F489189

General Info

Members Datasets Scaffolds Average Seq Length
1056 599 893 342

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100006258|Ga0307409_1000062582
Length 414
Sequence METPTFNGFEGPVWWAGGVPCSGVVMLNILTFEPEAQDFCSADPAAGCVCSWRPRITFCGVPAVTYVQRRPRLEAMKVLVTGGAGYIGSHTTLCLLEAGHEVVVLDNLMNSNPESLRRVEKLSGKKVDFRKVDLLDAASVDRLFEEGTFDAVIHFAGLKAVGESVAKPLWYYQNNVVGTLNLLHSMERAGVRRLVFSSSATVYGASEEVPLIEKAPLDATNPYGRTKEQIEDILSDLGAADPSWSIALLRYFNPVGAHESGLIGEDPVGVPNNLLPFVAQVAVGRREKVMVFGDDYPTADGTGVRDYIHVMDLAAGHLAALGYLQDKAGVYRWNLGTGRGSSVLEVIEAFSKAAGAPVPYEIAPRRPGDAAVSYSDPSAALADLGWSARRDLATMCEDHWRWQSRNPSGYEESV

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
5 2506520008 Serratia plymuthica AS12 Isolate Unclassified
6 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
7 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
8 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
9 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
10 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
11 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
12 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
13 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
14 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
15 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
16 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
17 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
18 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
19 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
20 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
21 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
22 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
23 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
24 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
25 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
26 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
27 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
28 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
29 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
30 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
31 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
32 2534681786 Brucella suis 92/29 Isolate Unclassified
33 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
34 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
35 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
36 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
37 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
38 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
39 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
40 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
41 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
42 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
43 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
44 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
45 2643221630 Microbacterium sp. Root322 Isolate Unclassified
46 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
47 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
48 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
49 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
50 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
51 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
52 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
53 2738541277 Variovorax sp. GV051 Isolate Unclassified
54 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
55 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
56 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
57 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
58 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
59 2738543019 Variovorax sp. GV040 Isolate Unclassified
60 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
61 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
62 2751185800 Brucella pituitosa AA2 Isolate Unclassified
63 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
64 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
65 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
66 2791355199
67 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
68 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
69 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
70 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
71 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
72 2818991450 Burkholderia sp. 604 Isolate Unclassified
73 2821131069 Duganella sp. 1224 Isolate Unclassified
74 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
75 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
76 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
77 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
78 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
79 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
80 2842677519 Variovorax sp. R-72495 Isolate Unclassified
81 2854911287 Brucella lupini LUP21 Isolate Unclassified
82 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
83 2857564685 Duganella sp. R-74599 Isolate Unclassified
84 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
85 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
86 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
87 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
88 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
89 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
90 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
91 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
92 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
93 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
94 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
95 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
96 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
97 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
98 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
99 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
100 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
101 2904456579 Variovorax sp. 2002 Isolate Unclassified
102 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
103 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
104 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
105 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
106 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
107 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
108 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
109 2904699407
110 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
111 2906610324
112 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
113 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
114 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
115 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
116 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
117 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
118 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
119 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
120 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
121 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
122 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
123 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
124 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
125 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
126 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
127 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
128 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
129 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
130 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
131 2932406140 Serratia sp. 2723 Isolate Rhizosphere
132 2939577877 Serratia sp. 509 Isolate Rhizosphere
133 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
134 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
135 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
136 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
137 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
138 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
139 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
140 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
141 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
142 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
143 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
144 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
145 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
146 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
147 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
148 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
149 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
150 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
151 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
152 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
153 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
154 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
155 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
156 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
157 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
158 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
159 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
160 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
162 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
163 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
164 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
165 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
166 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
167 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
168 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
169 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
170 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
171 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
172 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
173 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
174 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
175 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
176 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
177 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
178 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
179 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
180 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
181 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
182 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
183 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
184 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
185 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
186 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
187 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
188 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
189 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
190 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
191 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
192 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
193 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
194 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
195 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
196 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
197 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
