F489196

General Info

Members Datasets Scaffolds Average Seq Length
1057 374 2114 372

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10094658|Ga0065715_100946582
Length 435
Sequence MISAYSMALTIAQVSKPLASRLYEATFFIRVRNWLFRISVMQMRSTMTSLAQRVSGWFAFHTLAKLIHTLARFGANNERRTASSLARALVICISLLAYSIPGHSQSAPGFLFNDSHFHLTNYIQEGIDIHDFLKIMGNKTGRVALFGIPLQQQWSYRVDGNRAPTYYLNSDAPLYYYSFTDAWIATAYKSLTKEEQARFDPMITGFNPTDMYAADHIRRVLKTFPGVFTGIGEFSIHKEFVSAKISGEVASLQDPALDRLIDFASEVGLVILIHNDVDVPFAKPGAQPAYAKEIKALFIRHPNAAFIWAHIGVGRIIRPIKEQAAIIENVINDPQLSHVYFDISWDEVAKYVVATPESTKNAAALVNRHPDRFLFGTDEVAPANQENYLRVYNQYEPLWKLLTPEASEKVRKGNYERIFDEARRKVRSWEAANLK

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
201 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
212 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
213 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
214 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
215 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
216 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
217 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
218 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
229 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
243 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
246 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
260 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
261 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
266 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
267 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
288 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
289 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
304 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
305 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
306 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
327 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
328 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
329 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
330 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
331 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
332 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
333 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
334 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
335 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
336 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
337 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
338 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
339 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
343 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
362 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
363 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
364 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
365 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
366 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
367 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
368 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
369 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
370 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
372 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
373 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
374 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.38
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 1.61
Rhizosphere 95.84
Stem 0
Stem Tuber 0
Unclassified 12.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10094658 3300005293 Unclassified 4273
2 JGI24751J29686_10000015 3300002459 Bacteria 112804
3 rootL2_10182038 3300003322 Bacteria 4128
4 rootH1_10259089 3300003323 Bacteria 3765
5 Ga0065712_10013167 3300005290 Unclassified 3144
6 Ga0065712_10070589 3300005290 Bacteria 5873
7 Ga0065712_10125559 3300005290 Bacteria 1612
8 Ga0065715_10003301 3300005293 Bacteria 5051
9 Ga0065715_10004592 3300005293 Unclassified 4130
10 Ga0065715_10034501 3300005293 Bacteria 1250
11 Ga0065715_10101661 3300005293 Bacteria 3125
12 Ga0065715_10103801 3300005293 Bacteria 3007
13 Ga0065707_10089372 3300005295 Bacteria 4388
14 Ga0065707_10120543 3300005295 Bacteria 2132
15 Ga0070658_10057533 3300005327 Bacteria 3163
16 Ga0070658_10124840 3300005327 Bacteria 2142
17 Ga0070683_100002959 3300005329 Bacteria 13616
18 Ga0070683_100004761 3300005329 Bacteria 11230
19 Ga0070683_100021747 3300005329 Bacteria 5727
20 Ga0070683_100025038 3300005329 Bacteria 5353
21 Ga0070683_100344928 3300005329 Bacteria 1418
22 Ga0070683_100391653 3300005329 Bacteria 1325
23 Ga0070690_100011429 3300005330 Bacteria 5192
24 Ga0070690_100132358 3300005330 Bacteria 1685
25 Ga0070690_100202566 3300005330 Unclassified 1382
26 Ga0070670_100000182 3300005331 Bacteria 57532
27 Ga0070670_100001123 3300005331 Bacteria 21292
28 Ga0070670_100011025 3300005331 Bacteria 7722
29 Ga0070670_100012332 3300005331 Bacteria 7312
30 Ga0070670_100013951 3300005331 Bacteria 6891
31 Ga0070670_100048108 3300005331 Unclassified 3670
32 Ga0070670_100091754 3300005331 Bacteria 2611
33 Ga0070670_100245826 3300005331 Bacteria 1558
34 Ga0068869_100004393 3300005334 Bacteria 8757
35 Ga0068869_100023447 3300005334 Unclassified 4263
36 Ga0068869_100060827 3300005334 Unclassified 2769
37 Ga0070666_10074361 3300005335 Bacteria 2316
38 Ga0070666_10157086 3300005335 Bacteria 1589
39 Ga0070680_100012420 3300005336 Bacteria 6618
40 Ga0070680_100069253 3300005336 Bacteria 2897
41 Ga0070682_100000598 3300005337 Bacteria 21970
42 Ga0070682_100015142 3300005337 Bacteria 4465
43 Ga0070682_100095864 3300005337 Unclassified 1949
44 Ga0070682_100159834 3300005337 Bacteria 1555
45 Ga0068868_100004929 3300005338 Bacteria 9376
46 Ga0068868_100010013 3300005338 Bacteria 6850
47 Ga0070660_100009194 3300005339 Bacteria 6943
48 Ga0070689_100007951 3300005340 Bacteria 7443
49 Ga0070689_100030062 3300005340 Bacteria 4120
50 Ga0070689_100047396 3300005340 Bacteria 3314
51 Ga0070689_100065353 3300005340 Unclassified 2832
52 Ga0070687_100040624 3300005343 Bacteria 2345
53 Ga0070661_100001468 3300005344 Bacteria 16380
54 Ga0070661_100001891 3300005344 Bacteria 14504
55 Ga0070661_100024665 3300005344 Bacteria 4314
56 Ga0070661_100085329 3300005344 Bacteria 2333
57 Ga0070661_100124321 3300005344 Bacteria 1934
58 Ga0070661_100234593 3300005344 Bacteria 1411
59 Ga0070692_10042712 3300005345 Bacteria 2329
60 Ga0070668_100001090 3300005347 Bacteria 19137
61 Ga0070668_100008848 3300005347 Bacteria 7474
62 Ga0070669_100009064 3300005353 Bacteria 7095
63 Ga0070669_100017758 3300005353 Bacteria 5076
64 Ga0070675_100002309 3300005354 Bacteria 14167
65 Ga0070675_100173059 3300005354 Bacteria 1863
66 Ga0070671_100055942 3300005355 Bacteria 3282
67 Ga0070671_100093949 3300005355 Unclassified 2513
68 Ga0070674_100021525 3300005356 Bacteria 4142
69 Ga0070674_100064948 3300005356 Bacteria 2560
70 Ga0070673_100045666 3300005364 Unclassified 3398
71 Ga0070673_100085651 3300005364 Bacteria 2566
72 Ga0070673_100186758 3300005364 Unclassified 1778
73 Ga0070688_100004893 3300005365 Bacteria 7010
74 Ga0070688_100067992 3300005365 Bacteria 2271
75 Ga0070688_100168000 3300005365 Unclassified 1511
76 Ga0070659_100003330 3300005366 Bacteria 11435
77 Ga0070659_100035368 3300005366 Bacteria 3890
78 Ga0070667_100058538 3300005367 Bacteria 3258
79 Ga0070667_100060040 3300005367 Unclassified 3218
80 Ga0070667_100077286 3300005367 Bacteria 2842
81 Ga0070667_100079404 3300005367 Bacteria 2805
82 Ga0070667_100202431 3300005367 Bacteria 1762
83 Ga0070667_100273658 3300005367 Bacteria 1515
84 Ga0070703_10017976 3300005406 Bacteria 2040
85 Ga0070709_10110483 3300005434 Bacteria 1847
86 Ga0070713_100000139 3300005436 Bacteria 48014
87 Ga0070713_100000195 3300005436 Bacteria 40439
88 Ga0070713_100006295 3300005436 Bacteria 8220
89 Ga0070713_100041042 3300005436 Unclassified 3767
90 Ga0070713_100107659 3300005436 Bacteria 2425
91 Ga0070713_100168371 3300005436 Bacteria 1961
92 Ga0070713_100302700 3300005436 Bacteria 1472
93 Ga0070710_10004003 3300005437 Bacteria 6987
94 Ga0070710_10079557 3300005437 Bacteria 1910
95 Ga0070701_10053532 3300005438 Unclassified 2101
96 Ga0070711_100000480 3300005439 Bacteria 20805
97 Ga0070711_100002670 3300005439 Bacteria 10230
98 Ga0070711_100014703 3300005439 Bacteria 4938
99 Ga0070711_100018924 3300005439 Bacteria 4407
100 Ga0070711_100029891 3300005439 Bacteria 3601
101 Ga0070711_100042545 3300005439 Bacteria 3071
102 Ga0070711_100077605 3300005439 Bacteria 2358
103 Ga0070711_100096386 3300005439 Bacteria 2143
104 Ga0070705_100008155 3300005440 Bacteria 5179
105 Ga0070705_100021754 3300005440 Bacteria 3416
106 Ga0070705_100110709 3300005440 Bacteria 1754
107 Ga0070700_100058802 3300005441 Bacteria 2417
108 Ga0070694_100004717 3300005444 Bacteria 8211
109 Ga0070694_100015432 3300005444 Bacteria 4799
110 Ga0070694_100030672 3300005444 Unclassified 3519
111 Ga0070663_100053892 3300005455 Bacteria 2873
112 Ga0070678_100009099 3300005456 Bacteria 5992
113 Ga0070678_100073192 3300005456 Bacteria 2571
114 Ga0070678_100168193 3300005456 Bacteria 1783
115 Ga0070662_100186795 3300005457 Bacteria 1636
116 Ga0070681_10000906 3300005458 Bacteria 25060
117 Ga0070681_10012396 3300005458 Bacteria 8455
118 Ga0070681_10016309 3300005458 Bacteria 7413
119 Ga0068867_100025185 3300005459 Bacteria 4268
120 Ga0068867_100044703 3300005459 Bacteria 3245
121 Ga0070685_10003810 3300005466 Bacteria 7629
122 Ga0070685_10007093 3300005466 Bacteria 5724
123 Ga0070698_100016197 3300005471 Bacteria 7870
124 Ga0070698_100050794 3300005471 Bacteria 4225
125 Ga0070698_100093913 3300005471 Unclassified 2979
126 Ga0070679_100004172 3300005530 Bacteria 13320
127 Ga0070679_100010035 3300005530 Bacteria 8969
128 Ga0070679_100031055 3300005530 Bacteria 5277
129 Ga0070679_100056879 3300005530 Unclassified 3898
130 Ga0070684_100002611 3300005535 Bacteria 13310
131 Ga0070684_100044319 3300005535 Bacteria 3847
132 Ga0070684_100081137 3300005535 Bacteria 2870
133 Ga0070684_100138626 3300005535 Bacteria 2199
134 Ga0070684_100317788 3300005535 Bacteria 1430
135 Ga0070684_100394190 3300005535 Bacteria 1276
136 Ga0070697_100048133 3300005536 Bacteria 3457
137 Ga0070697_100078134 3300005536 Bacteria 2723
138 Ga0068853_100020227 3300005539 Bacteria 5533
139 Ga0068853_100022271 3300005539 Bacteria 5291
