ga0207652_10510858
1468 Ga0207681_10012368
1469 Ga0207681_10863991
1470 Ga0207681_11426787
1471 Ga0207694_10078744
1472 Ga0207650_10188130
1473 Ga0207650_10293562
1474 Ga0207659_10730623
1475 Ga0207687_10039129
1476 Ga0207687_10097453
1477 Ga0207687_10130733
1478 Ga0207687_10533062
1479 Ga0207687_10626337
1480 Ga0207687_10921404
1481 Ga0207664_10000057
1482 Ga0207664_10000522
1483 Ga0207664_10070074
1484 Ga0207644_10989524
1485 Ga0207644_11144117
1486 Ga0207690_10000081
1487 Ga0207690_10015170
1488 Ga0207690_10113906
1489 Ga0207690_10534518
1490 Ga0207690_10641251
1491 Ga0207690_10783931
1492 Ga0207706_10072135
1493 Ga0207706_10210912
1494 Ga0207706_10248275
1495 Ga0207706_11169311
1496 Ga0207686_10234499
1497 Ga0207686_10280569
1498 Ga0207686_10730797
1499 Ga0207686_11005549
1500 Ga0207709_10069612
1501 Ga0207709_10167905
1502 Ga0207709_10178061
1503 Ga0207709_10181835
1504 Ga0207709_10288029
1505 Ga0207709_10758351
1506 Ga0207670_10076166
1507 Ga0207670_10501807
1508 Ga0207670_11004994
1509 Ga0207669_10014878
1510 Ga0207669_10170896
1511 Ga0207669_10357253
1512 Ga0207669_10367439
1513 Ga0207704_10047473
1514 Ga0207704_10053874
1515 Ga0207704_10124106
1516 Ga0207704_10219688
1517 Ga0207704_10437001
1518 Ga0207704_10579289
1519 Ga0207704_10718426
1520 Ga0207704_10936297
1521 Ga0207691_10078403
1522 Ga0207691_10361722
1523 Ga0207691_10836641
1524 Ga0207691_10997485
1525 Ga0207711_11609694
1526 Ga0207689_10033303
1527 Ga0207689_10176030
1528 Ga0207689_10493721
1529 Ga0207661_10052161
1530 Ga0207661_10460768
1531 Ga0207661_10539032
1532 Ga0207661_10670339
1533 Ga0207661_10710200
1534 Ga0207661_11115301
1535 Ga0207661_11161928
1536 Ga0207661_11480118
1537 Ga0207679_10679497
1538 Ga0207679_10705377
1539 Ga0207679_11258235
1540 Ga0207667_11796126
1541 Ga0207651_10087818
1542 Ga0207651_10131842
1543 Ga0207712_10118030
1544 Ga0207712_10121501
1545 Ga0207712_10179326
1546 Ga0207712_10703050
1547 Ga0207668_10181194
1548 Ga0207668_10299312
1549 Ga0207668_10373820
1550 Ga0207668_10901722
1551 Ga0207668_11646955
1552 Ga0207640_10184553
1553 Ga0207640_10190055
1554 Ga0207640_10209665
1555 Ga0207640_10510668
1556 Ga0207658_10536450
1557 Ga0207677_10017431
1558 Ga0207677_10022655
1559 Ga0207677_10259067
1560 Ga0207677_10376174
1561 Ga0207677_10730588
1562 Ga0207677_10930506
1563 Ga0207677_11533848
1564 Ga0207703_10193899
1565 Ga0207703_10626196
1566 Ga0207703_11073458
1567 Ga0207703_11440470
1568 Ga0207639_10097721
1569 Ga0207639_10242118
1570 Ga0207639_10270346
1571 Ga0207678_10032759
1572 Ga0207678_10226085
1573 Ga0207678_10250791
1574 Ga0207678_10367885
1575 Ga0207678_10408241
1576 Ga0207678_10459758
1577 Ga0207678_10473464
1578 Ga0207678_11150899
1579 Ga0207708_10012288
1580 Ga0207708_10055029
1581 Ga0207708_10089587
1582 Ga0207708_10100954
1583 Ga0207708_10122781
1584 Ga0207708_10146655
1585 Ga0207708_10391124