198 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
199 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
200 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
201 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
202 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
203 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
204 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
205 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
206 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
207 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
208 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
209 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
210 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
211 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
212 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
213 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
214 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
215 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
216 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
217 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
218 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
219 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
220 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
221 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
222 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
223 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
224 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
225 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
226 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
227 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
228 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
229 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
230 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
231 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
232 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
233 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
234 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
235 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
236 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
237 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
238 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
239 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
240 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
241 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
242 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
243 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
244 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
245 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
246 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
247 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
248 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
249 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
250 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
251 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
252 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
253 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
254 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
255 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
256 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
257 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
258 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
259 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
260 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
261 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
262 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
263 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
264 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
265 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
266 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
267 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
268 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
269 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
270 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
271 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
272 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
273 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
274 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
275 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
276 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
277 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
278 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
279 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
280 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
281 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
282 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
283 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
290 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
294 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
295 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
296 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
297 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
299 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
300 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
301 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
303 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
304 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
306 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
355 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
356 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
357 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
358 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
359 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
363 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
364 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
365 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
366 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
367 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
368 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
369 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
370 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
371 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
372 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
373 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
374 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
375 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
376 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
377 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
378 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
379 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
380 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
381 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
382 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
383 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
384 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
385 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
386 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
387 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
388 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
389 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
390 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
391 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
392 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
393 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
394 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
395 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
396 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
397 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
398 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
399 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
400 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
401 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
402 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
403 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
404 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
405 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
406 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
407 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
408 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
409 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
410 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
411 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
412 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
413 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
414 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
415 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
416 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
417 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
418 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
419 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
420 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
421 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
422 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
423 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
424 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
425 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
426 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
427 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
428 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
429 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
430 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
431 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
432 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
433 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
434 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
435 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
436 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
437 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
438 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
439 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
440 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
441 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
442 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
443 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
444 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
445 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
446 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
447 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
448 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
449 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
450 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
451 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
452 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
453 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
454 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
455 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
456 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
457 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
458 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
459 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
460 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