140 Ga0068853_100025360 3300005539 Bacteria 4974
141 Ga0068853_100112226 3300005539 Bacteria 2423
142 Ga0068853_100118947 3300005539 Bacteria 2354
143 Ga0070672_100131822 3300005543 Bacteria 2055
144 Ga0070686_100000388 3300005544 Bacteria 28085
145 Ga0070686_100056883 3300005544 Bacteria 2510
146 Ga0070686_100077025 3300005544 Bacteria 2197
147 Ga0070686_100077968 3300005544 Unclassified 2186
148 Ga0070686_100235314 3300005544 Bacteria 1331
149 Ga0070695_100000002 3300005545 Bacteria 128335
150 Ga0070695_100030916 3300005545 Unclassified 3335
151 Ga0070695_100090738 3300005545 Bacteria 2039
152 Ga0070695_100102653 3300005545 Bacteria 1928
153 Ga0070695_100162978 3300005545 Unclassified 1566
154 Ga0070696_100000679 3300005546 Bacteria 21808
155 Ga0070696_100043562 3300005546 Bacteria 3105
156 Ga0070693_100000836 3300005547 Bacteria 13664
157 Ga0070693_100006343 3300005547 Bacteria 5733
158 Ga0070693_100007767 3300005547 Bacteria 5258
159 Ga0070693_100075398 3300005547 Unclassified 1997
160 Ga0070665_100000329 3300005548 Bacteria 73128
161 Ga0070665_100000489 3300005548 Bacteria 56677
162 Ga0070665_100117868 3300005548 Bacteria 2658
163 Ga0070665_100213410 3300005548 Bacteria 1931
164 Ga0070704_100140136 3300005549 Bacteria 1887
165 Ga0070704_100156605 3300005549 Bacteria 1797
166 Ga0068855_100009532 3300005563 Bacteria 11726
167 Ga0068855_100099680 3300005563 Bacteria 3346
168 Ga0068855_100248827 3300005563 Unclassified 1983
169 Ga0070664_100002629 3300005564 Bacteria 14481
170 Ga0070664_100004228 3300005564 Bacteria 11548
171 Ga0070664_100007304 3300005564 Bacteria 8906
172 Ga0070664_100012902 3300005564 Bacteria 6799
173 Ga0070664_100029976 3300005564 Bacteria 4537
174 Ga0070664_100031598 3300005564 Bacteria 4425
175 Ga0070664_100062279 3300005564 Bacteria 3180
176 Ga0070664_100075867 3300005564 Bacteria 2888
177 Ga0070664_100100942 3300005564 Bacteria 2509
178 Ga0068857_100003561 3300005577 Bacteria 13027
179 Ga0068857_100003873 3300005577 Bacteria 12601
180 Ga0068857_100026892 3300005577 Bacteria 5073
181 Ga0068857_100211873 3300005577 Bacteria 1768
182 Ga0068854_100018328 3300005578 Bacteria 4699
183 Ga0068854_100024998 3300005578 Unclassified 4097
184 Ga0068854_100073704 3300005578 Unclassified 2503
185 Ga0068856_100001478 3300005614 Bacteria 24620
186 Ga0068856_100001630 3300005614 Bacteria 23504
187 Ga0068856_100005411 3300005614 Bacteria 12584
188 Ga0068856_100111307 3300005614 Unclassified 2736
189 Ga0070702_100000035 3300005615 Bacteria 36633
190 Ga0070702_100000429 3300005615 Bacteria 14936
191 Ga0070702_100000989 3300005615 Bacteria 11219
192 Ga0070702_100009248 3300005615 Bacteria 4816
193 Ga0070702_100146969 3300005615 Unclassified 1508
194 Ga0068852_100094838 3300005616 Bacteria 2678
195 Ga0068852_100250210 3300005616 Bacteria 1698
196 Ga0068852_100297031 3300005616 Unclassified 1562
197 Ga0068859_100002169 3300005617 Bacteria 19950
198 Ga0068859_100011456 3300005617 Bacteria 8915
199 Ga0068859_100017021 3300005617 Bacteria 7298
200 Ga0068859_100018429 3300005617 Bacteria 7017
201 Ga0068859_100022495 3300005617 Bacteria 6321
202 Ga0068859_100028305 3300005617 Bacteria 5617
203 Ga0068859_100037489 3300005617 Unclassified 4865
204 Ga0068859_100038749 3300005617 Bacteria 4781
205 Ga0068859_100074042 3300005617 Bacteria 3444
206 Ga0068859_100106222 3300005617 Bacteria 2867
207 Ga0068859_100188463 3300005617 Bacteria 2147
208 Ga0068859_100203768 3300005617 Bacteria 2063
209 Ga0068859_100355511 3300005617 Bacteria 1560
210 Ga0068864_100000068 3300005618 Bacteria 115507
211 Ga0068864_100000505 3300005618 Bacteria 33651
212 Ga0068864_100020545 3300005618 Bacteria 5525
213 Ga0068864_100024457 3300005618 Bacteria 5082
214 Ga0068864_100030792 3300005618 Bacteria 4550
215 Ga0068864_100037187 3300005618 Unclassified 4153
216 Ga0068864_100037883 3300005618 Bacteria 4116
217 Ga0068864_100072019 3300005618 Bacteria 3011
218 Ga0068864_100350082 3300005618 Bacteria 1393
219 Ga0068866_10004767 3300005718 Bacteria 5566
220 Ga0068866_10010895 3300005718 Bacteria 3914
221 Ga0068861_100000611 3300005719 Bacteria 21166
222 Ga0068861_100081836 3300005719 Bacteria 2529
223 Ga0068861_100257845 3300005719 Bacteria 1491
224 Ga0068851_10040865 3300005834 Bacteria 2331
225 Ga0068870_10005537 3300005840 Bacteria 5513
226 Ga0068870_10051384 3300005840 Bacteria 2182
227 Ga0068863_100004085 3300005841 Bacteria 14419
228 Ga0068863_100012662 3300005841 Bacteria 8134
229 Ga0068863_100013585 3300005841 Bacteria 7856
230 Ga0068863_100018174 3300005841 Bacteria 6732
231 Ga0068863_100021167 3300005841 Bacteria 6209
232 Ga0068863_100125001 3300005841 Bacteria 2454
233 Ga0068863_100148396 3300005841 Bacteria 2243
234 Ga0068863_100397252 3300005841 Bacteria 1348
235 Ga0068858_100005289 3300005842 Bacteria 12653
236 Ga0068858_100028259 3300005842 Bacteria 5211
237 Ga0068858_100070085 3300005842 Bacteria 3250
238 Ga0068858_100076639 3300005842 Bacteria 3105
239 Ga0068858_100110527 3300005842 Bacteria 2566
240 Ga0068858_100131069 3300005842 Bacteria 2351
241 Ga0068858_100173266 3300005842 Bacteria 2035
242 Ga0068860_100000303 3300005843 Bacteria 68443
243 Ga0068860_100044787 3300005843 Bacteria 4216
244 Ga0068860_100092080 3300005843 Bacteria 2888
245 Ga0068860_100126887 3300005843 Bacteria 2446
246 Ga0068860_100303088 3300005843 Bacteria 1566
247 Ga0068862_100004089 3300005844 Bacteria 12372
248 Ga0068862_100026684 3300005844 Bacteria 4856
249 Ga0068862_100047630 3300005844 Bacteria 3659
250 Ga0068862_100148696 3300005844 Unclassified 2084
251 Ga0068862_100221639 3300005844 Unclassified 1712
252 Ga0068862_100288346 3300005844 Bacteria 1507
253 Ga0068862_100322284 3300005844 Bacteria 1427
254 Ga0070717_10001621 3300006028 Bacteria 15596
255 Ga0070717_10010535 3300006028 Bacteria 6986
256 Ga0070717_10014518 3300006028 Bacteria 6062
257 Ga0070717_10197155 3300006028 Bacteria 1762
258 Ga0075365_10114241 3300006038 Bacteria 1857
259 Ga0070715_10063543 3300006163 Bacteria 1628
260 Ga0070716_100045037 3300006173 Bacteria 2475
261 Ga0070712_100000068 3300006175 Bacteria 52953
262 Ga0070712_100003155 3300006175 Bacteria 10153
263 Ga0070712_100024777 3300006175 Bacteria 3980
264 Ga0070712_100079334 3300006175 Bacteria 2372
265 Ga0070712_100082047 3300006175 Bacteria 2338
266 Ga0070712_100283810 3300006175 Unclassified 1334
267 Ga0075362_10013272 3300006177 Bacteria 3295
268 Ga0075367_10012939 3300006178 Bacteria 4470
269 Ga0075366_10004672 3300006195 Bacteria 7365
270 Ga0097621_100000739 3300006237 Bacteria 22900
271 Ga0097621_100001227 3300006237 Bacteria 17771
272 Ga0097621_100001464 3300006237 Bacteria 16162
273 Ga0097621_100014464 3300006237 Bacteria 5905
274 Ga0097621_100060237 3300006237 Bacteria 3111
275 Ga0097621_100082532 3300006237 Bacteria 2677
276 Ga0097621_100088614 3300006237 Bacteria 2586
277 Ga0097621_100177372 3300006237 Bacteria 1840
278 Ga0097621_100216521 3300006237 Bacteria 1667
279 Ga0068871_100001869 3300006358 Bacteria 14244
280 Ga0068871_100002436 3300006358 Bacteria 12715
281 Ga0068871_100002615 3300006358 Bacteria 12294
282 Ga0068871_100012480 3300006358 Bacteria 6267
283 Ga0068871_100036087 3300006358 Bacteria 3934
284 Ga0068871_100038959 3300006358 Bacteria 3800
285 Ga0068871_100057608 3300006358 Bacteria 3161
286 Ga0068871_100231916 3300006358 Unclassified 1602
287 Ga0068871_100235285 3300006358 Bacteria 1591
288 Ga0075428_100012893 3300006844 Bacteria 9299
289 Ga0075428_100019477 3300006844 Bacteria 7509
290 Ga0075428_100087268 3300006844 Bacteria 3403
291 Ga0075428_100108985 3300006844 Bacteria 3018
292 Ga0075428_100119999 3300006844 Bacteria 2862
293 Ga0075428_100191088 3300006844 Bacteria 2214
294 Ga0075428_100296925 3300006844 Bacteria 1737
295 Ga0075428_100380739 3300006844 Unclassified 1513
296 Ga0075430_100038458 3300006846 Bacteria 4051
297 Ga0075430_100101103 3300006846 Bacteria 2407
298 Ga0075430_100122888 3300006846 Bacteria 2164
299 Ga0075430_100269535 3300006846 Bacteria 1409
300 Ga0075431_100094550 3300006847 Bacteria 3085
301 Ga0075431_100099234 3300006847 Bacteria 3005
302 Ga0075431_100242873 3300006847 Bacteria 1831
303 Ga0075433_10017964 3300006852 Bacteria 5868
304 Ga0075433_10032523 3300006852 Bacteria 4468
305 Ga0075434_100000752 3300006871 Bacteria 25541
306 Ga0075434_100003967 3300006871 Bacteria 13257
307 Ga0075434_100019695 3300006871 Bacteria 6531
308 Ga0075434_100020588 3300006871 Bacteria 6400
309 Ga0075434_100043609 3300006871 Bacteria 4448
310 Ga0075434_100085599 3300006871 Bacteria 3152
311 Ga0075434_100108387 3300006871 Bacteria 2788
312 Ga0075434_100157313 3300006871 Bacteria 2292
313 Ga0075434_100186025 3300006871 Bacteria 2098
314 Ga0075434_100507126 3300006871 Bacteria 1227
315 Ga0075429_100006558 3300006880 Bacteria 10076
316 Ga0075429_100053515 3300006880 Bacteria 3512
317 Ga0075429_100098012 3300006880 Bacteria 2558
318 Ga0068865_100122940 3300006881 Unclassified 1933
319 Ga0068865_100160258 3300006881 Bacteria 1716
320 Ga0075436_100000125 3300006914 Bacteria 45485
321 Ga0075436_100229523 3300006914 Unclassified 1318
322 Ga0097620_100002169 3300006931 Bacteria 19950
323 Ga0097620_100011456 3300006931 Bacteria 8915
324 Ga0097620_100017021 3300006931 Bacteria 7298
325 Ga0097620_100018429 3300006931 Bacteria 7017
326 Ga0097620_100022495 3300006931 Bacteria 6321
327 Ga0097620_100028305 3300006931 Bacteria 5617
328 Ga0097620_100037489 3300006931 Unclassified 4865
329 Ga0097620_100038749 3300006931 Bacteria 4781
330 Ga0097620_100074034 3300006931 Bacteria 3444
331 Ga0097620_100106223 3300006931 Bacteria 2867
332 Ga0097620_100188445 3300006931 Bacteria 2147
333 Ga0097620_100203768 3300006931 Bacteria 2063
334 Ga0097620_100355527 3300006931 Bacteria 1560
335 Ga0075435_100000242 3300007076 Bacteria 33676
336 Ga0075435_100003023 3300007076 Bacteria 11324
337 Ga0075435_100009050 3300007076 Bacteria 7183
338 Ga0075435_100020329 3300007076 Bacteria 5085
339 Ga0075435_100035457 3300007076 Bacteria 3960
340 Ga0075435_100121793 3300007076 Bacteria 2177
341 Ga0075435_100173479 3300007076 Bacteria 1820
342 Ga0099795_10004242 3300007788 Unclassified 3675
343 Ga0105240_10101159 3300009093 Bacteria 3506
344 Ga0111539_10000116 3300009094 Bacteria 88262
345 Ga0111539_10005883 3300009094 Bacteria 15843
346 Ga0111539_10010270 3300009094 Bacteria 11789
347 Ga0111539_10010922 3300009094 Bacteria 11429
