F489196
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1057 | 374 | 2114 | 372 |
Family's Representative Sequence
| Representative Sequence | 3300005293|Ga0065715_10094658|Ga0065715_100946582 |
| Length | 435 |
| Sequence | MISAYSMALTIAQVSKPLASRLYEATFFIRVRNWLFRISVMQMRSTMTSLAQRVSGWFAFHTLAKLIHTLARFGANNERRTASSLARALVICISLLAYSIPGHSQSAPGFLFNDSHFHLTNYIQEGIDIHDFLKIMGNKTGRVALFGIPLQQQWSYRVDGNRAPTYYLNSDAPLYYYSFTDAWIATAYKSLTKEEQARFDPMITGFNPTDMYAADHIRRVLKTFPGVFTGIGEFSIHKEFVSAKISGEVASLQDPALDRLIDFASEVGLVILIHNDVDVPFAKPGAQPAYAKEIKALFIRHPNAAFIWAHIGVGRIIRPIKEQAAIIENVINDPQLSHVYFDISWDEVAKYVVATPESTKNAAALVNRHPDRFLFGTDEVAPANQENYLRVYNQYEPLWKLLTPEASEKVRKGNYERIFDEARRKVRSWEAANLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 201 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 212 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 213 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 214 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 215 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 219 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 222 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 234 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 243 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 246 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 247 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 248 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 303 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 304 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 305 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 306 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 327 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 328 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 329 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 330 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 331 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 332 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 335 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 336 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 337 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 338 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 340 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 363 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 364 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 365 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 367 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 369 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 373 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 374 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.43 |
| Metatranscriptomes | 0.38 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.8 |
| Nodule | 0 |
| Rhizoplane | 1.61 |
| Rhizosphere | 95.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10094658 | 3300005293 | Unclassified | 4273 |
| 2 | JGI24751J29686_10000015 | 3300002459 | Bacteria | 112804 |
| 3 | rootL2_10182038 | 3300003322 | Bacteria | 4128 |
| 4 | rootH1_10259089 | 3300003323 | Bacteria | 3765 |
| 5 | Ga0065712_10013167 | 3300005290 | Unclassified | 3144 |
| 6 | Ga0065712_10070589 | 3300005290 | Bacteria | 5873 |
| 7 | Ga0065712_10125559 | 3300005290 | Bacteria | 1612 |
| 8 | Ga0065715_10003301 | 3300005293 | Bacteria | 5051 |
| 9 | Ga0065715_10004592 | 3300005293 | Unclassified | 4130 |
| 10 | Ga0065715_10034501 | 3300005293 | Bacteria | 1250 |
| 11 | Ga0065715_10101661 | 3300005293 | Bacteria | 3125 |
| 12 | Ga0065715_10103801 | 3300005293 | Bacteria | 3007 |
| 13 | Ga0065707_10089372 | 3300005295 | Bacteria | 4388 |
| 14 | Ga0065707_10120543 | 3300005295 | Bacteria | 2132 |
| 15 | Ga0070658_10057533 | 3300005327 | Bacteria | 3163 |
| 16 | Ga0070658_10124840 | 3300005327 | Bacteria | 2142 |
| 17 | Ga0070683_100002959 | 3300005329 | Bacteria | 13616 |
| 18 | Ga0070683_100004761 | 3300005329 | Bacteria | 11230 |
| 19 | Ga0070683_100021747 | 3300005329 | Bacteria | 5727 |
| 20 | Ga0070683_100025038 | 3300005329 | Bacteria | 5353 |
| 21 | Ga0070683_100344928 | 3300005329 | Bacteria | 1418 |
| 22 | Ga0070683_100391653 | 3300005329 | Bacteria | 1325 |
| 23 | Ga0070690_100011429 | 3300005330 | Bacteria | 5192 |
| 24 | Ga0070690_100132358 | 3300005330 | Bacteria | 1685 |
| 25 | Ga0070690_100202566 | 3300005330 | Unclassified | 1382 |
| 26 | Ga0070670_100000182 | 3300005331 | Bacteria | 57532 |
| 27 | Ga0070670_100001123 | 3300005331 | Bacteria | 21292 |
| 28 | Ga0070670_100011025 | 3300005331 | Bacteria | 7722 |
| 29 | Ga0070670_100012332 | 3300005331 | Bacteria | 7312 |
| 30 | Ga0070670_100013951 | 3300005331 | Bacteria | 6891 |
| 31 | Ga0070670_100048108 | 3300005331 | Unclassified | 3670 |
| 32 | Ga0070670_100091754 | 3300005331 | Bacteria | 2611 |
| 33 | Ga0070670_100245826 | 3300005331 | Bacteria | 1558 |
| 34 | Ga0068869_100004393 | 3300005334 | Bacteria | 8757 |
| 35 | Ga0068869_100023447 | 3300005334 | Unclassified | 4263 |
| 36 | Ga0068869_100060827 | 3300005334 | Unclassified | 2769 |
| 37 | Ga0070666_10074361 | 3300005335 | Bacteria | 2316 |
| 38 | Ga0070666_10157086 | 3300005335 | Bacteria | 1589 |
| 39 | Ga0070680_100012420 | 3300005336 | Bacteria | 6618 |
| 40 | Ga0070680_100069253 | 3300005336 | Bacteria | 2897 |
| 41 | Ga0070682_100000598 | 3300005337 | Bacteria | 21970 |
| 42 | Ga0070682_100015142 | 3300005337 | Bacteria | 4465 |
| 43 | Ga0070682_100095864 | 3300005337 | Unclassified | 1949 |
| 44 | Ga0070682_100159834 | 3300005337 | Bacteria | 1555 |
| 45 | Ga0068868_100004929 | 3300005338 | Bacteria | 9376 |
| 46 | Ga0068868_100010013 | 3300005338 | Bacteria | 6850 |
| 47 | Ga0070660_100009194 | 3300005339 | Bacteria | 6943 |
| 48 | Ga0070689_100007951 | 3300005340 | Bacteria | 7443 |
| 49 | Ga0070689_100030062 | 3300005340 | Bacteria | 4120 |
| 50 | Ga0070689_100047396 | 3300005340 | Bacteria | 3314 |
| 51 | Ga0070689_100065353 | 3300005340 | Unclassified | 2832 |
| 52 | Ga0070687_100040624 | 3300005343 | Bacteria | 2345 |
| 53 | Ga0070661_100001468 | 3300005344 | Bacteria | 16380 |
| 54 | Ga0070661_100001891 | 3300005344 | Bacteria | 14504 |
| 55 | Ga0070661_100024665 | 3300005344 | Bacteria | 4314 |
| 56 | Ga0070661_100085329 | 3300005344 | Bacteria | 2333 |
| 57 | Ga0070661_100124321 | 3300005344 | Bacteria | 1934 |
| 58 | Ga0070661_100234593 | 3300005344 | Bacteria | 1411 |
| 59 | Ga0070692_10042712 | 3300005345 | Bacteria | 2329 |
| 60 | Ga0070668_100001090 | 3300005347 | Bacteria | 19137 |
| 61 | Ga0070668_100008848 | 3300005347 | Bacteria | 7474 |
| 62 | Ga0070669_100009064 | 3300005353 | Bacteria | 7095 |
| 63 | Ga0070669_100017758 | 3300005353 | Bacteria | 5076 |
| 64 | Ga0070675_100002309 | 3300005354 | Bacteria | 14167 |
| 65 | Ga0070675_100173059 | 3300005354 | Bacteria | 1863 |
| 66 | Ga0070671_100055942 | 3300005355 | Bacteria | 3282 |
| 67 | Ga0070671_100093949 | 3300005355 | Unclassified | 2513 |
| 68 | Ga0070674_100021525 | 3300005356 | Bacteria | 4142 |
| 69 | Ga0070674_100064948 | 3300005356 | Bacteria | 2560 |
| 70 | Ga0070673_100045666 | 3300005364 | Unclassified | 3398 |
| 71 | Ga0070673_100085651 | 3300005364 | Bacteria | 2566 |
| 72 | Ga0070673_100186758 | 3300005364 | Unclassified | 1778 |
| 73 | Ga0070688_100004893 | 3300005365 | Bacteria | 7010 |
| 74 | Ga0070688_100067992 | 3300005365 | Bacteria | 2271 |
| 75 | Ga0070688_100168000 | 3300005365 | Unclassified | 1511 |
| 76 | Ga0070659_100003330 | 3300005366 | Bacteria | 11435 |
| 77 | Ga0070659_100035368 | 3300005366 | Bacteria | 3890 |
| 78 | Ga0070667_100058538 | 3300005367 | Bacteria | 3258 |
| 79 | Ga0070667_100060040 | 3300005367 | Unclassified | 3218 |
| 80 | Ga0070667_100077286 | 3300005367 | Bacteria | 2842 |
| 81 | Ga0070667_100079404 | 3300005367 | Bacteria | 2805 |
| 82 | Ga0070667_100202431 | 3300005367 | Bacteria | 1762 |
| 83 | Ga0070667_100273658 | 3300005367 | Bacteria | 1515 |
| 84 | Ga0070703_10017976 | 3300005406 | Bacteria | 2040 |
| 85 | Ga0070709_10110483 | 3300005434 | Bacteria | 1847 |
| 86 | Ga0070713_100000139 | 3300005436 | Bacteria | 48014 |
| 87 | Ga0070713_100000195 | 3300005436 | Bacteria | 40439 |
| 88 | Ga0070713_100006295 | 3300005436 | Bacteria | 8220 |
| 89 | Ga0070713_100041042 | 3300005436 | Unclassified | 3767 |
| 90 | Ga0070713_100107659 | 3300005436 | Bacteria | 2425 |
| 91 | Ga0070713_100168371 | 3300005436 | Bacteria | 1961 |
| 92 | Ga0070713_100302700 | 3300005436 | Bacteria | 1472 |
| 93 | Ga0070710_10004003 | 3300005437 | Bacteria | 6987 |
| 94 | Ga0070710_10079557 | 3300005437 | Bacteria | 1910 |
| 95 | Ga0070701_10053532 | 3300005438 | Unclassified | 2101 |
| 96 | Ga0070711_100000480 | 3300005439 | Bacteria | 20805 |
| 97 | Ga0070711_100002670 | 3300005439 | Bacteria | 10230 |
| 98 | Ga0070711_100014703 | 3300005439 | Bacteria | 4938 |
| 99 | Ga0070711_100018924 | 3300005439 | Bacteria | 4407 |
| 100 | Ga0070711_100029891 | 3300005439 | Bacteria | 3601 |
| 101 | Ga0070711_100042545 | 3300005439 | Bacteria | 3071 |
| 102 | Ga0070711_100077605 | 3300005439 | Bacteria | 2358 |
| 103 | Ga0070711_100096386 | 3300005439 | Bacteria | 2143 |
| 104 | Ga0070705_100008155 | 3300005440 | Bacteria | 5179 |
| 105 | Ga0070705_100021754 | 3300005440 | Bacteria | 3416 |
| 106 | Ga0070705_100110709 | 3300005440 | Bacteria | 1754 |
| 107 | Ga0070700_100058802 | 3300005441 | Bacteria | 2417 |
| 108 | Ga0070694_100004717 | 3300005444 | Bacteria | 8211 |
| 109 | Ga0070694_100015432 | 3300005444 | Bacteria | 4799 |
| 110 | Ga0070694_100030672 | 3300005444 | Unclassified | 3519 |
| 111 | Ga0070663_100053892 | 3300005455 | Bacteria | 2873 |
| 112 | Ga0070678_100009099 | 3300005456 | Bacteria | 5992 |
| 113 | Ga0070678_100073192 | 3300005456 | Bacteria | 2571 |
| 114 | Ga0070678_100168193 | 3300005456 | Bacteria | 1783 |
| 115 | Ga0070662_100186795 | 3300005457 | Bacteria | 1636 |
| 116 | Ga0070681_10000906 | 3300005458 | Bacteria | 25060 |
| 117 | Ga0070681_10012396 | 3300005458 | Bacteria | 8455 |
| 118 | Ga0070681_10016309 | 3300005458 | Bacteria | 7413 |
| 119 | Ga0068867_100025185 | 3300005459 | Bacteria | 4268 |
| 120 | Ga0068867_100044703 | 3300005459 | Bacteria | 3245 |
| 121 | Ga0070685_10003810 | 3300005466 | Bacteria | 7629 |
| 122 | Ga0070685_10007093 | 3300005466 | Bacteria | 5724 |
| 123 | Ga0070698_100016197 | 3300005471 | Bacteria | 7870 |
| 124 | Ga0070698_100050794 | 3300005471 | Bacteria | 4225 |
| 125 | Ga0070698_100093913 | 3300005471 | Unclassified | 2979 |
| 126 | Ga0070679_100004172 | 3300005530 | Bacteria | 13320 |
| 127 | Ga0070679_100010035 | 3300005530 | Bacteria | 8969 |
| 128 | Ga0070679_100031055 | 3300005530 | Bacteria | 5277 |
| 129 | Ga0070679_100056879 | 3300005530 | Unclassified | 3898 |
| 130 | Ga0070684_100002611 | 3300005535 | Bacteria | 13310 |
| 131 | Ga0070684_100044319 | 3300005535 | Bacteria | 3847 |
| 132 | Ga0070684_100081137 | 3300005535 | Bacteria | 2870 |
| 133 | Ga0070684_100138626 | 3300005535 | Bacteria | 2199 |
| 134 | Ga0070684_100317788 | 3300005535 | Bacteria | 1430 |
| 135 | Ga0070684_100394190 | 3300005535 | Bacteria | 1276 |
| 136 | Ga0070697_100048133 | 3300005536 | Bacteria | 3457 |
| 137 | Ga0070697_100078134 | 3300005536 | Bacteria | 2723 |
| 138 | Ga0068853_100020227 | 3300005539 | Bacteria | 5533 |
| 139 | Ga0068853_100022271 | 3300005539 | Bacteria | 5291 |
| 140 | Ga0068853_100025360 | 3300005539 | Bacteria | 4974 |
| 141 | Ga0068853_100112226 | 3300005539 | Bacteria | 2423 |
| 142 | Ga0068853_100118947 | 3300005539 | Bacteria | 2354 |
| 143 | Ga0070672_100131822 | 3300005543 | Bacteria | 2055 |
| 144 | Ga0070686_100000388 | 3300005544 | Bacteria | 28085 |
| 145 | Ga0070686_100056883 | 3300005544 | Bacteria | 2510 |
| 146 | Ga0070686_100077025 | 3300005544 | Bacteria | 2197 |
| 147 | Ga0070686_100077968 | 3300005544 | Unclassified | 2186 |
| 148 | Ga0070686_100235314 | 3300005544 | Bacteria | 1331 |
| 149 | Ga0070695_100000002 | 3300005545 | Bacteria | 128335 |
| 150 | Ga0070695_100030916 | 3300005545 | Unclassified | 3335 |
| 151 | Ga0070695_100090738 | 3300005545 | Bacteria | 2039 |
| 152 | Ga0070695_100102653 | 3300005545 | Bacteria | 1928 |
| 153 | Ga0070695_100162978 | 3300005545 | Unclassified | 1566 |
| 154 | Ga0070696_100000679 | 3300005546 | Bacteria | 21808 |
| 155 | Ga0070696_100043562 | 3300005546 | Bacteria | 3105 |
| 156 | Ga0070693_100000836 | 3300005547 | Bacteria | 13664 |
| 157 | Ga0070693_100006343 | 3300005547 | Bacteria | 5733 |
| 158 | Ga0070693_100007767 | 3300005547 | Bacteria | 5258 |
| 159 | Ga0070693_100075398 | 3300005547 | Unclassified | 1997 |
| 160 | Ga0070665_100000329 | 3300005548 | Bacteria | 73128 |
| 161 | Ga0070665_100000489 | 3300005548 | Bacteria | 56677 |
| 162 | Ga0070665_100117868 | 3300005548 | Bacteria | 2658 |
| 163 | Ga0070665_100213410 | 3300005548 | Bacteria | 1931 |
| 164 | Ga0070704_100140136 | 3300005549 | Bacteria | 1887 |
| 165 | Ga0070704_100156605 | 3300005549 | Bacteria | 1797 |
| 166 | Ga0068855_100009532 | 3300005563 | Bacteria | 11726 |
| 167 | Ga0068855_100099680 | 3300005563 | Bacteria | 3346 |
| 168 | Ga0068855_100248827 | 3300005563 | Unclassified | 1983 |
| 169 | Ga0070664_100002629 | 3300005564 | Bacteria | 14481 |