461 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
462 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
463 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
464 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
465 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
466 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
467 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
468 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
469 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
470 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
471 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
472 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
473 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
474 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
475 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
476 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
477 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
478 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
479 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
480 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
481 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
482 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
483 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
484 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
485 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
486 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
487 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
488 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
489 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
490 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
491 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
492 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
493 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
494 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
495 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
496 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
497 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
498 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
499 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
500 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
501 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
502 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
503 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
504 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
505 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
506 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
507 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
508 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
509 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
510 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
511 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
512 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
513 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
514 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
515 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
516 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
517 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
518 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
519 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
520 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
521 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
522 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
523 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
524 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
526 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
528 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
529 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
530 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
531 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
532 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
533 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
534 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
535 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
536 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
537 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
538 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
539 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
540 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
541 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
542 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
543 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
544 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
545 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
546 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
547 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
548 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
549 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
550 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
551 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
552 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
553 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
554 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
555 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
556 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
557 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
558 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
559 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
560 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
561 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
562 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
563 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
564 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
565 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
566 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
567 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
568 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
569 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
570 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
571 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
572 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
573 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
574 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
575 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
576 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
577 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
578 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
579 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
580 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
581 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
585 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
586 640753048 Serratia proteamaculans 568 Isolate Endosphere
587 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
588 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
589 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
590 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
591 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
592 8004592986 Serratia sp. S119 Isolate Unclassified
593 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
594 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
595 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
596 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
597 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
598 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
599 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.05
Metatranscriptomes 0.76
Isolates 15.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.87
Nodule 4.92
Rhizoplane 4.26
Rhizosphere 62.97
Stem 0
Stem Tuber 0
Unclassified 12.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1008444 3300000549 Bacteria 1252
2 JGI24740J21852_10002056 3300001979 Bacteria 9201
3 JGI24739J22299_10003515 3300001989 Bacteria 5981
4 JGI24739J22299_10021682 3300001989 Bacteria 2285
5 JGI24735J21928_10003656 3300002067 Bacteria 5213
6 JGI24735J21928_10010195 3300002067 Bacteria 3002
7 JGI24738J21930_10010003 3300002075 Bacteria 2121
8 JGI25156J39149_1000178 3300002705 Bacteria 46629
9 JGI25156J39149_1000226 3300002705 Bacteria 38895
10 JGI25156J39149_1000337 3300002705 Bacteria 30825
11 JGI25156J39149_1007431 3300002705 Bacteria 2879
12 JGI25159J45721_1000145 3300002987 Bacteria 32623
13 JGI25151J46595_10001061 3300003187 Bacteria 20487
14 JGI25151J46595_10004161 3300003187 Bacteria 7724
15 JGI25165J46597_1001162 3300003214 Bacteria 16252
16 rootH2_10299511 3300003320 Bacteria 2719
17 rootH1_10007027 3300003323 Bacteria 4599
18 JGI25160J50197_1000327 3300003354 Bacteria 32616
19 JGI25161J50226_1000245 3300003374 Bacteria 32623
20 Ga0007409J51694_1005204 3300003575 Bacteria 9118
21 Ga0007416J51690_1004145 3300003577 Bacteria 9118
22 Ga0032354_1011833 3300003693 Bacteria 9107
23 Ga0055538_1000002 3300003751 Bacteria 999437
24 Ga0055539_1000002 3300003752 Bacteria 999437
25 Ga0055533_1000004 3300003756 Bacteria 999437
26 Ga0055533_1000124 3300003756 Bacteria 87900
27 Ga0055533_1000563 3300003756 Bacteria 13037
28 Ga0055532_1000001 3300003758 Bacteria 1119836
29 Ga0055525_1000002 3300003759 Bacteria 999437
30 Ga0055527_1000014 3300003760 Bacteria 289449
31 Ga0055535_1000001 3300003761 Bacteria 1119836
32 Ga0055542_1000001 3300003762 Bacteria 1119836
33 Ga0055529_1000001 3300003763 Bacteria 826680
34 Ga0055529_1000100 3300003763 Bacteria 131049
35 Ga0055526_1013866 3300003771 Bacteria 3368
36 Ga0055537_1000229 3300003773 Bacteria 41052
37 Ga0055536_1002843 3300003781 Bacteria 9535
38 Ga0055534_1000081 3300003784 Bacteria 75591
39 Ga0055528_1000107 3300003790 Bacteria 67056
40 Ga0055540_1000641 3300003792 Bacteria 24815
41 Ga0055531_10003438 3300003794 Bacteria 10102
42 Ga0055541_1000002 3300003841 Bacteria 896405
43 Ga0055543_1000325 3300004625 Bacteria 32876
44 Ga0055543_1002357 3300004625 Bacteria 6319
45 Ga0065165_1000120 3300005262 Bacteria 134211
46 Ga0065165_1001062 3300005262 Bacteria 32876
47 Ga0065165_1002142 3300005262 Bacteria 17905
48 Ga0065704_10081616 3300005289 Bacteria 3729
49 Ga0070658_10000023 3300005327 Bacteria 185522
50 Ga0070658_10002509 3300005327 Bacteria 15336
51 Ga0068869_100003661 3300005334 Bacteria 9444
52 Ga0070666_10034313 3300005335 Bacteria 3363
53 Ga0068868_100080764 3300005338 Bacteria 2606
54 Ga0070660_100067618 3300005339 Bacteria 2784
55 Ga0070687_100008147 3300005343 Bacteria 4419
56 Ga0070692_10048994 3300005345 Bacteria 2190
57 Ga0070669_100052901 3300005353 Bacteria 2971
58 Ga0070671_100122145 3300005355 Bacteria 2192
59 Ga0070674_100031273 3300005356 Bacteria 3526
60 Ga0070674_100116630 3300005356 Bacteria 1970
61 Ga0070674_100253909 3300005356 Bacteria 1382
62 Ga0070673_100000226 3300005364 Bacteria 28311
63 Ga0070659_100202824 3300005366 Bacteria 1633
64 Ga0070659_100247619 3300005366 Bacteria 1476
65 Ga0070667_100229459 3300005367 Bacteria 1655
66 Ga0070713_100000597 3300005436 Bacteria 22955
67 Ga0070710_10160650 3300005437 Bacteria 1393
68 Ga0070705_100014971 3300005440 Bacteria 4002
69 Ga0070700_100009577 3300005441 Bacteria 5322
70 Ga0070694_100053561 3300005444 Bacteria 2731
71 Ga0070663_100034260 3300005455 Bacteria 3516
72 Ga0070663_100083409 3300005455 Bacteria 2353
73 Ga0070678_100000633 3300005456 Bacteria 17225
74 Ga0070678_100070874 3300005456 Bacteria 2608