348 Ga0111539_10022058 3300009094 Bacteria 7826
349 Ga0111539_10131018 3300009094 Bacteria 2936
350 Ga0111539_10225433 3300009094 Bacteria 2183
351 Ga0111539_10245041 3300009094 Bacteria 2087
352 Ga0111539_10352277 3300009094 Bacteria 1713
353 Ga0105245_10003927 3300009098 Bacteria 13220
354 Ga0105245_10060024 3300009098 Bacteria 3425
355 Ga0105245_10351234 3300009098 Unclassified 1461
356 Ga0105245_10369053 3300009098 Bacteria 1426
357 Ga0105247_10002892 3300009101 Bacteria 11433
358 Ga0105247_10116730 3300009101 Bacteria 1724
359 Ga0114129_10002377 3300009147 Bacteria 26132
360 Ga0114129_10003649 3300009147 Bacteria 21651
361 Ga0114129_10021105 3300009147 Bacteria 9248
362 Ga0114129_10040942 3300009147 Bacteria 6529
363 Ga0114129_10064441 3300009147 Bacteria 5114
364 Ga0114129_10074579 3300009147 Bacteria 4726
365 Ga0114129_10177577 3300009147 Unclassified 2900
366 Ga0114129_10216717 3300009147 Bacteria 2585
367 Ga0114129_10334138 3300009147 Bacteria 2011
368 Ga0114129_10499771 3300009147 Bacteria 1588
369 Ga0105243_10000419 3300009148 Bacteria 44706
370 Ga0105243_10013767 3300009148 Bacteria 6120
371 Ga0105241_10006596 3300009174 Bacteria 8550
372 Ga0105241_10017513 3300009174 Bacteria 5267
373 Ga0105241_10019500 3300009174 Bacteria 5001
374 Ga0105241_10143449 3300009174 Unclassified 1947
375 Ga0105241_10177089 3300009174 Bacteria 1766
376 Ga0105241_10386167 3300009174 Unclassified 1225
377 Ga0105241_10395121 3300009174 Unclassified 1211
378 Ga0105242_10000162 3300009176 Bacteria 50052
379 Ga0105242_10004177 3300009176 Bacteria 11252
380 Ga0105242_10010323 3300009176 Bacteria 7160
381 Ga0105242_10024640 3300009176 Bacteria 4754
382 Ga0105242_10353472 3300009176 Bacteria 1358
383 Ga0105248_10001543 3300009177 Bacteria 25639
384 Ga0105248_10011406 3300009177 Bacteria 9796
385 Ga0105248_10026373 3300009177 Bacteria 6463
386 Ga0105248_10031945 3300009177 Bacteria 5883
387 Ga0105248_10040359 3300009177 Bacteria 5231
388 Ga0105248_10048130 3300009177 Bacteria 4782
389 Ga0105248_10197542 3300009177 Bacteria 2267
390 Ga0105248_10284697 3300009177 Bacteria 1861
391 Ga0105248_10288985 3300009177 Bacteria 1846
392 Ga0105248_10338855 3300009177 Bacteria 1693
393 Ga0105237_10163649 3300009545 Bacteria 2223
394 Ga0105238_10000910 3300009551 Bacteria 30341
395 Ga0105238_10014550 3300009551 Bacteria 7957
396 Ga0105238_10030107 3300009551 Bacteria 5525
397 Ga0105238_10136428 3300009551 Unclassified 2431
398 Ga0105238_10185815 3300009551 Bacteria 2055
399 Ga0105249_10006716 3300009553 Bacteria 10022
400 Ga0105249_10030009 3300009553 Bacteria 4912
401 Ga0105249_10206610 3300009553 Bacteria 1924
402 Ga0105249_10282160 3300009553 Bacteria 1659
403 Ga0099796_10015084 3300010159 Unclassified 2250
404 Ga0105239_10008079 3300010375 Bacteria 12012
405 Ga0105239_10010869 3300010375 Bacteria 10170
406 Ga0105239_10066350 3300010375 Unclassified 3964
407 Ga0105239_10112714 3300010375 Unclassified 3015
408 Ga0105239_10273303 3300010375 Unclassified 1901
409 Ga0105239_10309161 3300010375 Unclassified 1781
410 Ga0105239_10383426 3300010375 Bacteria 1589
411 Ga0105246_10029689 3300011119 Bacteria 3603
412 Ga0105246_10084282 3300011119 Unclassified 2273
413 Ga0157373_10002998 3300013100 Bacteria 12768
414 Ga0157373_10004351 3300013100 Bacteria 10666
415 Ga0157373_10055027 3300013100 Unclassified 2827
416 Ga0157373_10187404 3300013100 Unclassified 1457
417 Ga0157369_10013891 3300013105 Bacteria 9096
418 Ga0157369_10014806 3300013105 Bacteria 8801
419 Ga0157369_10040623 3300013105 Bacteria 5078
420 Ga0157374_10000425 3300013296 Bacteria 38176
421 Ga0157374_10000477 3300013296 Bacteria 36340
422 Ga0157374_10007647 3300013296 Bacteria 9227
423 Ga0157374_10026181 3300013296 Bacteria 5246
424 Ga0157374_10058371 3300013296 Unclassified 3606
425 Ga0157374_10072860 3300013296 Bacteria 3241
426 Ga0157374_10133832 3300013296 Bacteria 2401
427 Ga0157374_10159590 3300013296 Bacteria 2196
428 Ga0157374_10208050 3300013296 Unclassified 1918
429 Ga0157374_10357462 3300013296 Bacteria 1452
430 Ga0157378_10000082 3300013297 Bacteria 88212
431 Ga0157378_10001226 3300013297 Bacteria 23186
432 Ga0157378_10001328 3300013297 Bacteria 22232
433 Ga0157378_10016738 3300013297 Bacteria 6424
434 Ga0157378_10017317 3300013297 Bacteria 6321
435 Ga0157378_10023027 3300013297 Bacteria 5483
436 Ga0157378_10100594 3300013297 Unclassified 2639
437 Ga0157378_10125132 3300013297 Bacteria 2374
438 Ga0163162_10031097 3300013306 Bacteria 5293
439 Ga0163162_10036124 3300013306 Bacteria 4923
440 Ga0163162_10054294 3300013306 Bacteria 4030
441 Ga0163162_10063133 3300013306 Bacteria 3745
442 Ga0163162_10081811 3300013306 Unclassified 3300
443 Ga0163162_10122176 3300013306 Bacteria 2709
444 Ga0163162_10157968 3300013306 Bacteria 2388
445 Ga0163162_10245167 3300013306 Bacteria 1923
446 Ga0163162_10560866 3300013306 Bacteria 1270
447 Ga0163162_10656363 3300013306 Unclassified 1172
448 Ga0157372_10001675 3300013307 Bacteria 23988
449 Ga0157372_10003558 3300013307 Bacteria 16783
450 Ga0157372_10004152 3300013307 Bacteria 15500
451 Ga0157372_10007396 3300013307 Bacteria 11678
452 Ga0157372_10017976 3300013307 Bacteria 7597
453 Ga0157372_10074383 3300013307 Bacteria 3831
454 Ga0157372_10126957 3300013307 Bacteria 2933
455 Ga0157372_10421497 3300013307 Bacteria 1555
456 Ga0157375_10002492 3300013308 Bacteria 15952
457 Ga0157375_10004861 3300013308 Bacteria 11676
458 Ga0157375_10015692 3300013308 Bacteria 6785
459 Ga0157375_10016209 3300013308 Bacteria 6683
460 Ga0157375_10190015 3300013308 Bacteria 2208
461 Ga0157375_10230644 3300013308 Unclassified 2010
462 Ga0157375_10328137 3300013308 Bacteria 1695
463 Ga0157375_10645525 3300013308 Bacteria 1215
464 Ga0163163_10000495 3300014325 Bacteria 35470
465 Ga0163163_10001144 3300014325 Bacteria 22578
466 Ga0163163_10001705 3300014325 Bacteria 18574
467 Ga0163163_10003211 3300014325 Bacteria 13850
468 Ga0163163_10004961 3300014325 Bacteria 11454
469 Ga0163163_10009445 3300014325 Bacteria 8708
470 Ga0163163_10029619 3300014325 Bacteria 5269
471 Ga0163163_10104037 3300014325 Bacteria 2864
472 Ga0163163_10121701 3300014325 Bacteria 2644
473 Ga0163163_10155939 3300014325 Bacteria 2328
474 Ga0163163_10164891 3300014325 Bacteria 2262
475 Ga0163163_10211087 3300014325 Bacteria 1991
476 Ga0157380_10100665 3300014326 Bacteria 2406
477 Ga0157380_10115285 3300014326 Unclassified 2266
478 Ga0157380_10260936 3300014326 Bacteria 1574
479 Ga0157377_10001335 3300014745 Bacteria 10588
480 Ga0157377_10044224 3300014745 Unclassified 2482
481 Ga0157377_10046124 3300014745 Bacteria 2436
482 Ga0157377_10117194 3300014745 Unclassified 1609
483 Ga0157379_10000585 3300014968 Bacteria 29535
484 Ga0157379_10031291 3300014968 Bacteria 4740
485 Ga0157379_10031430 3300014968 Bacteria 4729
486 Ga0157379_10074127 3300014968 Bacteria 3047
487 Ga0157379_10308804 3300014968 Bacteria 1442
488 Ga0157376_10000017 3300014969 Bacteria 268501
489 Ga0157376_10001723 3300014969 Bacteria 14550
490 Ga0157376_10007450 3300014969 Bacteria 7813
491 Ga0157376_10066376 3300014969 Unclassified 3050
492 Ga0157376_10079588 3300014969 Unclassified 2810
493 Ga0157376_10398198 3300014969 Bacteria 1331
494 Ga0163161_10026495 3300017792 Bacteria 4106
495 Ga0163161_10055402 3300017792 Unclassified 2878
496 Ga0163161_10074294 3300017792 Bacteria 2493
497 Ga0213876_10036799 3300021384 Bacteria 2582
498 Ga0224572_1008541 3300024225 Unclassified 1896
499 Ga0209758_1002835 3300025297 Bacteria 16849
500 Ga0207697_10015984 3300025315 Unclassified 3096
501 Ga0207656_10026445 3300025321 Bacteria 2366
502 Ga0207692_10002604 3300025898 Bacteria 6937
503 Ga0207692_10012351 3300025898 Bacteria 3667
504 Ga0207692_10027747 3300025898 Bacteria 2670
505 Ga0207692_10051978 3300025898 Bacteria 2080
506 Ga0207642_10014700 3300025899 Bacteria 2897
507 Ga0207642_10111421 3300025899 Unclassified 1394
508 Ga0207710_10001465 3300025900 Bacteria 11718
509 Ga0207688_10048037 3300025901 Bacteria 2384
510 Ga0207680_10020014 3300025903 Bacteria 3591
511 Ga0207647_10016615 3300025904 Bacteria 5020
512 Ga0207647_10097505 3300025904 Bacteria 1748
513 Ga0207699_10002098 3300025906 Bacteria 9426
514 Ga0207699_10083224 3300025906 Bacteria 1990
515 Ga0207645_10050981 3300025907 Bacteria 2644
516 Ga0207643_10007238 3300025908 Bacteria 5956
517 Ga0207643_10024801 3300025908 Bacteria 3309
518 Ga0207643_10037956 3300025908 Bacteria 2704
519 Ga0207643_10070802 3300025908 Bacteria 2006
520 Ga0207643_10132504 3300025908 Bacteria 1484
521 Ga0207705_10039977 3300025909 Bacteria 3361
522 Ga0207705_10191550 3300025909 Bacteria 1547
523 Ga0207654_10026183 3300025911 Bacteria 3155
524 Ga0207654_10040851 3300025911 Unclassified 2616
525 Ga0207654_10164105 3300025911 Unclassified 1437
526 Ga0207707_10003174 3300025912 Bacteria 14589
527 Ga0207707_10024436 3300025912 Bacteria 5287
528 Ga0207707_10176253 3300025912 Bacteria 1868
529 Ga0207707_10238299 3300025912 Bacteria 1582
530 Ga0207707_10323356 3300025912 Bacteria 1331
531 Ga0207671_10100082 3300025914 Bacteria 2194
532 Ga0207693_10000057 3300025915 Bacteria 94894
533 Ga0207693_10009295 3300025915 Bacteria 8021
534 Ga0207693_10016441 3300025915 Bacteria 5912
535 Ga0207693_10071493 3300025915 Bacteria 2716
536 Ga0207693_10101829 3300025915 Unclassified 2252
537 Ga0207693_10132833 3300025915 Bacteria 1956
538 Ga0207663_10003566 3300025916 Bacteria 7635
539 Ga0207660_10039627 3300025917 Bacteria 3294
540 Ga0207660_10120078 3300025917 Bacteria 1990
541 Ga0207662_10002208 3300025918 Bacteria 9707
542 Ga0207662_10051407 3300025918 Bacteria 2452
543 Ga0207662_10069798 3300025918 Bacteria 2124
544 Ga0207657_10012045 3300025919 Bacteria 8554
545 Ga0207657_10057579 3300025919 Bacteria 3349
546 Ga0207657_10238437 3300025919 Unclassified 1453
547 Ga0207649_10001696 3300025920 Bacteria 12706
548 Ga0207649_10004170 3300025920 Bacteria 7873
549 Ga0207649_10015254 3300025920 Bacteria 4317
550 Ga0207649_10082275 3300025920 Bacteria 2087
551 Ga0207649_10109102 3300025920 Bacteria 1846
552 Ga0207652_10003412 3300025921 Bacteria 13115
553 Ga0207652_10032862 3300025921 Bacteria 4365
554 Ga0207652_10229517 3300025921 Bacteria 1673
555 Ga0207681_10017573 3300025923 Bacteria 4493
556 Ga0207681_10057025 3300025923 Unclassified 2667
557 Ga0207681_10093051 3300025923 Bacteria 2157
558 Ga0207694_10003021 3300025924 Bacteria 13490