| 170 | Ga0070664_100004228 | 3300005564 | Bacteria | 11548 |
| 171 | Ga0070664_100007304 | 3300005564 | Bacteria | 8906 |
| 172 | Ga0070664_100012902 | 3300005564 | Bacteria | 6799 |
| 173 | Ga0070664_100029976 | 3300005564 | Bacteria | 4537 |
| 174 | Ga0070664_100031598 | 3300005564 | Bacteria | 4425 |
| 175 | Ga0070664_100062279 | 3300005564 | Bacteria | 3180 |
| 176 | Ga0070664_100075867 | 3300005564 | Bacteria | 2888 |
| 177 | Ga0070664_100100942 | 3300005564 | Bacteria | 2509 |
| 178 | Ga0068857_100003561 | 3300005577 | Bacteria | 13027 |
| 179 | Ga0068857_100003873 | 3300005577 | Bacteria | 12601 |
| 180 | Ga0068857_100026892 | 3300005577 | Bacteria | 5073 |
| 181 | Ga0068857_100211873 | 3300005577 | Bacteria | 1768 |
| 182 | Ga0068854_100018328 | 3300005578 | Bacteria | 4699 |
| 183 | Ga0068854_100024998 | 3300005578 | Unclassified | 4097 |
| 184 | Ga0068854_100073704 | 3300005578 | Unclassified | 2503 |
| 185 | Ga0068856_100001478 | 3300005614 | Bacteria | 24620 |
| 186 | Ga0068856_100001630 | 3300005614 | Bacteria | 23504 |
| 187 | Ga0068856_100005411 | 3300005614 | Bacteria | 12584 |
| 188 | Ga0068856_100111307 | 3300005614 | Unclassified | 2736 |
| 189 | Ga0070702_100000035 | 3300005615 | Bacteria | 36633 |
| 190 | Ga0070702_100000429 | 3300005615 | Bacteria | 14936 |
| 191 | Ga0070702_100000989 | 3300005615 | Bacteria | 11219 |
| 192 | Ga0070702_100009248 | 3300005615 | Bacteria | 4816 |
| 193 | Ga0070702_100146969 | 3300005615 | Unclassified | 1508 |
| 194 | Ga0068852_100094838 | 3300005616 | Bacteria | 2678 |
| 195 | Ga0068852_100250210 | 3300005616 | Bacteria | 1698 |
| 196 | Ga0068852_100297031 | 3300005616 | Unclassified | 1562 |
| 197 | Ga0068859_100002169 | 3300005617 | Bacteria | 19950 |
| 198 | Ga0068859_100011456 | 3300005617 | Bacteria | 8915 |
| 199 | Ga0068859_100017021 | 3300005617 | Bacteria | 7298 |
| 200 | Ga0068859_100018429 | 3300005617 | Bacteria | 7017 |
| 201 | Ga0068859_100022495 | 3300005617 | Bacteria | 6321 |
| 202 | Ga0068859_100028305 | 3300005617 | Bacteria | 5617 |
| 203 | Ga0068859_100037489 | 3300005617 | Unclassified | 4865 |
| 204 | Ga0068859_100038749 | 3300005617 | Bacteria | 4781 |
| 205 | Ga0068859_100074042 | 3300005617 | Bacteria | 3444 |
| 206 | Ga0068859_100106222 | 3300005617 | Bacteria | 2867 |
| 207 | Ga0068859_100188463 | 3300005617 | Bacteria | 2147 |
| 208 | Ga0068859_100203768 | 3300005617 | Bacteria | 2063 |
| 209 | Ga0068859_100355511 | 3300005617 | Bacteria | 1560 |
| 210 | Ga0068864_100000068 | 3300005618 | Bacteria | 115507 |
| 211 | Ga0068864_100000505 | 3300005618 | Bacteria | 33651 |
| 212 | Ga0068864_100020545 | 3300005618 | Bacteria | 5525 |
| 213 | Ga0068864_100024457 | 3300005618 | Bacteria | 5082 |
| 214 | Ga0068864_100030792 | 3300005618 | Bacteria | 4550 |
| 215 | Ga0068864_100037187 | 3300005618 | Unclassified | 4153 |
| 216 | Ga0068864_100037883 | 3300005618 | Bacteria | 4116 |
| 217 | Ga0068864_100072019 | 3300005618 | Bacteria | 3011 |
| 218 | Ga0068864_100350082 | 3300005618 | Bacteria | 1393 |
| 219 | Ga0068866_10004767 | 3300005718 | Bacteria | 5566 |
| 220 | Ga0068866_10010895 | 3300005718 | Bacteria | 3914 |
| 221 | Ga0068861_100000611 | 3300005719 | Bacteria | 21166 |
| 222 | Ga0068861_100081836 | 3300005719 | Bacteria | 2529 |
| 223 | Ga0068861_100257845 | 3300005719 | Bacteria | 1491 |
| 224 | Ga0068851_10040865 | 3300005834 | Bacteria | 2331 |
| 225 | Ga0068870_10005537 | 3300005840 | Bacteria | 5513 |
| 226 | Ga0068870_10051384 | 3300005840 | Bacteria | 2182 |
| 227 | Ga0068863_100004085 | 3300005841 | Bacteria | 14419 |
| 228 | Ga0068863_100012662 | 3300005841 | Bacteria | 8134 |
| 229 | Ga0068863_100013585 | 3300005841 | Bacteria | 7856 |
| 230 | Ga0068863_100018174 | 3300005841 | Bacteria | 6732 |
| 231 | Ga0068863_100021167 | 3300005841 | Bacteria | 6209 |
| 232 | Ga0068863_100125001 | 3300005841 | Bacteria | 2454 |
| 233 | Ga0068863_100148396 | 3300005841 | Bacteria | 2243 |
| 234 | Ga0068863_100397252 | 3300005841 | Bacteria | 1348 |
| 235 | Ga0068858_100005289 | 3300005842 | Bacteria | 12653 |
| 236 | Ga0068858_100028259 | 3300005842 | Bacteria | 5211 |
| 237 | Ga0068858_100070085 | 3300005842 | Bacteria | 3250 |
| 238 | Ga0068858_100076639 | 3300005842 | Bacteria | 3105 |
| 239 | Ga0068858_100110527 | 3300005842 | Bacteria | 2566 |
| 240 | Ga0068858_100131069 | 3300005842 | Bacteria | 2351 |
| 241 | Ga0068858_100173266 | 3300005842 | Bacteria | 2035 |
| 242 | Ga0068860_100000303 | 3300005843 | Bacteria | 68443 |
| 243 | Ga0068860_100044787 | 3300005843 | Bacteria | 4216 |
| 244 | Ga0068860_100092080 | 3300005843 | Bacteria | 2888 |
| 245 | Ga0068860_100126887 | 3300005843 | Bacteria | 2446 |
| 246 | Ga0068860_100303088 | 3300005843 | Bacteria | 1566 |
| 247 | Ga0068862_100004089 | 3300005844 | Bacteria | 12372 |
| 248 | Ga0068862_100026684 | 3300005844 | Bacteria | 4856 |
| 249 | Ga0068862_100047630 | 3300005844 | Bacteria | 3659 |
| 250 | Ga0068862_100148696 | 3300005844 | Unclassified | 2084 |
| 251 | Ga0068862_100221639 | 3300005844 | Unclassified | 1712 |
| 252 | Ga0068862_100288346 | 3300005844 | Bacteria | 1507 |
| 253 | Ga0068862_100322284 | 3300005844 | Bacteria | 1427 |
| 254 | Ga0070717_10001621 | 3300006028 | Bacteria | 15596 |
| 255 | Ga0070717_10010535 | 3300006028 | Bacteria | 6986 |
| 256 | Ga0070717_10014518 | 3300006028 | Bacteria | 6062 |
| 257 | Ga0070717_10197155 | 3300006028 | Bacteria | 1762 |
| 258 | Ga0075365_10114241 | 3300006038 | Bacteria | 1857 |
| 259 | Ga0070715_10063543 | 3300006163 | Bacteria | 1628 |
| 260 | Ga0070716_100045037 | 3300006173 | Bacteria | 2475 |
| 261 | Ga0070712_100000068 | 3300006175 | Bacteria | 52953 |
| 262 | Ga0070712_100003155 | 3300006175 | Bacteria | 10153 |
| 263 | Ga0070712_100024777 | 3300006175 | Bacteria | 3980 |
| 264 | Ga0070712_100079334 | 3300006175 | Bacteria | 2372 |
| 265 | Ga0070712_100082047 | 3300006175 | Bacteria | 2338 |
| 266 | Ga0070712_100283810 | 3300006175 | Unclassified | 1334 |
| 267 | Ga0075362_10013272 | 3300006177 | Bacteria | 3295 |
| 268 | Ga0075367_10012939 | 3300006178 | Bacteria | 4470 |
| 269 | Ga0075366_10004672 | 3300006195 | Bacteria | 7365 |
| 270 | Ga0097621_100000739 | 3300006237 | Bacteria | 22900 |
| 271 | Ga0097621_100001227 | 3300006237 | Bacteria | 17771 |
| 272 | Ga0097621_100001464 | 3300006237 | Bacteria | 16162 |
| 273 | Ga0097621_100014464 | 3300006237 | Bacteria | 5905 |
| 274 | Ga0097621_100060237 | 3300006237 | Bacteria | 3111 |
| 275 | Ga0097621_100082532 | 3300006237 | Bacteria | 2677 |
| 276 | Ga0097621_100088614 | 3300006237 | Bacteria | 2586 |
| 277 | Ga0097621_100177372 | 3300006237 | Bacteria | 1840 |
| 278 | Ga0097621_100216521 | 3300006237 | Bacteria | 1667 |
| 279 | Ga0068871_100001869 | 3300006358 | Bacteria | 14244 |
| 280 | Ga0068871_100002436 | 3300006358 | Bacteria | 12715 |
| 281 | Ga0068871_100002615 | 3300006358 | Bacteria | 12294 |
| 282 | Ga0068871_100012480 | 3300006358 | Bacteria | 6267 |
| 283 | Ga0068871_100036087 | 3300006358 | Bacteria | 3934 |
| 284 | Ga0068871_100038959 | 3300006358 | Bacteria | 3800 |
| 285 | Ga0068871_100057608 | 3300006358 | Bacteria | 3161 |
| 286 | Ga0068871_100231916 | 3300006358 | Unclassified | 1602 |
| 287 | Ga0068871_100235285 | 3300006358 | Bacteria | 1591 |
| 288 | Ga0075428_100012893 | 3300006844 | Bacteria | 9299 |
| 289 | Ga0075428_100019477 | 3300006844 | Bacteria | 7509 |
| 290 | Ga0075428_100087268 | 3300006844 | Bacteria | 3403 |
| 291 | Ga0075428_100108985 | 3300006844 | Bacteria | 3018 |
| 292 | Ga0075428_100119999 | 3300006844 | Bacteria | 2862 |
| 293 | Ga0075428_100191088 | 3300006844 | Bacteria | 2214 |
| 294 | Ga0075428_100296925 | 3300006844 | Bacteria | 1737 |
| 295 | Ga0075428_100380739 | 3300006844 | Unclassified | 1513 |
| 296 | Ga0075430_100038458 | 3300006846 | Bacteria | 4051 |
| 297 | Ga0075430_100101103 | 3300006846 | Bacteria | 2407 |
| 298 | Ga0075430_100122888 | 3300006846 | Bacteria | 2164 |
| 299 | Ga0075430_100269535 | 3300006846 | Bacteria | 1409 |
| 300 | Ga0075431_100094550 | 3300006847 | Bacteria | 3085 |
| 301 | Ga0075431_100099234 | 3300006847 | Bacteria | 3005 |
| 302 | Ga0075431_100242873 | 3300006847 | Bacteria | 1831 |
| 303 | Ga0075433_10017964 | 3300006852 | Bacteria | 5868 |
| 304 | Ga0075433_10032523 | 3300006852 | Bacteria | 4468 |
| 305 | Ga0075434_100000752 | 3300006871 | Bacteria | 25541 |
| 306 | Ga0075434_100003967 | 3300006871 | Bacteria | 13257 |
| 307 | Ga0075434_100019695 | 3300006871 | Bacteria | 6531 |
| 308 | Ga0075434_100020588 | 3300006871 | Bacteria | 6400 |
| 309 | Ga0075434_100043609 | 3300006871 | Bacteria | 4448 |
| 310 | Ga0075434_100085599 | 3300006871 | Bacteria | 3152 |
| 311 | Ga0075434_100108387 | 3300006871 | Bacteria | 2788 |
| 312 | Ga0075434_100157313 | 3300006871 | Bacteria | 2292 |
| 313 | Ga0075434_100186025 | 3300006871 | Bacteria | 2098 |
| 314 | Ga0075434_100507126 | 3300006871 | Bacteria | 1227 |
| 315 | Ga0075429_100006558 | 3300006880 | Bacteria | 10076 |
| 316 | Ga0075429_100053515 | 3300006880 | Bacteria | 3512 |
| 317 | Ga0075429_100098012 | 3300006880 | Bacteria | 2558 |
| 318 | Ga0068865_100122940 | 3300006881 | Unclassified | 1933 |
| 319 | Ga0068865_100160258 | 3300006881 | Bacteria | 1716 |
| 320 | Ga0075436_100000125 | 3300006914 | Bacteria | 45485 |
| 321 | Ga0075436_100229523 | 3300006914 | Unclassified | 1318 |
| 322 | Ga0097620_100002169 | 3300006931 | Bacteria | 19950 |
| 323 | Ga0097620_100011456 | 3300006931 | Bacteria | 8915 |
| 324 | Ga0097620_100017021 | 3300006931 | Bacteria | 7298 |
| 325 | Ga0097620_100018429 | 3300006931 | Bacteria | 7017 |
| 326 | Ga0097620_100022495 | 3300006931 | Bacteria | 6321 |
| 327 | Ga0097620_100028305 | 3300006931 | Bacteria | 5617 |
| 328 | Ga0097620_100037489 | 3300006931 | Unclassified | 4865 |
| 329 | Ga0097620_100038749 | 3300006931 | Bacteria | 4781 |
| 330 | Ga0097620_100074034 | 3300006931 | Bacteria | 3444 |
| 331 | Ga0097620_100106223 | 3300006931 | Bacteria | 2867 |
| 332 | Ga0097620_100188445 | 3300006931 | Bacteria | 2147 |
| 333 | Ga0097620_100203768 | 3300006931 | Bacteria | 2063 |
| 334 | Ga0097620_100355527 | 3300006931 | Bacteria | 1560 |
| 335 | Ga0075435_100000242 | 3300007076 | Bacteria | 33676 |
| 336 | Ga0075435_100003023 | 3300007076 | Bacteria | 11324 |
| 337 | Ga0075435_100009050 | 3300007076 | Bacteria | 7183 |
| 338 | Ga0075435_100020329 | 3300007076 | Bacteria | 5085 |
| 339 | Ga0075435_100035457 | 3300007076 | Bacteria | 3960 |
| 340 | Ga0075435_100121793 | 3300007076 | Bacteria | 2177 |
| 341 | Ga0075435_100173479 | 3300007076 | Bacteria | 1820 |
| 342 | Ga0099795_10004242 | 3300007788 | Unclassified | 3675 |
| 343 | Ga0105240_10101159 | 3300009093 | Bacteria | 3506 |
| 344 | Ga0111539_10000116 | 3300009094 | Bacteria | 88262 |
| 345 | Ga0111539_10005883 | 3300009094 | Bacteria | 15843 |
| 346 | Ga0111539_10010270 | 3300009094 | Bacteria | 11789 |
| 347 | Ga0111539_10010922 | 3300009094 | Bacteria | 11429 |
| 348 | Ga0111539_10022058 | 3300009094 | Bacteria | 7826 |
| 349 | Ga0111539_10131018 | 3300009094 | Bacteria | 2936 |
| 350 | Ga0111539_10225433 | 3300009094 | Bacteria | 2183 |
| 351 | Ga0111539_10245041 | 3300009094 | Bacteria | 2087 |
| 352 | Ga0111539_10352277 | 3300009094 | Bacteria | 1713 |
| 353 | Ga0105245_10003927 | 3300009098 | Bacteria | 13220 |
| 354 | Ga0105245_10060024 | 3300009098 | Bacteria | 3425 |
| 355 | Ga0105245_10351234 | 3300009098 | Unclassified | 1461 |
| 356 | Ga0105245_10369053 | 3300009098 | Bacteria | 1426 |
| 357 | Ga0105247_10002892 | 3300009101 | Bacteria | 11433 |
| 358 | Ga0105247_10116730 | 3300009101 | Bacteria | 1724 |
| 359 | Ga0114129_10002377 | 3300009147 | Bacteria | 26132 |
| 360 | Ga0114129_10003649 | 3300009147 | Bacteria | 21651 |
| 361 | Ga0114129_10021105 | 3300009147 | Bacteria | 9248 |
| 362 | Ga0114129_10040942 | 3300009147 | Bacteria | 6529 |
| 363 | Ga0114129_10064441 | 3300009147 | Bacteria | 5114 |
| 364 | Ga0114129_10074579 | 3300009147 | Bacteria | 4726 |
| 365 | Ga0114129_10177577 | 3300009147 | Unclassified | 2900 |
| 366 | Ga0114129_10216717 | 3300009147 | Bacteria | 2585 |
| 367 | Ga0114129_10334138 | 3300009147 | Bacteria | 2011 |
| 368 | Ga0114129_10499771 | 3300009147 | Bacteria | 1588 |
| 369 | Ga0105243_10000419 | 3300009148 | Bacteria | 44706 |
| 370 | Ga0105243_10013767 | 3300009148 | Bacteria | 6120 |
| 371 | Ga0105241_10006596 | 3300009174 | Bacteria | 8550 |
| 372 | Ga0105241_10017513 | 3300009174 | Bacteria | 5267 |
| 373 | Ga0105241_10019500 | 3300009174 | Bacteria | 5001 |
| 374 | Ga0105241_10143449 | 3300009174 | Unclassified | 1947 |
| 375 | Ga0105241_10177089 | 3300009174 | Bacteria | 1766 |
| 376 | Ga0105241_10386167 | 3300009174 | Unclassified | 1225 |
| 377 | Ga0105241_10395121 | 3300009174 | Unclassified | 1211 |
| 378 | Ga0105242_10000162 | 3300009176 | Bacteria | 50052 |
| 379 | Ga0105242_10004177 | 3300009176 | Bacteria | 11252 |
| 380 | Ga0105242_10010323 | 3300009176 | Bacteria | 7160 |
| 381 | Ga0105242_10024640 | 3300009176 | Bacteria | 4754 |
| 382 | Ga0105242_10353472 | 3300009176 | Bacteria | 1358 |
| 383 | Ga0105248_10001543 | 3300009177 | Bacteria | 25639 |