75 Ga0070681_10014815 3300005458 Bacteria 7755
76 Ga0070681_10034876 3300005458 Bacteria 5053
77 Ga0070681_10185792 3300005458 Bacteria 1999
78 Ga0068867_100004040 3300005459 Bacteria 10322
79 Ga0068867_100012498 3300005459 Bacteria 6009
80 Ga0070685_10045066 3300005466 Unclassified 2527
81 Ga0070679_100099164 3300005530 Bacteria 2900
82 Ga0070684_100035112 3300005535 Bacteria 4290
83 Ga0070697_100037403 3300005536 Bacteria 3921
84 Ga0068853_100044527 3300005539 Bacteria 3799
85 Ga0068853_100045570 3300005539 Bacteria 3757
86 Ga0068853_100228122 3300005539 Bacteria 1703
87 Ga0070672_100002363 3300005543 Bacteria 11939
88 Ga0070672_100097588 3300005543 Bacteria 2379
89 Ga0070686_100000404 3300005544 Bacteria 27098
90 Ga0070695_100007120 3300005545 Bacteria 6629
91 Ga0070696_100004953 3300005546 Bacteria 8891
92 Ga0070665_100001295 3300005548 Bacteria 29936
93 Ga0070665_100066937 3300005548 Bacteria 3603
94 Ga0070665_100137102 3300005548 Bacteria 2450
95 Ga0070665_100213471 3300005548 Bacteria 1931
96 Ga0070665_100260884 3300005548 Bacteria 1734
97 Ga0070665_100320649 3300005548 Bacteria 1554
98 Ga0068855_100014208 3300005563 Bacteria 9591
99 Ga0068855_100026819 3300005563 Bacteria 6893
100 Ga0068855_100074389 3300005563 Bacteria 3946
101 Ga0068855_100365544 3300005563 Bacteria 1587
102 Ga0068854_100006860 3300005578 Bacteria 7261
103 Ga0068854_100007052 3300005578 Bacteria 7171
104 Ga0068854_100048170 3300005578 Bacteria 3040
105 Ga0068854_100137278 3300005578 Bacteria 1873
106 Ga0068854_100244785 3300005578 Bacteria 1429
107 Ga0070702_100014379 3300005615 Bacteria 4015
108 Ga0068852_100046505 3300005616 Bacteria 3699
109 Ga0068859_100069877 3300005617 Bacteria 3547
110 Ga0068864_100022903 3300005618 Bacteria 5241
111 Ga0068866_10000265 3300005718 Bacteria 24733
112 Ga0068861_100000207 3300005719 Bacteria 31461
113 Ga0068851_10000255 3300005834 Bacteria 25249
114 Ga0068870_10025274 3300005840 Bacteria 2947
115 Ga0068858_100003094 3300005842 Bacteria 16643
116 Ga0068860_100024757 3300005843 Bacteria 5798
117 Ga0068862_100002710 3300005844 Bacteria 15551
118 Ga0081455_10018727 3300005937 Bacteria 6573
119 Ga0081540_1014084 3300005983 Bacteria 5151
120 Ga0081540_1014939 3300005983 Bacteria 4939
121 Ga0075365_10021610 3300006038 Bacteria 4017
122 Ga0075365_10176295 3300006038 Bacteria 1493
123 Ga0075363_100095788 3300006048 Bacteria 1638
124 Ga0075364_10000085 3300006051 Bacteria 37086
125 Ga0075364_10000342 3300006051 Bacteria 23182
126 Ga0075364_10031014 3300006051 Bacteria 3434
127 Ga0075364_10112207 3300006051 Bacteria 1820
128 Ga0075362_10002319 3300006177 Bacteria 6359
129 Ga0075362_10058467 3300006177 Bacteria 1739
130 Ga0075367_10005597 3300006178 Bacteria 6258
131 Ga0075367_10007757 3300006178 Bacteria 5520
132 Ga0075369_10006660 3300006186 Bacteria 4378
133 Ga0075369_10057272 3300006186 Bacteria 1695
134 Ga0075369_10094925 3300006186 Bacteria 1333
135 Ga0075369_10112983 3300006186 Bacteria 1225
136 Ga0075366_10000152 3300006195 Bacteria 29263
137 Ga0075366_10007229 3300006195 Bacteria 6118
138 Ga0075366_10011587 3300006195 Bacteria 4981
139 Ga0075366_10012147 3300006195 Bacteria 4879
140 Ga0075366_10020135 3300006195 Bacteria 3867
141 Ga0075366_10127546 3300006195 Bacteria 1535
142 Ga0075366_10128855 3300006195 Bacteria 1526
143 Ga0075366_10143559 3300006195 Bacteria 1444
144 Ga0097621_100010305 3300006237 Bacteria 6830
145 Ga0075370_10011056 3300006353 Bacteria 4733
146 Ga0075428_100012004 3300006844 Bacteria 9638
147 Ga0075430_100031742 3300006846 Bacteria 4483
148 Ga0068865_100019287 3300006881 Bacteria 4413
149 Ga0097620_100069877 3300006931 Bacteria 3547
150 Ga0099822_1024140 3300006943 Bacteria 5489
151 Ga0079104_1001448 3300006946 Bacteria 15868
152 Ga0079104_1001983 3300006946 Bacteria 12008
153 Ga0079104_1003315 3300006946 Bacteria 7632
154 Ga0079104_1008755 3300006946 Bacteria 3495
155 Ga0099826_10000087 3300006948 Bacteria 46364
156 Ga0099795_10000287 3300007788 Bacteria 9029
157 Ga0099795_10023436 3300007788 Bacteria 2049
158 Ga0105251_10000405 3300009011 Bacteria 42135
159 Ga0105251_10000869 3300009011 Bacteria 27105
160 Ga0105251_10001189 3300009011 Bacteria 22551
161 Ga0105251_10001416 3300009011 Bacteria 20666
162 Ga0105251_10006773 3300009011 Bacteria 7229
163 Ga0105251_10008305 3300009011 Bacteria 6269
164 Ga0105251_10042879 3300009011 Bacteria 2193
165 Ga0105251_10077891 3300009011 Bacteria 1536
166 Ga0105244_10000864 3300009036 Bacteria 25593
167 Ga0105244_10003298 3300009036 Bacteria 11622
168 Ga0105244_10030368 3300009036 Bacteria 2876
169 Ga0105250_10009703 3300009092 Bacteria 4045
170 Ga0105250_10075631 3300009092 Bacteria 1362
171 Ga0105240_10037364 3300009093 Bacteria 6242
172 Ga0105240_10043539 3300009093 Bacteria 5711
173 Ga0105240_10052645 3300009093 Bacteria 5115
174 Ga0105240_10112554 3300009093 Bacteria 3290
175 Ga0105240_10234108 3300009093 Bacteria 2133
176 Ga0105245_10000257 3300009098 Bacteria 50535
177 Ga0105245_10233232 3300009098 Bacteria 1781
178 Ga0105247_10000018 3300009101 Bacteria 259335
179 Ga0105247_10025401 3300009101 Bacteria 3573
180 Ga0105247_10141698 3300009101 Bacteria 1576
181 Ga0114129_10134216 3300009147 Bacteria 3397
182 Ga0105243_10002572 3300009148 Bacteria 15157
183 Ga0105243_10549837 3300009148 Bacteria 1103
184 Ga0105241_10000004 3300009174 Bacteria 803007
185 Ga0105241_10038817 3300009174 Bacteria 3590
186 Ga0105242_10000371 3300009176 Bacteria 35724
187 Ga0105242_10015952 3300009176 Bacteria 5838
188 Ga0105242_10293720 3300009176 Bacteria 1481
189 Ga0105248_10038127 3300009177 Bacteria 5377
190 Ga0105248_10067149 3300009177 Bacteria 4026
191 Ga0105248_10288123 3300009177 Bacteria 1849
192 Ga0105248_10587945 3300009177 Bacteria 1256
193 Ga0105237_10019838 3300009545 Bacteria 6940
194 Ga0105237_10059278 3300009545 Bacteria 3830
195 Ga0105238_10000038 3300009551 Bacteria 162920
196 Ga0105238_10088633 3300009551 Bacteria 3080
197 Ga0105238_10236725 3300009551 Bacteria 1803
198 Ga0105249_10000243 3300009553 Bacteria 60371
199 Ga0105249_10066635 3300009553 Bacteria 3315
200 Ga0105249_10117450 3300009553 Bacteria 2523
201 Ga0105249_10127223 3300009553 Bacteria 2428
202 Ga0105249_10508503 3300009553 Bacteria 1251
203 Ga0099796_10007059 3300010159 Bacteria 2915
204 Ga0105239_10000303 3300010375 Bacteria 72769
205 Ga0105239_10015338 3300010375 Bacteria 8490
206 Ga0157347_1003449 3300012502 Bacteria 1418
207 Ga0157373_10000633 3300013100 Bacteria 27561
208 Ga0157373_10000981 3300013100 Bacteria 22059
209 Ga0157373_10001613 3300013100 Bacteria 17234
210 Ga0157373_10009523 3300013100 Bacteria 7171
211 Ga0157371_10005108 3300013102 Bacteria 11195
212 Ga0157371_10013078 3300013102 Bacteria 6318
213 Ga0157370_10000485 3300013104 Bacteria 49509
214 Ga0157370_10000756 3300013104 Bacteria 40377
215 Ga0157370_10012877 3300013104 Bacteria 8647
216 Ga0157370_10013422 3300013104 Bacteria 8440
217 Ga0157369_10000138 3300013105 Bacteria 102776
218 Ga0157369_10000510 3300013105 Bacteria 51123
219 Ga0157369_10014085 3300013105 Bacteria 9037
220 Ga0157369_10024923 3300013105 Bacteria 6647
221 Ga0157369_10034798 3300013105 Bacteria 5526
222 Ga0157369_10035030 3300013105 Bacteria 5505
223 Ga0157369_10103667 3300013105 Bacteria 3030
224 Ga0157369_10118636 3300013105 Bacteria 2808
225 Ga0157374_10000056 3300013296 Bacteria 117163
226 Ga0157374_10064879 3300013296 Bacteria 3428
227 Ga0157374_10159705 3300013296 Bacteria 2195
228 Ga0157374_10268028 3300013296 Bacteria 1683
229 Ga0157378_10000651 3300013297 Bacteria 32716
230 Ga0157378_10005243 3300013297 Bacteria 11383
231 Ga0163162_10031705 3300013306 Bacteria 5243
232 Ga0163162_10144520 3300013306 Bacteria 2494
233 Ga0163162_10194891 3300013306 Bacteria 2154
234 Ga0163162_10355455 3300013306 Bacteria 1598
235 Ga0163162_10433579 3300013306 Bacteria 1446
236 Ga0163162_10518994 3300013306 Bacteria 1321
237 Ga0163162_10542389 3300013306 Bacteria 1292
238 Ga0157372_10018305 3300013307 Bacteria 7529
239 Ga0157372_10271228 3300013307 Bacteria 1972
240 Ga0157372_10435499 3300013307 Bacteria 1528
241 Ga0157375_10165333 3300013308 Bacteria 2357
242 Ga0157375_10221768 3300013308 Bacteria 2049
243 Ga0157375_10456583 3300013308 Bacteria 1443
244 Ga0157375_10473760 3300013308 Bacteria 1417
245 Ga0163163_10014066 3300014325 Bacteria 7346
246 Ga0157380_10004646 3300014326 Bacteria 9551
247 Ga0157380_10124899 3300014326 Bacteria 2185
248 Ga0182008_10000556 3300014497 Bacteria 27658
249 Ga0182008_10004707 3300014497 Bacteria 7915
250 Ga0182008_10028269 3300014497 Bacteria 2835
251 Ga0157379_10011772 3300014968 Bacteria 7641
252 Ga0157376_10000001 3300014969 Bacteria 842910
253 Ga0182006_1000118 3300015261 Bacteria 85805
254 Ga0182006_1000152 3300015261 Bacteria 74063
255 Ga0182006_1002843 3300015261 Bacteria 9220
256 Ga0182006_1008317 3300015261 Bacteria 4704
257 Ga0182006_1058423 3300015261 Bacteria 1463
258 Ga0182007_10002938 3300015262 Bacteria 8276
259 Ga0182005_1000005 3300015265 Bacteria 537378
260 Ga0183361_10018 3300016635 Bacteria 133279
261 Ga0163161_10000004 3300017792 Bacteria 333149
262 Ga0163161_10000738 3300017792 Bacteria 25670
263 Ga0163161_10037604 3300017792 Bacteria 3471
264 Ga0224712_10000040 3300022467 Bacteria 19652
265 Ga0224712_10058763 3300022467 Bacteria 1524
266 Ga0209436_100135 3300025208 Bacteria 36415
267 Ga0209784_100002 3300025224 Bacteria 1753105
268 Ga0209566_100003 3300025225 Bacteria 1753105
269 Ga0209674_100004 3300025226 Bacteria 1753105
270 Ga0209674_100005 3300025226 Bacteria 1708125
271 Ga0209674_100150 3300025226 Bacteria 96511
272 Ga0209672_100001 3300025228 Bacteria 2828210
273 Ga0209147_100001 3300025229 Bacteria 2384371
274 Ga0209563_100006 3300025230 Bacteria 1753105
275 Ga0209563_100794 3300025230 Bacteria 9503
276 Ga0207427_100394 3300025231 Bacteria 25938
277 Ga0209258_100001 3300025242 Bacteria 2384269
278 Ga0209677_100003 3300025253 Bacteria 1753105
279 Ga0209148_1000003 3300025254 Bacteria 2384288
280 Ga0209148_1000620 3300025254 Bacteria 31479
281 Ga0209759_1000228 3300025256 Bacteria 84202
282 Ga0209759_1000275 3300025256 Bacteria 72571
283 Ga0209759_1000543 3300025256 Bacteria 39344
284 Ga0209759_1001138 3300025256 Bacteria 17013
285 Ga0209129_1001909 3300025258 Bacteria 10989
286 Ga0209233_1000016 3300025261 Bacteria 907830
287 Ga0209565_1000150 3300025263 Bacteria 94073
288 Ga0209455_1000001 3300025272 Bacteria 2384278
289 Ga0209455_1000047 3300025272 Bacteria 379709
290 Ga0209673_1000114 3300025273 Bacteria 178557
291 Ga0209130_1000057 3300025284 Bacteria 210593
292 Ga0209130_1000574 3300025284 Bacteria 35904
293 Ga0209675_1000062 3300025291 Bacteria 178557
294 Ga0209676_1000164 3300025292 Bacteria 156826
295 Ga0209676_1000244 3300025292 Bacteria 116654
296 Ga0209676_1021981 3300025292 Bacteria 2125
297 Ga0209025_1000049 3300025294 Bacteria 333459
298 Ga0209025_1000191 3300025294 Bacteria 152552
299 Ga0209025_1000709 3300025294 Bacteria 56684
300 Ga0209564_1002709 3300025295 Bacteria 13379
301 Ga0209564_1004984 3300025295 Bacteria 7818
302 Ga0209050_1000904 3300025298 Bacteria 39210
303 Ga0207426_1000657 3300025302 Bacteria 42328
304 Ga0207426_1002801 3300025302 Bacteria 10455
305 Ga0207426_1006276 3300025302 Bacteria 5198
306 Ga0209051_1000208 3300025303 Bacteria 102967
307 Ga0209257_1004516 3300025304 Bacteria 10706
308 Ga0209257_1010985 3300025304 Bacteria 4449
309 Ga0207656_10001797 3300025321 Bacteria 7140
310 Ga0207696_1000001 3300025711 Bacteria 2579611
311 Ga0207655_1001151 3300025728 Bacteria 25725
312 Ga0207655_1003515 3300025728 Bacteria 11623
313 Ga0207713_1000093 3300025735 Bacteria 146199