559 Ga0207694_10011735 3300025924 Bacteria 6610
560 Ga0207650_10000017 3300025925 Bacteria 354674
561 Ga0207650_10000161 3300025925 Bacteria 81097
562 Ga0207650_10010243 3300025925 Bacteria 6425
563 Ga0207650_10010256 3300025925 Bacteria 6423
564 Ga0207650_10012827 3300025925 Bacteria 5791
565 Ga0207650_10016847 3300025925 Bacteria 5112
566 Ga0207650_10034247 3300025925 Bacteria 3683
567 Ga0207650_10040727 3300025925 Bacteria 3401
568 Ga0207650_10043812 3300025925 Bacteria 3287
569 Ga0207650_10051839 3300025925 Bacteria 3038
570 Ga0207650_10090144 3300025925 Bacteria 2341
571 Ga0207650_10231074 3300025925 Bacteria 1492
572 Ga0207650_10307021 3300025925 Bacteria 1297
573 Ga0207659_10010513 3300025926 Bacteria 5817
574 Ga0207659_10043054 3300025926 Bacteria 3169
575 Ga0207659_10271536 3300025926 Bacteria 1383
576 Ga0207687_10015698 3300025927 Bacteria 4970
577 Ga0207687_10088679 3300025927 Unclassified 2251
578 Ga0207687_10227108 3300025927 Unclassified 1473
579 Ga0207700_10000377 3300025928 Bacteria 26049
580 Ga0207700_10001680 3300025928 Bacteria 12561
581 Ga0207700_10009335 3300025928 Bacteria 6122
582 Ga0207700_10126814 3300025928 Bacteria 2078
583 Ga0207700_10137552 3300025928 Bacteria 2003
584 Ga0207664_10000973 3300025929 Bacteria 19302
585 Ga0207664_10042923 3300025929 Bacteria 3534
586 Ga0207644_10059757 3300025931 Bacteria 2757
587 Ga0207644_10119806 3300025931 Bacteria 2002
588 Ga0207690_10105895 3300025932 Unclassified 2017
589 Ga0207706_10009128 3300025933 Bacteria 9117
590 Ga0207706_10049873 3300025933 Bacteria 3699
591 Ga0207706_10101578 3300025933 Bacteria 2530
592 Ga0207686_10000069 3300025934 Bacteria 93699
593 Ga0207686_10024701 3300025934 Bacteria 3486
594 Ga0207686_10055668 3300025934 Bacteria 2483
595 Ga0207709_10000025 3300025935 Bacteria 364795
596 Ga0207709_10009789 3300025935 Bacteria 5281
597 Ga0207670_10002826 3300025936 Bacteria 9156
598 Ga0207670_10009696 3300025936 Bacteria 5508
599 Ga0207670_10028399 3300025936 Bacteria 3551
600 Ga0207670_10028594 3300025936 Bacteria 3542
601 Ga0207670_10058652 3300025936 Bacteria 2615
602 Ga0207670_10241135 3300025936 Unclassified 1393
603 Ga0207669_10004295 3300025937 Bacteria 6264
604 Ga0207669_10008824 3300025937 Unclassified 4756
605 Ga0207704_10024761 3300025938 Bacteria 3262
606 Ga0207704_10031390 3300025938 Bacteria 2992
607 Ga0207704_10054741 3300025938 Bacteria 2434
608 Ga0207665_10002196 3300025939 Bacteria 13179
609 Ga0207665_10003791 3300025939 Bacteria 10099
610 Ga0207665_10026876 3300025939 Unclassified 3801
611 Ga0207665_10054987 3300025939 Bacteria 2685
612 Ga0207691_10001839 3300025940 Bacteria 20739
613 Ga0207691_10048778 3300025940 Bacteria 3881
614 Ga0207691_10068402 3300025940 Bacteria 3208
615 Ga0207691_10192256 3300025940 Bacteria 1779
616 Ga0207711_10002939 3300025941 Bacteria 14897
617 Ga0207711_10005519 3300025941 Bacteria 10696
618 Ga0207711_10014282 3300025941 Bacteria 6598
619 Ga0207711_10063865 3300025941 Unclassified 3179
620 Ga0207711_10094626 3300025941 Bacteria 2633
621 Ga0207711_10133361 3300025941 Unclassified 2229
622 Ga0207711_10140745 3300025941 Bacteria 2170
623 Ga0207711_10147609 3300025941 Bacteria 2120
624 Ga0207711_10154589 3300025941 Bacteria 2072
625 Ga0207711_10255218 3300025941 Bacteria 1611
626 Ga0207689_10003244 3300025942 Bacteria 14908
627 Ga0207689_10008816 3300025942 Bacteria 8766
628 Ga0207689_10060268 3300025942 Unclassified 3121
629 Ga0207689_10070006 3300025942 Unclassified 2882
630 Ga0207689_10094510 3300025942 Bacteria 2455
631 Ga0207689_10165502 3300025942 Bacteria 1822
632 Ga0207689_10306345 3300025942 Unclassified 1317
633 Ga0207661_10002094 3300025944 Bacteria 13733
634 Ga0207661_10002500 3300025944 Bacteria 12660
635 Ga0207661_10296939 3300025944 Unclassified 1447
636 Ga0207679_10000553 3300025945 Bacteria 25114
637 Ga0207679_10001688 3300025945 Bacteria 13745
638 Ga0207679_10020455 3300025945 Bacteria 4466
639 Ga0207679_10052645 3300025945 Unclassified 2986
640 Ga0207679_10066658 3300025945 Bacteria 2698
641 Ga0207679_10088575 3300025945 Unclassified 2387
642 Ga0207679_10089450 3300025945 Bacteria 2377
643 Ga0207679_10228463 3300025945 Bacteria 1569
644 Ga0207667_10080893 3300025949 Bacteria 3366
645 Ga0207651_10024150 3300025960 Bacteria 3755
646 Ga0207651_10024355 3300025960 Bacteria 3743
647 Ga0207651_10048160 3300025960 Unclassified 2879
648 Ga0207651_10050643 3300025960 Bacteria 2821
649 Ga0207712_10005714 3300025961 Bacteria 7839
650 Ga0207712_10010302 3300025961 Bacteria 5933
651 Ga0207712_10151073 3300025961 Unclassified 1794
652 Ga0207668_10000053 3300025972 Bacteria 97131
653 Ga0207668_10000323 3300025972 Bacteria 31013
654 Ga0207668_10008775 3300025972 Bacteria 6039
655 Ga0207640_10012640 3300025981 Bacteria 4815
656 Ga0207640_10022145 3300025981 Unclassified 3798
657 Ga0207640_10031074 3300025981 Bacteria 3296
658 Ga0207640_10111121 3300025981 Bacteria 1943
659 Ga0207640_10188964 3300025981 Bacteria 1551
660 Ga0207658_10000988 3300025986 Bacteria 23373
661 Ga0207658_10028896 3300025986 Unclassified 3908
662 Ga0207658_10139156 3300025986 Bacteria 1962
663 Ga0207677_10107765 3300026023 Bacteria 2067
664 Ga0207703_10000968 3300026035 Bacteria 27762
665 Ga0207703_10008957 3300026035 Bacteria 7884
666 Ga0207703_10039130 3300026035 Bacteria 3788
667 Ga0207703_10044556 3300026035 Bacteria 3566
668 Ga0207703_10057802 3300026035 Bacteria 3164
669 Ga0207703_10151541 3300026035 Bacteria 2022
670 Ga0207703_10161030 3300026035 Unclassified 1966
671 Ga0207639_10016019 3300026041 Bacteria 5295
672 Ga0207708_10051799 3300026075 Bacteria 3126
673 Ga0207708_10052363 3300026075 Unclassified 3109
674 Ga0207708_10146312 3300026075 Bacteria 1857
675 Ga0207708_10188754 3300026075 Bacteria 1640
676 Ga0207708_10201025 3300026075 Bacteria 1590
677 Ga0207702_10002933 3300026078 Bacteria 15953
678 Ga0207702_10005179 3300026078 Bacteria 11469
679 Ga0207702_10200942 3300026078 Unclassified 1847
680 Ga0207641_10000539 3300026088 Bacteria 42499
681 Ga0207641_10015058 3300026088 Bacteria 6337
682 Ga0207641_10019989 3300026088 Bacteria 5497
683 Ga0207641_10021069 3300026088 Bacteria 5358
684 Ga0207641_10055254 3300026088 Unclassified 3371
685 Ga0207641_10080427 3300026088 Bacteria 2827
686 Ga0207641_10115770 3300026088 Bacteria 2384
687 Ga0207641_10238430 3300026088 Bacteria 1693
688 Ga0207648_10010425 3300026089 Bacteria 8807
689 Ga0207648_10013662 3300026089 Bacteria 7539
690 Ga0207648_10015056 3300026089 Bacteria 7122
691 Ga0207648_10046095 3300026089 Bacteria 3823
692 Ga0207648_10068880 3300026089 Unclassified 3083
693 Ga0207648_10081315 3300026089 Bacteria 2826
694 Ga0207676_10000685 3300026095 Bacteria 26828
695 Ga0207676_10003419 3300026095 Bacteria 11225
696 Ga0207676_10003684 3300026095 Bacteria 10833
697 Ga0207676_10008016 3300026095 Bacteria 7507
698 Ga0207676_10008366 3300026095 Bacteria 7354
699 Ga0207676_10014750 3300026095 Bacteria 5629
700 Ga0207676_10049523 3300026095 Unclassified 3269
701 Ga0207676_10060182 3300026095 Bacteria 3003
702 Ga0207676_10066290 3300026095 Bacteria 2879
703 Ga0207676_10208354 3300026095 Bacteria 1732
704 Ga0207676_10399710 3300026095 Bacteria 1284
705 Ga0207674_10000116 3300026116 Bacteria 93023
706 Ga0207674_10002114 3300026116 Bacteria 25120
707 Ga0207674_10007866 3300026116 Bacteria 12390
708 Ga0207674_10009074 3300026116 Bacteria 11419
709 Ga0207674_10011514 3300026116 Bacteria 9937
710 Ga0207674_10011730 3300026116 Bacteria 9833
711 Ga0207674_10011804 3300026116 Bacteria 9801
712 Ga0207675_100002992 3300026118 Bacteria 16603
713 Ga0207675_100005697 3300026118 Bacteria 11921
714 Ga0207675_100020125 3300026118 Bacteria 6224
715 Ga0207675_100051448 3300026118 Bacteria 3843
716 Ga0207675_100075376 3300026118 Bacteria 3158
717 Ga0207675_100089811 3300026118 Unclassified 2888
718 Ga0207683_10005942 3300026121 Bacteria 10463
719 Ga0207683_10149227 3300026121 Unclassified 2109
720 Ga0207698_10044959 3300026142 Bacteria 3322
721 Ga0207698_10124995 3300026142 Bacteria 2185
722 Ga0209984_1003365 3300027424 Bacteria 1828
723 Ga0209982_1001908 3300027552 Bacteria 2885
724 Ga0210002_1009932 3300027617 Bacteria 1455
725 Ga0209813_10025741 3300027866 Bacteria 1695
726 Ga0209974_10004187 3300027876 Bacteria 5156
727 Ga0207428_10000185 3300027907 Bacteria 86391
728 Ga0207428_10000657 3300027907 Bacteria 40497
729 Ga0207428_10007200 3300027907 Bacteria 10174
730 Ga0268266_10000306 3300028379 Bacteria 77988
731 Ga0268266_10000698 3300028379 Bacteria 45298
732 Ga0268266_10018384 3300028379 Bacteria 5956
733 Ga0268266_10101361 3300028379 Unclassified 2538
734 Ga0268266_10183086 3300028379 Unclassified 1909
735 Ga0268265_10045050 3300028380 Bacteria 3289
736 Ga0268265_10217330 3300028380 Bacteria 1670
737 Ga0268265_10234686 3300028380 Bacteria 1614
738 Ga0268264_10000059 3300028381 Bacteria 306927
739 Ga0268264_10028307 3300028381 Bacteria 4583
740 Ga0268264_10064072 3300028381 Bacteria 3092
741 Ga0268264_10068130 3300028381 Unclassified 3006
742 Ga0268264_10255434 3300028381 Bacteria 1630
743 Ga0265338_10009200 3300028800 Bacteria 11826
744 Ga0265760_10000174 3300031090 Bacteria 16947
745 Ga0265760_10001093 3300031090 Bacteria 7877
746 Ga0265760_10015062 3300031090 Bacteria 2216
747 Ga0307509_10005400 3300031507 Bacteria 17788
748 Ga0307408_100004133 3300031548 Bacteria 9883
749 Ga0307408_100233060 3300031548 Bacteria 1509
750 Ga0316576_10120432 3300031727 Bacteria 1970
751 Ga0316578_10016124 3300031728 Bacteria 4037
752 Ga0307405_10007682 3300031731 Bacteria 5416
753 Ga0307410_10016725 3300031852 Bacteria 4385
754 Ga0307406_10008001 3300031901 Bacteria 5889
755 Ga0307406_10080872 3300031901 Bacteria 2159
756 Ga0307412_10012020 3300031911 Bacteria 5030
757 Ga0307409_100004668 3300031995 Bacteria 7747
758 Ga0307409_100127309 3300031995 Bacteria 2169
759 Ga0307416_100000605 3300032002 Bacteria 18488
760 Ga0307416_100191448 3300032002 Bacteria 1930
761 Ga0307414_10004572 3300032004 Bacteria 7528
762 Ga0307411_10058544 3300032005 Bacteria 2550
763 Ga0307415_100004707 3300032126 Bacteria 7140
764 Ga0373950_0016590 3300034818 Bacteria 1261
765 Ga0373958_0004283 3300034819 Bacteria 2105
766 Ga0373938_0006621 3300034957 Bacteria 2010
767 Ga0373926_0086634 3300035083 Bacteria 1162
768 Ga0373934_0000323 3300035086 Bacteria 16843