| 384 | Ga0105248_10011406 | 3300009177 | Bacteria | 9796 |
| 385 | Ga0105248_10026373 | 3300009177 | Bacteria | 6463 |
| 386 | Ga0105248_10031945 | 3300009177 | Bacteria | 5883 |
| 387 | Ga0105248_10040359 | 3300009177 | Bacteria | 5231 |
| 388 | Ga0105248_10048130 | 3300009177 | Bacteria | 4782 |
| 389 | Ga0105248_10197542 | 3300009177 | Bacteria | 2267 |
| 390 | Ga0105248_10284697 | 3300009177 | Bacteria | 1861 |
| 391 | Ga0105248_10288985 | 3300009177 | Bacteria | 1846 |
| 392 | Ga0105248_10338855 | 3300009177 | Bacteria | 1693 |
| 393 | Ga0105237_10163649 | 3300009545 | Bacteria | 2223 |
| 394 | Ga0105238_10000910 | 3300009551 | Bacteria | 30341 |
| 395 | Ga0105238_10014550 | 3300009551 | Bacteria | 7957 |
| 396 | Ga0105238_10030107 | 3300009551 | Bacteria | 5525 |
| 397 | Ga0105238_10136428 | 3300009551 | Unclassified | 2431 |
| 398 | Ga0105238_10185815 | 3300009551 | Bacteria | 2055 |
| 399 | Ga0105249_10006716 | 3300009553 | Bacteria | 10022 |
| 400 | Ga0105249_10030009 | 3300009553 | Bacteria | 4912 |
| 401 | Ga0105249_10206610 | 3300009553 | Bacteria | 1924 |
| 402 | Ga0105249_10282160 | 3300009553 | Bacteria | 1659 |
| 403 | Ga0099796_10015084 | 3300010159 | Unclassified | 2250 |
| 404 | Ga0105239_10008079 | 3300010375 | Bacteria | 12012 |
| 405 | Ga0105239_10010869 | 3300010375 | Bacteria | 10170 |
| 406 | Ga0105239_10066350 | 3300010375 | Unclassified | 3964 |
| 407 | Ga0105239_10112714 | 3300010375 | Unclassified | 3015 |
| 408 | Ga0105239_10273303 | 3300010375 | Unclassified | 1901 |
| 409 | Ga0105239_10309161 | 3300010375 | Unclassified | 1781 |
| 410 | Ga0105239_10383426 | 3300010375 | Bacteria | 1589 |
| 411 | Ga0105246_10029689 | 3300011119 | Bacteria | 3603 |
| 412 | Ga0105246_10084282 | 3300011119 | Unclassified | 2273 |
| 413 | Ga0157373_10002998 | 3300013100 | Bacteria | 12768 |
| 414 | Ga0157373_10004351 | 3300013100 | Bacteria | 10666 |
| 415 | Ga0157373_10055027 | 3300013100 | Unclassified | 2827 |
| 416 | Ga0157373_10187404 | 3300013100 | Unclassified | 1457 |
| 417 | Ga0157369_10013891 | 3300013105 | Bacteria | 9096 |
| 418 | Ga0157369_10014806 | 3300013105 | Bacteria | 8801 |
| 419 | Ga0157369_10040623 | 3300013105 | Bacteria | 5078 |
| 420 | Ga0157374_10000425 | 3300013296 | Bacteria | 38176 |
| 421 | Ga0157374_10000477 | 3300013296 | Bacteria | 36340 |
| 422 | Ga0157374_10007647 | 3300013296 | Bacteria | 9227 |
| 423 | Ga0157374_10026181 | 3300013296 | Bacteria | 5246 |
| 424 | Ga0157374_10058371 | 3300013296 | Unclassified | 3606 |
| 425 | Ga0157374_10072860 | 3300013296 | Bacteria | 3241 |
| 426 | Ga0157374_10133832 | 3300013296 | Bacteria | 2401 |
| 427 | Ga0157374_10159590 | 3300013296 | Bacteria | 2196 |
| 428 | Ga0157374_10208050 | 3300013296 | Unclassified | 1918 |
| 429 | Ga0157374_10357462 | 3300013296 | Bacteria | 1452 |
| 430 | Ga0157378_10000082 | 3300013297 | Bacteria | 88212 |
| 431 | Ga0157378_10001226 | 3300013297 | Bacteria | 23186 |
| 432 | Ga0157378_10001328 | 3300013297 | Bacteria | 22232 |
| 433 | Ga0157378_10016738 | 3300013297 | Bacteria | 6424 |
| 434 | Ga0157378_10017317 | 3300013297 | Bacteria | 6321 |
| 435 | Ga0157378_10023027 | 3300013297 | Bacteria | 5483 |
| 436 | Ga0157378_10100594 | 3300013297 | Unclassified | 2639 |
| 437 | Ga0157378_10125132 | 3300013297 | Bacteria | 2374 |
| 438 | Ga0163162_10031097 | 3300013306 | Bacteria | 5293 |
| 439 | Ga0163162_10036124 | 3300013306 | Bacteria | 4923 |
| 440 | Ga0163162_10054294 | 3300013306 | Bacteria | 4030 |
| 441 | Ga0163162_10063133 | 3300013306 | Bacteria | 3745 |
| 442 | Ga0163162_10081811 | 3300013306 | Unclassified | 3300 |
| 443 | Ga0163162_10122176 | 3300013306 | Bacteria | 2709 |
| 444 | Ga0163162_10157968 | 3300013306 | Bacteria | 2388 |
| 445 | Ga0163162_10245167 | 3300013306 | Bacteria | 1923 |
| 446 | Ga0163162_10560866 | 3300013306 | Bacteria | 1270 |
| 447 | Ga0163162_10656363 | 3300013306 | Unclassified | 1172 |
| 448 | Ga0157372_10001675 | 3300013307 | Bacteria | 23988 |
| 449 | Ga0157372_10003558 | 3300013307 | Bacteria | 16783 |
| 450 | Ga0157372_10004152 | 3300013307 | Bacteria | 15500 |
| 451 | Ga0157372_10007396 | 3300013307 | Bacteria | 11678 |
| 452 | Ga0157372_10017976 | 3300013307 | Bacteria | 7597 |
| 453 | Ga0157372_10074383 | 3300013307 | Bacteria | 3831 |
| 454 | Ga0157372_10126957 | 3300013307 | Bacteria | 2933 |
| 455 | Ga0157372_10421497 | 3300013307 | Bacteria | 1555 |
| 456 | Ga0157375_10002492 | 3300013308 | Bacteria | 15952 |
| 457 | Ga0157375_10004861 | 3300013308 | Bacteria | 11676 |
| 458 | Ga0157375_10015692 | 3300013308 | Bacteria | 6785 |
| 459 | Ga0157375_10016209 | 3300013308 | Bacteria | 6683 |
| 460 | Ga0157375_10190015 | 3300013308 | Bacteria | 2208 |
| 461 | Ga0157375_10230644 | 3300013308 | Unclassified | 2010 |
| 462 | Ga0157375_10328137 | 3300013308 | Bacteria | 1695 |
| 463 | Ga0157375_10645525 | 3300013308 | Bacteria | 1215 |
| 464 | Ga0163163_10000495 | 3300014325 | Bacteria | 35470 |
| 465 | Ga0163163_10001144 | 3300014325 | Bacteria | 22578 |
| 466 | Ga0163163_10001705 | 3300014325 | Bacteria | 18574 |
| 467 | Ga0163163_10003211 | 3300014325 | Bacteria | 13850 |
| 468 | Ga0163163_10004961 | 3300014325 | Bacteria | 11454 |
| 469 | Ga0163163_10009445 | 3300014325 | Bacteria | 8708 |
| 470 | Ga0163163_10029619 | 3300014325 | Bacteria | 5269 |
| 471 | Ga0163163_10104037 | 3300014325 | Bacteria | 2864 |
| 472 | Ga0163163_10121701 | 3300014325 | Bacteria | 2644 |
| 473 | Ga0163163_10155939 | 3300014325 | Bacteria | 2328 |
| 474 | Ga0163163_10164891 | 3300014325 | Bacteria | 2262 |
| 475 | Ga0163163_10211087 | 3300014325 | Bacteria | 1991 |
| 476 | Ga0157380_10100665 | 3300014326 | Bacteria | 2406 |
| 477 | Ga0157380_10115285 | 3300014326 | Unclassified | 2266 |
| 478 | Ga0157380_10260936 | 3300014326 | Bacteria | 1574 |
| 479 | Ga0157377_10001335 | 3300014745 | Bacteria | 10588 |
| 480 | Ga0157377_10044224 | 3300014745 | Unclassified | 2482 |
| 481 | Ga0157377_10046124 | 3300014745 | Bacteria | 2436 |
| 482 | Ga0157377_10117194 | 3300014745 | Unclassified | 1609 |
| 483 | Ga0157379_10000585 | 3300014968 | Bacteria | 29535 |
| 484 | Ga0157379_10031291 | 3300014968 | Bacteria | 4740 |
| 485 | Ga0157379_10031430 | 3300014968 | Bacteria | 4729 |
| 486 | Ga0157379_10074127 | 3300014968 | Bacteria | 3047 |
| 487 | Ga0157379_10308804 | 3300014968 | Bacteria | 1442 |
| 488 | Ga0157376_10000017 | 3300014969 | Bacteria | 268501 |
| 489 | Ga0157376_10001723 | 3300014969 | Bacteria | 14550 |
| 490 | Ga0157376_10007450 | 3300014969 | Bacteria | 7813 |
| 491 | Ga0157376_10066376 | 3300014969 | Unclassified | 3050 |
| 492 | Ga0157376_10079588 | 3300014969 | Unclassified | 2810 |
| 493 | Ga0157376_10398198 | 3300014969 | Bacteria | 1331 |
| 494 | Ga0163161_10026495 | 3300017792 | Bacteria | 4106 |
| 495 | Ga0163161_10055402 | 3300017792 | Unclassified | 2878 |
| 496 | Ga0163161_10074294 | 3300017792 | Bacteria | 2493 |
| 497 | Ga0213876_10036799 | 3300021384 | Bacteria | 2582 |
| 498 | Ga0224572_1008541 | 3300024225 | Unclassified | 1896 |
| 499 | Ga0209758_1002835 | 3300025297 | Bacteria | 16849 |
| 500 | Ga0207697_10015984 | 3300025315 | Unclassified | 3096 |
| 501 | Ga0207656_10026445 | 3300025321 | Bacteria | 2366 |
| 502 | Ga0207692_10002604 | 3300025898 | Bacteria | 6937 |
| 503 | Ga0207692_10012351 | 3300025898 | Bacteria | 3667 |
| 504 | Ga0207692_10027747 | 3300025898 | Bacteria | 2670 |
| 505 | Ga0207692_10051978 | 3300025898 | Bacteria | 2080 |
| 506 | Ga0207642_10014700 | 3300025899 | Bacteria | 2897 |
| 507 | Ga0207642_10111421 | 3300025899 | Unclassified | 1394 |
| 508 | Ga0207710_10001465 | 3300025900 | Bacteria | 11718 |
| 509 | Ga0207688_10048037 | 3300025901 | Bacteria | 2384 |
| 510 | Ga0207680_10020014 | 3300025903 | Bacteria | 3591 |
| 511 | Ga0207647_10016615 | 3300025904 | Bacteria | 5020 |
| 512 | Ga0207647_10097505 | 3300025904 | Bacteria | 1748 |
| 513 | Ga0207699_10002098 | 3300025906 | Bacteria | 9426 |
| 514 | Ga0207699_10083224 | 3300025906 | Bacteria | 1990 |
| 515 | Ga0207645_10050981 | 3300025907 | Bacteria | 2644 |
| 516 | Ga0207643_10007238 | 3300025908 | Bacteria | 5956 |
| 517 | Ga0207643_10024801 | 3300025908 | Bacteria | 3309 |
| 518 | Ga0207643_10037956 | 3300025908 | Bacteria | 2704 |
| 519 | Ga0207643_10070802 | 3300025908 | Bacteria | 2006 |
| 520 | Ga0207643_10132504 | 3300025908 | Bacteria | 1484 |
| 521 | Ga0207705_10039977 | 3300025909 | Bacteria | 3361 |
| 522 | Ga0207705_10191550 | 3300025909 | Bacteria | 1547 |
| 523 | Ga0207654_10026183 | 3300025911 | Bacteria | 3155 |
| 524 | Ga0207654_10040851 | 3300025911 | Unclassified | 2616 |
| 525 | Ga0207654_10164105 | 3300025911 | Unclassified | 1437 |
| 526 | Ga0207707_10003174 | 3300025912 | Bacteria | 14589 |
| 527 | Ga0207707_10024436 | 3300025912 | Bacteria | 5287 |
| 528 | Ga0207707_10176253 | 3300025912 | Bacteria | 1868 |
| 529 | Ga0207707_10238299 | 3300025912 | Bacteria | 1582 |
| 530 | Ga0207707_10323356 | 3300025912 | Bacteria | 1331 |
| 531 | Ga0207671_10100082 | 3300025914 | Bacteria | 2194 |
| 532 | Ga0207693_10000057 | 3300025915 | Bacteria | 94894 |
| 533 | Ga0207693_10009295 | 3300025915 | Bacteria | 8021 |
| 534 | Ga0207693_10016441 | 3300025915 | Bacteria | 5912 |
| 535 | Ga0207693_10071493 | 3300025915 | Bacteria | 2716 |
| 536 | Ga0207693_10101829 | 3300025915 | Unclassified | 2252 |
| 537 | Ga0207693_10132833 | 3300025915 | Bacteria | 1956 |
| 538 | Ga0207663_10003566 | 3300025916 | Bacteria | 7635 |
| 539 | Ga0207660_10039627 | 3300025917 | Bacteria | 3294 |
| 540 | Ga0207660_10120078 | 3300025917 | Bacteria | 1990 |
| 541 | Ga0207662_10002208 | 3300025918 | Bacteria | 9707 |
| 542 | Ga0207662_10051407 | 3300025918 | Bacteria | 2452 |
| 543 | Ga0207662_10069798 | 3300025918 | Bacteria | 2124 |
| 544 | Ga0207657_10012045 | 3300025919 | Bacteria | 8554 |
| 545 | Ga0207657_10057579 | 3300025919 | Bacteria | 3349 |
| 546 | Ga0207657_10238437 | 3300025919 | Unclassified | 1453 |
| 547 | Ga0207649_10001696 | 3300025920 | Bacteria | 12706 |
| 548 | Ga0207649_10004170 | 3300025920 | Bacteria | 7873 |
| 549 | Ga0207649_10015254 | 3300025920 | Bacteria | 4317 |
| 550 | Ga0207649_10082275 | 3300025920 | Bacteria | 2087 |
| 551 | Ga0207649_10109102 | 3300025920 | Bacteria | 1846 |
| 552 | Ga0207652_10003412 | 3300025921 | Bacteria | 13115 |
| 553 | Ga0207652_10032862 | 3300025921 | Bacteria | 4365 |
| 554 | Ga0207652_10229517 | 3300025921 | Bacteria | 1673 |
| 555 | Ga0207681_10017573 | 3300025923 | Bacteria | 4493 |
| 556 | Ga0207681_10057025 | 3300025923 | Unclassified | 2667 |
| 557 | Ga0207681_10093051 | 3300025923 | Bacteria | 2157 |
| 558 | Ga0207694_10003021 | 3300025924 | Bacteria | 13490 |
| 559 | Ga0207694_10011735 | 3300025924 | Bacteria | 6610 |
| 560 | Ga0207650_10000017 | 3300025925 | Bacteria | 354674 |
| 561 | Ga0207650_10000161 | 3300025925 | Bacteria | 81097 |
| 562 | Ga0207650_10010243 | 3300025925 | Bacteria | 6425 |
| 563 | Ga0207650_10010256 | 3300025925 | Bacteria | 6423 |
| 564 | Ga0207650_10012827 | 3300025925 | Bacteria | 5791 |
| 565 | Ga0207650_10016847 | 3300025925 | Bacteria | 5112 |
| 566 | Ga0207650_10034247 | 3300025925 | Bacteria | 3683 |
| 567 | Ga0207650_10040727 | 3300025925 | Bacteria | 3401 |
| 568 | Ga0207650_10043812 | 3300025925 | Bacteria | 3287 |
| 569 | Ga0207650_10051839 | 3300025925 | Bacteria | 3038 |
| 570 | Ga0207650_10090144 | 3300025925 | Bacteria | 2341 |
| 571 | Ga0207650_10231074 | 3300025925 | Bacteria | 1492 |
| 572 | Ga0207650_10307021 | 3300025925 | Bacteria | 1297 |
| 573 | Ga0207659_10010513 | 3300025926 | Bacteria | 5817 |
| 574 | Ga0207659_10043054 | 3300025926 | Bacteria | 3169 |
| 575 | Ga0207659_10271536 | 3300025926 | Bacteria | 1383 |
| 576 | Ga0207687_10015698 | 3300025927 | Bacteria | 4970 |
| 577 | Ga0207687_10088679 | 3300025927 | Unclassified | 2251 |
| 578 | Ga0207687_10227108 | 3300025927 | Unclassified | 1473 |
| 579 | Ga0207700_10000377 | 3300025928 | Bacteria | 26049 |
| 580 | Ga0207700_10001680 | 3300025928 | Bacteria | 12561 |
| 581 | Ga0207700_10009335 | 3300025928 | Bacteria | 6122 |
| 582 | Ga0207700_10126814 | 3300025928 | Bacteria | 2078 |
| 583 | Ga0207700_10137552 | 3300025928 | Bacteria | 2003 |
| 584 | Ga0207664_10000973 | 3300025929 | Bacteria | 19302 |
| 585 | Ga0207664_10042923 | 3300025929 | Bacteria | 3534 |
| 586 | Ga0207644_10059757 | 3300025931 | Bacteria | 2757 |
| 587 | Ga0207644_10119806 | 3300025931 | Bacteria | 2002 |
| 588 | Ga0207690_10105895 | 3300025932 | Unclassified | 2017 |
| 589 | Ga0207706_10009128 | 3300025933 | Bacteria | 9117 |
| 590 | Ga0207706_10049873 | 3300025933 | Bacteria | 3699 |
| 591 | Ga0207706_10101578 | 3300025933 | Bacteria | 2530 |
| 592 | Ga0207686_10000069 | 3300025934 | Bacteria | 93699 |
| 593 | Ga0207686_10024701 | 3300025934 | Bacteria | 3486 |
| 594 | Ga0207686_10055668 | 3300025934 | Bacteria | 2483 |
| 595 | Ga0207709_10000025 | 3300025935 | Bacteria | 364795 |
| 596 | Ga0207709_10009789 | 3300025935 | Bacteria | 5281 |
| 597 | Ga0207670_10002826 | 3300025936 | Bacteria | 9156 |
| 598 | Ga0207670_10009696 | 3300025936 | Bacteria | 5508 |
| 599 | Ga0207670_10028399 | 3300025936 | Bacteria | 3551 |