1586 Ga0207708_10398408
1587 Ga0207708_10552546
1588 Ga0207708_10991456
1589 Ga0207708_11041367
1590 Ga0207708_11172470
1591 Ga0207702_10050975
1592 Ga0207702_10486804
1593 Ga0207702_10509524
1594 Ga0207702_10859186
1595 Ga0207702_11728337
1596 Ga0207641_10248692
1597 Ga0207648_10014783
1598 Ga0207648_10174383
1599 Ga0207648_10422751
1600 Ga0207676_10075999
1601 Ga0207676_10084497
1602 Ga0207676_10229351
1603 Ga0207674_10061387
1604 Ga0207674_10063806
1605 Ga0207674_10216842
1606 Ga0207674_10355020
1607 Ga0207674_10930427
1608 Ga0207675_100014391
1609 Ga0207675_100030014
1610 Ga0207675_100054223
1611 Ga0207675_100216099
1612 Ga0207675_100796800
1613 Ga0207683_10073916
1614 Ga0207683_10102860
1615 Ga0207683_10234582
1616 Ga0207698_10145145
1617 Ga0207698_10155788
1618 Ga0207698_10823898
1619 Ga0207428_10054987
1620 Ga0207428_10131812
1621 Ga0207428_10342116
1622 Ga0207428_10889352
1623 Ga0268266_10031677
1624 Ga0268266_10382601
1625 Ga0268265_10362451
1626 Ga0268264_10242639
1627 Ga0268264_10742789
1628 Ga0265326_10000006
1629 Ga0265319_1003953
1630 Ga0265334_10000245
1631 Ga0265318_10100873
1632 Ga0265336_10016363
1633 Ga0265338_10011026
1634 Ga0265324_10002704
1635 Ga0265320_10088417
1636 Ga0307408_100199276
1637 Ga0307408_100310745
1638 Ga0307408_100806788
1639 Ga0307405_10095359
1640 Ga0307405_10456430
1641 Ga0307405_11457348
1642 Ga0307413_10356752
1643 Ga0307413_10576181
1644 Ga0307413_10868687
1645 Ga0307413_11005401
1646 Ga0307413_11068407
1647 Ga0307410_10041390
1648 Ga0307410_10071388
1649 Ga0307410_10244092
1650 Ga0307410_10384855
1651 Ga0307406_10021780
1652 Ga0307406_10079939
1653 Ga0307406_10281673
1654 Ga0307406_10826696
1655 Ga0307407_10037093
1656 Ga0307407_10043214
1657 Ga0307407_10046307
1658 Ga0307407_10384481
1659 Ga0307412_10904481
1660 Ga0307409_100014990
1661 Ga0307409_100307641
1662 Ga0307409_100526792
1663 Ga0307409_100672142
1664 Ga0307409_100814137
1665 Ga0307409_101076973
1666 Ga0307409_101108743
1667 Ga0307416_100029352
1668 Ga0307416_100035150
1669 Ga0307416_100131603
1670 Ga0307416_100146977
1671 Ga0307416_100159027
1672 Ga0307416_100559456
1673 Ga0307416_100744761
1674 Ga0307416_100795414
1675 Ga0307414_10062801
1676 Ga0307414_10300875
1677 Ga0307414_10625639
1678 Ga0307411_10202059
1679 Ga0307411_10361341
1680 Ga0307411_10574001
1681 Ga0307415_100072104
1682 Ga0307415_100091393
1683 Ga0307415_100131596
1684 Ga0307415_100133935
1685 Ga0307415_100412879
1686 Ga0307415_100542898
1687 Ga0307415_100939352
1688 Ga0373930_0112005
1689 Ga0373938_0126502
1690 Ga0373928_0152932
1691 Ga0373928_0175202
1692 Ga0373944_0346289
1693 Ga0373932_0030809
1694 Ga0373939_0156575
1695 Ga0373941_0003041
1696 Ga0373960_0025422
1697 Ga0373960_0054765
1698 Ga0373946_0149088
1699 Ga0373946_0436230
1700 Ga0373942_0146895
1701 Ga0373961_0149140
1702 Ga0373962_0205989