769 Ga0373940_0009176 3300035088 Bacteria 2293
770 Ga0373951_0001465 3300035091 Bacteria 6181
771 Ga0373952_0002185 3300035092 Bacteria 3518
772 Ga0373932_0001201 3300035112 Bacteria 7383
773 Ga0373936_0023260 3300035113 Bacteria 2414
774 Ga0373939_0005514 3300035114 Bacteria 3017
775 Ga0373953_0010189 3300035117 Bacteria 3260
776 Ga0373954_0015478 3300035118 Bacteria 3410
777 Ga0373956_0004608 3300035119 Bacteria 5510
778 Ga0373956_0018013 3300035119 Bacteria 2987
779 Ga0373960_0001714 3300035121 Bacteria 4912
780 Ga0373943_0008378 3300035170 Bacteria 4639
781 Ga0373943_0146183 3300035170 Bacteria 1277
782 Ga0373955_0016372 3300035172 Bacteria 3648
783 Ga0373955_0028932 3300035172 Bacteria 2877
784 Ga0373942_0002890 3300035207 Bacteria 4077
785 Ga0373961_0000931 3300035241 Bacteria 9764
786 Ga0373962_0000951 3300035242 Bacteria 6679
787 Ga0373931_0015368 3300035691 Bacteria 3753
788 Ga0373931_0027486 3300035691 Bacteria 2905
789 Ga0373935_0019050 3300035692 Bacteria 4185
790 Ga0373935_0021952 3300035692 Bacteria 3909
791 Ga0373935_0105576 3300035692 Bacteria 1863
792 Ga0373927_0005808 3300035695 Bacteria 8467
793 Ga0373933_0021210 3300035724 Bacteria 3688
794 Ga0373933_0091542 3300035724 Unclassified 1877
795 Ga0373947_0029890 3300035725 Bacteria 3198
796 Ga0373947_0044571 3300035725 Bacteria 2652
797 Ga0373947_0080090 3300035725 Unclassified 2020
798 Ga0373937_0013437 3300036401 Bacteria 7213
799 Ga0373937_0015347 3300036401 Bacteria 6775
800 Ga0373937_0048754 3300036401 Bacteria 3877
801 Ga0373937_0122221 3300036401 Unclassified 2427
802 Ga0373937_0200743 3300036401 Unclassified 1875
803 Ga0373937_0273085 3300036401 Bacteria 1596
804 Ga0316584_0001131 3300036712 Bacteria 15666
805 Ga0373925_0010539 3300037068 Bacteria 6704
806 Ga0373925_0010955 3300037068 Bacteria 6580
807 Ga0373925_0057697 3300037068 Bacteria 2909
808 Ga0373925_0058512 3300037068 Bacteria 2890
809 Ga0395898_0325404 3300037466 Bacteria 1466
810 Ga0395905_0023172 3300037471 Bacteria 5870
811 Ga0395905_0048659 3300037471 Bacteria 3973
812 Ga0395905_0096348 3300037471 Unclassified 2778
813 Ga0395905_0124328 3300037471 Bacteria 2425
814 Ga0395905_0132428 3300037471 Bacteria 2345
815 Ga0395905_0244601 3300037471 Bacteria 1676
816 Ga0436365_0409719 3300039437 Bacteria 3331
817 Ga0451807_2187363 3300041486 Bacteria 6071
818 Ga0450896_002822 3300042133 Bacteria 2269
819 Ga0451577_0008592 3300042876 Bacteria 9931
820 Ga0439440_0023534 3300042993 Bacteria 1406
821 Ga0453683_0005527 3300044673 Bacteria 8810
822 Ga0453683_0136003 3300044673 Bacteria 1550
823 Ga0453684_0090989 3300044712 Bacteria 3768
824 Ga0451576_0011708 3300045051 Bacteria 9938
825 Ga0451576_0019279 3300045051 Bacteria 7447
826 Ga0451576_0042805 3300045051 Bacteria 4781
827 Ga0451576_0048611 3300045051 Bacteria 4454
828 Ga0451576_0192576 3300045051 Bacteria 2130
829 Ga0495592_0028956 3300046454 Unclassified 4193
830 Ga0495592_0040306 3300046454 Bacteria 3505
831 Ga0495592_0228326 3300046454 Bacteria 1241
832 Ga0495629_0005805 3300046459 Bacteria 9209
833 Ga0495638_0007473 3300046460 Bacteria 7831
834 Ga0495651_0028800 3300046462 Unclassified 4329
835 Ga0495653_0226725 3300046463 Unclassified 1253
836 Ga0495650_0000045 3300046471 Bacteria 346204
837 Ga0495580_0000558 3300046472 Bacteria 31485
838 Ga0495580_0000961 3300046472 Bacteria 25258
839 Ga0495580_0036817 3300046472 Unclassified 3513
840 Ga0495582_0000315 3300046473 Bacteria 26627
841 Ga0495582_0009594 3300046473 Bacteria 5330
842 Ga0495582_0044677 3300046473 Unclassified 2440
843 Ga0495639_0016096 3300046475 Bacteria 3244
844 Ga0495639_0031988 3300046475 Bacteria 2345
845 Ga0495639_0040354 3300046475 Bacteria 2100
846 Ga0495664_0014975 3300046477 Bacteria 4404
847 Ga0495664_0188728 3300046477 Unclassified 1250
848 Ga0495606_0009164 3300046507 Bacteria 8419
849 Ga0495608_0000709 3300046511 Bacteria 23212
850 Ga0495610_0000024 3300046512 Bacteria 304748
851 Ga0495618_0000587 3300046514 Bacteria 25927
852 Ga0495628_0023573 3300046516 Bacteria 5050
853 Ga0495628_0106722 3300046516 Bacteria 2157
854 Ga0495628_0270852 3300046516 Bacteria 1263
855 Ga0495630_0166890 3300046517 Unclassified 1676
856 Ga0495648_0024034 3300046524 Bacteria 4160
857 Ga0495663_0001266 3300046525 Bacteria 8032
858 Ga0495654_0000010 3300046530 Bacteria 378481
859 Ga0495665_0002082 3300046531 Bacteria 10837
860 Ga0495665_0007984 3300046531 Bacteria 5740
861 Ga0495640_0020040 3300046533 Bacteria 4930
862 Ga0495587_0005837 3300046536 Bacteria 8016
863 Ga0495587_0086343 3300046536 Bacteria 1816
864 Ga0495598_0000193 3300046537 Bacteria 10779
865 Ga0495667_0018926 3300046559 Bacteria 4649
866 Ga0495667_0103860 3300046559 Bacteria 1838
867 Ga0495634_0011628 3300046642 Bacteria 6401
868 Ga0495625_0000033 3300046660 Bacteria 228108
869 Ga0495625_0002447 3300046660 Bacteria 20057
870 Ga0495635_0040916 3300046663 Unclassified 3202
871 Ga0495635_0122520 3300046663 Bacteria 1773
872 Ga0495635_0197181 3300046663 Unclassified 1366
873 Ga0495599_0056107 3300046678 Unclassified 2465
874 Ga0495599_0106591 3300046678 Bacteria 1746
875 Ga0495658_0012020 3300046683 Bacteria 4371
876 Ga0495658_0042589 3300046683 Bacteria 2536
877 Ga0495669_0020611 3300046684 Bacteria 2854
878 Ga0495613_0003782 3300046689 Bacteria 11343
879 Ga0495613_0209322 3300046689 Bacteria 1372
880 Ga0495671_0041698 3300046692 Bacteria 2310
881 Ga0495600_0036083 3300046809 Bacteria 3213
882 Ga0495600_0147790 3300046809 Bacteria 1523
883 Ga0495581_0022153 3300047315 Bacteria 3682
884 Ga0495604_0248231 3300047317 Unclassified 1214
885 Ga0495674_0014008 3300047319 Bacteria 7518
886 Ga0495674_0096597 3300047319 Bacteria 2518
887 Ga0495674_0104991 3300047319 Bacteria 2401
888 Ga0495672_0028744 3300047320 Bacteria 3511
889 Ga0495676_0063232 3300047321 Bacteria 2886
890 Ga0495680_0014624 3300047322 Bacteria 6792
891 Ga0495680_0203628 3300047322 Bacteria 1419
892 Ga0495675_0000762 3300047444 Bacteria 20167
893 Ga0495675_0049039 3300047444 Bacteria 2685
894 Ga0495681_0066687 3300047470 Bacteria 1642
895 Ga0495684_0038376 3300047471 Unclassified 3673
896 Ga0495684_0043106 3300047471 Bacteria 3454
897 Ga0495684_0055898 3300047471 Unclassified 3010
898 Ga0495602_0074166 3300048088 Unclassified 2893
899 Ga0496100_0071207 3300048903 Bacteria 2321
900 Ga0496102_0027357 3300048905 Bacteria 5093
901 Ga0496104_0029250 3300048907 Bacteria 5110
902 Ga0496105_0031370 3300048908 Bacteria 4357
903 Ga0496105_0165085 3300048908 Unclassified 1817
904 Ga0496108_0208960 3300048911 Bacteria 1694
905 Ga0496109_0156602 3300048912 Bacteria 2134
906 Ga0496112_0034481 3300048915 Bacteria 4925
907 Ga0496112_0039480 3300048915 Bacteria 4614
908 Ga0496112_0081811 3300048915 Bacteria 3194
909 Ga0496112_0102576 3300048915 Bacteria 2831
910 Ga0496113_0123627 3300048916 Bacteria 2025
911 Ga0496114_0005144 3300048917 Bacteria 10201
912 Ga0496114_0089365 3300048917 Bacteria 2614
913 Ga0496115_0013076 3300048918 Bacteria 6268
914 Ga0496115_0029811 3300048918 Bacteria 4288
915 Ga0496126_0010655 3300048929 Bacteria 9614
916 Ga0501291_002334 3300049514 Unclassified 2261
917 Ga0501296_001988 3300049519 Unclassified 2095
918 Ga0501298_000718 3300049521 Bacteria 4638
919 Ga0501298_001838 3300049521 Unclassified 3140
920 Ga0501299_014370 3300049522 Bacteria 1376
921 Ga0501036_0045618 3300049572 Bacteria 3713
922 Ga0501038_0002013 3300049574 Bacteria 18771
923 Ga0501038_0018009 3300049574 Bacteria 6379
924 Ga0501039_0086994 3300049575 Bacteria 2434
925 Ga0501040_0019587 3300049576 Bacteria 4502
926 Ga0501041_0000056 3300049577 Bacteria 40879
927 Ga0501041_0058117 3300049577 Bacteria 2366
928 Ga0501043_0015748 3300049579 Bacteria 5928
929 Ga0501046_0018609 3300049580 Bacteria 5773
930 Ga0501047_0001175 3300049581 Bacteria 25953
931 Ga0501048_0014054 3300049582 Bacteria 5933
932 Ga0501067_0001640 3300049583 Bacteria 12294
933 Ga0501068_0000102 3300049584 Bacteria 37184
934 Ga0501069_0073254 3300049585 Bacteria 1920
935 Ga0501070_0028058 3300049586 Bacteria 4721
936 Ga0501071_0000181 3300049587 Bacteria 27971
937 Ga0501071_0146738 3300049587 Bacteria 1759
938 Ga0501072_0000031 3300049588 Bacteria 128377
939 Ga0501072_0002955 3300049588 Bacteria 12802
940 Ga0501072_0027658 3300049588 Bacteria 4424
941 Ga0501073_0006570 3300049589 Bacteria 8650
942 Ga0501074_0003665 3300049590 Bacteria 10899
943 Ga0501075_0058057 3300049591 Bacteria 2914
944 Ga0501076_0000164 3300049592 Bacteria 38475
945 Ga0501076_0004526 3300049592 Bacteria 9901
946 Ga0501076_0038160 3300049592 Bacteria 3771
947 Ga0501202_002514 3300049652 Bacteria 3085
948 Ga0501207_003645 3300049654 Bacteria 2061
949 Ga0501209_002324 3300049656 Bacteria 2898
950 Ga0501217_000362 3300049661 Bacteria 7238
951 Ga0501223_001430 3300049663 Bacteria 5511
952 Ga0501224_003650 3300049664 Unclassified 2160
953 Ga0501224_005937 3300049664 Bacteria 1762
954 Ga0501227_003409 3300049665 Bacteria 3447
955 Ga0501235_002159 3300049669 Unclassified 4222
956 Ga0501240_001966 3300049673 Unclassified 2103
957 Ga0501243_002919 3300049675 Bacteria 2517
958 Ga0501251_003383 3300049681 Bacteria 1592
959 Ga0501257_004229 3300049686 Bacteria 3124
960 Ga0501257_024549 3300049686 Bacteria 1432
961 Ga0501225_0002472 3300049705 Bacteria 5711
962 Ga0501225_0003511 3300049705 Bacteria 4730
963 Ga0501225_0008103 3300049705 Unclassified 3022
964 Ga0501234_003334 3300049707 Bacteria 2524
965 Ga0501234_006244 3300049707 Unclassified 1865
966 Ga0501079_0008412 3300049741 Bacteria 7820
967 Ga0501080_0021642 3300049742 Bacteria 5954
968 Ga0501080_0046568 3300049742 Bacteria 4037
969 Ga0501081_0000077 3300049743 Bacteria 38611
970 Ga0501081_0056739 3300049743 Bacteria 2707
971 Ga0501283_003764 3300049779 Unclassified 2024
972 Ga0501283_008782 3300049779 Bacteria 1463
973 Ga0501035_0011181 3300049822 Bacteria 8312
974 Ga0501044_0006402 3300049823 Bacteria 13015
975 Ga0501045_0001345 3300049824 Bacteria 16303
976 Ga0501226_002297 3300049853 Bacteria 2345
977 nmdc:mga00v17_39922_c1 3300050491 Bacteria 2813
978 nmdc:mga0yw44_33681_c1 3300050492 Bacteria 2995
979 nmdc:mga0k408_3808_c1 3300050493 Bacteria 7996
980 nmdc:mga06z11_11279_c1 3300050494 Bacteria 3849
981 nmdc:mga05p37_103682_c1 3300050507 Bacteria 3500
982 nmdc:mga05p37_122502_c1 3300050507 Bacteria 3194
983 nmdc:mga05p37_153595_c1 3300050507 Bacteria 2814
984 nmdc:mga05p37_1622_c1 3300050507 Bacteria 11969