| 600 | Ga0207670_10028594 | 3300025936 | Bacteria | 3542 |
| 601 | Ga0207670_10058652 | 3300025936 | Bacteria | 2615 |
| 602 | Ga0207670_10241135 | 3300025936 | Unclassified | 1393 |
| 603 | Ga0207669_10004295 | 3300025937 | Bacteria | 6264 |
| 604 | Ga0207669_10008824 | 3300025937 | Unclassified | 4756 |
| 605 | Ga0207704_10024761 | 3300025938 | Bacteria | 3262 |
| 606 | Ga0207704_10031390 | 3300025938 | Bacteria | 2992 |
| 607 | Ga0207704_10054741 | 3300025938 | Bacteria | 2434 |
| 608 | Ga0207665_10002196 | 3300025939 | Bacteria | 13179 |
| 609 | Ga0207665_10003791 | 3300025939 | Bacteria | 10099 |
| 610 | Ga0207665_10026876 | 3300025939 | Unclassified | 3801 |
| 611 | Ga0207665_10054987 | 3300025939 | Bacteria | 2685 |
| 612 | Ga0207691_10001839 | 3300025940 | Bacteria | 20739 |
| 613 | Ga0207691_10048778 | 3300025940 | Bacteria | 3881 |
| 614 | Ga0207691_10068402 | 3300025940 | Bacteria | 3208 |
| 615 | Ga0207691_10192256 | 3300025940 | Bacteria | 1779 |
| 616 | Ga0207711_10002939 | 3300025941 | Bacteria | 14897 |
| 617 | Ga0207711_10005519 | 3300025941 | Bacteria | 10696 |
| 618 | Ga0207711_10014282 | 3300025941 | Bacteria | 6598 |
| 619 | Ga0207711_10063865 | 3300025941 | Unclassified | 3179 |
| 620 | Ga0207711_10094626 | 3300025941 | Bacteria | 2633 |
| 621 | Ga0207711_10133361 | 3300025941 | Unclassified | 2229 |
| 622 | Ga0207711_10140745 | 3300025941 | Bacteria | 2170 |
| 623 | Ga0207711_10147609 | 3300025941 | Bacteria | 2120 |
| 624 | Ga0207711_10154589 | 3300025941 | Bacteria | 2072 |
| 625 | Ga0207711_10255218 | 3300025941 | Bacteria | 1611 |
| 626 | Ga0207689_10003244 | 3300025942 | Bacteria | 14908 |
| 627 | Ga0207689_10008816 | 3300025942 | Bacteria | 8766 |
| 628 | Ga0207689_10060268 | 3300025942 | Unclassified | 3121 |
| 629 | Ga0207689_10070006 | 3300025942 | Unclassified | 2882 |
| 630 | Ga0207689_10094510 | 3300025942 | Bacteria | 2455 |
| 631 | Ga0207689_10165502 | 3300025942 | Bacteria | 1822 |
| 632 | Ga0207689_10306345 | 3300025942 | Unclassified | 1317 |
| 633 | Ga0207661_10002094 | 3300025944 | Bacteria | 13733 |
| 634 | Ga0207661_10002500 | 3300025944 | Bacteria | 12660 |
| 635 | Ga0207661_10296939 | 3300025944 | Unclassified | 1447 |
| 636 | Ga0207679_10000553 | 3300025945 | Bacteria | 25114 |
| 637 | Ga0207679_10001688 | 3300025945 | Bacteria | 13745 |
| 638 | Ga0207679_10020455 | 3300025945 | Bacteria | 4466 |
| 639 | Ga0207679_10052645 | 3300025945 | Unclassified | 2986 |
| 640 | Ga0207679_10066658 | 3300025945 | Bacteria | 2698 |
| 641 | Ga0207679_10088575 | 3300025945 | Unclassified | 2387 |
| 642 | Ga0207679_10089450 | 3300025945 | Bacteria | 2377 |
| 643 | Ga0207679_10228463 | 3300025945 | Bacteria | 1569 |
| 644 | Ga0207667_10080893 | 3300025949 | Bacteria | 3366 |
| 645 | Ga0207651_10024150 | 3300025960 | Bacteria | 3755 |
| 646 | Ga0207651_10024355 | 3300025960 | Bacteria | 3743 |
| 647 | Ga0207651_10048160 | 3300025960 | Unclassified | 2879 |
| 648 | Ga0207651_10050643 | 3300025960 | Bacteria | 2821 |
| 649 | Ga0207712_10005714 | 3300025961 | Bacteria | 7839 |
| 650 | Ga0207712_10010302 | 3300025961 | Bacteria | 5933 |
| 651 | Ga0207712_10151073 | 3300025961 | Unclassified | 1794 |
| 652 | Ga0207668_10000053 | 3300025972 | Bacteria | 97131 |
| 653 | Ga0207668_10000323 | 3300025972 | Bacteria | 31013 |
| 654 | Ga0207668_10008775 | 3300025972 | Bacteria | 6039 |
| 655 | Ga0207640_10012640 | 3300025981 | Bacteria | 4815 |
| 656 | Ga0207640_10022145 | 3300025981 | Unclassified | 3798 |
| 657 | Ga0207640_10031074 | 3300025981 | Bacteria | 3296 |
| 658 | Ga0207640_10111121 | 3300025981 | Bacteria | 1943 |
| 659 | Ga0207640_10188964 | 3300025981 | Bacteria | 1551 |
| 660 | Ga0207658_10000988 | 3300025986 | Bacteria | 23373 |
| 661 | Ga0207658_10028896 | 3300025986 | Unclassified | 3908 |
| 662 | Ga0207658_10139156 | 3300025986 | Bacteria | 1962 |
| 663 | Ga0207677_10107765 | 3300026023 | Bacteria | 2067 |
| 664 | Ga0207703_10000968 | 3300026035 | Bacteria | 27762 |
| 665 | Ga0207703_10008957 | 3300026035 | Bacteria | 7884 |
| 666 | Ga0207703_10039130 | 3300026035 | Bacteria | 3788 |
| 667 | Ga0207703_10044556 | 3300026035 | Bacteria | 3566 |
| 668 | Ga0207703_10057802 | 3300026035 | Bacteria | 3164 |
| 669 | Ga0207703_10151541 | 3300026035 | Bacteria | 2022 |
| 670 | Ga0207703_10161030 | 3300026035 | Unclassified | 1966 |
| 671 | Ga0207639_10016019 | 3300026041 | Bacteria | 5295 |
| 672 | Ga0207708_10051799 | 3300026075 | Bacteria | 3126 |
| 673 | Ga0207708_10052363 | 3300026075 | Unclassified | 3109 |
| 674 | Ga0207708_10146312 | 3300026075 | Bacteria | 1857 |
| 675 | Ga0207708_10188754 | 3300026075 | Bacteria | 1640 |
| 676 | Ga0207708_10201025 | 3300026075 | Bacteria | 1590 |
| 677 | Ga0207702_10002933 | 3300026078 | Bacteria | 15953 |
| 678 | Ga0207702_10005179 | 3300026078 | Bacteria | 11469 |
| 679 | Ga0207702_10200942 | 3300026078 | Unclassified | 1847 |
| 680 | Ga0207641_10000539 | 3300026088 | Bacteria | 42499 |
| 681 | Ga0207641_10015058 | 3300026088 | Bacteria | 6337 |
| 682 | Ga0207641_10019989 | 3300026088 | Bacteria | 5497 |
| 683 | Ga0207641_10021069 | 3300026088 | Bacteria | 5358 |
| 684 | Ga0207641_10055254 | 3300026088 | Unclassified | 3371 |
| 685 | Ga0207641_10080427 | 3300026088 | Bacteria | 2827 |
| 686 | Ga0207641_10115770 | 3300026088 | Bacteria | 2384 |
| 687 | Ga0207641_10238430 | 3300026088 | Bacteria | 1693 |
| 688 | Ga0207648_10010425 | 3300026089 | Bacteria | 8807 |
| 689 | Ga0207648_10013662 | 3300026089 | Bacteria | 7539 |
| 690 | Ga0207648_10015056 | 3300026089 | Bacteria | 7122 |
| 691 | Ga0207648_10046095 | 3300026089 | Bacteria | 3823 |
| 692 | Ga0207648_10068880 | 3300026089 | Unclassified | 3083 |
| 693 | Ga0207648_10081315 | 3300026089 | Bacteria | 2826 |
| 694 | Ga0207676_10000685 | 3300026095 | Bacteria | 26828 |
| 695 | Ga0207676_10003419 | 3300026095 | Bacteria | 11225 |
| 696 | Ga0207676_10003684 | 3300026095 | Bacteria | 10833 |
| 697 | Ga0207676_10008016 | 3300026095 | Bacteria | 7507 |
| 698 | Ga0207676_10008366 | 3300026095 | Bacteria | 7354 |
| 699 | Ga0207676_10014750 | 3300026095 | Bacteria | 5629 |
| 700 | Ga0207676_10049523 | 3300026095 | Unclassified | 3269 |
| 701 | Ga0207676_10060182 | 3300026095 | Bacteria | 3003 |
| 702 | Ga0207676_10066290 | 3300026095 | Bacteria | 2879 |
| 703 | Ga0207676_10208354 | 3300026095 | Bacteria | 1732 |
| 704 | Ga0207676_10399710 | 3300026095 | Bacteria | 1284 |
| 705 | Ga0207674_10000116 | 3300026116 | Bacteria | 93023 |
| 706 | Ga0207674_10002114 | 3300026116 | Bacteria | 25120 |
| 707 | Ga0207674_10007866 | 3300026116 | Bacteria | 12390 |
| 708 | Ga0207674_10009074 | 3300026116 | Bacteria | 11419 |
| 709 | Ga0207674_10011514 | 3300026116 | Bacteria | 9937 |
| 710 | Ga0207674_10011730 | 3300026116 | Bacteria | 9833 |
| 711 | Ga0207674_10011804 | 3300026116 | Bacteria | 9801 |
| 712 | Ga0207675_100002992 | 3300026118 | Bacteria | 16603 |
| 713 | Ga0207675_100005697 | 3300026118 | Bacteria | 11921 |
| 714 | Ga0207675_100020125 | 3300026118 | Bacteria | 6224 |
| 715 | Ga0207675_100051448 | 3300026118 | Bacteria | 3843 |
| 716 | Ga0207675_100075376 | 3300026118 | Bacteria | 3158 |
| 717 | Ga0207675_100089811 | 3300026118 | Unclassified | 2888 |
| 718 | Ga0207683_10005942 | 3300026121 | Bacteria | 10463 |
| 719 | Ga0207683_10149227 | 3300026121 | Unclassified | 2109 |
| 720 | Ga0207698_10044959 | 3300026142 | Bacteria | 3322 |
| 721 | Ga0207698_10124995 | 3300026142 | Bacteria | 2185 |
| 722 | Ga0209984_1003365 | 3300027424 | Bacteria | 1828 |
| 723 | Ga0209982_1001908 | 3300027552 | Bacteria | 2885 |
| 724 | Ga0210002_1009932 | 3300027617 | Bacteria | 1455 |
| 725 | Ga0209813_10025741 | 3300027866 | Bacteria | 1695 |
| 726 | Ga0209974_10004187 | 3300027876 | Bacteria | 5156 |
| 727 | Ga0207428_10000185 | 3300027907 | Bacteria | 86391 |
| 728 | Ga0207428_10000657 | 3300027907 | Bacteria | 40497 |
| 729 | Ga0207428_10007200 | 3300027907 | Bacteria | 10174 |
| 730 | Ga0268266_10000306 | 3300028379 | Bacteria | 77988 |
| 731 | Ga0268266_10000698 | 3300028379 | Bacteria | 45298 |
| 732 | Ga0268266_10018384 | 3300028379 | Bacteria | 5956 |
| 733 | Ga0268266_10101361 | 3300028379 | Unclassified | 2538 |
| 734 | Ga0268266_10183086 | 3300028379 | Unclassified | 1909 |
| 735 | Ga0268265_10045050 | 3300028380 | Bacteria | 3289 |
| 736 | Ga0268265_10217330 | 3300028380 | Bacteria | 1670 |
| 737 | Ga0268265_10234686 | 3300028380 | Bacteria | 1614 |
| 738 | Ga0268264_10000059 | 3300028381 | Bacteria | 306927 |
| 739 | Ga0268264_10028307 | 3300028381 | Bacteria | 4583 |
| 740 | Ga0268264_10064072 | 3300028381 | Bacteria | 3092 |
| 741 | Ga0268264_10068130 | 3300028381 | Unclassified | 3006 |
| 742 | Ga0268264_10255434 | 3300028381 | Bacteria | 1630 |
| 743 | Ga0265338_10009200 | 3300028800 | Bacteria | 11826 |
| 744 | Ga0265760_10000174 | 3300031090 | Bacteria | 16947 |
| 745 | Ga0265760_10001093 | 3300031090 | Bacteria | 7877 |
| 746 | Ga0265760_10015062 | 3300031090 | Bacteria | 2216 |
| 747 | Ga0307509_10005400 | 3300031507 | Bacteria | 17788 |
| 748 | Ga0307408_100004133 | 3300031548 | Bacteria | 9883 |
| 749 | Ga0307408_100233060 | 3300031548 | Bacteria | 1509 |
| 750 | Ga0316576_10120432 | 3300031727 | Bacteria | 1970 |
| 751 | Ga0316578_10016124 | 3300031728 | Bacteria | 4037 |
| 752 | Ga0307405_10007682 | 3300031731 | Bacteria | 5416 |
| 753 | Ga0307410_10016725 | 3300031852 | Bacteria | 4385 |
| 754 | Ga0307406_10008001 | 3300031901 | Bacteria | 5889 |
| 755 | Ga0307406_10080872 | 3300031901 | Bacteria | 2159 |
| 756 | Ga0307412_10012020 | 3300031911 | Bacteria | 5030 |
| 757 | Ga0307409_100004668 | 3300031995 | Bacteria | 7747 |
| 758 | Ga0307409_100127309 | 3300031995 | Bacteria | 2169 |
| 759 | Ga0307416_100000605 | 3300032002 | Bacteria | 18488 |
| 760 | Ga0307416_100191448 | 3300032002 | Bacteria | 1930 |
| 761 | Ga0307414_10004572 | 3300032004 | Bacteria | 7528 |
| 762 | Ga0307411_10058544 | 3300032005 | Bacteria | 2550 |
| 763 | Ga0307415_100004707 | 3300032126 | Bacteria | 7140 |
| 764 | Ga0373950_0016590 | 3300034818 | Bacteria | 1261 |
| 765 | Ga0373958_0004283 | 3300034819 | Bacteria | 2105 |
| 766 | Ga0373938_0006621 | 3300034957 | Bacteria | 2010 |
| 767 | Ga0373926_0086634 | 3300035083 | Bacteria | 1162 |
| 768 | Ga0373934_0000323 | 3300035086 | Bacteria | 16843 |
| 769 | Ga0373940_0009176 | 3300035088 | Bacteria | 2293 |
| 770 | Ga0373951_0001465 | 3300035091 | Bacteria | 6181 |
| 771 | Ga0373952_0002185 | 3300035092 | Bacteria | 3518 |
| 772 | Ga0373932_0001201 | 3300035112 | Bacteria | 7383 |
| 773 | Ga0373936_0023260 | 3300035113 | Bacteria | 2414 |
| 774 | Ga0373939_0005514 | 3300035114 | Bacteria | 3017 |
| 775 | Ga0373953_0010189 | 3300035117 | Bacteria | 3260 |
| 776 | Ga0373954_0015478 | 3300035118 | Bacteria | 3410 |
| 777 | Ga0373956_0004608 | 3300035119 | Bacteria | 5510 |
| 778 | Ga0373956_0018013 | 3300035119 | Bacteria | 2987 |
| 779 | Ga0373960_0001714 | 3300035121 | Bacteria | 4912 |
| 780 | Ga0373943_0008378 | 3300035170 | Bacteria | 4639 |
| 781 | Ga0373943_0146183 | 3300035170 | Bacteria | 1277 |
| 782 | Ga0373955_0016372 | 3300035172 | Bacteria | 3648 |
| 783 | Ga0373955_0028932 | 3300035172 | Bacteria | 2877 |
| 784 | Ga0373942_0002890 | 3300035207 | Bacteria | 4077 |
| 785 | Ga0373961_0000931 | 3300035241 | Bacteria | 9764 |
| 786 | Ga0373962_0000951 | 3300035242 | Bacteria | 6679 |
| 787 | Ga0373931_0015368 | 3300035691 | Bacteria | 3753 |
| 788 | Ga0373931_0027486 | 3300035691 | Bacteria | 2905 |
| 789 | Ga0373935_0019050 | 3300035692 | Bacteria | 4185 |
| 790 | Ga0373935_0021952 | 3300035692 | Bacteria | 3909 |
| 791 | Ga0373935_0105576 | 3300035692 | Bacteria | 1863 |
| 792 | Ga0373927_0005808 | 3300035695 | Bacteria | 8467 |
| 793 | Ga0373933_0021210 | 3300035724 | Bacteria | 3688 |
| 794 | Ga0373933_0091542 | 3300035724 | Unclassified | 1877 |
| 795 | Ga0373947_0029890 | 3300035725 | Bacteria | 3198 |
| 796 | Ga0373947_0044571 | 3300035725 | Bacteria | 2652 |
| 797 | Ga0373947_0080090 | 3300035725 | Unclassified | 2020 |
| 798 | Ga0373937_0013437 | 3300036401 | Bacteria | 7213 |
| 799 | Ga0373937_0015347 | 3300036401 | Bacteria | 6775 |
| 800 | Ga0373937_0048754 | 3300036401 | Bacteria | 3877 |
| 801 | Ga0373937_0122221 | 3300036401 | Unclassified | 2427 |
| 802 | Ga0373937_0200743 | 3300036401 | Unclassified | 1875 |
| 803 | Ga0373937_0273085 | 3300036401 | Bacteria | 1596 |
| 804 | Ga0316584_0001131 | 3300036712 | Bacteria | 15666 |
| 805 | Ga0373925_0010539 | 3300037068 | Bacteria | 6704 |
| 806 | Ga0373925_0010955 | 3300037068 | Bacteria | 6580 |
| 807 | Ga0373925_0057697 | 3300037068 | Bacteria | 2909 |
| 808 | Ga0373925_0058512 | 3300037068 | Bacteria | 2890 |
| 809 | Ga0395898_0325404 | 3300037466 | Bacteria | 1466 |
| 810 | Ga0395905_0023172 | 3300037471 | Bacteria | 5870 |
| 811 | Ga0395905_0048659 | 3300037471 | Bacteria | 3973 |
| 812 | Ga0395905_0096348 | 3300037471 | Unclassified | 2778 |
| 813 | Ga0395905_0124328 | 3300037471 | Bacteria | 2425 |
| 814 | Ga0395905_0132428 | 3300037471 | Bacteria | 2345 |
| 815 | Ga0395905_0244601 | 3300037471 | Bacteria | 1676 |
| 816 | Ga0436365_0409719 | 3300039437 | Bacteria | 3331 |
| 817 | Ga0451807_2187363 | 3300041486 | Bacteria | 6071 |