1703 Ga0373931_0592583
1704 Ga0373935_0487104
1705 Ga0373927_0810470
1706 Ga0395899_0591481
1707 Ga0395899_0737358
1708 Ga0395899_0830544
1709 Ga0395900_0104932
1710 Ga0395900_0226672
1711 Ga0395900_0278555
1712 Ga0395900_0656794
1713 Ga0395900_0933313
1714 Ga0395900_1274231
1715 Ga0395898_0069317
1716 Ga0395898_0240819
1717 Ga0395898_0245845
1718 Ga0395898_0338759
1719 Ga0395898_0388855
1720 Ga0395898_1062362
1721 Ga0395898_1544612
1722 Ga0395898_1649867
1723 Ga0395905_0047391
1724 Ga0395905_0093024
1725 Ga0395905_0587158
1726 Ga0395905_0618737
1727 Ga0395905_0827579
1728 Ga0395905_1072710
1729 Ga0436364_1489748
1730 Ga0395901_0110486
1731 Ga0395901_0121241
1732 Ga0395901_0229973
1733 Ga0395901_0298699
1734 Ga0395901_0344459
1735 Ga0395901_0435964
1736 Ga0395901_0443081
1737 Ga0395901_0607634
1738 Ga0395901_0673550
1739 Ga0395901_0679609
1740 Ga0395901_0703900
1741 Ga0395901_1048296
1742 Ga0395901_1386336
1743 Ga0436365_0226686
1744 Ga0436365_0668736
1745 Ga0436360_0805047
1746 Ga0436363_0590901
1747 Ga0436362_0882791
1748 Ga0451789_0360271
1749 Ga0451791_0083592
1750 Ga0451795_1445687
1751 Ga0451802_1632828
1752 Ga0451837_1641471
1753 Ga0451853_0431845
1754 Ga0451853_2408925
1755 Ga0451853_2555167
1756 Ga0439455_0224701
1757 Ga0439463_048564
1758 Ga0439460_0054787
1759 Ga0439460_0206293
1760 Ga0450893_0031157
1761 Ga0450901_031704
1762 Ga0466972_0274317
1763 Ga0466965_0171154
1764 Ga0466965_0185347
1765 Ga0466965_0313157
1766 Ga0466966_0090781
1767 Ga0466961_0048728
1768 Ga0466961_0802134
1769 Ga0466963_0027649
1770 Ga0466963_0067837
1771 Ga0466963_0102367
1772 Ga0466963_0208788
1773 Ga0466963_1030688
1774 Ga0466964_0052318
1775 Ga0466964_0573177
1776 Ga0466971_0056179
1777 Ga0466971_0168774
1778 Ga0466968_0173984
1779 Ga0466970_0126872
1780 Ga0466970_0215606
1781 Ga0466960_0000153
1782 Ga0466960_0113381
1783 Ga0466960_0139960
1784 Ga0466960_0146010
1785 Ga0466960_0258893
1786 Ga0466960_0347951
1787 Ga0466960_0813396
1788 Ga0466960_0839732
1789 Ga0466959_0048882
1790 Ga0466959_0208828
1791 Ga0466959_0309101
1792 Ga0466958_0080257
1793 Ga0466958_0351392
1794 Ga0466958_0506396
1795 Ga0466967_0010593
1796 Ga0466967_0055102
1797 Ga0466967_0059076
1798 Ga0466967_0085023
1799 Ga0466967_0089864
1800 Ga0466967_0100274
1801 Ga0466967_0141249
1802 Ga0466967_0148499
1803 Ga0466967_0159932
1804 Ga0466967_0165106
1805 Ga0466967_0181651
1806 Ga0466967_0263371
1807 Ga0466967_0374364
1808 Ga0466967_0394301
1809 Ga0466967_0588784
1810 Ga0466967_0683196
1811 Ga0466967_0711191
1812 Ga0466967_0772776
1813 Ga0466967_0851012
1814 Ga0466967_1042973
1815 Ga0466967_1045067
1816 Ga0466967_1112944
1817 Ga0466967_1242194
1818 Ga0466967_1371181
1819 Ga0466967_1552669
1820 Ga0466967_1602422
1821 Ga0466967_1764797
1822 Ga0495603_0137714
1823 Ga0495590_0216625
1824 Ga0495629_0806338
1825 Ga0495641_0000718
1826 Ga0495641_0034067