985 nmdc:mga05p37_246936_c1 3300050507 Unclassified 2142
986 nmdc:mga05p37_293002_c1 3300050507 Bacteria 1936
987 nmdc:mga05p37_35163_c1 3300050507 Bacteria 6142
988 nmdc:mga05p37_35707_c1 3300050507 Bacteria 6096
989 nmdc:mga05p37_4187_c1 3300050507 Bacteria 16861
990 nmdc:mga09592_100390_c1 3300050508 Bacteria 2478
991 nmdc:mga09592_13302_c1 3300050508 Bacteria 6719
992 nmdc:mga09592_160053_c1 3300050508 Bacteria 1945
993 nmdc:mga09592_52081_c1 3300050508 Bacteria 3454
994 nmdc:mga0qj67_128687_c1 3300050509 Unclassified 2050
995 nmdc:mga0qj67_290179_c1 3300050509 Bacteria 1326
996 nmdc:mga0qj67_89249_c1 3300050509 Bacteria 2476
997 nmdc:mga06r32_306668_c1 3300050510 Bacteria 1573
998 nmdc:mga08y16_127628_c1 3300050511 Bacteria 2646
999 nmdc:mga08y16_185319_c1 3300050511 Bacteria 2160
1000 nmdc:mga08y16_18887_c1 3300050511 Bacteria 7261
1001 nmdc:mga08y16_195218_c1 3300050511 Bacteria 2098
1002 nmdc:mga08y16_197539_c1 3300050511 Bacteria 2085
1003 nmdc:mga08y16_438369_c1 3300050511 Bacteria 1334
1004 nmdc:mga08y16_4783_c1 3300050511 Bacteria 14127
1005 nmdc:mga08y16_52662_c1 3300050511 Bacteria 4258
1006 nmdc:mga08y16_530_c1 3300050511 Bacteria 35277
1007 nmdc:mga08y16_91616_c1 3300050511 Bacteria 3168
1008 nmdc:mga0n895_121919_c1 3300050512 Bacteria 2628
1009 nmdc:mga0n895_146501_c1 3300050512 Bacteria 2391
1010 nmdc:mga0n895_14823_c1 3300050512 Bacteria 7093
1011 nmdc:mga0n895_15713_c1 3300050512 Bacteria 6917
1012 nmdc:mga0n895_170444_c1 3300050512 Bacteria 2209
1013 nmdc:mga0n895_317679_c1 3300050512 Unclassified 1578
1014 nmdc:mga0n895_38338_c1 3300050512 Bacteria 4642
1015 nmdc:mga0n895_39973_c1 3300050512 Bacteria 4555
1016 nmdc:mga0n895_8024_c1 3300050512 Bacteria 9108
1017 nmdc:mga0n895_8852_c1 3300050512 Bacteria 8762
1018 nmdc:mga0n895_92745_c1 3300050512 Bacteria 3023
1019 nmdc:mga0rr50_100347_c1 3300050513 Bacteria 2273
1020 nmdc:mga0rr50_167671_c1 3300050513 Bacteria 1787
1021 nmdc:mga0rr50_20835_c1 3300050513 Bacteria 4463
1022 nmdc:mga0rr50_209368_c1 3300050513 Bacteria 1606
1023 nmdc:mga0rr50_42037_c1 3300050513 Bacteria 3335
1024 nmdc:mga0rr50_84355_c1 3300050513 Bacteria 2459
1025 nmdc:mga08x19_439_c1 3300050514 Bacteria 28578
1026 nmdc:mga08x19_5637_c1 3300050514 Bacteria 7398
1027 nmdc:mga0a205_10856_c1 3300050515 Bacteria 8378
1028 nmdc:mga0a205_128957_c1 3300050515 Bacteria 2430
1029 nmdc:mga0a205_15367_c1 3300050515 Bacteria 7154
1030 nmdc:mga0a205_154900_c1 3300050515 Bacteria 2190
1031 nmdc:mga0a205_30937_c1 3300050515 Bacteria 5127
1032 nmdc:mga0a205_45526_c1 3300050515 Bacteria 4231
1033 nmdc:mga0a205_83890_c1 3300050515 Bacteria 3077
1034 nmdc:mga0a205_8720_c1 3300050515 Bacteria 9235
1035 Ga0495619_0028449 3300053085 Bacteria 3606
1036 Ga0495619_0120114 3300053085 Bacteria 1801
1037 Ga0500578_0000003 3300053086 Bacteria 266033
1038 Ga0500578_0009243 3300053086 Bacteria 6402
1039 Ga0500578_0043913 3300053086 Bacteria 2869
1040 Ga0500597_031061 3300053120 Bacteria 2199
1041 Ga0500608_001777 3300053122 Bacteria 7703
1042 Ga0500658_0003216 3300053134 Bacteria 6214
1043 Ga0500616_0013388 3300053153 Bacteria 4764
1044 Ga0500627_0005934 3300053158 Bacteria 4104
1045 Ga0500645_004166 3300053730 Bacteria 5630
1046 Ga0501084_0000050 3300054114 Bacteria 92878
1047 Ga0501084_0019636 3300054114 Bacteria 5631
1048 Ga0501084_0060748 3300054114 Bacteria 3164
1049 Ga0587071_002305 3300060344 Bacteria 2572
1050 Ga0501082_0000164 3300060353 Bacteria 56679
1051 Ga0501082_0000337 3300060353 Bacteria 41361
1052 Ga0501082_0001219 3300060353 Bacteria 22593
1053 Ga0530510_0000438 3300061734 Bacteria 26867
1054 Ga0530510_0005862 3300061734 Bacteria 8513
1055 Ga0530510_0024406 3300061734 Bacteria 4313
1056 2644344811 2643221661 Bacteria 4267604
1057 2644367554 2643221666 Bacteria 4265935
1058 Ga0065715_10094658
1059 JGI24751J29686_10000015
1060 rootL2_10182038
1061 rootH1_10259089
1062 Ga0065712_10013167
1063 Ga0065712_10070589
1064 Ga0065712_10125559
1065 Ga0065715_10003301
1066 Ga0065715_10004592
1067 Ga0065715_10034501
1068 Ga0065715_10101661
1069 Ga0065715_10103801
1070 Ga0065707_10089372
1071 Ga0065707_10120543
1072 Ga0070658_10057533
1073 Ga0070658_10124840
1074 Ga0070683_100002959
1075 Ga0070683_100004761
1076 Ga0070683_100021747
1077 Ga0070683_100025038
1078 Ga0070683_100344928
1079 Ga0070683_100391653
1080 Ga0070690_100011429
1081 Ga0070690_100132358
1082 Ga0070690_100202566
1083 Ga0070670_100000182
1084 Ga0070670_100001123
1085 Ga0070670_100011025
1086 Ga0070670_100012332
1087 Ga0070670_100013951
1088 Ga0070670_100048108
1089 Ga0070670_100091754
1090 Ga0070670_100245826
1091 Ga0068869_100004393
1092 Ga0068869_100023447
1093 Ga0068869_100060827
1094 Ga0070666_10074361
1095 Ga0070666_10157086
1096 Ga0070680_100012420
1097 Ga0070680_100069253
1098 Ga0070682_100000598
1099 Ga0070682_100015142
1100 Ga0070682_100095864
1101 Ga0070682_100159834
1102 Ga0068868_100004929
1103 Ga0068868_100010013
1104 Ga0070660_100009194
1105 Ga0070689_100007951
1106 Ga0070689_100030062
1107 Ga0070689_100047396
1108 Ga0070689_100065353
1109 Ga0070687_100040624
1110 Ga0070661_100001468
1111 Ga0070661_100001891
1112 Ga0070661_100024665
1113 Ga0070661_100085329
1114 Ga0070661_100124321
1115 Ga0070661_100234593
1116 Ga0070692_10042712
1117 Ga0070668_100001090
1118 Ga0070668_100008848
1119 Ga0070669_100009064
1120 Ga0070669_100017758
1121 Ga0070675_100002309
1122 Ga0070675_100173059
1123 Ga0070671_100055942
1124 Ga0070671_100093949
1125 Ga0070674_100021525
1126 Ga0070674_100064948
1127 Ga0070673_100045666
1128 Ga0070673_100085651
1129 Ga0070673_100186758
1130 Ga0070688_100004893
1131 Ga0070688_100067992
1132 Ga0070688_100168000
1133 Ga0070659_100003330
1134 Ga0070659_100035368
1135 Ga0070667_100058538
1136 Ga0070667_100060040
1137 Ga0070667_100077286
1138 Ga0070667_100079404
1139 Ga0070667_100202431
1140 Ga0070667_100273658
1141 Ga0070703_10017976
1142 Ga0070709_10110483
1143 Ga0070713_100000139
1144 Ga0070713_100000195
1145 Ga0070713_100006295
1146 Ga0070713_100041042
1147 Ga0070713_100107659
1148 Ga0070713_100168371
1149 Ga0070713_100302700
1150 Ga0070710_10004003
1151 Ga0070710_10079557
1152 Ga0070701_10053532
1153 Ga0070711_100000480
1154 Ga0070711_100002670
1155 Ga0070711_100014703
1156 Ga0070711_100018924
1157 Ga0070711_100029891
1158 Ga0070711_100042545
1159 Ga0070711_100077605
1160 Ga0070711_100096386
1161 Ga0070705_100008155
1162 Ga0070705_100021754
1163 Ga0070705_100110709
1164 Ga0070700_100058802
1165 Ga0070694_100004717
1166 Ga0070694_100015432
1167 Ga0070694_100030672
1168 Ga0070663_100053892
1169 Ga0070678_100009099
1170 Ga0070678_100073192
1171 Ga0070678_100168193
1172 Ga0070662_100186795
1173 Ga0070681_10000906
1174 Ga0070681_10012396
1175 Ga0070681_10016309
1176 Ga0068867_100025185
1177 Ga0068867_100044703
1178 Ga0070685_10003810
1179 Ga0070685_10007093
1180 Ga0070698_100016197
1181 Ga0070698_100050794
1182 Ga0070698_100093913
1183 Ga0070679_100004172
1184 Ga0070679_100010035
1185 Ga0070679_100031055
1186 Ga0070679_100056879
1187 Ga0070684_100002611
1188 Ga0070684_100044319
1189 Ga0070684_100081137
1190 Ga0070684_100138626
1191 Ga0070684_100317788
1192 Ga0070684_100394190
1193 Ga0070697_100048133
1194 Ga0070697_100078134
1195 Ga0068853_100020227
1196 Ga0068853_100022271
1197 Ga0068853_100025360
1198 Ga0068853_100112226
1199 Ga0068853_100118947
1200 Ga0070672_100131822
1201 Ga0070686_100000388
1202 Ga0070686_100056883
1203 Ga0070686_100077025
1204 Ga0070686_100077968
1205 Ga0070686_100235314
1206 Ga0070695_100000002
1207 Ga0070695_100030916
1208 Ga0070695_100090738
1209 Ga0070695_100102653
1210 Ga0070695_100162978
1211 Ga0070696_100000679
1212 Ga0070696_100043562
1213 Ga0070693_100000836
1214 Ga0070693_100006343
1215 Ga0070693_100007767
1216 Ga0070693_100075398
1217 Ga0070665_100000329
1218 Ga0070665_100000489
1219 Ga0070665_100117868
1220 Ga0070665_100213410
1221 Ga0070704_100140136
1222 Ga0070704_100156605
1223 Ga0068855_100009532
1224 Ga0068855_100099680
1225 Ga0068855_100248827
1226 Ga0070664_100002629
1227 Ga0070664_100004228
1228 Ga0070664_100007304
1229 Ga0070664_100012902
1230 Ga0070664_100029976
1231 Ga0070664_100031598
1232 Ga0070664_100062279
1233 Ga0070664_100075867
1234 Ga0070664_100100942
1235 Ga0068857_100003561
1236 Ga0068857_100003873
1237 Ga0068857_100026892
1238 Ga0068857_100211873
1239 Ga0068854_100018328
1240 Ga0068854_100024998
1241 Ga0068854_100073704
1242 Ga0068856_100001478
1243 Ga0068856_100001630
1244 Ga0068856_100005411
1245 Ga0068856_100111307
1246 Ga0070702_100000035
1247 Ga0070702_100000429
1248 Ga0070702_100000989
1249 Ga0070702_100009248
1250 Ga0070702_100146969
1251 Ga0068852_100094838
1252 Ga0068852_100250210
1253 Ga0068852_100297031
1254 Ga0068859_100002169
1255 Ga0068859_100011456
1256 Ga0068859_100017021
1257 Ga0068859_100018429
1258 Ga0068859_100022495
1259 Ga0068859_100028305
1260 Ga0068859_100037489
1261 Ga0068859_100038749
1262 Ga0068859_100074042
1263 Ga0068859_100106222
1264 Ga0068859_100188463
1265 Ga0068859_100203768
1266 Ga0068859_100355511
1267 Ga0068864_100000068
1268 Ga0068864_100000505
1269 Ga0068864_100020545
1270 Ga0068864_100024457
1271 Ga0068864_100030792
1272 Ga0068864_100037187
1273 Ga0068864_100037883
1274 Ga0068864_100072019
1275 Ga0068864_100350082
1276 Ga0068866_10004767
1277 Ga0068866_10010895
1278 Ga0068861_100000611
1279 Ga0068861_100081836
1280 Ga0068861_100257845
1281 Ga0068851_10040865
1282 Ga0068870_10005537
1283 Ga0068870_10051384
1284 Ga0068863_100004085
1285 Ga0068863_100012662
1286 Ga0068863_100013585
1287 Ga0068863_100018174
1288 Ga0068863_100021167
1289 Ga0068863_100125001
1290 Ga0068863_100148396
1291 Ga0068863_100397252
1292 Ga0068858_100005289
1293 Ga0068858_100028259
1294 Ga0068858_100070085
1295 Ga0068858_100076639
1296 Ga0068858_100110527
1297 Ga0068858_100131069
1298 Ga0068858_100173266
1299 Ga0068860_100000303
1300 Ga0068860_100044787
1301 Ga0068860_100092080
1302 Ga0068860_100126887
1303 Ga0068860_100303088
1304 Ga0068862_100004089
1305 Ga0068862_100026684
1306 Ga0068862_100047630
1307 Ga0068862_100148696
1308 Ga0068862_100221639
1309 Ga0068862_100288346
1310 Ga0068862_100322284
1311 Ga0070717_10001621
1312 Ga0070717_10010535
1313 Ga0070717_10014518
1314 Ga0070717_10197155
1315 Ga0075365_10114241
1316 Ga0070715_10063543
1317 Ga0070716_100045037
1318 Ga0070712_100000068
1319 Ga0070712_100003155