| 818 | Ga0450896_002822 | 3300042133 | Bacteria | 2269 |
| 819 | Ga0451577_0008592 | 3300042876 | Bacteria | 9931 |
| 820 | Ga0439440_0023534 | 3300042993 | Bacteria | 1406 |
| 821 | Ga0453683_0005527 | 3300044673 | Bacteria | 8810 |
| 822 | Ga0453683_0136003 | 3300044673 | Bacteria | 1550 |
| 823 | Ga0453684_0090989 | 3300044712 | Bacteria | 3768 |
| 824 | Ga0451576_0011708 | 3300045051 | Bacteria | 9938 |
| 825 | Ga0451576_0019279 | 3300045051 | Bacteria | 7447 |
| 826 | Ga0451576_0042805 | 3300045051 | Bacteria | 4781 |
| 827 | Ga0451576_0048611 | 3300045051 | Bacteria | 4454 |
| 828 | Ga0451576_0192576 | 3300045051 | Bacteria | 2130 |
| 829 | Ga0495592_0028956 | 3300046454 | Unclassified | 4193 |
| 830 | Ga0495592_0040306 | 3300046454 | Bacteria | 3505 |
| 831 | Ga0495592_0228326 | 3300046454 | Bacteria | 1241 |
| 832 | Ga0495629_0005805 | 3300046459 | Bacteria | 9209 |
| 833 | Ga0495638_0007473 | 3300046460 | Bacteria | 7831 |
| 834 | Ga0495651_0028800 | 3300046462 | Unclassified | 4329 |
| 835 | Ga0495653_0226725 | 3300046463 | Unclassified | 1253 |
| 836 | Ga0495650_0000045 | 3300046471 | Bacteria | 346204 |
| 837 | Ga0495580_0000558 | 3300046472 | Bacteria | 31485 |
| 838 | Ga0495580_0000961 | 3300046472 | Bacteria | 25258 |
| 839 | Ga0495580_0036817 | 3300046472 | Unclassified | 3513 |
| 840 | Ga0495582_0000315 | 3300046473 | Bacteria | 26627 |
| 841 | Ga0495582_0009594 | 3300046473 | Bacteria | 5330 |
| 842 | Ga0495582_0044677 | 3300046473 | Unclassified | 2440 |
| 843 | Ga0495639_0016096 | 3300046475 | Bacteria | 3244 |
| 844 | Ga0495639_0031988 | 3300046475 | Bacteria | 2345 |
| 845 | Ga0495639_0040354 | 3300046475 | Bacteria | 2100 |
| 846 | Ga0495664_0014975 | 3300046477 | Bacteria | 4404 |
| 847 | Ga0495664_0188728 | 3300046477 | Unclassified | 1250 |
| 848 | Ga0495606_0009164 | 3300046507 | Bacteria | 8419 |
| 849 | Ga0495608_0000709 | 3300046511 | Bacteria | 23212 |
| 850 | Ga0495610_0000024 | 3300046512 | Bacteria | 304748 |
| 851 | Ga0495618_0000587 | 3300046514 | Bacteria | 25927 |
| 852 | Ga0495628_0023573 | 3300046516 | Bacteria | 5050 |
| 853 | Ga0495628_0106722 | 3300046516 | Bacteria | 2157 |
| 854 | Ga0495628_0270852 | 3300046516 | Bacteria | 1263 |
| 855 | Ga0495630_0166890 | 3300046517 | Unclassified | 1676 |
| 856 | Ga0495648_0024034 | 3300046524 | Bacteria | 4160 |
| 857 | Ga0495663_0001266 | 3300046525 | Bacteria | 8032 |
| 858 | Ga0495654_0000010 | 3300046530 | Bacteria | 378481 |
| 859 | Ga0495665_0002082 | 3300046531 | Bacteria | 10837 |
| 860 | Ga0495665_0007984 | 3300046531 | Bacteria | 5740 |
| 861 | Ga0495640_0020040 | 3300046533 | Bacteria | 4930 |
| 862 | Ga0495587_0005837 | 3300046536 | Bacteria | 8016 |
| 863 | Ga0495587_0086343 | 3300046536 | Bacteria | 1816 |
| 864 | Ga0495598_0000193 | 3300046537 | Bacteria | 10779 |
| 865 | Ga0495667_0018926 | 3300046559 | Bacteria | 4649 |
| 866 | Ga0495667_0103860 | 3300046559 | Bacteria | 1838 |
| 867 | Ga0495634_0011628 | 3300046642 | Bacteria | 6401 |
| 868 | Ga0495625_0000033 | 3300046660 | Bacteria | 228108 |
| 869 | Ga0495625_0002447 | 3300046660 | Bacteria | 20057 |
| 870 | Ga0495635_0040916 | 3300046663 | Unclassified | 3202 |
| 871 | Ga0495635_0122520 | 3300046663 | Bacteria | 1773 |
| 872 | Ga0495635_0197181 | 3300046663 | Unclassified | 1366 |
| 873 | Ga0495599_0056107 | 3300046678 | Unclassified | 2465 |
| 874 | Ga0495599_0106591 | 3300046678 | Bacteria | 1746 |
| 875 | Ga0495658_0012020 | 3300046683 | Bacteria | 4371 |
| 876 | Ga0495658_0042589 | 3300046683 | Bacteria | 2536 |
| 877 | Ga0495669_0020611 | 3300046684 | Bacteria | 2854 |
| 878 | Ga0495613_0003782 | 3300046689 | Bacteria | 11343 |
| 879 | Ga0495613_0209322 | 3300046689 | Bacteria | 1372 |
| 880 | Ga0495671_0041698 | 3300046692 | Bacteria | 2310 |
| 881 | Ga0495600_0036083 | 3300046809 | Bacteria | 3213 |
| 882 | Ga0495600_0147790 | 3300046809 | Bacteria | 1523 |
| 883 | Ga0495581_0022153 | 3300047315 | Bacteria | 3682 |
| 884 | Ga0495604_0248231 | 3300047317 | Unclassified | 1214 |
| 885 | Ga0495674_0014008 | 3300047319 | Bacteria | 7518 |
| 886 | Ga0495674_0096597 | 3300047319 | Bacteria | 2518 |
| 887 | Ga0495674_0104991 | 3300047319 | Bacteria | 2401 |
| 888 | Ga0495672_0028744 | 3300047320 | Bacteria | 3511 |
| 889 | Ga0495676_0063232 | 3300047321 | Bacteria | 2886 |
| 890 | Ga0495680_0014624 | 3300047322 | Bacteria | 6792 |
| 891 | Ga0495680_0203628 | 3300047322 | Bacteria | 1419 |
| 892 | Ga0495675_0000762 | 3300047444 | Bacteria | 20167 |
| 893 | Ga0495675_0049039 | 3300047444 | Bacteria | 2685 |
| 894 | Ga0495681_0066687 | 3300047470 | Bacteria | 1642 |
| 895 | Ga0495684_0038376 | 3300047471 | Unclassified | 3673 |
| 896 | Ga0495684_0043106 | 3300047471 | Bacteria | 3454 |
| 897 | Ga0495684_0055898 | 3300047471 | Unclassified | 3010 |
| 898 | Ga0495602_0074166 | 3300048088 | Unclassified | 2893 |
| 899 | Ga0496100_0071207 | 3300048903 | Bacteria | 2321 |
| 900 | Ga0496102_0027357 | 3300048905 | Bacteria | 5093 |
| 901 | Ga0496104_0029250 | 3300048907 | Bacteria | 5110 |
| 902 | Ga0496105_0031370 | 3300048908 | Bacteria | 4357 |
| 903 | Ga0496105_0165085 | 3300048908 | Unclassified | 1817 |
| 904 | Ga0496108_0208960 | 3300048911 | Bacteria | 1694 |
| 905 | Ga0496109_0156602 | 3300048912 | Bacteria | 2134 |
| 906 | Ga0496112_0034481 | 3300048915 | Bacteria | 4925 |
| 907 | Ga0496112_0039480 | 3300048915 | Bacteria | 4614 |
| 908 | Ga0496112_0081811 | 3300048915 | Bacteria | 3194 |
| 909 | Ga0496112_0102576 | 3300048915 | Bacteria | 2831 |
| 910 | Ga0496113_0123627 | 3300048916 | Bacteria | 2025 |
| 911 | Ga0496114_0005144 | 3300048917 | Bacteria | 10201 |
| 912 | Ga0496114_0089365 | 3300048917 | Bacteria | 2614 |
| 913 | Ga0496115_0013076 | 3300048918 | Bacteria | 6268 |
| 914 | Ga0496115_0029811 | 3300048918 | Bacteria | 4288 |
| 915 | Ga0496126_0010655 | 3300048929 | Bacteria | 9614 |
| 916 | Ga0501291_002334 | 3300049514 | Unclassified | 2261 |
| 917 | Ga0501296_001988 | 3300049519 | Unclassified | 2095 |
| 918 | Ga0501298_000718 | 3300049521 | Bacteria | 4638 |
| 919 | Ga0501298_001838 | 3300049521 | Unclassified | 3140 |
| 920 | Ga0501299_014370 | 3300049522 | Bacteria | 1376 |
| 921 | Ga0501036_0045618 | 3300049572 | Bacteria | 3713 |
| 922 | Ga0501038_0002013 | 3300049574 | Bacteria | 18771 |
| 923 | Ga0501038_0018009 | 3300049574 | Bacteria | 6379 |
| 924 | Ga0501039_0086994 | 3300049575 | Bacteria | 2434 |
| 925 | Ga0501040_0019587 | 3300049576 | Bacteria | 4502 |
| 926 | Ga0501041_0000056 | 3300049577 | Bacteria | 40879 |
| 927 | Ga0501041_0058117 | 3300049577 | Bacteria | 2366 |
| 928 | Ga0501043_0015748 | 3300049579 | Bacteria | 5928 |
| 929 | Ga0501046_0018609 | 3300049580 | Bacteria | 5773 |
| 930 | Ga0501047_0001175 | 3300049581 | Bacteria | 25953 |
| 931 | Ga0501048_0014054 | 3300049582 | Bacteria | 5933 |
| 932 | Ga0501067_0001640 | 3300049583 | Bacteria | 12294 |
| 933 | Ga0501068_0000102 | 3300049584 | Bacteria | 37184 |
| 934 | Ga0501069_0073254 | 3300049585 | Bacteria | 1920 |
| 935 | Ga0501070_0028058 | 3300049586 | Bacteria | 4721 |
| 936 | Ga0501071_0000181 | 3300049587 | Bacteria | 27971 |
| 937 | Ga0501071_0146738 | 3300049587 | Bacteria | 1759 |
| 938 | Ga0501072_0000031 | 3300049588 | Bacteria | 128377 |
| 939 | Ga0501072_0002955 | 3300049588 | Bacteria | 12802 |
| 940 | Ga0501072_0027658 | 3300049588 | Bacteria | 4424 |
| 941 | Ga0501073_0006570 | 3300049589 | Bacteria | 8650 |
| 942 | Ga0501074_0003665 | 3300049590 | Bacteria | 10899 |
| 943 | Ga0501075_0058057 | 3300049591 | Bacteria | 2914 |
| 944 | Ga0501076_0000164 | 3300049592 | Bacteria | 38475 |
| 945 | Ga0501076_0004526 | 3300049592 | Bacteria | 9901 |
| 946 | Ga0501076_0038160 | 3300049592 | Bacteria | 3771 |
| 947 | Ga0501202_002514 | 3300049652 | Bacteria | 3085 |
| 948 | Ga0501207_003645 | 3300049654 | Bacteria | 2061 |
| 949 | Ga0501209_002324 | 3300049656 | Bacteria | 2898 |
| 950 | Ga0501217_000362 | 3300049661 | Bacteria | 7238 |
| 951 | Ga0501223_001430 | 3300049663 | Bacteria | 5511 |
| 952 | Ga0501224_003650 | 3300049664 | Unclassified | 2160 |
| 953 | Ga0501224_005937 | 3300049664 | Bacteria | 1762 |
| 954 | Ga0501227_003409 | 3300049665 | Bacteria | 3447 |
| 955 | Ga0501235_002159 | 3300049669 | Unclassified | 4222 |
| 956 | Ga0501240_001966 | 3300049673 | Unclassified | 2103 |
| 957 | Ga0501243_002919 | 3300049675 | Bacteria | 2517 |
| 958 | Ga0501251_003383 | 3300049681 | Bacteria | 1592 |
| 959 | Ga0501257_004229 | 3300049686 | Bacteria | 3124 |
| 960 | Ga0501257_024549 | 3300049686 | Bacteria | 1432 |
| 961 | Ga0501225_0002472 | 3300049705 | Bacteria | 5711 |
| 962 | Ga0501225_0003511 | 3300049705 | Bacteria | 4730 |
| 963 | Ga0501225_0008103 | 3300049705 | Unclassified | 3022 |
| 964 | Ga0501234_003334 | 3300049707 | Bacteria | 2524 |
| 965 | Ga0501234_006244 | 3300049707 | Unclassified | 1865 |
| 966 | Ga0501079_0008412 | 3300049741 | Bacteria | 7820 |
| 967 | Ga0501080_0021642 | 3300049742 | Bacteria | 5954 |
| 968 | Ga0501080_0046568 | 3300049742 | Bacteria | 4037 |
| 969 | Ga0501081_0000077 | 3300049743 | Bacteria | 38611 |
| 970 | Ga0501081_0056739 | 3300049743 | Bacteria | 2707 |
| 971 | Ga0501283_003764 | 3300049779 | Unclassified | 2024 |
| 972 | Ga0501283_008782 | 3300049779 | Bacteria | 1463 |
| 973 | Ga0501035_0011181 | 3300049822 | Bacteria | 8312 |
| 974 | Ga0501044_0006402 | 3300049823 | Bacteria | 13015 |
| 975 | Ga0501045_0001345 | 3300049824 | Bacteria | 16303 |
| 976 | Ga0501226_002297 | 3300049853 | Bacteria | 2345 |
| 977 | nmdc:mga00v17_39922_c1 | 3300050491 | Bacteria | 2813 |
| 978 | nmdc:mga0yw44_33681_c1 | 3300050492 | Bacteria | 2995 |
| 979 | nmdc:mga0k408_3808_c1 | 3300050493 | Bacteria | 7996 |
| 980 | nmdc:mga06z11_11279_c1 | 3300050494 | Bacteria | 3849 |
| 981 | nmdc:mga05p37_103682_c1 | 3300050507 | Bacteria | 3500 |
| 982 | nmdc:mga05p37_122502_c1 | 3300050507 | Bacteria | 3194 |
| 983 | nmdc:mga05p37_153595_c1 | 3300050507 | Bacteria | 2814 |
| 984 | nmdc:mga05p37_1622_c1 | 3300050507 | Bacteria | 11969 |
| 985 | nmdc:mga05p37_246936_c1 | 3300050507 | Unclassified | 2142 |
| 986 | nmdc:mga05p37_293002_c1 | 3300050507 | Bacteria | 1936 |
| 987 | nmdc:mga05p37_35163_c1 | 3300050507 | Bacteria | 6142 |
| 988 | nmdc:mga05p37_35707_c1 | 3300050507 | Bacteria | 6096 |
| 989 | nmdc:mga05p37_4187_c1 | 3300050507 | Bacteria | 16861 |
| 990 | nmdc:mga09592_100390_c1 | 3300050508 | Bacteria | 2478 |
| 991 | nmdc:mga09592_13302_c1 | 3300050508 | Bacteria | 6719 |
| 992 | nmdc:mga09592_160053_c1 | 3300050508 | Bacteria | 1945 |
| 993 | nmdc:mga09592_52081_c1 | 3300050508 | Bacteria | 3454 |
| 994 | nmdc:mga0qj67_128687_c1 | 3300050509 | Unclassified | 2050 |
| 995 | nmdc:mga0qj67_290179_c1 | 3300050509 | Bacteria | 1326 |
| 996 | nmdc:mga0qj67_89249_c1 | 3300050509 | Bacteria | 2476 |
| 997 | nmdc:mga06r32_306668_c1 | 3300050510 | Bacteria | 1573 |
| 998 | nmdc:mga08y16_127628_c1 | 3300050511 | Bacteria | 2646 |
| 999 | nmdc:mga08y16_185319_c1 | 3300050511 | Bacteria | 2160 |
| 1000 | nmdc:mga08y16_18887_c1 | 3300050511 | Bacteria | 7261 |
| 1001 | nmdc:mga08y16_195218_c1 | 3300050511 | Bacteria | 2098 |
| 1002 | nmdc:mga08y16_197539_c1 | 3300050511 | Bacteria | 2085 |
| 1003 | nmdc:mga08y16_438369_c1 | 3300050511 | Bacteria | 1334 |
| 1004 | nmdc:mga08y16_4783_c1 | 3300050511 | Bacteria | 14127 |
| 1005 | nmdc:mga08y16_52662_c1 | 3300050511 | Bacteria | 4258 |
| 1006 | nmdc:mga08y16_530_c1 | 3300050511 | Bacteria | 35277 |
| 1007 | nmdc:mga08y16_91616_c1 | 3300050511 | Bacteria | 3168 |
| 1008 | nmdc:mga0n895_121919_c1 | 3300050512 | Bacteria | 2628 |
| 1009 | nmdc:mga0n895_146501_c1 | 3300050512 | Bacteria | 2391 |
| 1010 | nmdc:mga0n895_14823_c1 | 3300050512 | Bacteria | 7093 |
| 1011 | nmdc:mga0n895_15713_c1 | 3300050512 | Bacteria | 6917 |
| 1012 | nmdc:mga0n895_170444_c1 | 3300050512 | Bacteria | 2209 |
| 1013 | nmdc:mga0n895_317679_c1 | 3300050512 | Unclassified | 1578 |
| 1014 | nmdc:mga0n895_38338_c1 | 3300050512 | Bacteria | 4642 |
| 1015 | nmdc:mga0n895_39973_c1 | 3300050512 | Bacteria | 4555 |
| 1016 | nmdc:mga0n895_8024_c1 | 3300050512 | Bacteria | 9108 |
| 1017 | nmdc:mga0n895_8852_c1 | 3300050512 | Bacteria | 8762 |
| 1018 | nmdc:mga0n895_92745_c1 | 3300050512 | Bacteria | 3023 |
| 1019 | nmdc:mga0rr50_100347_c1 | 3300050513 | Bacteria | 2273 |
| 1020 | nmdc:mga0rr50_167671_c1 | 3300050513 | Bacteria | 1787 |
| 1021 | nmdc:mga0rr50_20835_c1 | 3300050513 | Bacteria | 4463 |
| 1022 | nmdc:mga0rr50_209368_c1 | 3300050513 | Bacteria | 1606 |
| 1023 | nmdc:mga0rr50_42037_c1 | 3300050513 | Bacteria | 3335 |
| 1024 | nmdc:mga0rr50_84355_c1 | 3300050513 | Bacteria | 2459 |
| 1025 | nmdc:mga08x19_439_c1 | 3300050514 | Bacteria | 28578 |
| 1026 | nmdc:mga08x19_5637_c1 | 3300050514 | Bacteria | 7398 |
| 1027 | nmdc:mga0a205_10856_c1 | 3300050515 | Bacteria | 8378 |
| 1028 | nmdc:mga0a205_128957_c1 | 3300050515 | Bacteria | 2430 |
| 1029 | nmdc:mga0a205_15367_c1 | 3300050515 | Bacteria | 7154 |
| 1030 | nmdc:mga0a205_154900_c1 | 3300050515 | Bacteria | 2190 |
| 1031 | nmdc:mga0a205_30937_c1 | 3300050515 | Bacteria | 5127 |
| 1032 | nmdc:mga0a205_45526_c1 | 3300050515 | Bacteria | 4231 |