314 Ga0207713_1000205 3300025735 Bacteria 80817
315 Ga0207713_1000699 3300025735 Bacteria 31392
316 Ga0207713_1001376 3300025735 Bacteria 19744
317 Ga0207713_1001567 3300025735 Bacteria 17940
318 Ga0207642_10022646 3300025899 Bacteria 2496
319 Ga0207710_10000016 3300025900 Bacteria 388568
320 Ga0207647_10000410 3300025904 Bacteria 35247
321 Ga0207647_10000430 3300025904 Bacteria 34390
322 Ga0207647_10011603 3300025904 Bacteria 6171
323 Ga0207647_10013337 3300025904 Bacteria 5703
324 Ga0207647_10013559 3300025904 Bacteria 5644
325 Ga0207645_10008061 3300025907 Bacteria 7388
326 Ga0207645_10019099 3300025907 Bacteria 4500
327 Ga0207705_10000129 3300025909 Bacteria 82827
328 Ga0207705_10005484 3300025909 Bacteria 9487
329 Ga0207654_10000006 3300025911 Bacteria 815027
330 Ga0207707_10046163 3300025912 Unclassified 3793
331 Ga0207707_10102181 3300025912 Bacteria 2506
332 Ga0207695_10012277 3300025913 Bacteria 10288
333 Ga0207695_10012751 3300025913 Bacteria 10063
334 Ga0207695_10063221 3300025913 Bacteria 3817
335 Ga0207671_10171065 3300025914 Bacteria 1687
336 Ga0207671_10187055 3300025914 Bacteria 1614
337 Ga0207693_10265151 3300025915 Bacteria 1346
338 Ga0207663_10206381 3300025916 Bacteria 1421
339 Ga0207660_10178590 3300025917 Bacteria 1647
340 Ga0207657_10013828 3300025919 Bacteria 7898
341 Ga0207652_10021290 3300025921 Bacteria 5351
342 Ga0207694_10000126 3300025924 Bacteria 79243
343 Ga0207694_10013637 3300025924 Bacteria 6125
344 Ga0207694_10279127 3300025924 Bacteria 1372
345 Ga0207687_10023025 3300025927 Bacteria 4149
346 Ga0207700_10004741 3300025928 Bacteria 8066
347 Ga0207690_10179013 3300025932 Bacteria 1595
348 Ga0207686_10003545 3300025934 Bacteria 8372
349 Ga0207686_10047434 3300025934 Bacteria 2656
350 Ga0207709_10003067 3300025935 Bacteria 10096
351 Ga0207669_10024658 3300025937 Bacteria 3237
352 Ga0207669_10045061 3300025937 Bacteria 2597
353 Ga0207669_10176018 3300025937 Bacteria 1528
354 Ga0207704_10005412 3300025938 Bacteria 5886
355 Ga0207691_10135597 3300025940 Bacteria 2171
356 Ga0207711_10026051 3300025941 Bacteria 4905
357 Ga0207711_10309015 3300025941 Bacteria 1459
358 Ga0207711_10444961 3300025941 Bacteria 1206
359 Ga0207689_10000465 3300025942 Bacteria 38002
360 Ga0207689_10129531 3300025942 Bacteria 2076
361 Ga0207667_10000427 3300025949 Bacteria 56780
362 Ga0207667_10028128 3300025949 Bacteria 6107
363 Ga0207667_10148183 3300025949 Bacteria 2415
364 Ga0207667_10319366 3300025949 Bacteria 1586
365 Ga0207651_10000125 3300025960 Bacteria 32722
366 Ga0207712_10000433 3300025961 Bacteria 35737
367 Ga0207712_10069123 3300025961 Bacteria 2533
368 Ga0207668_10099867 3300025972 Bacteria 2154
369 Ga0207640_10077107 3300025981 Bacteria 2264
370 Ga0207640_10236046 3300025981 Bacteria 1410
371 Ga0207658_10139733 3300025986 Bacteria 1958
372 Ga0207677_10023862 3300026023 Bacteria 3787
373 Ga0207703_10015850 3300026035 Bacteria 5880
374 Ga0207678_10106794 3300026067 Bacteria 2388
375 Ga0207678_10126657 3300026067 Bacteria 2178
376 Ga0207708_10000376 3300026075 Bacteria 34827
377 Ga0207702_10278497 3300026078 Bacteria 1580
378 Ga0207641_10129547 3300026088 Bacteria 2264
379 Ga0207648_10000092 3300026089 Bacteria 84700
380 Ga0207676_10041160 3300026095 Bacteria 3545
381 Ga0207674_10244418 3300026116 Bacteria 1742
382 Ga0207675_100000181 3300026118 Bacteria 56942
383 Ga0207675_100222708 3300026118 Bacteria 1818
384 Ga0207683_10001307 3300026121 Bacteria 22512
385 Ga0207683_10098198 3300026121 Bacteria 2613
386 Ga0209281_1001285 3300027111 Bacteria 16101
387 Ga0209281_1005294 3300027111 Bacteria 3616
388 Ga0209589_1000014 3300027357 Bacteria 227996
389 Ga0209489_100014 3300027361 Bacteria 227996
390 Ga0209700_100024 3300027363 Bacteria 227996
391 Ga0209282_1002130 3300027666 Bacteria 11281
392 Ga0268266_10000916 3300028379 Bacteria 37956
393 Ga0268266_10023525 3300028379 Bacteria 5244
394 Ga0268266_10218115 3300028379 Bacteria 1752
395 Ga0268266_10284684 3300028379 Bacteria 1538
396 Ga0268265_10006000 3300028380 Bacteria 8265
397 Ga0268264_10021329 3300028381 Bacteria 5289
398 Ga0265338_10049870 3300028800 Bacteria 3789
399 Ga0307511_10000109 3300030521 Bacteria 74186
400 Ga0316180_1141634 3300030736 Bacteria 3981
401 Ga0316181_1264586 3300030744 Bacteria 3840
402 Ga0265328_10000002 3300031239 Bacteria 275819
403 Ga0265328_10007645 3300031239 Bacteria 4495
404 Ga0265320_10100830 3300031240 Bacteria 1330
405 Ga0265331_10053560 3300031250 Bacteria 1924
406 Ga0265327_10005493 3300031251 Bacteria 10556
407 Ga0265316_10000511 3300031344 Bacteria 43817
408 Ga0307408_100001595 3300031548 Bacteria 16749
409 Ga0307408_100009230 3300031548 Bacteria 6501
410 Ga0307408_100030979 3300031548 Bacteria 3719
411 Ga0307408_100087687 3300031548 Bacteria 2342
412 Ga0316576_10004707 3300031727 Bacteria 8236
413 Ga0316578_10027905 3300031728 Bacteria 3193
414 Ga0307405_10026202 3300031731 Bacteria 3361
415 Ga0307405_10109589 3300031731 Bacteria 1868
416 Ga0316577_10202466 3300031733 Bacteria 1122
417 Ga0307413_10253810 3300031824 Bacteria 1306
418 Ga0307410_10010788 3300031852 Bacteria 5197
419 Ga0307407_10048464 3300031903 Bacteria 2418
420 Ga0307412_10000005 3300031911 Bacteria 526194
421 Ga0307412_10000069 3300031911 Bacteria 108218
422 Ga0307412_10009054 3300031911 Bacteria 5704
423 Ga0307412_10020542 3300031911 Bacteria 4021
424 Ga0307409_100006258 3300031995 Bacteria 6974
425 Ga0307409_100364197 3300031995 Bacteria 1368
426 Ga0307416_100006168 3300032002 Bacteria 7474
427 Ga0307416_100008505 3300032002 Bacteria 6630
428 Ga0307416_100090969 3300032002 Bacteria 2619
429 Ga0307414_10100900 3300032004 Bacteria 2172
430 Ga0307510_10000948 3300033180 Bacteria 30647
431 Ga0315911_1000018 3300033442 Bacteria 152089
432 Ga0316574_0013130 3300035398 Bacteria 4756
433 Ga0316582_0276906 3300036647 Bacteria 1151
434 Ga0316584_0002399 3300036712 Bacteria 11842
435 Ga0316584_0014538 3300036712 Bacteria 5605
436 Ga0395899_0040683 3300037312 Bacteria 3476
437 Ga0395900_0052659 3300037418 Bacteria 4190
438 Ga0395900_0216701 3300037418 Bacteria 1931
439 Ga0395900_0233979 3300037418 Bacteria 1846
440 Ga0395898_0012898 3300037466 Bacteria 8622
441 Ga0395898_0073469 3300037466 Bacteria 3304
442 Ga0395898_0131666 3300037466 Bacteria 2395
443 Ga0395905_0000236 3300037471 Bacteria 83344
444 Ga0395905_0007181 3300037471 Bacteria 11123
445 Ga0395905_0007879 3300037471 Bacteria 10546
446 Ga0395905_0008311 3300037471 Bacteria 10241
447 Ga0395905_0015581 3300037471 Bacteria 7223
448 Ga0395905_0031654 3300037471 Bacteria 4978
449 Ga0395905_0036002 3300037471 Bacteria 4648
450 Ga0395905_0165040 3300037471 Bacteria 2081
451 Ga0395905_0275078 3300037471 Bacteria 1570
452 Ga0395905_0279247 3300037471 Bacteria 1556
453 Ga0395901_0000154 3300038443 Bacteria 89750
454 Ga0395901_0004377 3300038443 Bacteria 14249
455 Ga0395901_0031280 3300038443 Bacteria 5488
456 Ga0395901_0447378 3300038443 Bacteria 1322
457 Ga0439439_0010800 3300041406 Bacteria 2189
458 Ga0439466_0008698 3300041411 Bacteria 3825
459 Ga0451807_1151223 3300041486 Bacteria 2109
460 Ga0439449_0011594 3300042007 Bacteria 3315
461 Ga0439462_0005035 3300042015 Bacteria 3242
462 Ga0439463_004189 3300042016 Bacteria 3619
463 Ga0439446_0032084 3300042156 Bacteria 1522
464 Ga0450909_005168 3300042185 Bacteria 1878
465 Ga0451577_0008941 3300042876 Bacteria 9690
466 Ga0466969_0003919 3300044656 Bacteria 7901
467 Ga0466972_0055584 3300044658 Bacteria 1904
468 Ga0466973_0023612 3300044659 Bacteria 5893
469 Ga0466966_0000008 3300044684 Bacteria 155597
470 Ga0466966_0003154 3300044684 Bacteria 10855
471 Ga0466961_0007135 3300044693 Bacteria 7108
472 Ga0466961_0042890 3300044693 Bacteria 2898
473 Ga0466963_0003221 3300044694 Bacteria 9291
474 Ga0466963_0004171 3300044694 Bacteria 8366
475 Ga0466964_0005801 3300044706 Bacteria 4594
476 Ga0453684_0041659 3300044712 Bacteria 6206
477 Ga0453684_0094361 3300044712 Bacteria 3681
478 Ga0453684_0158893 3300044712 Bacteria 2676
479 Ga0466957_0032011 3300044842 Bacteria 3146
480 Ga0466957_0053462 3300044842 Bacteria 2462
481 Ga0466959_0000027 3300045049 Bacteria 114262
482 Ga0466967_0074519 3300045976 Bacteria 3049
483 Ga0495627_000038 3300046453 Bacteria 198316
484 Ga0495627_000231 3300046453 Bacteria 59148
485 Ga0495627_000396 3300046453 Bacteria 39486
486 Ga0495592_0008737 3300046454 Bacteria 7605
487 Ga0495603_0021997 3300046455 Bacteria 3861
488 Ga0495603_0055671 3300046455 Bacteria 2343
489 Ga0495603_0187281 3300046455 Bacteria 1197
490 Ga0495590_0000062 3300046457 Bacteria 82552
491 Ga0495590_0003467 3300046457 Bacteria 6435
492 Ga0495590_0019222 3300046457 Bacteria 2436
493 Ga0495591_001099 3300046458 Bacteria 18000
494 Ga0495629_0000054 3300046459 Bacteria 106374
495 Ga0495629_0000099 3300046459 Bacteria 75956
496 Ga0495629_0047453 3300046459 Bacteria 3012
497 Ga0495629_0067906 3300046459 Bacteria 2487
498 Ga0495638_0007214 3300046460 Bacteria 7992
499 Ga0495638_0007523 3300046460 Bacteria 7797
500 Ga0495638_0016585 3300046460 Bacteria 4930
501 Ga0495638_0035271 3300046460 Bacteria 3190
502 Ga0495638_0120959 3300046460 Bacteria 1547
503 Ga0495651_0036224 3300046462 Bacteria 3841
504 Ga0495651_0059265 3300046462 Bacteria 2936
505 Ga0495651_0070947 3300046462 Bacteria 2649
506 Ga0495653_0000099 3300046463 Bacteria 71802
507 Ga0495653_0013098 3300046463 Bacteria 6760
508 Ga0495650_0001143 3300046471 Bacteria 28780
509 Ga0495650_0002455 3300046471 Bacteria 14954
510 Ga0495650_0002504 3300046471 Bacteria 14727
511 Ga0495650_0018748 3300046471 Bacteria 3430
512 Ga0495580_0000082 3300046472 Bacteria 61156
513 Ga0495580_0000208 3300046472 Bacteria 45347
514 Ga0495580_0014112 3300046472 Bacteria 6073
515 Ga0495580_0015382 3300046472 Bacteria 5772
516 Ga0495580_0038009 3300046472 Bacteria 3451
517 Ga0495580_0048682 3300046472 Bacteria 2999
518 Ga0495580_0054404 3300046472 Bacteria 2823
519 Ga0495582_0008194 3300046473 Bacteria 5768
520 Ga0495582_0010405 3300046473 Bacteria 5117
521 Ga0495582_0015819 3300046473 Bacteria 4138
522 Ga0495582_0019610 3300046473 Bacteria 3699
523 Ga0495582_0052010 3300046473 Bacteria 2259
524 Ga0495605_0000250 3300046474 Bacteria 63615
525 Ga0495605_0002569 3300046474 Bacteria 11163
526 Ga0495605_0004126 3300046474 Bacteria 8564
527 Ga0495605_0009441 3300046474 Bacteria 5480
528 Ga0495664_0012257 3300046477 Bacteria 4854
529 Ga0495584_0000055 3300046491 Bacteria 81977
530 Ga0495596_0001254 3300046500 Bacteria 14780
531 Ga0495596_0015853 3300046500 Bacteria 3142
532 Ga0495607_0002944 3300046501 Bacteria 13378
533 Ga0495583_0003132 3300046506 Bacteria 13051
534 Ga0495583_0006321 3300046506 Bacteria 7777
535 Ga0495606_0000240 3300046507 Bacteria 96783
536 Ga0495606_0009476 3300046507 Bacteria 8232
537 Ga0495606_0015029 3300046507 Bacteria 5996
538 Ga0495606_0020115 3300046507 Bacteria 4935
539 Ga0495606_0040054 3300046507 Bacteria 3152
540 Ga0495606_0152876 3300046507 Bacteria 1353
541 Ga0495610_0001010 3300046512 Bacteria 25912
542 Ga0495610_0005858 3300046512 Bacteria 8629
543 Ga0495616_0000211 3300046513 Bacteria 48566
544 Ga0495618_0030599 3300046514 Bacteria 3362
545 Ga0495620_0000720 3300046515 Bacteria 20399
546 Ga0495620_0011883 3300046515 Bacteria 4524
547 Ga0495620_0016675 3300046515 Bacteria 3680
548 Ga0495628_0004119 3300046516 Bacteria 12931
549 Ga0495628_0017922 3300046516 Bacteria 5877
550 Ga0495628_0065029 3300046516 Bacteria 2854
551 Ga0495628_0065782 3300046516 Bacteria 2834
552 Ga0495628_0173768 3300046516 Bacteria 1632
553 Ga0495630_0003148 3300046517 Bacteria 11447
554 Ga0495630_0006005 3300046517 Bacteria 8589
555 Ga0495631_0000054 3300046518 Bacteria 70253
556 Ga0495631_0000932 3300046518 Bacteria 18216