1827 Ga0495580_0505283
1828 Ga0495582_0297112
1829 Ga0495605_0191583
1830 Ga0495639_0143228
1831 Ga0495639_0421779
1832 Ga0495584_0356804
1833 Ga0495584_0656070
1834 Ga0495594_0464234
1835 Ga0495596_0019659
1836 Ga0495596_0034987
1837 Ga0495596_0204124
1838 Ga0495596_0358658
1839 Ga0495616_0131594
1840 Ga0495630_0100285
1841 Ga0495630_0157424
1842 Ga0495631_0053610
1843 Ga0495631_0337679
1844 Ga0495637_0084360
1845 Ga0495644_0008525
1846 Ga0495644_0125366
1847 Ga0495644_0155601
1848 Ga0495663_0110879
1849 Ga0495665_0196985
1850 Ga0495598_0273553
1851 Ga0495609_0260415
1852 Ga0495597_0146841
1853 Ga0495656_0014794
1854 Ga0495656_0038831
1855 Ga0495656_0175576
1856 Ga0495668_0305786
1857 Ga0495668_0375978
1858 Ga0495634_0096592
1859 Ga0495634_0354715
1860 Ga0495661_0320349
1861 Ga0495588_0283026
1862 Ga0495657_0121794
1863 Ga0495657_0560498
1864 Ga0495658_0107790
1865 Ga0495658_0112709
1866 Ga0495669_0479201
1867 Ga0495670_0189929
1868 Ga0495589_0214168
1869 Ga0495672_0006135
1870 Ga0495672_0078865
1871 Ga0495676_0448135
1872 Ga0495680_0131447
1873 Ga0495677_0142628
1874 Ga0495686_0000020
1875 Ga0495686_0042903
1876 Ga0496100_0005856
1877 Ga0496100_0016521
1878 Ga0496100_0237625
1879 Ga0496100_0301210
1880 Ga0496100_1192937
1881 Ga0496101_0019765
1882 Ga0496101_0040882
1883 Ga0496101_0133499
1884 Ga0496101_0137927
1885 Ga0496101_0217221
1886 Ga0496101_0266035
1887 Ga0496101_0441989
1888 Ga0496101_0734010
1889 Ga0496101_0834370
1890 Ga0496101_1356280
1891 Ga0496102_0059664
1892 Ga0496102_0111078
1893 Ga0496102_0212419
1894 Ga0496102_0227926
1895 Ga0496103_0217426
1896 Ga0496103_0373252
1897 Ga0496103_0442450
1898 Ga0496104_0046426
1899 Ga0496104_0056585
1900 Ga0496104_0103096
1901 Ga0496104_0528731
1902 Ga0496104_0791084
1903 Ga0496104_0970716
1904 Ga0496105_0003850
1905 Ga0496105_0050885
1906 Ga0496105_0097377
1907 Ga0496105_0441723
1908 Ga0496105_1349333
1909 Ga0496106_0095354
1910 Ga0496106_0167494
1911 Ga0496106_0172353
1912 Ga0496106_0183144
1913 Ga0496106_0204283
1914 Ga0496106_0310379
1915 Ga0496106_0583920
1916 Ga0496106_0658970
1917 Ga0496106_1226644
1918 Ga0496107_0108764
1919 Ga0496107_0120682
1920 Ga0496107_0124634
1921 Ga0496107_0166610
1922 Ga0496107_0300758
1923 Ga0496107_0516555
1924 Ga0496107_0783680
1925 Ga0496108_0028255
1926 Ga0496108_0171813
1927 Ga0496108_0191106
1928 Ga0496108_0242395
1929 Ga0496108_0376791
1930 Ga0496108_0399495
1931 Ga0496108_0517433
1932 Ga0496108_1276281
1933 Ga0496109_0007531
1934 Ga0496109_0014197
1935 Ga0496109_0060210
1936 Ga0496109_0180512
1937 Ga0496109_0183449
1938 Ga0496109_0233815
1939 Ga0496109_0278118
1940 Ga0496109_0313599
1941 Ga0496109_0416680
1942 Ga0496109_0446059
1943 Ga0496109_0502592
1944 Ga0496109_0946411
1945 Ga0496109_1476720
1946 Ga0496110_0062947
1947 Ga0496110_0132373
1948 Ga0496110_0153411
1949 Ga0496110_0252100