| 1033 | nmdc:mga0a205_83890_c1 | 3300050515 | Bacteria | 3077 |
| 1034 | nmdc:mga0a205_8720_c1 | 3300050515 | Bacteria | 9235 |
| 1035 | Ga0495619_0028449 | 3300053085 | Bacteria | 3606 |
| 1036 | Ga0495619_0120114 | 3300053085 | Bacteria | 1801 |
| 1037 | Ga0500578_0000003 | 3300053086 | Bacteria | 266033 |
| 1038 | Ga0500578_0009243 | 3300053086 | Bacteria | 6402 |
| 1039 | Ga0500578_0043913 | 3300053086 | Bacteria | 2869 |
| 1040 | Ga0500597_031061 | 3300053120 | Bacteria | 2199 |
| 1041 | Ga0500608_001777 | 3300053122 | Bacteria | 7703 |
| 1042 | Ga0500658_0003216 | 3300053134 | Bacteria | 6214 |
| 1043 | Ga0500616_0013388 | 3300053153 | Bacteria | 4764 |
| 1044 | Ga0500627_0005934 | 3300053158 | Bacteria | 4104 |
| 1045 | Ga0500645_004166 | 3300053730 | Bacteria | 5630 |
| 1046 | Ga0501084_0000050 | 3300054114 | Bacteria | 92878 |
| 1047 | Ga0501084_0019636 | 3300054114 | Bacteria | 5631 |
| 1048 | Ga0501084_0060748 | 3300054114 | Bacteria | 3164 |
| 1049 | Ga0587071_002305 | 3300060344 | Bacteria | 2572 |
| 1050 | Ga0501082_0000164 | 3300060353 | Bacteria | 56679 |
| 1051 | Ga0501082_0000337 | 3300060353 | Bacteria | 41361 |
| 1052 | Ga0501082_0001219 | 3300060353 | Bacteria | 22593 |
| 1053 | Ga0530510_0000438 | 3300061734 | Bacteria | 26867 |
| 1054 | Ga0530510_0005862 | 3300061734 | Bacteria | 8513 |
| 1055 | Ga0530510_0024406 | 3300061734 | Bacteria | 4313 |
| 1056 | 2644344811 | 2643221661 | Bacteria | 4267604 |
| 1057 | 2644367554 | 2643221666 | Bacteria | 4265935 |
| 1058 | Ga0065715_10094658 | |||
| 1059 | JGI24751J29686_10000015 | |||
| 1060 | rootL2_10182038 | |||
| 1061 | rootH1_10259089 | |||
| 1062 | Ga0065712_10013167 | |||
| 1063 | Ga0065712_10070589 | |||
| 1064 | Ga0065712_10125559 | |||
| 1065 | Ga0065715_10003301 | |||
| 1066 | Ga0065715_10004592 | |||
| 1067 | Ga0065715_10034501 | |||
| 1068 | Ga0065715_10101661 | |||
| 1069 | Ga0065715_10103801 | |||
| 1070 | Ga0065707_10089372 | |||
| 1071 | Ga0065707_10120543 | |||
| 1072 | Ga0070658_10057533 | |||
| 1073 | Ga0070658_10124840 | |||
| 1074 | Ga0070683_100002959 | |||
| 1075 | Ga0070683_100004761 | |||
| 1076 | Ga0070683_100021747 | |||
| 1077 | Ga0070683_100025038 | |||
| 1078 | Ga0070683_100344928 | |||
| 1079 | Ga0070683_100391653 | |||
| 1080 | Ga0070690_100011429 | |||
| 1081 | Ga0070690_100132358 | |||
| 1082 | Ga0070690_100202566 | |||
| 1083 | Ga0070670_100000182 | |||
| 1084 | Ga0070670_100001123 | |||
| 1085 | Ga0070670_100011025 | |||
| 1086 | Ga0070670_100012332 | |||
| 1087 | Ga0070670_100013951 | |||
| 1088 | Ga0070670_100048108 | |||
| 1089 | Ga0070670_100091754 | |||
| 1090 | Ga0070670_100245826 | |||
| 1091 | Ga0068869_100004393 | |||
| 1092 | Ga0068869_100023447 | |||
| 1093 | Ga0068869_100060827 | |||
| 1094 | Ga0070666_10074361 | |||
| 1095 | Ga0070666_10157086 | |||
| 1096 | Ga0070680_100012420 | |||
| 1097 | Ga0070680_100069253 | |||
| 1098 | Ga0070682_100000598 | |||
| 1099 | Ga0070682_100015142 | |||
| 1100 | Ga0070682_100095864 | |||
| 1101 | Ga0070682_100159834 | |||
| 1102 | Ga0068868_100004929 | |||
| 1103 | Ga0068868_100010013 | |||
| 1104 | Ga0070660_100009194 | |||
| 1105 | Ga0070689_100007951 | |||
| 1106 | Ga0070689_100030062 | |||
| 1107 | Ga0070689_100047396 | |||
| 1108 | Ga0070689_100065353 | |||
| 1109 | Ga0070687_100040624 | |||
| 1110 | Ga0070661_100001468 | |||
| 1111 | Ga0070661_100001891 | |||
| 1112 | Ga0070661_100024665 | |||
| 1113 | Ga0070661_100085329 | |||
| 1114 | Ga0070661_100124321 | |||
| 1115 | Ga0070661_100234593 | |||
| 1116 | Ga0070692_10042712 | |||
| 1117 | Ga0070668_100001090 | |||
| 1118 | Ga0070668_100008848 | |||
| 1119 | Ga0070669_100009064 | |||
| 1120 | Ga0070669_100017758 | |||
| 1121 | Ga0070675_100002309 | |||
| 1122 | Ga0070675_100173059 | |||
| 1123 | Ga0070671_100055942 | |||
| 1124 | Ga0070671_100093949 | |||
| 1125 | Ga0070674_100021525 | |||
| 1126 | Ga0070674_100064948 | |||
| 1127 | Ga0070673_100045666 | |||
| 1128 | Ga0070673_100085651 | |||
| 1129 | Ga0070673_100186758 | |||
| 1130 | Ga0070688_100004893 | |||
| 1131 | Ga0070688_100067992 | |||
| 1132 | Ga0070688_100168000 | |||
| 1133 | Ga0070659_100003330 | |||
| 1134 | Ga0070659_100035368 | |||
| 1135 | Ga0070667_100058538 | |||
| 1136 | Ga0070667_100060040 | |||
| 1137 | Ga0070667_100077286 | |||
| 1138 | Ga0070667_100079404 | |||
| 1139 | Ga0070667_100202431 | |||
| 1140 | Ga0070667_100273658 | |||
| 1141 | Ga0070703_10017976 | |||
| 1142 | Ga0070709_10110483 | |||
| 1143 | Ga0070713_100000139 | |||
| 1144 | Ga0070713_100000195 | |||
| 1145 | Ga0070713_100006295 | |||
| 1146 | Ga0070713_100041042 | |||
| 1147 | Ga0070713_100107659 | |||
| 1148 | Ga0070713_100168371 | |||
| 1149 | Ga0070713_100302700 | |||
| 1150 | Ga0070710_10004003 | |||
| 1151 | Ga0070710_10079557 | |||
| 1152 | Ga0070701_10053532 | |||
| 1153 | Ga0070711_100000480 | |||
| 1154 | Ga0070711_100002670 | |||
| 1155 | Ga0070711_100014703 | |||
| 1156 | Ga0070711_100018924 | |||
| 1157 | Ga0070711_100029891 | |||
| 1158 | Ga0070711_100042545 | |||
| 1159 | Ga0070711_100077605 | |||
| 1160 | Ga0070711_100096386 | |||
| 1161 | Ga0070705_100008155 | |||
| 1162 | Ga0070705_100021754 | |||
| 1163 | Ga0070705_100110709 | |||
| 1164 | Ga0070700_100058802 | |||
| 1165 | Ga0070694_100004717 | |||
| 1166 | Ga0070694_100015432 | |||
| 1167 | Ga0070694_100030672 | |||
| 1168 | Ga0070663_100053892 | |||
| 1169 | Ga0070678_100009099 | |||
| 1170 | Ga0070678_100073192 | |||
| 1171 | Ga0070678_100168193 | |||
| 1172 | Ga0070662_100186795 | |||
| 1173 | Ga0070681_10000906 | |||
| 1174 | Ga0070681_10012396 | |||
| 1175 | Ga0070681_10016309 | |||
| 1176 | Ga0068867_100025185 | |||
| 1177 | Ga0068867_100044703 | |||
| 1178 | Ga0070685_10003810 | |||
| 1179 | Ga0070685_10007093 | |||
| 1180 | Ga0070698_100016197 | |||
| 1181 | Ga0070698_100050794 | |||
| 1182 | Ga0070698_100093913 | |||
| 1183 | Ga0070679_100004172 | |||
| 1184 | Ga0070679_100010035 | |||
| 1185 | Ga0070679_100031055 | |||
| 1186 | Ga0070679_100056879 | |||
| 1187 | Ga0070684_100002611 | |||
| 1188 | Ga0070684_100044319 | |||
| 1189 | Ga0070684_100081137 | |||
| 1190 | Ga0070684_100138626 | |||
| 1191 | Ga0070684_100317788 | |||
| 1192 | Ga0070684_100394190 | |||
| 1193 | Ga0070697_100048133 | |||
| 1194 | Ga0070697_100078134 | |||
| 1195 | Ga0068853_100020227 | |||
| 1196 | Ga0068853_100022271 | |||
| 1197 | Ga0068853_100025360 | |||
| 1198 | Ga0068853_100112226 | |||
| 1199 | Ga0068853_100118947 | |||
| 1200 | Ga0070672_100131822 | |||
| 1201 | Ga0070686_100000388 | |||
| 1202 | Ga0070686_100056883 | |||
| 1203 | Ga0070686_100077025 | |||
| 1204 | Ga0070686_100077968 | |||
| 1205 | Ga0070686_100235314 | |||
| 1206 | Ga0070695_100000002 | |||
| 1207 | Ga0070695_100030916 | |||
| 1208 | Ga0070695_100090738 | |||
| 1209 | Ga0070695_100102653 | |||
| 1210 | Ga0070695_100162978 | |||
| 1211 | Ga0070696_100000679 | |||
| 1212 | Ga0070696_100043562 | |||
| 1213 | Ga0070693_100000836 | |||
| 1214 | Ga0070693_100006343 | |||
| 1215 | Ga0070693_100007767 | |||
| 1216 | Ga0070693_100075398 | |||
| 1217 | Ga0070665_100000329 | |||
| 1218 | Ga0070665_100000489 | |||
| 1219 | Ga0070665_100117868 | |||
| 1220 | Ga0070665_100213410 | |||
| 1221 | Ga0070704_100140136 | |||
| 1222 | Ga0070704_100156605 | |||
| 1223 | Ga0068855_100009532 | |||
| 1224 | Ga0068855_100099680 | |||
| 1225 | Ga0068855_100248827 | |||
| 1226 | Ga0070664_100002629 | |||
| 1227 | Ga0070664_100004228 | |||
| 1228 | Ga0070664_100007304 | |||
| 1229 | Ga0070664_100012902 | |||
| 1230 | Ga0070664_100029976 | |||
| 1231 | Ga0070664_100031598 | |||
| 1232 | Ga0070664_100062279 | |||
| 1233 | Ga0070664_100075867 | |||
| 1234 | Ga0070664_100100942 | |||
| 1235 | Ga0068857_100003561 | |||
| 1236 | Ga0068857_100003873 | |||
| 1237 | Ga0068857_100026892 | |||
| 1238 | Ga0068857_100211873 | |||
| 1239 | Ga0068854_100018328 | |||
| 1240 | Ga0068854_100024998 | |||
| 1241 | Ga0068854_100073704 | |||
| 1242 | Ga0068856_100001478 | |||
| 1243 | Ga0068856_100001630 | |||
| 1244 | Ga0068856_100005411 | |||
| 1245 | Ga0068856_100111307 | |||
| 1246 | Ga0070702_100000035 | |||
| 1247 | Ga0070702_100000429 | |||
| 1248 | Ga0070702_100000989 | |||
| 1249 | Ga0070702_100009248 | |||
| 1250 | Ga0070702_100146969 | |||
| 1251 | Ga0068852_100094838 | |||
| 1252 | Ga0068852_100250210 | |||
| 1253 | Ga0068852_100297031 | |||
| 1254 | Ga0068859_100002169 | |||
| 1255 | Ga0068859_100011456 | |||
| 1256 | Ga0068859_100017021 | |||
| 1257 | Ga0068859_100018429 | |||
| 1258 | Ga0068859_100022495 | |||
| 1259 | Ga0068859_100028305 | |||
| 1260 | Ga0068859_100037489 | |||
| 1261 | Ga0068859_100038749 | |||
| 1262 | Ga0068859_100074042 | |||
| 1263 | Ga0068859_100106222 | |||
| 1264 | Ga0068859_100188463 | |||
| 1265 | Ga0068859_100203768 | |||
| 1266 | Ga0068859_100355511 | |||
| 1267 | Ga0068864_100000068 | |||
| 1268 | Ga0068864_100000505 | |||
| 1269 | Ga0068864_100020545 | |||
| 1270 | Ga0068864_100024457 | |||
| 1271 | Ga0068864_100030792 | |||
| 1272 | Ga0068864_100037187 | |||
| 1273 | Ga0068864_100037883 | |||
| 1274 | Ga0068864_100072019 | |||
| 1275 | Ga0068864_100350082 | |||
| 1276 | Ga0068866_10004767 | |||
| 1277 | Ga0068866_10010895 | |||
| 1278 | Ga0068861_100000611 | |||
| 1279 | Ga0068861_100081836 | |||
| 1280 | Ga0068861_100257845 | |||
| 1281 | Ga0068851_10040865 | |||
| 1282 | Ga0068870_10005537 | |||
| 1283 | Ga0068870_10051384 | |||
| 1284 | Ga0068863_100004085 | |||
| 1285 | Ga0068863_100012662 | |||
| 1286 | Ga0068863_100013585 | |||
| 1287 | Ga0068863_100018174 | |||
| 1288 | Ga0068863_100021167 | |||
| 1289 | Ga0068863_100125001 | |||
| 1290 | Ga0068863_100148396 | |||
| 1291 | Ga0068863_100397252 | |||
| 1292 | Ga0068858_100005289 | |||
| 1293 | Ga0068858_100028259 | |||
| 1294 | Ga0068858_100070085 | |||
| 1295 | Ga0068858_100076639 | |||
| 1296 | Ga0068858_100110527 | |||
| 1297 | Ga0068858_100131069 | |||
| 1298 | Ga0068858_100173266 | |||
| 1299 | Ga0068860_100000303 | |||
| 1300 | Ga0068860_100044787 | |||
| 1301 | Ga0068860_100092080 | |||
| 1302 | Ga0068860_100126887 | |||
| 1303 | Ga0068860_100303088 | |||
| 1304 | Ga0068862_100004089 | |||
| 1305 | Ga0068862_100026684 | |||
| 1306 | Ga0068862_100047630 | |||
| 1307 | Ga0068862_100148696 | |||
| 1308 | Ga0068862_100221639 | |||
| 1309 | Ga0068862_100288346 | |||
| 1310 | Ga0068862_100322284 | |||
| 1311 | Ga0070717_10001621 | |||
| 1312 | Ga0070717_10010535 | |||
| 1313 | Ga0070717_10014518 | |||
| 1314 | Ga0070717_10197155 | |||
| 1315 | Ga0075365_10114241 | |||
| 1316 | Ga0070715_10063543 | |||
| 1317 | Ga0070716_100045037 | |||
| 1318 | Ga0070712_100000068 | |||
| 1319 | Ga0070712_100003155 | |||
| 1320 | Ga0070712_100024777 | |||
| 1321 | Ga0070712_100079334 | |||
| 1322 | Ga0070712_100082047 | |||
| 1323 | Ga0070712_100283810 | |||
| 1324 | Ga0075362_10013272 | |||
| 1325 | Ga0075367_10012939 | |||
| 1326 | Ga0075366_10004672 | |||
| 1327 | Ga0097621_100000739 | |||
| 1328 | Ga0097621_100001227 | |||
| 1329 | Ga0097621_100001464 | |||
| 1330 | Ga0097621_100014464 | |||
| 1331 | Ga0097621_100060237 | |||
| 1332 | Ga0097621_100082532 | |||
| 1333 | Ga0097621_100088614 | |||
| 1334 | Ga0097621_100177372 | |||
| 1335 | Ga0097621_100216521 | |||
| 1336 | Ga0068871_100001869 | |||
| 1337 | Ga0068871_100002436 | |||
| 1338 | Ga0068871_100002615 | |||
| 1339 | Ga0068871_100012480 | |||
| 1340 | Ga0068871_100036087 | |||
| 1341 | Ga0068871_100038959 | |||
| 1342 | Ga0068871_100057608 | |||
| 1343 | Ga0068871_100231916 | |||
| 1344 | Ga0068871_100235285 | |||
| 1345 | Ga0075428_100012893 | |||
| 1346 | Ga0075428_100019477 | |||
| 1347 | Ga0075428_100087268 | |||
| 1348 | Ga0075428_100108985 | |||
| 1349 | Ga0075428_100119999 | |||
| 1350 | Ga0075428_100191088 | |||
| 1351 | Ga0075428_100296925 | |||
| 1352 | Ga0075428_100380739 | |||
| 1353 | Ga0075430_100038458 | |||
| 1354 | Ga0075430_100101103 | |||
| 1355 | Ga0075430_100122888 | |||
| 1356 | Ga0075430_100269535 | |||
| 1357 | Ga0075431_100094550 | |||
| 1358 | Ga0075431_100099234 | |||
| 1359 | Ga0075431_100242873 | |||
| 1360 | Ga0075433_10017964 | |||
| 1361 | Ga0075433_10032523 | |||
| 1362 | Ga0075434_100000752 | |||
| 1363 | Ga0075434_100003967 | |||
| 1364 | Ga0075434_100019695 | |||
| 1365 | Ga0075434_100020588 | |||
| 1366 | Ga0075434_100043609 | |||
| 1367 | Ga0075434_100085599 | |||
| 1368 | Ga0075434_100108387 | |||
| 1369 | Ga0075434_100157313 | |||
| 1370 | Ga0075434_100186025 | |||
| 1371 | Ga0075434_100507126 | |||
| 1372 | Ga0075429_100006558 | |||
| 1373 | Ga0075429_100053515 | |||
| 1374 | Ga0075429_100098012 | |||
| 1375 | Ga0068865_100122940 | |||
| 1376 | Ga0068865_100160258 | |||
| 1377 | Ga0075436_100000125 | |||
| 1378 | Ga0075436_100229523 | |||
| 1379 | Ga0097620_100002169 | |||
| 1380 | Ga0097620_100011456 | |||
| 1381 | Ga0097620_100017021 | |||
| 1382 | Ga0097620_100018429 | |||
| 1383 | Ga0097620_100022495 | |||
| 1384 | Ga0097620_100028305 | |||
| 1385 | Ga0097620_100037489 | |||
| 1386 | Ga0097620_100038749 | |||
| 1387 | Ga0097620_100074034 | |||
| 1388 | Ga0097620_100106223 | |||
| 1389 | Ga0097620_100188445 | |||
| 1390 | Ga0097620_100203768 | |||
| 1391 | Ga0097620_100355527 | |||