1320 Ga0070712_100024777
1321 Ga0070712_100079334
1322 Ga0070712_100082047
1323 Ga0070712_100283810
1324 Ga0075362_10013272
1325 Ga0075367_10012939
1326 Ga0075366_10004672
1327 Ga0097621_100000739
1328 Ga0097621_100001227
1329 Ga0097621_100001464
1330 Ga0097621_100014464
1331 Ga0097621_100060237
1332 Ga0097621_100082532
1333 Ga0097621_100088614
1334 Ga0097621_100177372
1335 Ga0097621_100216521
1336 Ga0068871_100001869
1337 Ga0068871_100002436
1338 Ga0068871_100002615
1339 Ga0068871_100012480
1340 Ga0068871_100036087
1341 Ga0068871_100038959
1342 Ga0068871_100057608
1343 Ga0068871_100231916
1344 Ga0068871_100235285
1345 Ga0075428_100012893
1346 Ga0075428_100019477
1347 Ga0075428_100087268
1348 Ga0075428_100108985
1349 Ga0075428_100119999
1350 Ga0075428_100191088
1351 Ga0075428_100296925
1352 Ga0075428_100380739
1353 Ga0075430_100038458
1354 Ga0075430_100101103
1355 Ga0075430_100122888
1356 Ga0075430_100269535
1357 Ga0075431_100094550
1358 Ga0075431_100099234
1359 Ga0075431_100242873
1360 Ga0075433_10017964
1361 Ga0075433_10032523
1362 Ga0075434_100000752
1363 Ga0075434_100003967
1364 Ga0075434_100019695
1365 Ga0075434_100020588
1366 Ga0075434_100043609
1367 Ga0075434_100085599
1368 Ga0075434_100108387
1369 Ga0075434_100157313
1370 Ga0075434_100186025
1371 Ga0075434_100507126
1372 Ga0075429_100006558
1373 Ga0075429_100053515
1374 Ga0075429_100098012
1375 Ga0068865_100122940
1376 Ga0068865_100160258
1377 Ga0075436_100000125
1378 Ga0075436_100229523
1379 Ga0097620_100002169
1380 Ga0097620_100011456
1381 Ga0097620_100017021
1382 Ga0097620_100018429
1383 Ga0097620_100022495
1384 Ga0097620_100028305
1385 Ga0097620_100037489
1386 Ga0097620_100038749
1387 Ga0097620_100074034
1388 Ga0097620_100106223
1389 Ga0097620_100188445
1390 Ga0097620_100203768
1391 Ga0097620_100355527
1392 Ga0075435_100000242
1393 Ga0075435_100003023
1394 Ga0075435_100009050
1395 Ga0075435_100020329
1396 Ga0075435_100035457
1397 Ga0075435_100121793
1398 Ga0075435_100173479
1399 Ga0099795_10004242
1400 Ga0105240_10101159
1401 Ga0111539_10000116
1402 Ga0111539_10005883
1403 Ga0111539_10010270
1404 Ga0111539_10010922
1405 Ga0111539_10022058
1406 Ga0111539_10131018
1407 Ga0111539_10225433
1408 Ga0111539_10245041
1409 Ga0111539_10352277
1410 Ga0105245_10003927
1411 Ga0105245_10060024
1412 Ga0105245_10351234
1413 Ga0105245_10369053
1414 Ga0105247_10002892
1415 Ga0105247_10116730
1416 Ga0114129_10002377
1417 Ga0114129_10003649
1418 Ga0114129_10021105
1419 Ga0114129_10040942
1420 Ga0114129_10064441
1421 Ga0114129_10074579
1422 Ga0114129_10177577
1423 Ga0114129_10216717
1424 Ga0114129_10334138
1425 Ga0114129_10499771
1426 Ga0105243_10000419
1427 Ga0105243_10013767
1428 Ga0105241_10006596
1429 Ga0105241_10017513
1430 Ga0105241_10019500
1431 Ga0105241_10143449
1432 Ga0105241_10177089
1433 Ga0105241_10386167
1434 Ga0105241_10395121
1435 Ga0105242_10000162
1436 Ga0105242_10004177
1437 Ga0105242_10010323
1438 Ga0105242_10024640
1439 Ga0105242_10353472
1440 Ga0105248_10001543
1441 Ga0105248_10011406
1442 Ga0105248_10026373
1443 Ga0105248_10031945
1444 Ga0105248_10040359
1445 Ga0105248_10048130
1446 Ga0105248_10197542
1447 Ga0105248_10284697
1448 Ga0105248_10288985
1449 Ga0105248_10338855
1450 Ga0105237_10163649
1451 Ga0105238_10000910
1452 Ga0105238_10014550
1453 Ga0105238_10030107
1454 Ga0105238_10136428
1455 Ga0105238_10185815
1456 Ga0105249_10006716
1457 Ga0105249_10030009
1458 Ga0105249_10206610
1459 Ga0105249_10282160
1460 Ga0099796_10015084
1461 Ga0105239_10008079
1462 Ga0105239_10010869
1463 Ga0105239_10066350
1464 Ga0105239_10112714
1465 Ga0105239_10273303
1466 Ga0105239_10309161
1467 Ga0105239_10383426
1468 Ga0105246_10029689
1469 Ga0105246_10084282
1470 Ga0157373_10002998
1471 Ga0157373_10004351
1472 Ga0157373_10055027
1473 Ga0157373_10187404
1474 Ga0157369_10013891
1475 Ga0157369_10014806
1476 Ga0157369_10040623
1477 Ga0157374_10000425
1478 Ga0157374_10000477
1479 Ga0157374_10007647
1480 Ga0157374_10026181
1481 Ga0157374_10058371
1482 Ga0157374_10072860
1483 Ga0157374_10133832
1484 Ga0157374_10159590
1485 Ga0157374_10208050
1486 Ga0157374_10357462
1487 Ga0157378_10000082
1488 Ga0157378_10001226
1489 Ga0157378_10001328
1490 Ga0157378_10016738
1491 Ga0157378_10017317
1492 Ga0157378_10023027
1493 Ga0157378_10100594
1494 Ga0157378_10125132
1495 Ga0163162_10031097
1496 Ga0163162_10036124
1497 Ga0163162_10054294
1498 Ga0163162_10063133
1499 Ga0163162_10081811
1500 Ga0163162_10122176
1501 Ga0163162_10157968
1502 Ga0163162_10245167
1503 Ga0163162_10560866
1504 Ga0163162_10656363
1505 Ga0157372_10001675
1506 Ga0157372_10003558
1507 Ga0157372_10004152
1508 Ga0157372_10007396
1509 Ga0157372_10017976
1510 Ga0157372_10074383
1511 Ga0157372_10126957
1512 Ga0157372_10421497
1513 Ga0157375_10002492
1514 Ga0157375_10004861
1515 Ga0157375_10015692
1516 Ga0157375_10016209
1517 Ga0157375_10190015
1518 Ga0157375_10230644
1519 Ga0157375_10328137
1520 Ga0157375_10645525
1521 Ga0163163_10000495
1522 Ga0163163_10001144
1523 Ga0163163_10001705
1524 Ga0163163_10003211
1525 Ga0163163_10004961
1526 Ga0163163_10009445
1527 Ga0163163_10029619
1528 Ga0163163_10104037
1529 Ga0163163_10121701
1530 Ga0163163_10155939
1531 Ga0163163_10164891
1532 Ga0163163_10211087
1533 Ga0157380_10100665
1534 Ga0157380_10115285
1535 Ga0157380_10260936
1536 Ga0157377_10001335
1537 Ga0157377_10044224
1538 Ga0157377_10046124
1539 Ga0157377_10117194
1540 Ga0157379_10000585
1541 Ga0157379_10031291
1542 Ga0157379_10031430
1543 Ga0157379_10074127
1544 Ga0157379_10308804
1545 Ga0157376_10000017
1546 Ga0157376_10001723
1547 Ga0157376_10007450
1548 Ga0157376_10066376
1549 Ga0157376_10079588
1550 Ga0157376_10398198
1551 Ga0163161_10026495
1552 Ga0163161_10055402
1553 Ga0163161_10074294
1554 Ga0213876_10036799
1555 Ga0224572_1008541
1556 Ga0209758_1002835
1557 Ga0207697_10015984
1558 Ga0207656_10026445
1559 Ga0207692_10002604
1560 Ga0207692_10012351
1561 Ga0207692_10027747
1562 Ga0207692_10051978
1563 Ga0207642_10014700
1564 Ga0207642_10111421
1565 Ga0207710_10001465
1566 Ga0207688_10048037
1567 Ga0207680_10020014
1568 Ga0207647_10016615
1569 Ga0207647_10097505
1570 Ga0207699_10002098
1571 Ga0207699_10083224
1572 Ga0207645_10050981
1573 Ga0207643_10007238
1574 Ga0207643_10024801
1575 Ga0207643_10037956
1576 Ga0207643_10070802
1577 Ga0207643_10132504
1578 Ga0207705_10039977
1579 Ga0207705_10191550
1580 Ga0207654_10026183
1581 Ga0207654_10040851
1582 Ga0207654_10164105
1583 Ga0207707_10003174
1584 Ga0207707_10024436
1585 Ga0207707_10176253
1586 Ga0207707_10238299
1587 Ga0207707_10323356
1588 Ga0207671_10100082
1589 Ga0207693_10000057
1590 Ga0207693_10009295
1591 Ga0207693_10016441
1592 Ga0207693_10071493
1593 Ga0207693_10101829
1594 Ga0207693_10132833
1595 Ga0207663_10003566
1596 Ga0207660_10039627
1597 Ga0207660_10120078
1598 Ga0207662_10002208
1599 Ga0207662_10051407
1600 Ga0207662_10069798
1601 Ga0207657_10012045
1602 Ga0207657_10057579
1603 Ga0207657_10238437
1604 Ga0207649_10001696
1605 Ga0207649_10004170
1606 Ga0207649_10015254
1607 Ga0207649_10082275
1608 Ga0207649_10109102
1609 Ga0207652_10003412
1610 Ga0207652_10032862
1611 Ga0207652_10229517
1612 Ga0207681_10017573
1613 Ga0207681_10057025
1614 Ga0207681_10093051
1615 Ga0207694_10003021
1616 Ga0207694_10011735
1617 Ga0207650_10000017
1618 Ga0207650_10000161
1619 Ga0207650_10010243
1620 Ga0207650_10010256
1621 Ga0207650_10012827
1622 Ga0207650_10016847
1623 Ga0207650_10034247
1624 Ga0207650_10040727
1625 Ga0207650_10043812
1626 Ga0207650_10051839
1627 Ga0207650_10090144
1628 Ga0207650_10231074
1629 Ga0207650_10307021
1630 Ga0207659_10010513
1631 Ga0207659_10043054
1632 Ga0207659_10271536
1633 Ga0207687_10015698
1634 Ga0207687_10088679
1635 Ga0207687_10227108
1636 Ga0207700_10000377
1637 Ga0207700_10001680
1638 Ga0207700_10009335
1639 Ga0207700_10126814
1640 Ga0207700_10137552
1641 Ga0207664_10000973
1642 Ga0207664_10042923
1643 Ga0207644_10059757
1644 Ga0207644_10119806
1645 Ga0207690_10105895
1646 Ga0207706_10009128
1647 Ga0207706_10049873
1648 Ga0207706_10101578
1649 Ga0207686_10000069
1650 Ga0207686_10024701
1651 Ga0207686_10055668
1652 Ga0207709_10000025
1653 Ga0207709_10009789
1654 Ga0207670_10002826
1655 Ga0207670_10009696
1656 Ga0207670_10028399
1657 Ga0207670_10028594
1658 Ga0207670_10058652
1659 Ga0207670_10241135
1660 Ga0207669_10004295
1661 Ga0207669_10008824
1662 Ga0207704_10024761
1663 Ga0207704_10031390
1664 Ga0207704_10054741
1665 Ga0207665_10002196
1666 Ga0207665_10003791
1667 Ga0207665_10026876
1668 Ga0207665_10054987
1669 Ga0207691_10001839
1670 Ga0207691_10048778
1671 Ga0207691_10068402
1672 Ga0207691_10192256
1673 Ga0207711_10002939
1674 Ga0207711_10005519
1675 Ga0207711_10014282
1676 Ga0207711_10063865
1677 Ga0207711_10094626
1678 Ga0207711_10133361
1679 Ga0207711_10140745
1680 Ga0207711_10147609
1681 Ga0207711_10154589
1682 Ga0207711_10255218
1683 Ga0207689_10003244
1684 Ga0207689_10008816
1685 Ga0207689_10060268
1686 Ga0207689_10070006
1687 Ga0207689_10094510
1688 Ga0207689_10165502
1689 Ga0207689_10306345
1690 Ga0207661_10002094
1691 Ga0207661_10002500
1692 Ga0207661_10296939
1693 Ga0207679_10000553
1694 Ga0207679_10001688
1695 Ga0207679_10020455
1696 Ga0207679_10052645
1697 Ga0207679_10066658
1698 Ga0207679_10088575
1699 Ga0207679_10089450
1700 Ga0207679_10228463
1701 Ga0207667_10080893
1702 Ga0207651_10024150
1703 Ga0207651_10024355
1704 Ga0207651_10048160
1705 Ga0207651_10050643
1706 Ga0207712_10005714
1707 Ga0207712_10010302
1708 Ga0207712_10151073
1709 Ga0207668_10000053
1710 Ga0207668_10000323
1711 Ga0207668_10008775
1712 Ga0207640_10012640
1713 Ga0207640_10022145
1714 Ga0207640_10031074
1715 Ga0207640_10111121
1716 Ga0207640_10188964
1717 Ga0207658_10000988
1718 Ga0207658_10028896
1719 Ga0207658_10139156
1720 Ga0207677_10107765
1721 Ga0207703_10000968
1722 Ga0207703_10008957
1723 Ga0207703_10039130
1724 Ga0207703_10044556
1725 Ga0207703_10057802
1726 Ga0207703_10151541
1727 Ga0207703_10161030
1728 Ga0207639_10016019
1729 Ga0207708_10051799
1730 Ga0207708_10052363
1731 Ga0207708_10146312
1732 Ga0207708_10188754
1733 Ga0207708_10201025
1734 Ga0207702_10002933
1735 Ga0207702_10005179
1736 Ga0207702_10200942
1737 Ga0207641_10000539
1738 Ga0207641_10015058
1739 Ga0207641_10019989
1740 Ga0207641_10021069
1741 Ga0207641_10055254
1742 Ga0207641_10080427
1743 Ga0207641_10115770
1744 Ga0207641_10238430
1745 Ga0207648_10010425