557 Ga0495637_0012154 3300046520 Bacteria 4123
558 Ga0495643_0045249 3300046522 Bacteria 2390
559 Ga0495644_0045471 3300046523 Bacteria 1651
560 Ga0495648_0000971 3300046524 Bacteria 29603
561 Ga0495648_0003217 3300046524 Bacteria 14492
562 Ga0495648_0004756 3300046524 Bacteria 11492
563 Ga0495648_0052631 3300046524 Bacteria 2471
564 Ga0495648_0114174 3300046524 Bacteria 1463
565 Ga0495648_0149648 3300046524 Bacteria 1219
566 Ga0495666_0054900 3300046526 Bacteria 1910
567 Ga0495666_0064354 3300046526 Bacteria 1750
568 Ga0495666_0130873 3300046526 Bacteria 1172
569 Ga0495642_0000006 3300046528 Bacteria 172412
570 Ga0495652_0024230 3300046529 Bacteria 5373
571 Ga0495652_0047659 3300046529 Bacteria 3674
572 Ga0495654_0000424 3300046530 Bacteria 35763
573 Ga0495654_0006828 3300046530 Bacteria 6441
574 Ga0495654_0010213 3300046530 Bacteria 5116
575 Ga0495654_0045562 3300046530 Bacteria 2163
576 Ga0495654_0051889 3300046530 Bacteria 2000
577 Ga0495665_0006780 3300046531 Bacteria 6178
578 Ga0495665_0010499 3300046531 Bacteria 5013
579 Ga0495665_0012030 3300046531 Bacteria 4684
580 Ga0495665_0022519 3300046531 Bacteria 3387
581 Ga0495665_0048049 3300046531 Bacteria 2263
582 Ga0495640_0002986 3300046533 Bacteria 13619
583 Ga0495640_0006341 3300046533 Bacteria 9374
584 Ga0495640_0071184 3300046533 Bacteria 2334
585 Ga0495586_0030103 3300046535 Bacteria 2905
586 Ga0495586_0123042 3300046535 Bacteria 1450
587 Ga0495586_0195080 3300046535 Bacteria 1147
588 Ga0495587_0041837 3300046536 Bacteria 2733
589 Ga0495609_0000069 3300046538 Bacteria 128601
590 Ga0495609_0000357 3300046538 Bacteria 39838
591 Ga0495621_0001102 3300046539 Bacteria 6956
592 Ga0495621_0030015 3300046539 Bacteria 1856
593 Ga0495597_0007210 3300046542 Bacteria 5667
594 Ga0495645_0018667 3300046543 Bacteria 4984
595 Ga0495622_0000880 3300046557 Bacteria 16384
596 Ga0495633_0008364 3300046558 Bacteria 5838
597 Ga0495667_0004661 3300046559 Bacteria 9270
598 Ga0495668_0000064 3300046616 Bacteria 180583
599 Ga0495668_0000319 3300046616 Bacteria 66006
600 Ga0495668_0003544 3300046616 Bacteria 11604
601 Ga0495668_0025365 3300046616 Bacteria 3368
602 Ga0495634_0142422 3300046642 Bacteria 1521
603 Ga0495611_0017239 3300046648 Bacteria 3088
604 Ga0495611_0046716 3300046648 Bacteria 1942
605 Ga0495611_0117353 3300046648 Bacteria 1240
606 Ga0495625_0020529 3300046660 Bacteria 5098
607 Ga0495625_0049416 3300046660 Bacteria 3024
608 Ga0495625_0172162 3300046660 Bacteria 1445
609 Ga0495635_0029567 3300046663 Bacteria 3811
610 Ga0495661_0017617 3300046665 Bacteria 4715
611 Ga0495661_0020918 3300046665 Bacteria 4267
612 Ga0495661_0155273 3300046665 Bacteria 1233
613 Ga0495657_0021542 3300046675 Bacteria 4624
614 Ga0495657_0079614 3300046675 Bacteria 2122
615 Ga0495599_0019288 3300046678 Bacteria 4251
616 Ga0495623_0002988 3300046679 Bacteria 11120
617 Ga0495623_0034113 3300046679 Bacteria 3264
618 Ga0495623_0104159 3300046679 Bacteria 1725
619 Ga0495646_0001798 3300046680 Bacteria 12872
620 Ga0495646_0003633 3300046680 Bacteria 9626
621 Ga0495646_0048346 3300046680 Bacteria 2584
622 Ga0495669_0004952 3300046684 Bacteria 5535
623 Ga0495669_0008446 3300046684 Bacteria 4331
624 Ga0495613_0007126 3300046689 Bacteria 8323
625 Ga0495613_0109898 3300046689 Bacteria 1987
626 Ga0495624_0002851 3300046690 Bacteria 12937
627 Ga0495624_0014790 3300046690 Bacteria 5284
628 Ga0495624_0016562 3300046690 Bacteria 4961
629 Ga0495624_0018031 3300046690 Bacteria 4727
630 Ga0495624_0046239 3300046690 Bacteria 2768
631 Ga0495624_0051742 3300046690 Bacteria 2597
632 Ga0495670_0000603 3300046691 Bacteria 17150
633 Ga0495670_0002733 3300046691 Bacteria 8710
634 Ga0495671_0001569 3300046692 Bacteria 15147
635 Ga0495671_0020281 3300046692 Bacteria 3503
636 Ga0495671_0023174 3300046692 Bacteria 3245
637 Ga0495671_0045650 3300046692 Bacteria 2193
638 Ga0495671_0047884 3300046692 Bacteria 2134
639 Ga0495649_0000844 3300046694 Bacteria 24615
640 Ga0495649_0005939 3300046694 Bacteria 7655
641 Ga0495649_0055517 3300046694 Bacteria 2140
642 Ga0495649_0066462 3300046694 Bacteria 1935
643 Ga0495589_0000002 3300046794 Bacteria 758846
644 Ga0495589_0000928 3300046794 Bacteria 18001
645 Ga0495589_0025596 3300046794 Bacteria 2994
646 Ga0495600_0004096 3300046809 Bacteria 8676
647 Ga0495660_0000080 3300046810 Bacteria 103751
648 Ga0495660_0000177 3300046810 Bacteria 69130
649 Ga0495581_0014339 3300047315 Bacteria 4596
650 Ga0495604_0018563 3300047317 Bacteria 5572
651 Ga0495604_0020358 3300047317 Bacteria 5300
652 Ga0495604_0025620 3300047317 Bacteria 4697
653 Ga0495604_0080016 3300047317 Bacteria 2449
654 Ga0495674_0004220 3300047319 Bacteria 13838
655 Ga0495674_0007713 3300047319 Bacteria 10280
656 Ga0495674_0012326 3300047319 Bacteria 8053
657 Ga0495674_0057474 3300047319 Bacteria 3404
658 Ga0495674_0118705 3300047319 Bacteria 2236
659 Ga0495674_0149829 3300047319 Bacteria 1956
660 Ga0495674_0341658 3300047319 Bacteria 1216
661 Ga0495672_0000010 3300047320 Bacteria 545038
662 Ga0495672_0000158 3300047320 Bacteria 98531
663 Ga0495672_0004354 3300047320 Bacteria 11636
664 Ga0495672_0014192 3300047320 Bacteria 5465
665 Ga0495672_0121310 3300047320 Bacteria 1389
666 Ga0495676_0022045 3300047321 Bacteria 5551
667 Ga0495680_0023583 3300047322 Bacteria 5114
668 Ga0495680_0031745 3300047322 Bacteria 4295
669 Ga0495680_0069170 3300047322 Bacteria 2694
670 Ga0495680_0076445 3300047322 Bacteria 2538
671 Ga0495683_0002027 3300047323 Bacteria 12553
672 Ga0495683_0004646 3300047323 Bacteria 7738
673 Ga0495683_0015176 3300047323 Bacteria 4011
674 Ga0495683_0026041 3300047323 Bacteria 2995
675 Ga0495687_000104 3300047443 Bacteria 128704
676 Ga0495687_013575 3300047443 Bacteria 4241
677 Ga0495687_014501 3300047443 Bacteria 4054
678 Ga0495687_026210 3300047443 Bacteria 2748
679 Ga0495687_030850 3300047443 Bacteria 2465
680 Ga0495687_037021 3300047443 Bacteria 2177
681 Ga0495687_042575 3300047443 Bacteria 1983
682 Ga0495675_0001679 3300047444 Bacteria 13286
683 Ga0495675_0054579 3300047444 Bacteria 2535
684 Ga0495675_0072682 3300047444 Bacteria 2169
685 Ga0495679_000062 3300047446 Bacteria 107181
686 Ga0495679_000063 3300047446 Bacteria 103758
687 Ga0495679_001490 3300047446 Bacteria 13210
688 Ga0495679_002444 3300047446 Bacteria 9462
689 Ga0495679_013378 3300047446 Bacteria 3083
690 Ga0495673_0001271 3300047469 Bacteria 20784
691 Ga0495673_0019368 3300047469 Bacteria 3410
692 Ga0495673_0049331 3300047469 Bacteria 1853
693 Ga0495673_0050304 3300047469 Bacteria 1829
694 Ga0495673_0061242 3300047469 Bacteria 1612
695 Ga0495684_0138695 3300047471 Bacteria 1824
696 Ga0495686_0002575 3300047472 Bacteria 16881
697 Ga0495686_0028742 3300047472 Bacteria 3620
698 Ga0495686_0041236 3300047472 Bacteria 2939
699 Ga0495686_0043715 3300047472 Bacteria 2839
700 Ga0495593_0011480 3300047673 Bacteria 5086
701 Ga0495593_0019601 3300047673 Bacteria 3791
702 Ga0495593_0044331 3300047673 Bacteria 2380
703 Ga0495602_0000856 3300048088 Bacteria 29354
704 Ga0495602_0028550 3300048088 Bacteria 5336
705 Ga0495602_0081496 3300048088 Bacteria 2720
706 Ga0495614_0118602 3300048089 Bacteria 1165
707 Ga0496100_0063024 3300048903 Bacteria 2449
708 Ga0496100_0064098 3300048903 Bacteria 2430
709 Ga0496101_0001501 3300048904 Bacteria 13958
710 Ga0496101_0009824 3300048904 Bacteria 6303
711 Ga0496101_0076060 3300048904 Bacteria 2472
712 Ga0496101_0261609 3300048904 Bacteria 1350
713 Ga0496102_0004504 3300048905 Bacteria 11768
714 Ga0496102_0004959 3300048905 Bacteria 11276
715 Ga0496102_0005431 3300048905 Bacteria 10811
716 Ga0496102_0016284 3300048905 Bacteria 6494
717 Ga0496102_0042541 3300048905 Bacteria 4116
718 Ga0496102_0085628 3300048905 Bacteria 2910
719 Ga0496102_0151506 3300048905 Bacteria 2179
720 Ga0496102_0179263 3300048905 Bacteria 1996
721 Ga0496102_0192183 3300048905 Bacteria 1923
722 Ga0496102_0193752 3300048905 Bacteria 1915
723 Ga0496102_0311666 3300048905 Bacteria 1483
724 Ga0496102_0479345 3300048905 Bacteria 1165
725 Ga0496103_0001546 3300048906 Bacteria 15290
726 Ga0496103_0002245 3300048906 Bacteria 12238
727 Ga0496103_0004401 3300048906 Bacteria 8547
728 Ga0496103_0011170 3300048906 Bacteria 5317
729 Ga0496103_0098874 3300048906 Bacteria 1845
730 Ga0496104_0099819 3300048907 Bacteria 2779
731 Ga0496105_0018285 3300048908 Bacteria 5629
732 Ga0496106_0002122 3300048909 Bacteria 14837
733 Ga0496107_0025617 3300048910 Bacteria 4176
734 Ga0496107_0037012 3300048910 Bacteria 3502
735 Ga0496108_0334082 3300048911 Bacteria 1322
736 Ga0496109_0162694 3300048912 Bacteria 2091
737 Ga0496110_0005967 3300048913 Bacteria 9593
738 Ga0496110_0383698 3300048913 Bacteria 1280
739 Ga0496111_0031413 3300048914 Bacteria 3783
740 Ga0496112_0113275 3300048915 Bacteria 2683
741 Ga0496114_0065402 3300048917 Bacteria 3047
742 Ga0496116_0000031 3300048919 Bacteria 420043
743 Ga0496117_0001221 3300048920 Bacteria 38481
744 Ga0496117_0003334 3300048920 Bacteria 18760
745 Ga0496117_0012014 3300048920 Bacteria 7690
746 Ga0496117_0024611 3300048920 Bacteria 4755
747 Ga0496117_0117992 3300048920 Bacteria 1637
748 Ga0496117_0170475 3300048920 Bacteria 1264
749 Ga0496118_0001708 3300048921 Bacteria 32058
750 Ga0496118_0004252 3300048921 Bacteria 17141
751 Ga0496118_0016225 3300048921 Bacteria 6842
752 Ga0496118_0044336 3300048921 Bacteria 3484
753 Ga0496118_0072369 3300048921 Bacteria 2476
754 Ga0496119_0000468 3300048922 Bacteria 55018
755 Ga0496119_0033243 3300048922 Bacteria 3423
756 Ga0496120_0000137 3300048923 Bacteria 123518
757 Ga0496121_0000437 3300048924 Bacteria 82376
758 Ga0496121_0000573 3300048924 Bacteria 69111
759 Ga0496121_0006494 3300048924 Bacteria 14471
760 Ga0496121_0009566 3300048924 Bacteria 11105
761 Ga0496121_0014837 3300048924 Bacteria 8222
762 Ga0496121_0051729 3300048924 Bacteria 3457
763 Ga0496121_0161963 3300048924 Bacteria 1635
764 Ga0496122_0001630 3300048925 Bacteria 35015
765 Ga0496122_0002855 3300048925 Bacteria 23658
766 Ga0496122_0041369 3300048925 Bacteria 3645
767 Ga0496122_0072071 3300048925 Bacteria 2458
768 Ga0496123_0001111 3300048926 Bacteria 40321
769 Ga0496123_0003528 3300048926 Bacteria 17419
770 Ga0496123_0015546 3300048926 Bacteria 6236
771 Ga0496123_0048914 3300048926 Bacteria 2840
772 Ga0496124_0000017 3300048927 Bacteria 444389
773 Ga0496124_0000138 3300048927 Bacteria 150311
774 Ga0496124_0002733 3300048927 Bacteria 22485
775 Ga0496124_0205923 3300048927 Bacteria 1492
776 Ga0496125_0001586 3300048928 Bacteria 32273
777 Ga0496125_0007850 3300048928 Bacteria 11280
778 Ga0496125_0022722 3300048928 Bacteria 5814
779 Ga0496125_0046935 3300048928 Bacteria 3618
780 Ga0496125_0076609 3300048928 Bacteria 2582
781 Ga0496125_0118496 3300048928 Bacteria 1896
782 Ga0496126_0000034 3300048929 Bacteria 362440
783 Ga0496126_0000446 3300048929 Bacteria 82267
784 Ga0496126_0000882 3300048929 Bacteria 52767
785 Ga0496126_0006636 3300048929 Bacteria 12879
786 Ga0496126_0019981 3300048929 Bacteria 6581
787 Ga0496126_0034277 3300048929 Bacteria 4769
788 Ga0496126_0073429 3300048929 Bacteria 3041
789 Ga0496126_0092103 3300048929 Bacteria 2664
790 Ga0496126_0126700 3300048929 Bacteria 2210
791 Ga0496126_0162752 3300048929 Bacteria 1906
792 Ga0496126_0186025 3300048929 Bacteria 1761
793 Ga0495678_009436 3300049459 Bacteria 4828
794 Ga0495678_012518 3300049459 Bacteria 4019
795 Ga0495682_0025422 3300049460 Bacteria 2203
796 Ga0501033_0056048 3300049570 Bacteria 2914
797 Ga0501033_0173407 3300049570 Bacteria 1548
798 Ga0501034_0000042 3300049571 Bacteria 229124
799 Ga0501036_0165230 3300049572 Bacteria 1866
800 Ga0501038_0241156 3300049574 Bacteria 1435
801 Ga0501041_0047297 3300049577 Bacteria 2619