| 1392 | Ga0075435_100000242 | |||
| 1393 | Ga0075435_100003023 | |||
| 1394 | Ga0075435_100009050 | |||
| 1395 | Ga0075435_100020329 | |||
| 1396 | Ga0075435_100035457 | |||
| 1397 | Ga0075435_100121793 | |||
| 1398 | Ga0075435_100173479 | |||
| 1399 | Ga0099795_10004242 | |||
| 1400 | Ga0105240_10101159 | |||
| 1401 | Ga0111539_10000116 | |||
| 1402 | Ga0111539_10005883 | |||
| 1403 | Ga0111539_10010270 | |||
| 1404 | Ga0111539_10010922 | |||
| 1405 | Ga0111539_10022058 | |||
| 1406 | Ga0111539_10131018 | |||
| 1407 | Ga0111539_10225433 | |||
| 1408 | Ga0111539_10245041 | |||
| 1409 | Ga0111539_10352277 | |||
| 1410 | Ga0105245_10003927 | |||
| 1411 | Ga0105245_10060024 | |||
| 1412 | Ga0105245_10351234 | |||
| 1413 | Ga0105245_10369053 | |||
| 1414 | Ga0105247_10002892 | |||
| 1415 | Ga0105247_10116730 | |||
| 1416 | Ga0114129_10002377 | |||
| 1417 | Ga0114129_10003649 | |||
| 1418 | Ga0114129_10021105 | |||
| 1419 | Ga0114129_10040942 | |||
| 1420 | Ga0114129_10064441 | |||
| 1421 | Ga0114129_10074579 | |||
| 1422 | Ga0114129_10177577 | |||
| 1423 | Ga0114129_10216717 | |||
| 1424 | Ga0114129_10334138 | |||
| 1425 | Ga0114129_10499771 | |||
| 1426 | Ga0105243_10000419 | |||
| 1427 | Ga0105243_10013767 | |||
| 1428 | Ga0105241_10006596 | |||
| 1429 | Ga0105241_10017513 | |||
| 1430 | Ga0105241_10019500 | |||
| 1431 | Ga0105241_10143449 | |||
| 1432 | Ga0105241_10177089 | |||
| 1433 | Ga0105241_10386167 | |||
| 1434 | Ga0105241_10395121 | |||
| 1435 | Ga0105242_10000162 | |||
| 1436 | Ga0105242_10004177 | |||
| 1437 | Ga0105242_10010323 | |||
| 1438 | Ga0105242_10024640 | |||
| 1439 | Ga0105242_10353472 | |||
| 1440 | Ga0105248_10001543 | |||
| 1441 | Ga0105248_10011406 | |||
| 1442 | Ga0105248_10026373 | |||
| 1443 | Ga0105248_10031945 | |||
| 1444 | Ga0105248_10040359 | |||
| 1445 | Ga0105248_10048130 | |||
| 1446 | Ga0105248_10197542 | |||
| 1447 | Ga0105248_10284697 | |||
| 1448 | Ga0105248_10288985 | |||
| 1449 | Ga0105248_10338855 | |||
| 1450 | Ga0105237_10163649 | |||
| 1451 | Ga0105238_10000910 | |||
| 1452 | Ga0105238_10014550 | |||
| 1453 | Ga0105238_10030107 | |||
| 1454 | Ga0105238_10136428 | |||
| 1455 | Ga0105238_10185815 | |||
| 1456 | Ga0105249_10006716 | |||
| 1457 | Ga0105249_10030009 | |||
| 1458 | Ga0105249_10206610 | |||
| 1459 | Ga0105249_10282160 | |||
| 1460 | Ga0099796_10015084 | |||
| 1461 | Ga0105239_10008079 | |||
| 1462 | Ga0105239_10010869 | |||
| 1463 | Ga0105239_10066350 | |||
| 1464 | Ga0105239_10112714 | |||
| 1465 | Ga0105239_10273303 | |||
| 1466 | Ga0105239_10309161 | |||
| 1467 | Ga0105239_10383426 | |||
| 1468 | Ga0105246_10029689 | |||
| 1469 | Ga0105246_10084282 | |||
| 1470 | Ga0157373_10002998 | |||
| 1471 | Ga0157373_10004351 | |||
| 1472 | Ga0157373_10055027 | |||
| 1473 | Ga0157373_10187404 | |||
| 1474 | Ga0157369_10013891 | |||
| 1475 | Ga0157369_10014806 | |||
| 1476 | Ga0157369_10040623 | |||
| 1477 | Ga0157374_10000425 | |||
| 1478 | Ga0157374_10000477 | |||
| 1479 | Ga0157374_10007647 | |||
| 1480 | Ga0157374_10026181 | |||
| 1481 | Ga0157374_10058371 | |||
| 1482 | Ga0157374_10072860 | |||
| 1483 | Ga0157374_10133832 | |||
| 1484 | Ga0157374_10159590 | |||
| 1485 | Ga0157374_10208050 | |||
| 1486 | Ga0157374_10357462 | |||
| 1487 | Ga0157378_10000082 | |||
| 1488 | Ga0157378_10001226 | |||
| 1489 | Ga0157378_10001328 | |||
| 1490 | Ga0157378_10016738 | |||
| 1491 | Ga0157378_10017317 | |||
| 1492 | Ga0157378_10023027 | |||
| 1493 | Ga0157378_10100594 | |||
| 1494 | Ga0157378_10125132 | |||
| 1495 | Ga0163162_10031097 | |||
| 1496 | Ga0163162_10036124 | |||
| 1497 | Ga0163162_10054294 | |||
| 1498 | Ga0163162_10063133 | |||
| 1499 | Ga0163162_10081811 | |||
| 1500 | Ga0163162_10122176 | |||
| 1501 | Ga0163162_10157968 | |||
| 1502 | Ga0163162_10245167 | |||
| 1503 | Ga0163162_10560866 | |||
| 1504 | Ga0163162_10656363 | |||
| 1505 | Ga0157372_10001675 | |||
| 1506 | Ga0157372_10003558 | |||
| 1507 | Ga0157372_10004152 | |||
| 1508 | Ga0157372_10007396 | |||
| 1509 | Ga0157372_10017976 | |||
| 1510 | Ga0157372_10074383 | |||
| 1511 | Ga0157372_10126957 | |||
| 1512 | Ga0157372_10421497 | |||
| 1513 | Ga0157375_10002492 | |||
| 1514 | Ga0157375_10004861 | |||
| 1515 | Ga0157375_10015692 | |||
| 1516 | Ga0157375_10016209 | |||
| 1517 | Ga0157375_10190015 | |||
| 1518 | Ga0157375_10230644 | |||
| 1519 | Ga0157375_10328137 | |||
| 1520 | Ga0157375_10645525 | |||
| 1521 | Ga0163163_10000495 | |||
| 1522 | Ga0163163_10001144 | |||
| 1523 | Ga0163163_10001705 | |||
| 1524 | Ga0163163_10003211 | |||
| 1525 | Ga0163163_10004961 | |||
| 1526 | Ga0163163_10009445 | |||
| 1527 | Ga0163163_10029619 | |||
| 1528 | Ga0163163_10104037 | |||
| 1529 | Ga0163163_10121701 | |||
| 1530 | Ga0163163_10155939 | |||
| 1531 | Ga0163163_10164891 | |||
| 1532 | Ga0163163_10211087 | |||
| 1533 | Ga0157380_10100665 | |||
| 1534 | Ga0157380_10115285 | |||
| 1535 | Ga0157380_10260936 | |||
| 1536 | Ga0157377_10001335 | |||
| 1537 | Ga0157377_10044224 | |||
| 1538 | Ga0157377_10046124 | |||
| 1539 | Ga0157377_10117194 | |||
| 1540 | Ga0157379_10000585 | |||
| 1541 | Ga0157379_10031291 | |||
| 1542 | Ga0157379_10031430 | |||
| 1543 | Ga0157379_10074127 | |||
| 1544 | Ga0157379_10308804 | |||
| 1545 | Ga0157376_10000017 | |||
| 1546 | Ga0157376_10001723 | |||
| 1547 | Ga0157376_10007450 | |||
| 1548 | Ga0157376_10066376 | |||
| 1549 | Ga0157376_10079588 | |||
| 1550 | Ga0157376_10398198 | |||
| 1551 | Ga0163161_10026495 | |||
| 1552 | Ga0163161_10055402 | |||
| 1553 | Ga0163161_10074294 | |||
| 1554 | Ga0213876_10036799 | |||
| 1555 | Ga0224572_1008541 | |||
| 1556 | Ga0209758_1002835 | |||
| 1557 | Ga0207697_10015984 | |||
| 1558 | Ga0207656_10026445 | |||
| 1559 | Ga0207692_10002604 | |||
| 1560 | Ga0207692_10012351 | |||
| 1561 | Ga0207692_10027747 | |||
| 1562 | Ga0207692_10051978 | |||
| 1563 | Ga0207642_10014700 | |||
| 1564 | Ga0207642_10111421 | |||
| 1565 | Ga0207710_10001465 | |||
| 1566 | Ga0207688_10048037 | |||
| 1567 | Ga0207680_10020014 | |||
| 1568 | Ga0207647_10016615 | |||
| 1569 | Ga0207647_10097505 | |||
| 1570 | Ga0207699_10002098 | |||
| 1571 | Ga0207699_10083224 | |||
| 1572 | Ga0207645_10050981 | |||
| 1573 | Ga0207643_10007238 | |||
| 1574 | Ga0207643_10024801 | |||
| 1575 | Ga0207643_10037956 | |||
| 1576 | Ga0207643_10070802 | |||
| 1577 | Ga0207643_10132504 | |||
| 1578 | Ga0207705_10039977 | |||
| 1579 | Ga0207705_10191550 | |||
| 1580 | Ga0207654_10026183 | |||
| 1581 | Ga0207654_10040851 | |||
| 1582 | Ga0207654_10164105 | |||
| 1583 | Ga0207707_10003174 | |||
| 1584 | Ga0207707_10024436 | |||
| 1585 | Ga0207707_10176253 | |||
| 1586 | Ga0207707_10238299 | |||
| 1587 | Ga0207707_10323356 | |||
| 1588 | Ga0207671_10100082 | |||
| 1589 | Ga0207693_10000057 | |||
| 1590 | Ga0207693_10009295 | |||
| 1591 | Ga0207693_10016441 | |||
| 1592 | Ga0207693_10071493 | |||
| 1593 | Ga0207693_10101829 | |||
| 1594 | Ga0207693_10132833 | |||
| 1595 | Ga0207663_10003566 | |||
| 1596 | Ga0207660_10039627 | |||
| 1597 | Ga0207660_10120078 | |||
| 1598 | Ga0207662_10002208 | |||
| 1599 | Ga0207662_10051407 | |||
| 1600 | Ga0207662_10069798 | |||
| 1601 | Ga0207657_10012045 | |||
| 1602 | Ga0207657_10057579 | |||
| 1603 | Ga0207657_10238437 | |||
| 1604 | Ga0207649_10001696 | |||
| 1605 | Ga0207649_10004170 | |||
| 1606 | Ga0207649_10015254 | |||
| 1607 | Ga0207649_10082275 | |||
| 1608 | Ga0207649_10109102 | |||
| 1609 | Ga0207652_10003412 | |||
| 1610 | Ga0207652_10032862 | |||
| 1611 | Ga0207652_10229517 | |||
| 1612 | Ga0207681_10017573 | |||
| 1613 | Ga0207681_10057025 | |||
| 1614 | Ga0207681_10093051 | |||
| 1615 | Ga0207694_10003021 | |||
| 1616 | Ga0207694_10011735 | |||
| 1617 | Ga0207650_10000017 | |||
| 1618 | Ga0207650_10000161 | |||
| 1619 | Ga0207650_10010243 | |||
| 1620 | Ga0207650_10010256 | |||
| 1621 | Ga0207650_10012827 | |||
| 1622 | Ga0207650_10016847 | |||
| 1623 | Ga0207650_10034247 | |||
| 1624 | Ga0207650_10040727 | |||
| 1625 | Ga0207650_10043812 | |||
| 1626 | Ga0207650_10051839 | |||
| 1627 | Ga0207650_10090144 | |||
| 1628 | Ga0207650_10231074 | |||
| 1629 | Ga0207650_10307021 | |||
| 1630 | Ga0207659_10010513 | |||
| 1631 | Ga0207659_10043054 | |||
| 1632 | Ga0207659_10271536 | |||
| 1633 | Ga0207687_10015698 | |||
| 1634 | Ga0207687_10088679 | |||
| 1635 | Ga0207687_10227108 | |||
| 1636 | Ga0207700_10000377 | |||
| 1637 | Ga0207700_10001680 | |||
| 1638 | Ga0207700_10009335 | |||
| 1639 | Ga0207700_10126814 | |||
| 1640 | Ga0207700_10137552 | |||
| 1641 | Ga0207664_10000973 | |||
| 1642 | Ga0207664_10042923 | |||
| 1643 | Ga0207644_10059757 | |||
| 1644 | Ga0207644_10119806 | |||
| 1645 | Ga0207690_10105895 | |||
| 1646 | Ga0207706_10009128 | |||
| 1647 | Ga0207706_10049873 | |||
| 1648 | Ga0207706_10101578 | |||
| 1649 | Ga0207686_10000069 | |||
| 1650 | Ga0207686_10024701 | |||
| 1651 | Ga0207686_10055668 | |||
| 1652 | Ga0207709_10000025 | |||
| 1653 | Ga0207709_10009789 | |||
| 1654 | Ga0207670_10002826 | |||
| 1655 | Ga0207670_10009696 | |||
| 1656 | Ga0207670_10028399 | |||
| 1657 | Ga0207670_10028594 | |||
| 1658 | Ga0207670_10058652 | |||
| 1659 | Ga0207670_10241135 | |||
| 1660 | Ga0207669_10004295 | |||
| 1661 | Ga0207669_10008824 | |||
| 1662 | Ga0207704_10024761 | |||
| 1663 | Ga0207704_10031390 | |||
| 1664 | Ga0207704_10054741 | |||
| 1665 | Ga0207665_10002196 | |||
| 1666 | Ga0207665_10003791 | |||
| 1667 | Ga0207665_10026876 | |||
| 1668 | Ga0207665_10054987 | |||
| 1669 | Ga0207691_10001839 | |||
| 1670 | Ga0207691_10048778 | |||
| 1671 | Ga0207691_10068402 | |||
| 1672 | Ga0207691_10192256 | |||
| 1673 | Ga0207711_10002939 | |||
| 1674 | Ga0207711_10005519 | |||
| 1675 | Ga0207711_10014282 | |||
| 1676 | Ga0207711_10063865 | |||
| 1677 | Ga0207711_10094626 | |||
| 1678 | Ga0207711_10133361 | |||
| 1679 | Ga0207711_10140745 | |||
| 1680 | Ga0207711_10147609 | |||
| 1681 | Ga0207711_10154589 | |||
| 1682 | Ga0207711_10255218 | |||
| 1683 | Ga0207689_10003244 | |||
| 1684 | Ga0207689_10008816 | |||
| 1685 | Ga0207689_10060268 | |||
| 1686 | Ga0207689_10070006 | |||
| 1687 | Ga0207689_10094510 | |||
| 1688 | Ga0207689_10165502 | |||
| 1689 | Ga0207689_10306345 | |||
| 1690 | Ga0207661_10002094 | |||
| 1691 | Ga0207661_10002500 | |||
| 1692 | Ga0207661_10296939 | |||
| 1693 | Ga0207679_10000553 | |||
| 1694 | Ga0207679_10001688 | |||
| 1695 | Ga0207679_10020455 | |||
| 1696 | Ga0207679_10052645 | |||
| 1697 | Ga0207679_10066658 | |||
| 1698 | Ga0207679_10088575 | |||
| 1699 | Ga0207679_10089450 | |||
| 1700 | Ga0207679_10228463 | |||
| 1701 | Ga0207667_10080893 | |||
| 1702 | Ga0207651_10024150 | |||
| 1703 | Ga0207651_10024355 | |||
| 1704 | Ga0207651_10048160 | |||
| 1705 | Ga0207651_10050643 | |||
| 1706 | Ga0207712_10005714 | |||
| 1707 | Ga0207712_10010302 | |||
| 1708 | Ga0207712_10151073 | |||
| 1709 | Ga0207668_10000053 | |||
| 1710 | Ga0207668_10000323 | |||
| 1711 | Ga0207668_10008775 | |||
| 1712 | Ga0207640_10012640 | |||
| 1713 | Ga0207640_10022145 | |||
| 1714 | Ga0207640_10031074 | |||
| 1715 | Ga0207640_10111121 | |||
| 1716 | Ga0207640_10188964 | |||
| 1717 | Ga0207658_10000988 | |||
| 1718 | Ga0207658_10028896 | |||
| 1719 | Ga0207658_10139156 | |||
| 1720 | Ga0207677_10107765 | |||
| 1721 | Ga0207703_10000968 | |||
| 1722 | Ga0207703_10008957 | |||
| 1723 | Ga0207703_10039130 | |||
| 1724 | Ga0207703_10044556 | |||
| 1725 | Ga0207703_10057802 | |||
| 1726 | Ga0207703_10151541 | |||
| 1727 | Ga0207703_10161030 | |||
| 1728 | Ga0207639_10016019 | |||
| 1729 | Ga0207708_10051799 | |||
| 1730 | Ga0207708_10052363 | |||
| 1731 | Ga0207708_10146312 | |||
| 1732 | Ga0207708_10188754 | |||
| 1733 | Ga0207708_10201025 | |||
| 1734 | Ga0207702_10002933 | |||
| 1735 | Ga0207702_10005179 | |||
| 1736 | Ga0207702_10200942 | |||
| 1737 | Ga0207641_10000539 | |||
| 1738 | Ga0207641_10015058 | |||
| 1739 | Ga0207641_10019989 | |||
| 1740 | Ga0207641_10021069 | |||
| 1741 | Ga0207641_10055254 | |||
| 1742 | Ga0207641_10080427 | |||
| 1743 | Ga0207641_10115770 | |||
| 1744 | Ga0207641_10238430 | |||
| 1745 | Ga0207648_10010425 | |||
| 1746 | Ga0207648_10013662 | |||
| 1747 | Ga0207648_10015056 | |||
| 1748 | Ga0207648_10046095 | |||
| 1749 | Ga0207648_10068880 | |||
| 1750 | Ga0207648_10081315 | |||
| 1751 | Ga0207676_10000685 | |||
| 1752 | Ga0207676_10003419 | |||
| 1753 | Ga0207676_10003684 | |||
| 1754 | Ga0207676_10008016 | |||
| 1755 | Ga0207676_10008366 | |||
| 1756 | Ga0207676_10014750 | |||
| 1757 | Ga0207676_10049523 | |||
| 1758 | Ga0207676_10060182 | |||
| 1759 | Ga0207676_10066290 | |||
| 1760 | Ga0207676_10208354 | |||
| 1761 | Ga0207676_10399710 | |||
| 1762 | Ga0207674_10000116 | |||
| 1763 | Ga0207674_10002114 | |||
| 1764 | Ga0207674_10007866 | |||
| 1765 | Ga0207674_10009074 | |||
| 1766 | Ga0207674_10011514 | |||
| 1767 | Ga0207674_10011730 | |||
| 1768 | Ga0207674_10011804 | |||
| 1769 | Ga0207675_100002992 | |||
| 1770 | Ga0207675_100005697 | |||
| 1771 | Ga0207675_100020125 | |||
| 1772 | Ga0207675_100051448 | |||
| 1773 | Ga0207675_100075376 | |||
| 1774 | Ga0207675_100089811 | |||
| 1775 | Ga0207683_10005942 | |||
| 1776 | Ga0207683_10149227 | |||
| 1777 | Ga0207698_10044959 | |||