1950 Ga0496110_0318107
1951 Ga0496110_0515275
1952 Ga0496110_1107710
1953 Ga0496111_0175832
1954 Ga0496111_0346687
1955 Ga0496111_0400586
1956 Ga0496111_0585906
1957 Ga0496111_0697035
1958 Ga0496111_0720130
1959 Ga0496111_0770521
1960 Ga0496111_1145068
1961 Ga0496111_1146969
1962 Ga0496112_0017261
1963 Ga0496112_0031376
1964 Ga0496112_0056139
1965 Ga0496112_0084982
1966 Ga0496112_0097829
1967 Ga0496112_0112292
1968 Ga0496112_0347406
1969 Ga0496112_0403027
1970 Ga0496112_0489218
1971 Ga0496112_0537568
1972 Ga0496112_0688578
1973 Ga0496112_0812623
1974 Ga0496112_0865354
1975 Ga0496113_0031787
1976 Ga0496113_0073617
1977 Ga0496113_0099312
1978 Ga0496113_0113780
1979 Ga0496113_0244170
1980 Ga0496113_0279079
1981 Ga0496113_1022495
1982 Ga0496114_0214849
1983 Ga0496114_0338885
1984 Ga0496114_0580905
1985 Ga0496114_0843578
1986 Ga0496115_0085254
1987 Ga0496117_0488623
1988 Ga0496119_0324187
1989 Ga0496121_0024549
1990 Ga0496121_0091033
1991 Ga0496124_0153174
1992 Ga0496124_0191425
1993 Ga0496125_0618432
1994 Ga0501031_0050881
1995 Ga0501031_0064483
1996 Ga0501032_0161252
1997 Ga0501033_0064178
1998 Ga0501034_0299292
1999 Ga0501036_0098487
2000 Ga0501037_0044331
2001 Ga0501037_0317031
2002 Ga0501038_0064421
2003 Ga0501039_0006815
2004 Ga0501041_0128400
2005 Ga0501041_0201261
2006 Ga0501042_0059981
2007 Ga0501042_0126733
2008 Ga0501042_0529938
2009 Ga0501043_0017649
2010 Ga0501043_0203530
2011 Ga0501046_0029028
2012 Ga0501046_0735960
2013 Ga0501047_0188083
2014 Ga0501048_0117757
2015 Ga0501048_0146166
2016 Ga0501067_0089089
2017 Ga0501067_0462542
2018 Ga0501068_0205443
2019 Ga0501069_0030726
2020 Ga0501069_0454118
2021 Ga0501069_0523137
2022 Ga0501069_0712365
2023 Ga0501070_0139909
2024 Ga0501071_0384696
2025 Ga0501071_1174747
2026 Ga0501072_0125940
2027 Ga0501074_0039394
2028 Ga0501074_0057969
2029 Ga0501075_0085499
2030 Ga0501075_0272822
2031 Ga0501076_0089544
2032 Ga0501076_0159018
2033 Ga0501077_0228544
2034 Ga0501217_067240
2035 Ga0501079_0026126
2036 Ga0501080_0035685
2037 Ga0501080_0053581
2038 Ga0501080_0714673
2039 Ga0501081_0468748
2040 Ga0501083_0143219
2041 Ga0501083_0191672
2042 Ga0501035_0093610
2043 Ga0501044_0250907
2044 Ga0501045_0455490
2045 nmdc:mga03n38_764928_c1
2046 nmdc:mga0yw44_586656_c1
2047 nmdc:mga0yw44_793758_c1
2048 nmdc:mga05p37_1042252_c1
2049 nmdc:mga05p37_1103539_c1
2050 nmdc:mga05p37_255723_c1
2051 nmdc:mga05p37_395820_c1
2052 nmdc:mga05p37_4922_c1
2053 nmdc:mga05p37_534995_c1
2054 nmdc:mga05p37_599007_c1
2055 nmdc:mga05p37_677138_c1
2056 nmdc:mga05p37_71078_c1
2057 nmdc:mga09592_14891_c1
2058 nmdc:mga09592_1671928_c1
2059 nmdc:mga09592_188182_c1
2060 nmdc:mga09592_770579_c1
2061 nmdc:mga09592_80361_c1
2062 nmdc:mga0qj67_64751_c1
2063 nmdc:mga0qj67_9191_c1
2064 nmdc:mga0qj67_99555_c1
2065 nmdc:mga06r32_1493479_c1
2066 nmdc:mga06r32_1528221_c1
2067 nmdc:mga06r32_362346_c1