802 Ga0501042_0041141 3300049578 Bacteria 3286
803 Ga0501043_0117598 3300049579 Bacteria 2086
804 Ga0501046_0082618 3300049580 Bacteria 2481
805 Ga0501047_0024493 3300049581 Bacteria 5792
806 Ga0501047_0030160 3300049581 Bacteria 5229
807 Ga0501048_0215348 3300049582 Bacteria 1362
808 Ga0501071_0080338 3300049587 Bacteria 2384
809 Ga0501072_0029409 3300049588 Bacteria 4292
810 Ga0501075_0021514 3300049591 Bacteria 4704
811 Ga0501075_0084934 3300049591 Bacteria 2398
812 Ga0501077_0140931 3300049593 Bacteria 1529
813 Ga0501227_001375 3300049665 Bacteria 5456
814 Ga0501080_0029512 3300049742 Bacteria 5106
815 Ga0501081_0070143 3300049743 Bacteria 2442
816 Ga0501279_000660 3300049775 Bacteria 4548
817 Ga0501035_0026358 3300049822 Bacteria 5319
818 Ga0501035_0229014 3300049822 Bacteria 1584
819 Ga0501044_0000059 3300049823 Bacteria 134132
820 Ga0501044_0001443 3300049823 Bacteria 27936
821 Ga0501045_0049438 3300049824 Bacteria 3066
822 nmdc:mga03683_490_c1 3300050489 Bacteria 11307
823 nmdc:mga03n38_23536_c1 3300050490 Bacteria 2507
824 nmdc:mga03n38_32004_c1 3300050490 Bacteria 2224
825 nmdc:mga03n38_99544_c1 3300050490 Bacteria 1400
826 nmdc:mga00v17_157_c1 3300050491 Bacteria 40094
827 nmdc:mga00v17_253000_c1 3300050491 Bacteria 1142
828 nmdc:mga00v17_25948_c1 3300050491 Bacteria 3409
829 nmdc:mga00v17_3382_c1 3300050491 Bacteria 8234
830 nmdc:mga00v17_41288_c1 3300050491 Bacteria 2770
831 nmdc:mga0yw44_152651_c1 3300050492 Bacteria 1507
832 nmdc:mga0yw44_16617_c1 3300050492 Bacteria 3981
833 nmdc:mga0yw44_246638_c1 3300050492 Bacteria 1188
834 nmdc:mga0yw44_36855_c1 3300050492 Bacteria 2885
835 nmdc:mga0k408_103016_c1 3300050493 Bacteria 1684
836 nmdc:mga0k408_134985_c1 3300050493 Bacteria 1466
837 nmdc:mga0k408_15670_c1 3300050493 Bacteria 4196
838 nmdc:mga0k408_264_c1 3300050493 Bacteria 28733
839 nmdc:mga06z11_43335_c1 3300050494 Bacteria 2263
840 nmdc:mga07m45_101710_c1 3300050496 Bacteria 1650
841 nmdc:mga07m45_18103_c1 3300050496 Bacteria 3796
842 nmdc:mga07m45_33873_c1 3300050496 Bacteria 2838
843 nmdc:mga0qj67_26252_c1 3300050509 Bacteria 4508
844 Ga0495619_0027397 3300053085 Unclassified 3669
845 Ga0500643_005454 3300053087 Bacteria 5481
846 Ga0500581_047926 3300053089 Bacteria 2182
847 Ga0500647_0001969 3300053091 Bacteria 7413
848 Ga0500583_0080956 3300053092 Bacteria 1568
849 Ga0500651_0000011 3300053093 Bacteria 246573
850 Ga0500566_0002124 3300053094 Bacteria 11676
851 Ga0500556_0000058 3300053104 Bacteria 114257
852 Ga0500557_000056 3300053105 Bacteria 49363
853 Ga0500562_008953 3300053108 Bacteria 2529
854 Ga0500569_017661 3300053109 Bacteria 1828
855 Ga0500571_000008 3300053110 Bacteria 87309
856 Ga0500595_006780 3300053119 Bacteria 4823
857 Ga0500595_022855 3300053119 Bacteria 2205
858 Ga0500614_013147 3300053123 Bacteria 1815
859 Ga0500642_0000025 3300053130 Bacteria 130425
860 Ga0500642_0000295 3300053130 Bacteria 18073
861 Ga0500652_000007 3300053131 Bacteria 165913
862 Ga0500652_001122 3300053131 Bacteria 8613
863 Ga0500655_000511 3300053133 Bacteria 7830
864 Ga0500658_0000085 3300053134 Bacteria 43497
865 Ga0500658_0000181 3300053134 Bacteria 29974
866 Ga0500658_0017903 3300053134 Bacteria 2651
867 Ga0500658_0028537 3300053134 Bacteria 2166
868 Ga0500559_0005262 3300053136 Bacteria 5965
869 Ga0500559_0051010 3300053136 Bacteria 1826
870 Ga0500568_0000547 3300053139 Bacteria 27675
871 Ga0500568_0001205 3300053139 Bacteria 17266
872 Ga0500574_005440 3300053141 Bacteria 2481
873 Ga0500588_0003547 3300053146 Bacteria 3306
874 Ga0500600_0024281 3300053149 Bacteria 3613
875 Ga0500604_0011096 3300053151 Bacteria 2416
876 Ga0500620_035558 3300053155 Bacteria 1606
877 Ga0500622_0000112 3300053156 Bacteria 83558
878 Ga0500627_0019290 3300053158 Bacteria 2714
879 Ga0500634_0016121 3300053161 Bacteria 3983
880 Ga0500634_0034310 3300053161 Bacteria 2764
881 Ga0500634_0041670 3300053161 Bacteria 2493
882 Ga0500634_0048936 3300053161 Bacteria 2280
883 Ga0500638_062146 3300053162 Bacteria 1793
884 Ga0500636_0073472 3300053177 Bacteria 1980
885 Ga0500611_001649 3300053727 Bacteria 2514
886 Ga0590075_026072 3300059424 Bacteria 1471
887 Ga0587090_000446 3300059510 Bacteria 3416
888 Ga0587072_000808 3300059643 Bacteria 3495
889 Ga0587124_000762 3300059660 Bacteria 1893
890 Ga0501082_0020019 3300060353 Bacteria 5766
891 Ga0501082_0361104 3300060353 Bacteria 1267
892 Ga0466962_0006642 3300061719 Bacteria 5550
893 Ga0466962_0021693 3300061719 Bacteria 3082

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0117598 Ga0501043_0117598_1185_2063 284
2 3300048913 Ga0496110_0383698 Ga0496110_0383698_16_975 296
3 3300025294 Ga0209025_1000049 Ga0209025_1000049298 305
4 3300053133 Ga0500655_000511 Ga0500655_000511_3798_4922 312
5 3300053162 Ga0500638_062146 Ga0500638_062146_569_1693 312
6 3300048928 Ga0496125_0046935 Ga0496125_0046935_537_1721 314
7 3300046660 Ga0495625_0020529 Ga0495625_0020529_4101_5063 317
8 3300053131 Ga0500652_001122 Ga0500652_001122_854_1816 317
9 3300050493 nmdc:mga0k408_103016_c1 nmdc:mga0k408_103016_c1_640_1644 319
10 3300053130 Ga0500642_0000295 Ga0500642_0000295_16974_18047 319
11 3300046473 Ga0495582_0052010 Ga0495582_0052010_1011_2075 320
12 3300049572 Ga0501036_0165230 Ga0501036_0165230_103_1083 320
13 3300053087 Ga0500643_005454 Ga0500643_005454_3494_4618 321
14 3300053161 Ga0500634_0034310 Ga0500634_0034310_825_1949 321
15 3300005356 Ga0070674_100031273 Ga0070674_1000312732 323
16 3300017792 Ga0163161_10037604 Ga0163161_100376042 323
17 3300025937 Ga0207669_10024658 Ga0207669_100246582 323
18 3300046513 Ga0495616_0000211 Ga0495616_0000211_1525_2649 323
19 3300046518 Ga0495631_0000054 Ga0495631_0000054_5532_6656 323
20 3300046520 Ga0495637_0012154 Ga0495637_0012154_225_1349 323
21 3300046530 Ga0495654_0006828 Ga0495654_0006828_578_1702 323
22 3300048929 Ga0496126_0092103 Ga0496126_0092103_1243_2367 323
23 3300053134 Ga0500658_0000181 Ga0500658_0000181_10205_11329 323
24 3300013306 Ga0163162_10355455 Ga0163162_103554552 324
25 3300013308 Ga0157375_10165333 Ga0157375_101653333 324
26 3300048905 Ga0496102_0004959 Ga0496102_0004959_293_1336 324
27 3300006844 Ga0075428_100012004 Ga0075428_1000120044 327
28 3300006846 Ga0075430_100031742 Ga0075430_1000317424 327
29 3300050509 nmdc:mga0qj67_26252_c1 nmdc:mga0qj67_26252_c1_1445_2467 327
30 3300005458 Ga0070681_10014815 Ga0070681_100148152 329
31 3300005536 Ga0070697_100037403 Ga0070697_1000374033 329
32 3300005578 Ga0068854_100137278 Ga0068854_1001372782 329
33 3300025912 Ga0207707_10102181 Ga0207707_101021812 329
34 3300049577 Ga0501041_0047297 Ga0501041_0047297_709_1722 329
35 3300049578 Ga0501042_0041141 Ga0501042_0041141_1721_2734 329
36 3300049580 Ga0501046_0082618 Ga0501046_0082618_609_1622 329
37 3300049582 Ga0501048_0215348 Ga0501048_0215348_88_1101 329
38 3300049587 Ga0501071_0080338 Ga0501071_0080338_238_1251 329
39 3300049588 Ga0501072_0029409 Ga0501072_0029409_2544_3557 329
40 3300049591 Ga0501075_0021514 Ga0501075_0021514_1827_2840 329
41 3300049591 Ga0501075_0084934 Ga0501075_0084934_1057_2070 329
42 3300049593 Ga0501077_0140931 Ga0501077_0140931_396_1409 329
43 3300049742 Ga0501080_0029512 Ga0501080_0029512_793_1806 329
44 3300049743 Ga0501081_0070143 Ga0501081_0070143_594_1607 329
45 3300049824 Ga0501045_0049438 Ga0501045_0049438_1374_2387 329
46 3300060353 Ga0501082_0020019 Ga0501082_0020019_1580_2593 329
47 3300060353 Ga0501082_0361104 Ga0501082_0361104_87_1100 329
48 3300005353 Ga0070669_100052901 Ga0070669_1000529011 330
49 3300005355 Ga0070671_100122145 Ga0070671_1001221452 330
50 3300005356 Ga0070674_100253909 Ga0070674_1002539091 330
51 3300005543 Ga0070672_100097588 Ga0070672_1000975882 330
52 3300014326 Ga0157380_10124899 Ga0157380_101248991 330
53 3300025937 Ga0207669_10176018 Ga0207669_101760181 330
54 3300025940 Ga0207691_10135597 Ga0207691_101355971 330
55 3300046539 Ga0495621_0001102 Ga0495621_0001102_3851_4858 330
56 3300048922 Ga0496119_0033243 Ga0496119_0033243_253_1272 330
57 iso_pu_bacteria 2513237098 2513678860 330
58 iso_pu_bacteria 2524023210 2524467980 330
59 iso_pu_bacteria 2728368998 2728749317 330
60 iso_pu_bacteria 2885383462 2885392379 330
61 iso_pu_bacteria 2903748898 2903752196 330
62 iso_pu_bacteria 2903768456 2903775544 330
63 iso_pu_bacteria 2919073203 2919076965 330
64 iso_pu_bacteria 8056681323 8056684960 330
65 3300048924 Ga0496121_0000573 Ga0496121_0000573_50335_51339 331
66 iso_pu_bacteria 2534681786 2535484790 331
67 iso_pu_bacteria 2751185800 2753359403 331
68 iso_pu_bacteria 2757320392 2757572385 331
69 iso_pu_bacteria 2854911287 2854911970 331
70 iso_pu_bacteria 2888373701 2888374221 331
71 iso_pu_bacteria 2915650412 2915653891 331
72 3300004625 Ga0055543_1002357 Ga0055543_10023575 332
73 3300005262 Ga0065165_1000120 Ga0065165_100012091 332
74 3300006038 Ga0075365_10021610 Ga0075365_100216103 332
75 3300006051 Ga0075364_10000342 Ga0075364_1000034212 332
76 3300025284 Ga0209130_1000057 Ga0209130_1000057108 332
77 3300025302 Ga0207426_1006276 Ga0207426_10062764 332
78 3300030736 Ga0316180_1141634 Ga0316180_11416343 332
79 3300046507 Ga0495606_0015029 Ga0495606_0015029_4240_5238 332
80 3300046523 Ga0495644_0045471 Ga0495644_0045471_557_1555 332
81 3300046558 Ga0495633_0008364 Ga0495633_0008364_3359_4357 332
82 3300046616 Ga0495668_0003544 Ga0495668_0003544_7478_8476 332
83 3300046691 Ga0495670_0000603 Ga0495670_0000603_6142_7140 332
84 3300046691 Ga0495670_0002733 Ga0495670_0002733_48_1046 332
85 3300048905 Ga0496102_0016284 Ga0496102_0016284_3346_4344 332
86 3300048905 Ga0496102_0042541 Ga0496102_0042541_3038_4036 332
87 3300048906 Ga0496103_0004401 Ga0496103_0004401_5897_6895 332
88 3300050491 nmdc:mga00v17_3382_c1 nmdc:mga00v17_3382_c1_2372_3385 332
89 3300050492 nmdc:mga0yw44_16617_c1 nmdc:mga0yw44_16617_c1_1132_2145 332
90 iso_pu_bacteria 2508501128 2509153415 332
91 iso_pu_bacteria 2513237096 2513658138 332
92 iso_pu_bacteria 2513237137 2513860270 332
93 iso_pu_bacteria 2513237141 2513889889 332
94 iso_pu_bacteria 2513237145 2513920370 332
95 iso_pu_bacteria 2517572143 2517889207 332
96 iso_pu_bacteria 2521172590 2521560316 332
97 iso_pu_bacteria 2524023228 2524541580 332
98 iso_pu_bacteria 2667528175 2671118403 332
99 iso_pu_bacteria 2818991445 2819594832 332
100 iso_pu_bacteria 2818991449 2819616678 332
101 iso_pu_bacteria 2824704595 2824710736 332
102 iso_pu_bacteria 2824753945 2824761312 332
103 iso_pu_bacteria 2824763712 2824765916 332
104 iso_pu_bacteria 2857564685 2857570104 332
105 iso_pu_bacteria 2903748898 2903751239 332
106 iso_pu_bacteria 2904439833 2904442555 332
107 iso_pu_bacteria 2904530477 2904535237 332
108 iso_pu_bacteria 2904584206 2904589581 332
109 iso_pu_bacteria 2904589729 2904594488 332
110 iso_pu_bacteria 2904601388 2904606254 332
111 iso_pu_bacteria 2904711408 2904715353 332
112 iso_pu_bacteria 2906610324 2906617002 332
113 iso_pu_bacteria 2906635258 2906641336 332
114 iso_pu_bacteria 2906660503 2906668530 332
115 iso_pu_bacteria 2919079590 2919084203 332
116 iso_pu_bacteria 2923510766 2923514090 332
117 iso_pu_bacteria 3005474847 3005480733 332
118 iso_pu_bacteria 8004592986 8004597540 332
119 iso_pu_bacteria 8006933436 8006934693 332
120 iso_pu_bacteria 8006973647 8006974661 332
121 iso_pu_bacteria 8006984368 8006985411 332
122 3300003323 rootH1_10007027 rootH1_100070274 333
123 3300003763 Ga0055529_1000100 Ga0055529_100010096 333
124 3300003771 Ga0055526_1013866 Ga0055526_10138663 333
125 3300003794 Ga0055531_10003438 Ga0055531_100034382 333
126 3300006946 Ga0079104_1008755 Ga0079104_10087552 333
127 3300007788 Ga0099795_10023436 Ga0099795_100234361 333