| 1778 | Ga0207698_10124995 | |||
| 1779 | Ga0209984_1003365 | |||
| 1780 | Ga0209982_1001908 | |||
| 1781 | Ga0210002_1009932 | |||
| 1782 | Ga0209813_10025741 | |||
| 1783 | Ga0209974_10004187 | |||
| 1784 | Ga0207428_10000185 | |||
| 1785 | Ga0207428_10000657 | |||
| 1786 | Ga0207428_10007200 | |||
| 1787 | Ga0268266_10000306 | |||
| 1788 | Ga0268266_10000698 | |||
| 1789 | Ga0268266_10018384 | |||
| 1790 | Ga0268266_10101361 | |||
| 1791 | Ga0268266_10183086 | |||
| 1792 | Ga0268265_10045050 | |||
| 1793 | Ga0268265_10217330 | |||
| 1794 | Ga0268265_10234686 | |||
| 1795 | Ga0268264_10000059 | |||
| 1796 | Ga0268264_10028307 | |||
| 1797 | Ga0268264_10064072 | |||
| 1798 | Ga0268264_10068130 | |||
| 1799 | Ga0268264_10255434 | |||
| 1800 | Ga0265338_10009200 | |||
| 1801 | Ga0265760_10000174 | |||
| 1802 | Ga0265760_10001093 | |||
| 1803 | Ga0265760_10015062 | |||
| 1804 | Ga0307509_10005400 | |||
| 1805 | Ga0307408_100004133 | |||
| 1806 | Ga0307408_100233060 | |||
| 1807 | Ga0316576_10120432 | |||
| 1808 | Ga0316578_10016124 | |||
| 1809 | Ga0307405_10007682 | |||
| 1810 | Ga0307410_10016725 | |||
| 1811 | Ga0307406_10008001 | |||
| 1812 | Ga0307406_10080872 | |||
| 1813 | Ga0307412_10012020 | |||
| 1814 | Ga0307409_100004668 | |||
| 1815 | Ga0307409_100127309 | |||
| 1816 | Ga0307416_100000605 | |||
| 1817 | Ga0307416_100191448 | |||
| 1818 | Ga0307414_10004572 | |||
| 1819 | Ga0307411_10058544 | |||
| 1820 | Ga0307415_100004707 | |||
| 1821 | Ga0373950_0016590 | |||
| 1822 | Ga0373958_0004283 | |||
| 1823 | Ga0373938_0006621 | |||
| 1824 | Ga0373926_0086634 | |||
| 1825 | Ga0373934_0000323 | |||
| 1826 | Ga0373940_0009176 | |||
| 1827 | Ga0373951_0001465 | |||
| 1828 | Ga0373952_0002185 | |||
| 1829 | Ga0373932_0001201 | |||
| 1830 | Ga0373936_0023260 | |||
| 1831 | Ga0373939_0005514 | |||
| 1832 | Ga0373953_0010189 | |||
| 1833 | Ga0373954_0015478 | |||
| 1834 | Ga0373956_0004608 | |||
| 1835 | Ga0373956_0018013 | |||
| 1836 | Ga0373960_0001714 | |||
| 1837 | Ga0373943_0008378 | |||
| 1838 | Ga0373943_0146183 | |||
| 1839 | Ga0373955_0016372 | |||
| 1840 | Ga0373955_0028932 | |||
| 1841 | Ga0373942_0002890 | |||
| 1842 | Ga0373961_0000931 | |||
| 1843 | Ga0373962_0000951 | |||
| 1844 | Ga0373931_0015368 | |||
| 1845 | Ga0373931_0027486 | |||
| 1846 | Ga0373935_0019050 | |||
| 1847 | Ga0373935_0021952 | |||
| 1848 | Ga0373935_0105576 | |||
| 1849 | Ga0373927_0005808 | |||
| 1850 | Ga0373933_0021210 | |||
| 1851 | Ga0373933_0091542 | |||
| 1852 | Ga0373947_0029890 | |||
| 1853 | Ga0373947_0044571 | |||
| 1854 | Ga0373947_0080090 | |||
| 1855 | Ga0373937_0013437 | |||
| 1856 | Ga0373937_0015347 | |||
| 1857 | Ga0373937_0048754 | |||
| 1858 | Ga0373937_0122221 | |||
| 1859 | Ga0373937_0200743 | |||
| 1860 | Ga0373937_0273085 | |||
| 1861 | Ga0316584_0001131 | |||
| 1862 | Ga0373925_0010539 | |||
| 1863 | Ga0373925_0010955 | |||
| 1864 | Ga0373925_0057697 | |||
| 1865 | Ga0373925_0058512 | |||
| 1866 | Ga0395898_0325404 | |||
| 1867 | Ga0395905_0023172 | |||
| 1868 | Ga0395905_0048659 | |||
| 1869 | Ga0395905_0096348 | |||
| 1870 | Ga0395905_0124328 | |||
| 1871 | Ga0395905_0132428 | |||
| 1872 | Ga0395905_0244601 | |||
| 1873 | Ga0436365_0409719 | |||
| 1874 | Ga0451807_2187363 | |||
| 1875 | Ga0450896_002822 | |||
| 1876 | Ga0451577_0008592 | |||
| 1877 | Ga0439440_0023534 | |||
| 1878 | Ga0453683_0005527 | |||
| 1879 | Ga0453683_0136003 | |||
| 1880 | Ga0453684_0090989 | |||
| 1881 | Ga0451576_0011708 | |||
| 1882 | Ga0451576_0019279 | |||
| 1883 | Ga0451576_0042805 | |||
| 1884 | Ga0451576_0048611 | |||
| 1885 | Ga0451576_0192576 | |||
| 1886 | Ga0495592_0028956 | |||
| 1887 | Ga0495592_0040306 | |||
| 1888 | Ga0495592_0228326 | |||
| 1889 | Ga0495629_0005805 | |||
| 1890 | Ga0495638_0007473 | |||
| 1891 | Ga0495651_0028800 | |||
| 1892 | Ga0495653_0226725 | |||
| 1893 | Ga0495650_0000045 | |||
| 1894 | Ga0495580_0000558 | |||
| 1895 | Ga0495580_0000961 | |||
| 1896 | Ga0495580_0036817 | |||
| 1897 | Ga0495582_0000315 | |||
| 1898 | Ga0495582_0009594 | |||
| 1899 | Ga0495582_0044677 | |||
| 1900 | Ga0495639_0016096 | |||
| 1901 | Ga0495639_0031988 | |||
| 1902 | Ga0495639_0040354 | |||
| 1903 | Ga0495664_0014975 | |||
| 1904 | Ga0495664_0188728 | |||
| 1905 | Ga0495606_0009164 | |||
| 1906 | Ga0495608_0000709 | |||
| 1907 | Ga0495610_0000024 | |||
| 1908 | Ga0495618_0000587 | |||
| 1909 | Ga0495628_0023573 | |||
| 1910 | Ga0495628_0106722 | |||
| 1911 | Ga0495628_0270852 | |||
| 1912 | Ga0495630_0166890 | |||
| 1913 | Ga0495648_0024034 | |||
| 1914 | Ga0495663_0001266 | |||
| 1915 | Ga0495654_0000010 | |||
| 1916 | Ga0495665_0002082 | |||
| 1917 | Ga0495665_0007984 | |||
| 1918 | Ga0495640_0020040 | |||
| 1919 | Ga0495587_0005837 | |||
| 1920 | Ga0495587_0086343 | |||
| 1921 | Ga0495598_0000193 | |||
| 1922 | Ga0495667_0018926 | |||
| 1923 | Ga0495667_0103860 | |||
| 1924 | Ga0495634_0011628 | |||
| 1925 | Ga0495625_0000033 | |||
| 1926 | Ga0495625_0002447 | |||
| 1927 | Ga0495635_0040916 | |||
| 1928 | Ga0495635_0122520 | |||
| 1929 | Ga0495635_0197181 | |||
| 1930 | Ga0495599_0056107 | |||
| 1931 | Ga0495599_0106591 | |||
| 1932 | Ga0495658_0012020 | |||
| 1933 | Ga0495658_0042589 | |||
| 1934 | Ga0495669_0020611 | |||
| 1935 | Ga0495613_0003782 | |||
| 1936 | Ga0495613_0209322 | |||
| 1937 | Ga0495671_0041698 | |||
| 1938 | Ga0495600_0036083 | |||
| 1939 | Ga0495600_0147790 | |||
| 1940 | Ga0495581_0022153 | |||
| 1941 | Ga0495604_0248231 | |||
| 1942 | Ga0495674_0014008 | |||
| 1943 | Ga0495674_0096597 | |||
| 1944 | Ga0495674_0104991 | |||
| 1945 | Ga0495672_0028744 | |||
| 1946 | Ga0495676_0063232 | |||
| 1947 | Ga0495680_0014624 | |||
| 1948 | Ga0495680_0203628 | |||
| 1949 | Ga0495675_0000762 | |||
| 1950 | Ga0495675_0049039 | |||
| 1951 | Ga0495681_0066687 | |||
| 1952 | Ga0495684_0038376 | |||
| 1953 | Ga0495684_0043106 | |||
| 1954 | Ga0495684_0055898 | |||
| 1955 | Ga0495602_0074166 | |||
| 1956 | Ga0496100_0071207 | |||
| 1957 | Ga0496102_0027357 | |||
| 1958 | Ga0496104_0029250 | |||
| 1959 | Ga0496105_0031370 | |||
| 1960 | Ga0496105_0165085 | |||
| 1961 | Ga0496108_0208960 | |||
| 1962 | Ga0496109_0156602 | |||
| 1963 | Ga0496112_0034481 | |||
| 1964 | Ga0496112_0039480 | |||
| 1965 | Ga0496112_0081811 | |||
| 1966 | Ga0496112_0102576 | |||
| 1967 | Ga0496113_0123627 | |||
| 1968 | Ga0496114_0005144 | |||
| 1969 | Ga0496114_0089365 | |||
| 1970 | Ga0496115_0013076 | |||
| 1971 | Ga0496115_0029811 | |||
| 1972 | Ga0496126_0010655 | |||
| 1973 | Ga0501291_002334 | |||
| 1974 | Ga0501296_001988 | |||
| 1975 | Ga0501298_000718 | |||
| 1976 | Ga0501298_001838 | |||
| 1977 | Ga0501299_014370 | |||
| 1978 | Ga0501036_0045618 | |||
| 1979 | Ga0501038_0002013 | |||
| 1980 | Ga0501038_0018009 | |||
| 1981 | Ga0501039_0086994 | |||
| 1982 | Ga0501040_0019587 | |||
| 1983 | Ga0501041_0000056 | |||
| 1984 | Ga0501041_0058117 | |||
| 1985 | Ga0501043_0015748 | |||
| 1986 | Ga0501046_0018609 | |||
| 1987 | Ga0501047_0001175 | |||
| 1988 | Ga0501048_0014054 | |||
| 1989 | Ga0501067_0001640 | |||
| 1990 | Ga0501068_0000102 | |||
| 1991 | Ga0501069_0073254 | |||
| 1992 | Ga0501070_0028058 | |||
| 1993 | Ga0501071_0000181 | |||
| 1994 | Ga0501071_0146738 | |||
| 1995 | Ga0501072_0000031 | |||
| 1996 | Ga0501072_0002955 | |||
| 1997 | Ga0501072_0027658 | |||
| 1998 | Ga0501073_0006570 | |||
| 1999 | Ga0501074_0003665 | |||
| 2000 | Ga0501075_0058057 | |||
| 2001 | Ga0501076_0000164 | |||
| 2002 | Ga0501076_0004526 | |||
| 2003 | Ga0501076_0038160 | |||
| 2004 | Ga0501202_002514 | |||
| 2005 | Ga0501207_003645 | |||
| 2006 | Ga0501209_002324 | |||
| 2007 | Ga0501217_000362 | |||
| 2008 | Ga0501223_001430 | |||
| 2009 | Ga0501224_003650 | |||
| 2010 | Ga0501224_005937 | |||
| 2011 | Ga0501227_003409 | |||
| 2012 | Ga0501235_002159 | |||
| 2013 | Ga0501240_001966 | |||
| 2014 | Ga0501243_002919 | |||
| 2015 | Ga0501251_003383 | |||
| 2016 | Ga0501257_004229 | |||
| 2017 | Ga0501257_024549 | |||
| 2018 | Ga0501225_0002472 | |||
| 2019 | Ga0501225_0003511 | |||
| 2020 | Ga0501225_0008103 | |||
| 2021 | Ga0501234_003334 | |||
| 2022 | Ga0501234_006244 | |||
| 2023 | Ga0501079_0008412 | |||
| 2024 | Ga0501080_0021642 | |||
| 2025 | Ga0501080_0046568 | |||
| 2026 | Ga0501081_0000077 | |||
| 2027 | Ga0501081_0056739 | |||
| 2028 | Ga0501283_003764 | |||
| 2029 | Ga0501283_008782 | |||
| 2030 | Ga0501035_0011181 | |||
| 2031 | Ga0501044_0006402 | |||
| 2032 | Ga0501045_0001345 | |||
| 2033 | Ga0501226_002297 | |||
| 2034 | nmdc:mga00v17_39922_c1 | |||
| 2035 | nmdc:mga0yw44_33681_c1 | |||
| 2036 | nmdc:mga0k408_3808_c1 | |||
| 2037 | nmdc:mga06z11_11279_c1 | |||
| 2038 | nmdc:mga05p37_103682_c1 | |||
| 2039 | nmdc:mga05p37_122502_c1 | |||
| 2040 | nmdc:mga05p37_153595_c1 | |||
| 2041 | nmdc:mga05p37_1622_c1 | |||
| 2042 | nmdc:mga05p37_246936_c1 | |||
| 2043 | nmdc:mga05p37_293002_c1 | |||
| 2044 | nmdc:mga05p37_35163_c1 | |||
| 2045 | nmdc:mga05p37_35707_c1 | |||
| 2046 | nmdc:mga05p37_4187_c1 | |||
| 2047 | nmdc:mga09592_100390_c1 | |||
| 2048 | nmdc:mga09592_13302_c1 | |||
| 2049 | nmdc:mga09592_160053_c1 | |||
| 2050 | nmdc:mga09592_52081_c1 | |||
| 2051 | nmdc:mga0qj67_128687_c1 | |||
| 2052 | nmdc:mga0qj67_290179_c1 | |||
| 2053 | nmdc:mga0qj67_89249_c1 | |||
| 2054 | nmdc:mga06r32_306668_c1 | |||
| 2055 | nmdc:mga08y16_127628_c1 | |||
| 2056 | nmdc:mga08y16_185319_c1 | |||
| 2057 | nmdc:mga08y16_18887_c1 | |||
| 2058 | nmdc:mga08y16_195218_c1 | |||
| 2059 | nmdc:mga08y16_197539_c1 | |||
| 2060 | nmdc:mga08y16_438369_c1 | |||
| 2061 | nmdc:mga08y16_4783_c1 | |||
| 2062 | nmdc:mga08y16_52662_c1 | |||
| 2063 | nmdc:mga08y16_530_c1 | |||
| 2064 | nmdc:mga08y16_91616_c1 | |||
| 2065 | nmdc:mga0n895_121919_c1 | |||
| 2066 | nmdc:mga0n895_146501_c1 | |||
| 2067 | nmdc:mga0n895_14823_c1 | |||
| 2068 | nmdc:mga0n895_15713_c1 | |||
| 2069 | nmdc:mga0n895_170444_c1 | |||
| 2070 | nmdc:mga0n895_317679_c1 | |||
| 2071 | nmdc:mga0n895_38338_c1 | |||
| 2072 | nmdc:mga0n895_39973_c1 | |||
| 2073 | nmdc:mga0n895_8024_c1 | |||
| 2074 | nmdc:mga0n895_8852_c1 | |||
| 2075 | nmdc:mga0n895_92745_c1 | |||
| 2076 | nmdc:mga0rr50_100347_c1 | |||
| 2077 | nmdc:mga0rr50_167671_c1 | |||
| 2078 | nmdc:mga0rr50_20835_c1 | |||
| 2079 | nmdc:mga0rr50_209368_c1 | |||
| 2080 | nmdc:mga0rr50_42037_c1 | |||
| 2081 | nmdc:mga0rr50_84355_c1 | |||
| 2082 | nmdc:mga08x19_439_c1 | |||
| 2083 | nmdc:mga08x19_5637_c1 | |||
| 2084 | nmdc:mga0a205_10856_c1 | |||
| 2085 | nmdc:mga0a205_128957_c1 | |||
| 2086 | nmdc:mga0a205_15367_c1 | |||
| 2087 | nmdc:mga0a205_154900_c1 | |||
| 2088 | nmdc:mga0a205_30937_c1 | |||
| 2089 | nmdc:mga0a205_45526_c1 | |||
| 2090 | nmdc:mga0a205_83890_c1 | |||
| 2091 | nmdc:mga0a205_8720_c1 | |||
| 2092 | Ga0495619_0028449 | |||
| 2093 | Ga0495619_0120114 | |||
| 2094 | Ga0500578_0000003 | |||
| 2095 | Ga0500578_0009243 | |||
| 2096 | Ga0500578_0043913 | |||
| 2097 | Ga0500597_031061 | |||
| 2098 | Ga0500608_001777 | |||
| 2099 | Ga0500658_0003216 | |||
| 2100 | Ga0500616_0013388 | |||
| 2101 | Ga0500627_0005934 | |||
| 2102 | Ga0500645_004166 | |||
| 2103 | Ga0501084_0000050 | |||
| 2104 | Ga0501084_0019636 | |||
| 2105 | Ga0501084_0060748 | |||
| 2106 | Ga0587071_002305 | |||
| 2107 | Ga0501082_0000164 | |||
| 2108 | Ga0501082_0000337 | |||
| 2109 | Ga0501082_0001219 | |||
| 2110 | Ga0530510_0000438 | |||
| 2111 | Ga0530510_0005862 | |||
| 2112 | Ga0530510_0024406 | |||
| 2113 | 2644344811 | |||
| 2114 | 2644367554 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ffi-assembly2.cif.gz_B | crystal structure of putative 2-pyrone-4,6-dicarboxylic acid hydrolase from pseudomonas putida, northeast structural genomics target ppr23. | 0.6591 | 53 | 363 |
| 2ffi-assembly2.cif.gz_B | crystal structure of putative 2-pyrone-4,6-dicarboxylic acid hydrolase from pseudomonas putida, northeast structural genomics target ppr23. | 0.6463 | 53 | 363 |
| 4i6k-assembly1.cif.gz_A | crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound | 0.6461 | 53 | 362 |
| 4i6k-assembly1.cif.gz_A | crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound | 0.6396 | 53 | 362 |
| 4do7-assembly2.cif.gz_B | crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 | 0.6391 | 53 | 362 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q50662_37_305_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7751 | 123 | 362 | 3.20.20.140 |
| af_A0A0P0W9I9_79_364_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7426 | 48 | 361 | 3.20.20.140 |
| af_A0A0P0W9I9_79_364_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7356 | 48 | 361 | 3.20.20.140 |
| af_A0A0R0KUU2_4_202_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7242 | 152 | 349 | 3.20.20.140 |
| 3cjpA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.6894 | 53 | 362 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4LYG9-F1-model_v4 | Amidohydrolase | 0.9915 | 117 | 377 |
GO:0016787
|
| AF-A0A845BYA1-F1-model_v4 | deleted | 0.9863 | 49 | 375 |
|
| AF-A0A6L7VNQ8-F1-model_v4 | Amidohydrolase family protein | 0.9853 | 79 | 374 |
GO:0016787
|
| AF-A0A845BYA1-F1-model_v4 | deleted | 0.9833 | 49 | 375 |
|
| AF-A0A2W4LYG9-F1-model_v4 | Amidohydrolase | 0.9803 | 117 | 377 |
GO:0016787
|