2068 nmdc:mga06r32_444047_c1
2069 nmdc:mga06r32_719242_c1
2070 nmdc:mga06r32_86123_c1
2071 nmdc:mga06r32_99604_c1
2072 nmdc:mga08y16_1311683_c1
2073 nmdc:mga08y16_151757_c1
2074 nmdc:mga08y16_192770_c1
2075 nmdc:mga08y16_241550_c1
2076 nmdc:mga08y16_343013_c1
2077 nmdc:mga08y16_412792_c1
2078 nmdc:mga08y16_468919_c1
2079 nmdc:mga08y16_67035_c1
2080 nmdc:mga08y16_734100_c1
2081 nmdc:mga08y16_79157_c1
2082 nmdc:mga08y16_98367_c1
2083 nmdc:mga0n895_425484_c1
2084 nmdc:mga0n895_488196_c1
2085 nmdc:mga0n895_539946_c1
2086 nmdc:mga0n895_613336_c1
2087 nmdc:mga0n895_949928_c1
2088 nmdc:mga0rr50_146331_c1
2089 nmdc:mga0rr50_147011_c1
2090 nmdc:mga0rr50_454925_c1
2091 nmdc:mga0rr50_575502_c1
2092 nmdc:mga08x19_34334_c1
2093 nmdc:mga08x19_411369_c1
2094 nmdc:mga08x19_978819_c1
2095 nmdc:mga0a205_1268634_c1
2096 nmdc:mga0a205_383720_c1
2097 nmdc:mga0a205_582310_c1
2098 Ga0495601_0382694
2099 Ga0495655_0218274
2100 Ga0495619_0156825
2101 Ga0500572_255235
2102 Ga0500628_012956
2103 Ga0500628_122671
2104 Ga0500616_0036915
2105 Ga0500599_005317
2106 Ga0501084_0742587
2107 Ga0501082_0229510
2108 Ga0501082_0442825
2109 Ga0501082_0460447
2110 Ga0466962_0030424
2111 Ga0466962_0146541
2112 Ga0466962_0222918
2113 Ga0466962_0755888
2114 Ga0530510_0302932
2115 Ga0530510_1169650
2116 Ga0530510_1419624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xam-assembly1.cif.gz_V mycobacterium smegmatis 50s ribosomal subunit from stationary phase of growth 0.7694 115 138
7wtu-assembly1.cif.gz_Z cryo-em structure of a human pre-40s ribosomal subunit - state rrp12-a1 (without ck1) 0.6933 96 130
8ovr-assembly1.cif.gz_A clostridium perfringens chitinase cp56_3454 apo form 0.5976 104 134
4v6i-assembly1.cif.gz_AV localization of the small subunit ribosomal proteins into a 6.1 a cryo-em map of saccharomyces cerevisiae translating 80s ribosome 0.506 96 130
5i0p-assembly1.cif.gz_A crystal structure of a beta-lactamase domain protein from burkholderia ambifaria 0.4981 69 130
ID Description Score Start End Superfamily
af_Q18607_287_334_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.6956 101 130 3.20.20.80
af_O08540_72_113_2.20.25.590 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.673 112 142 2.20.25.590
af_Q4D3Q0_236_286_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6486 99 129 1.10.10.10
1s3jB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.616 100 126 1.10.10.10
af_I1NID7_1_63_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5941 76 130 1.10.10.10
ID Description Score Start End GO Terms
AF-D3F2E3-F1-model_v4 Uncharacterized protein 0.9149 4 154
AF-A0A1Q6XAZ9-F1-model_v4 Uncharacterized protein 0.9019 11 120
AF-A0A538EFX8-F1-model_v4 Uncharacterized protein 0.8989 1 154
AF-D3F2E3-F1-model_v4 Uncharacterized protein 0.8916 4 154
AF-A0A7V8YUX2-F1-model_v4 Uncharacterized protein 0.8893 11 139

Map