1746 Ga0207648_10013662
1747 Ga0207648_10015056
1748 Ga0207648_10046095
1749 Ga0207648_10068880
1750 Ga0207648_10081315
1751 Ga0207676_10000685
1752 Ga0207676_10003419
1753 Ga0207676_10003684
1754 Ga0207676_10008016
1755 Ga0207676_10008366
1756 Ga0207676_10014750
1757 Ga0207676_10049523
1758 Ga0207676_10060182
1759 Ga0207676_10066290
1760 Ga0207676_10208354
1761 Ga0207676_10399710
1762 Ga0207674_10000116
1763 Ga0207674_10002114
1764 Ga0207674_10007866
1765 Ga0207674_10009074
1766 Ga0207674_10011514
1767 Ga0207674_10011730
1768 Ga0207674_10011804
1769 Ga0207675_100002992
1770 Ga0207675_100005697
1771 Ga0207675_100020125
1772 Ga0207675_100051448
1773 Ga0207675_100075376
1774 Ga0207675_100089811
1775 Ga0207683_10005942
1776 Ga0207683_10149227
1777 Ga0207698_10044959
1778 Ga0207698_10124995
1779 Ga0209984_1003365
1780 Ga0209982_1001908
1781 Ga0210002_1009932
1782 Ga0209813_10025741
1783 Ga0209974_10004187
1784 Ga0207428_10000185
1785 Ga0207428_10000657
1786 Ga0207428_10007200
1787 Ga0268266_10000306
1788 Ga0268266_10000698
1789 Ga0268266_10018384
1790 Ga0268266_10101361
1791 Ga0268266_10183086
1792 Ga0268265_10045050
1793 Ga0268265_10217330
1794 Ga0268265_10234686
1795 Ga0268264_10000059
1796 Ga0268264_10028307
1797 Ga0268264_10064072
1798 Ga0268264_10068130
1799 Ga0268264_10255434
1800 Ga0265338_10009200
1801 Ga0265760_10000174
1802 Ga0265760_10001093
1803 Ga0265760_10015062
1804 Ga0307509_10005400
1805 Ga0307408_100004133
1806 Ga0307408_100233060
1807 Ga0316576_10120432
1808 Ga0316578_10016124
1809 Ga0307405_10007682
1810 Ga0307410_10016725
1811 Ga0307406_10008001
1812 Ga0307406_10080872
1813 Ga0307412_10012020
1814 Ga0307409_100004668
1815 Ga0307409_100127309
1816 Ga0307416_100000605
1817 Ga0307416_100191448
1818 Ga0307414_10004572
1819 Ga0307411_10058544
1820 Ga0307415_100004707
1821 Ga0373950_0016590
1822 Ga0373958_0004283
1823 Ga0373938_0006621
1824 Ga0373926_0086634
1825 Ga0373934_0000323
1826 Ga0373940_0009176
1827 Ga0373951_0001465
1828 Ga0373952_0002185
1829 Ga0373932_0001201
1830 Ga0373936_0023260
1831 Ga0373939_0005514
1832 Ga0373953_0010189
1833 Ga0373954_0015478
1834 Ga0373956_0004608
1835 Ga0373956_0018013
1836 Ga0373960_0001714
1837 Ga0373943_0008378
1838 Ga0373943_0146183
1839 Ga0373955_0016372
1840 Ga0373955_0028932
1841 Ga0373942_0002890
1842 Ga0373961_0000931
1843 Ga0373962_0000951
1844 Ga0373931_0015368
1845 Ga0373931_0027486
1846 Ga0373935_0019050
1847 Ga0373935_0021952
1848 Ga0373935_0105576
1849 Ga0373927_0005808
1850 Ga0373933_0021210
1851 Ga0373933_0091542
1852 Ga0373947_0029890
1853 Ga0373947_0044571
1854 Ga0373947_0080090
1855 Ga0373937_0013437
1856 Ga0373937_0015347
1857 Ga0373937_0048754
1858 Ga0373937_0122221
1859 Ga0373937_0200743
1860 Ga0373937_0273085
1861 Ga0316584_0001131
1862 Ga0373925_0010539
1863 Ga0373925_0010955
1864 Ga0373925_0057697
1865 Ga0373925_0058512
1866 Ga0395898_0325404
1867 Ga0395905_0023172
1868 Ga0395905_0048659
1869 Ga0395905_0096348
1870 Ga0395905_0124328
1871 Ga0395905_0132428
1872 Ga0395905_0244601
1873 Ga0436365_0409719
1874 Ga0451807_2187363
1875 Ga0450896_002822
1876 Ga0451577_0008592
1877 Ga0439440_0023534
1878 Ga0453683_0005527
1879 Ga0453683_0136003
1880 Ga0453684_0090989
1881 Ga0451576_0011708
1882 Ga0451576_0019279
1883 Ga0451576_0042805
1884 Ga0451576_0048611
1885 Ga0451576_0192576
1886 Ga0495592_0028956
1887 Ga0495592_0040306
1888 Ga0495592_0228326
1889 Ga0495629_0005805
1890 Ga0495638_0007473
1891 Ga0495651_0028800
1892 Ga0495653_0226725
1893 Ga0495650_0000045
1894 Ga0495580_0000558
1895 Ga0495580_0000961
1896 Ga0495580_0036817
1897 Ga0495582_0000315
1898 Ga0495582_0009594
1899 Ga0495582_0044677
1900 Ga0495639_0016096
1901 Ga0495639_0031988
1902 Ga0495639_0040354
1903 Ga0495664_0014975
1904 Ga0495664_0188728
1905 Ga0495606_0009164
1906 Ga0495608_0000709
1907 Ga0495610_0000024
1908 Ga0495618_0000587
1909 Ga0495628_0023573
1910 Ga0495628_0106722
1911 Ga0495628_0270852
1912 Ga0495630_0166890
1913 Ga0495648_0024034
1914 Ga0495663_0001266
1915 Ga0495654_0000010
1916 Ga0495665_0002082
1917 Ga0495665_0007984
1918 Ga0495640_0020040
1919 Ga0495587_0005837
1920 Ga0495587_0086343
1921 Ga0495598_0000193
1922 Ga0495667_0018926
1923 Ga0495667_0103860
1924 Ga0495634_0011628
1925 Ga0495625_0000033
1926 Ga0495625_0002447
1927 Ga0495635_0040916
1928 Ga0495635_0122520
1929 Ga0495635_0197181
1930 Ga0495599_0056107
1931 Ga0495599_0106591
1932 Ga0495658_0012020
1933 Ga0495658_0042589
1934 Ga0495669_0020611
1935 Ga0495613_0003782
1936 Ga0495613_0209322
1937 Ga0495671_0041698
1938 Ga0495600_0036083
1939 Ga0495600_0147790
1940 Ga0495581_0022153
1941 Ga0495604_0248231
1942 Ga0495674_0014008
1943 Ga0495674_0096597
1944 Ga0495674_0104991
1945 Ga0495672_0028744
1946 Ga0495676_0063232
1947 Ga0495680_0014624
1948 Ga0495680_0203628
1949 Ga0495675_0000762
1950 Ga0495675_0049039
1951 Ga0495681_0066687
1952 Ga0495684_0038376
1953 Ga0495684_0043106
1954 Ga0495684_0055898
1955 Ga0495602_0074166
1956 Ga0496100_0071207
1957 Ga0496102_0027357
1958 Ga0496104_0029250
1959 Ga0496105_0031370
1960 Ga0496105_0165085
1961 Ga0496108_0208960
1962 Ga0496109_0156602
1963 Ga0496112_0034481
1964 Ga0496112_0039480
1965 Ga0496112_0081811
1966 Ga0496112_0102576
1967 Ga0496113_0123627
1968 Ga0496114_0005144
1969 Ga0496114_0089365
1970 Ga0496115_0013076
1971 Ga0496115_0029811
1972 Ga0496126_0010655
1973 Ga0501291_002334
1974 Ga0501296_001988
1975 Ga0501298_000718
1976 Ga0501298_001838
1977 Ga0501299_014370
1978 Ga0501036_0045618
1979 Ga0501038_0002013
1980 Ga0501038_0018009
1981 Ga0501039_0086994
1982 Ga0501040_0019587
1983 Ga0501041_0000056
1984 Ga0501041_0058117
1985 Ga0501043_0015748
1986 Ga0501046_0018609
1987 Ga0501047_0001175
1988 Ga0501048_0014054
1989 Ga0501067_0001640
1990 Ga0501068_0000102
1991 Ga0501069_0073254
1992 Ga0501070_0028058
1993 Ga0501071_0000181
1994 Ga0501071_0146738
1995 Ga0501072_0000031
1996 Ga0501072_0002955
1997 Ga0501072_0027658
1998 Ga0501073_0006570
1999 Ga0501074_0003665
2000 Ga0501075_0058057
2001 Ga0501076_0000164
2002 Ga0501076_0004526
2003 Ga0501076_0038160
2004 Ga0501202_002514
2005 Ga0501207_003645
2006 Ga0501209_002324
2007 Ga0501217_000362
2008 Ga0501223_001430
2009 Ga0501224_003650
2010 Ga0501224_005937
2011 Ga0501227_003409
2012 Ga0501235_002159
2013 Ga0501240_001966
2014 Ga0501243_002919
2015 Ga0501251_003383
2016 Ga0501257_004229
2017 Ga0501257_024549
2018 Ga0501225_0002472
2019 Ga0501225_0003511
2020 Ga0501225_0008103
2021 Ga0501234_003334
2022 Ga0501234_006244
2023 Ga0501079_0008412
2024 Ga0501080_0021642
2025 Ga0501080_0046568
2026 Ga0501081_0000077
2027 Ga0501081_0056739
2028 Ga0501283_003764
2029 Ga0501283_008782
2030 Ga0501035_0011181
2031 Ga0501044_0006402
2032 Ga0501045_0001345
2033 Ga0501226_002297
2034 nmdc:mga00v17_39922_c1
2035 nmdc:mga0yw44_33681_c1
2036 nmdc:mga0k408_3808_c1
2037 nmdc:mga06z11_11279_c1
2038 nmdc:mga05p37_103682_c1
2039 nmdc:mga05p37_122502_c1
2040 nmdc:mga05p37_153595_c1
2041 nmdc:mga05p37_1622_c1
2042 nmdc:mga05p37_246936_c1
2043 nmdc:mga05p37_293002_c1
2044 nmdc:mga05p37_35163_c1
2045 nmdc:mga05p37_35707_c1
2046 nmdc:mga05p37_4187_c1
2047 nmdc:mga09592_100390_c1
2048 nmdc:mga09592_13302_c1
2049 nmdc:mga09592_160053_c1
2050 nmdc:mga09592_52081_c1
2051 nmdc:mga0qj67_128687_c1
2052 nmdc:mga0qj67_290179_c1
2053 nmdc:mga0qj67_89249_c1
2054 nmdc:mga06r32_306668_c1
2055 nmdc:mga08y16_127628_c1
2056 nmdc:mga08y16_185319_c1
2057 nmdc:mga08y16_18887_c1
2058 nmdc:mga08y16_195218_c1
2059 nmdc:mga08y16_197539_c1
2060 nmdc:mga08y16_438369_c1
2061 nmdc:mga08y16_4783_c1
2062 nmdc:mga08y16_52662_c1
2063 nmdc:mga08y16_530_c1
2064 nmdc:mga08y16_91616_c1
2065 nmdc:mga0n895_121919_c1
2066 nmdc:mga0n895_146501_c1
2067 nmdc:mga0n895_14823_c1
2068 nmdc:mga0n895_15713_c1
2069 nmdc:mga0n895_170444_c1
2070 nmdc:mga0n895_317679_c1
2071 nmdc:mga0n895_38338_c1
2072 nmdc:mga0n895_39973_c1
2073 nmdc:mga0n895_8024_c1
2074 nmdc:mga0n895_8852_c1
2075 nmdc:mga0n895_92745_c1
2076 nmdc:mga0rr50_100347_c1
2077 nmdc:mga0rr50_167671_c1
2078 nmdc:mga0rr50_20835_c1
2079 nmdc:mga0rr50_209368_c1
2080 nmdc:mga0rr50_42037_c1
2081 nmdc:mga0rr50_84355_c1
2082 nmdc:mga08x19_439_c1
2083 nmdc:mga08x19_5637_c1
2084 nmdc:mga0a205_10856_c1
2085 nmdc:mga0a205_128957_c1
2086 nmdc:mga0a205_15367_c1
2087 nmdc:mga0a205_154900_c1
2088 nmdc:mga0a205_30937_c1
2089 nmdc:mga0a205_45526_c1
2090 nmdc:mga0a205_83890_c1
2091 nmdc:mga0a205_8720_c1
2092 Ga0495619_0028449
2093 Ga0495619_0120114
2094 Ga0500578_0000003
2095 Ga0500578_0009243
2096 Ga0500578_0043913
2097 Ga0500597_031061
2098 Ga0500608_001777
2099 Ga0500658_0003216
2100 Ga0500616_0013388
2101 Ga0500627_0005934
2102 Ga0500645_004166
2103 Ga0501084_0000050
2104 Ga0501084_0019636
2105 Ga0501084_0060748
2106 Ga0587071_002305
2107 Ga0501082_0000164
2108 Ga0501082_0000337
2109 Ga0501082_0001219
2110 Ga0530510_0000438
2111 Ga0530510_0005862
2112 Ga0530510_0024406
2113 2644344811
2114 2644367554

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

149

420

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ffi-assembly2.cif.gz_B crystal structure of putative 2-pyrone-4,6-dicarboxylic acid hydrolase from pseudomonas putida, northeast structural genomics target ppr23. 0.6591 53 363
2ffi-assembly2.cif.gz_B crystal structure of putative 2-pyrone-4,6-dicarboxylic acid hydrolase from pseudomonas putida, northeast structural genomics target ppr23. 0.6463 53 363
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.6461 53 362
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.6396 53 362
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.6391 53 362
ID Description Score Start End Superfamily
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7751 123 362 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7426 48 361 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7356 48 361 3.20.20.140
af_A0A0R0KUU2_4_202_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7242 152 349 3.20.20.140
3cjpA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6894 53 362 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2W4LYG9-F1-model_v4 Amidohydrolase 0.9915 117 377 GO:0016787
AF-A0A845BYA1-F1-model_v4 deleted 0.9863 49 375
AF-A0A6L7VNQ8-F1-model_v4 Amidohydrolase family protein 0.9853 79 374 GO:0016787
AF-A0A845BYA1-F1-model_v4 deleted 0.9833 49 375
AF-A0A2W4LYG9-F1-model_v4 Amidohydrolase 0.9803 117 377 GO:0016787

Map