128 3300010159 Ga0099796_10007059 Ga0099796_100070594 333
129 3300015261 Ga0182006_1000152 Ga0182006_100015232 333
130 3300015265 Ga0182005_1000005 Ga0182005_1000005391 333
131 3300025272 Ga0209455_1000047 Ga0209455_1000047293 333
132 3300025295 Ga0209564_1002709 Ga0209564_10027098 333
133 3300025304 Ga0209257_1004516 Ga0209257_10045168 333
134 3300027111 Ga0209281_1005294 Ga0209281_10052943 333
135 3300030744 Ga0316181_1264586 Ga0316181_12645863 333
136 3300046453 Ga0495627_000038 Ga0495627_000038_116110_117111 333
137 3300046471 Ga0495650_0002504 Ga0495650_0002504_7618_8619 333
138 3300046491 Ga0495584_0000055 Ga0495584_0000055_47236_48237 333
139 3300046501 Ga0495607_0002944 Ga0495607_0002944_9923_10924 333
140 3300046524 Ga0495648_0000971 Ga0495648_0000971_5584_6585 333
141 3300046538 Ga0495609_0000357 Ga0495609_0000357_9445_10446 333
142 3300046665 Ga0495661_0020918 Ga0495661_0020918_2500_3501 333
143 3300046810 Ga0495660_0000080 Ga0495660_0000080_72252_73253 333
144 3300046810 Ga0495660_0000177 Ga0495660_0000177_17408_18409 333
145 3300047320 Ga0495672_0004354 Ga0495672_0004354_916_1944 333
146 3300047469 Ga0495673_0049331 Ga0495673_0049331_457_1458 333
147 3300047472 Ga0495686_0041236 Ga0495686_0041236_197_1198 333
148 iso_pu_bacteria 2506520007 2506577259 333
149 iso_pu_bacteria 2506520008 2506582397 333
150 iso_pu_bacteria 2508501071 2508851188 333
151 iso_pu_bacteria 2513237098 2513675972 333
152 iso_pu_bacteria 2513237104 2513723552 333
153 iso_pu_bacteria 2599185313 2600005361 333
154 iso_pu_bacteria 2599185324 2600072358 333
155 iso_pu_bacteria 2643221542 2643734223 333
156 iso_pu_bacteria 2643221630 2644170809 333
157 iso_pu_bacteria 2654587920 2656277915 333
158 iso_pu_bacteria 2687453601 2689443715 333
159 iso_pu_bacteria 2758568016 2758641665 333
160 iso_pu_bacteria 2791355199 2793078954 333
161 iso_pu_bacteria 2806310673 2807180513 333
162 iso_pu_bacteria 2869551831 2869553114 333
163 iso_pu_bacteria 2874628541 2874635542 333
164 iso_pu_bacteria 2888378607 2888381744 333
165 iso_pu_bacteria 2945956166 2945959786 333
166 iso_pu_bacteria 3006984091 3006987758 333
167 iso_pu_bacteria 640753048 640936761 333
168 iso_pu_bacteria 8004021418 8004023410 333
169 iso_pu_bacteria 8019648815 8019648932 333
170 3300003320 rootH2_10299511 rootH2_102995112 334
171 3300005327 Ga0070658_10000023 Ga0070658_1000002363 334
172 3300005339 Ga0070660_100067618 Ga0070660_1000676183 334
173 3300005364 Ga0070673_100000226 Ga0070673_10000022619 334
174 3300005456 Ga0070678_100000633 Ga0070678_1000006338 334
175 3300005458 Ga0070681_10034876 Ga0070681_100348765 334
176 3300005466 Ga0070685_10045066 Ga0070685_100450662 334
177 3300005543 Ga0070672_100002363 Ga0070672_10000236311 334
178 3300005548 Ga0070665_100001295 Ga0070665_10000129527 334
179 3300005548 Ga0070665_100066937 Ga0070665_1000669372 334
180 3300006943 Ga0099822_1024140 Ga0099822_10241404 334
181 3300007788 Ga0099795_10000287 Ga0099795_100002873 334
182 3300009101 Ga0105247_10141698 Ga0105247_101416981 334
183 3300009176 Ga0105242_10015952 Ga0105242_100159525 334
184 3300010375 Ga0105239_10015338 Ga0105239_100153387 334
185 3300013296 Ga0157374_10064879 Ga0157374_100648793 334
186 3300013297 Ga0157378_10005243 Ga0157378_100052435 334
187 3300013306 Ga0163162_10144520 Ga0163162_101445201 334
188 3300013306 Ga0163162_10518994 Ga0163162_105189941 334
189 3300013306 Ga0163162_10542389 Ga0163162_105423891 334
190 3300013307 Ga0157372_10271228 Ga0157372_102712282 334
191 3300025907 Ga0207645_10019099 Ga0207645_100190992 334
192 3300025909 Ga0207705_10000129 Ga0207705_1000012967 334
193 3300025960 Ga0207651_10000125 Ga0207651_1000012520 334
194 3300025972 Ga0207668_10099867 Ga0207668_100998672 334
195 3300026121 Ga0207683_10001307 Ga0207683_1000130715 334
196 3300027357 Ga0209589_1000014 Ga0209589_10000142 334
197 3300027361 Ga0209489_100014 Ga0209489_1000142 334
198 3300027363 Ga0209700_100024 Ga0209700_1000242 334
199 3300028379 Ga0268266_10000916 Ga0268266_1000091634 334
200 3300028379 Ga0268266_10023525 Ga0268266_100235252 334
201 3300030521 Ga0307511_10000109 Ga0307511_100001097 334
202 3300037466 Ga0395898_0073469 Ga0395898_0073469_1742_2746 334
203 3300037471 Ga0395905_0007181 Ga0395905_0007181_4020_5045 334
204 3300037471 Ga0395905_0279247 Ga0395905_0279247_21_1025 334
205 3300038443 Ga0395901_0004377 Ga0395901_0004377_6056_7069 334
206 3300038443 Ga0395901_0447378 Ga0395901_0447378_173_1177 334
207 3300045976 Ga0466967_0074519 Ga0466967_0074519_1412_2431 334
208 3300046460 Ga0495638_0007523 Ga0495638_0007523_6083_7096 334
209 3300046460 Ga0495638_0016585 Ga0495638_0016585_3231_4271 334
210 3300046524 Ga0495648_0004756 Ga0495648_0004756_2199_3212 334
211 3300046530 Ga0495654_0051889 Ga0495654_0051889_56_1069 334
212 3300048905 Ga0496102_0005431 Ga0496102_0005431_7466_8470 334
213 3300048920 Ga0496117_0117992 Ga0496117_0117992_295_1335 334
214 3300048925 Ga0496122_0041369 Ga0496122_0041369_177_1190 334
215 3300048925 Ga0496122_0072071 Ga0496122_0072071_559_1563 334
216 3300048926 Ga0496123_0048914 Ga0496123_0048914_1648_2661 334
217 3300048928 Ga0496125_0007850 Ga0496125_0007850_6983_7996 334
218 3300048928 Ga0496125_0076609 Ga0496125_0076609_541_1581 334
219 3300048929 Ga0496126_0073429 Ga0496126_0073429_790_1803 334
220 3300049570 Ga0501033_0056048 Ga0501033_0056048_674_1705 334
221 3300049581 Ga0501047_0030160 Ga0501047_0030160_300_1331 334
222 3300049822 Ga0501035_0229014 Ga0501035_0229014_239_1270 334
223 3300049823 Ga0501044_0000059 Ga0501044_0000059_115985_117016 334
224 3300053085 Ga0495619_0027397 Ga0495619_0027397_2199_3212 334
225 3300053089 Ga0500581_047926 Ga0500581_047926_521_1534 334
226 3300053093 Ga0500651_0000011 Ga0500651_0000011_142844_143875 334
227 3300053094 Ga0500566_0002124 Ga0500566_0002124_7846_8886 334
228 3300053104 Ga0500556_0000058 Ga0500556_0000058_49060_50073 334
229 3300053109 Ga0500569_017661 Ga0500569_017661_526_1539 334
230 3300053123 Ga0500614_013147 Ga0500614_013147_747_1778 334
231 3300053130 Ga0500642_0000025 Ga0500642_0000025_58021_59061 334
232 3300053139 Ga0500568_0000547 Ga0500568_0000547_5562_6602 334
233 3300053151 Ga0500604_0011096 Ga0500604_0011096_766_1806 334
234 3300053156 Ga0500622_0000112 Ga0500622_0000112_72204_73217 334
235 3300053158 Ga0500627_0019290 Ga0500627_0019290_1039_2052 334
236 3300053161 Ga0500634_0041670 Ga0500634_0041670_107_1120 334
237 iso_pu_bacteria 2751185800 2753357371 334
238 iso_pu_bacteria 2888366609 2888368166 334
239 iso_pu_bacteria 2919493220 2919497461 334
240 iso_pu_bacteria 2919543075 2919546078 334
241 iso_pu_bacteria 2923525760 2923529636 334
242 iso_pu_bacteria 8004025490 8004026504 334
243 3300002987 JGI25159J45721_1000145 JGI25159J45721_10001453 335
244 3300003187 JGI25151J46595_10004161 JGI25151J46595_100041618 335
245 3300003354 JGI25160J50197_1000327 JGI25160J50197_10003273 335
246 3300003374 JGI25161J50226_1000245 JGI25161J50226_10002453 335
247 3300004625 Ga0055543_1000325 Ga0055543_100032530 335
248 3300005262 Ga0065165_1001062 Ga0065165_10010623 335
249 3300005334 Ga0068869_100003661 Ga0068869_1000036613 335
250 3300005338 Ga0068868_100080764 Ga0068868_1000807642 335
251 3300005343 Ga0070687_100008147 Ga0070687_1000081472 335
252 3300005345 Ga0070692_10048994 Ga0070692_100489942 335
253 3300005440 Ga0070705_100014971 Ga0070705_1000149712 335
254 3300005441 Ga0070700_100009577 Ga0070700_1000095774 335
255 3300005444 Ga0070694_100053561 Ga0070694_1000535613 335
256 3300005459 Ga0068867_100012498 Ga0068867_1000124986 335
257 3300005544 Ga0070686_100000404 Ga0070686_1000004044 335
258 3300005545 Ga0070695_100007120 Ga0070695_1000071205 335
259 3300005546 Ga0070696_100004953 Ga0070696_1000049533 335
260 3300005615 Ga0070702_100014379 Ga0070702_1000143793 335
261 3300005617 Ga0068859_100069877 Ga0068859_1000698772 335
262 3300005718 Ga0068866_10000265 Ga0068866_1000026515 335
263 3300005719 Ga0068861_100000207 Ga0068861_10000020714 335
264 3300005840 Ga0068870_10025274 Ga0068870_100252742 335
265 3300005842 Ga0068858_100003094 Ga0068858_1000030942 335
266 3300005843 Ga0068860_100024757 Ga0068860_1000247572 335
267 3300005844 Ga0068862_100002710 Ga0068862_1000027104 335
268 3300006038 Ga0075365_10176295 Ga0075365_101762952 335
269 3300006048 Ga0075363_100095788 Ga0075363_1000957881 335
270 3300006051 Ga0075364_10031014 Ga0075364_100310142 335
271 3300006177 Ga0075362_10058467 Ga0075362_100584671 335
272 3300006186 Ga0075369_10006660 Ga0075369_100066602 335
273 3300006195 Ga0075366_10000152 Ga0075366_1000015216 335
274 3300006195 Ga0075366_10007229 Ga0075366_100072292 335
275 3300006195 Ga0075366_10143559 Ga0075366_101435591 335
276 3300006237 Ga0097621_100010305 Ga0097621_1000103058 335
277 3300006881 Ga0068865_100019287 Ga0068865_1000192873 335
278 3300006931 Ga0097620_100069877 Ga0097620_1000698772 335
279 3300009098 Ga0105245_10000257 Ga0105245_1000025747 335
280 3300009147 Ga0114129_10134216 Ga0114129_101342162 335
281 3300009148 Ga0105243_10002572 Ga0105243_100025727 335
282 3300009148 Ga0105243_10549837 Ga0105243_105498371 335
283 3300009176 Ga0105242_10000371 Ga0105242_1000037113 335
284 3300009177 Ga0105248_10288123 Ga0105248_102881232 335
285 3300009553 Ga0105249_10066635 Ga0105249_100666352 335
286 3300009553 Ga0105249_10508503 Ga0105249_105085031 335
287 3300012502 Ga0157347_1003449 Ga0157347_10034491 335
288 3300013297 Ga0157378_10000651 Ga0157378_1000065128 335
289 3300013306 Ga0163162_10031705 Ga0163162_100317052 335
290 3300013308 Ga0157375_10473760 Ga0157375_104737601 335
291 3300014326 Ga0157380_10004646 Ga0157380_1000464610 335
292 3300014968 Ga0157379_10011772 Ga0157379_100117722 335
293 3300025208 Ga0209436_100135 Ga0209436_10013535 335
294 3300025258 Ga0209129_1001909 Ga0209129_100190912 335
295 3300025284 Ga0209130_1000574 Ga0209130_100057435 335
296 3300025294 Ga0209025_1000709 Ga0209025_10007092 335
297 3300025302 Ga0207426_1000657 Ga0207426_100065734 335
298 3300025899 Ga0207642_10022646 Ga0207642_100226462 335
299 3300025927 Ga0207687_10023025 Ga0207687_100230253 335
300 3300025934 Ga0207686_10003545 Ga0207686_100035453 335
301 3300025935 Ga0207709_10003067 Ga0207709_100030672 335
302 3300025938 Ga0207704_10005412 Ga0207704_100054123 335
303 3300025941 Ga0207711_10309015 Ga0207711_103090152 335
304 3300025942 Ga0207689_10000465 Ga0207689_1000046522 335
305 3300025942 Ga0207689_10129531 Ga0207689_101295312 335
306 3300025961 Ga0207712_10069123 Ga0207712_100691232 335
307 3300026023 Ga0207677_10023862 Ga0207677_100238622 335
308 3300026035 Ga0207703_10015850 Ga0207703_100158504 335
309 3300026075 Ga0207708_10000376 Ga0207708_1000037615 335
310 3300026089 Ga0207648_10000092 Ga0207648_1000009254 335
311 3300026118 Ga0207675_100000181 Ga0207675_10000018115 335
312 3300028380 Ga0268265_10006000 Ga0268265_100060007 335
313 3300028381 Ga0268264_10021329 Ga0268264_100213292 335
314 3300031344 Ga0265316_10000511 Ga0265316_100005112 335
315 3300031548 Ga0307408_100001595 Ga0307408_10000159514 335
316 3300031727 Ga0316576_10004707 Ga0316576_100047075 335
317 3300031728 Ga0316578_10027905 Ga0316578_100279052 335
318 3300031733 Ga0316577_10202466 Ga0316577_102024661 335
319 3300032002 Ga0307416_100006168 Ga0307416_1000061682 335
320 3300035398 Ga0316574_0013130 Ga0316574_0013130_1945_2955 335
321 3300036647 Ga0316582_0276906 Ga0316582_0276906_45_1055 335
322 3300036712 Ga0316584_0002399 Ga0316584_0002399_7401_8411 335
323 3300036712 Ga0316584_0014538 Ga0316584_0014538_4210_5220 335
324 3300037418 Ga0395900_0216701 Ga0395900_0216701_615_1643 335
325 3300038443 Ga0395901_0000154 Ga0395901_0000154_20886_21914 335
326 3300041486 Ga0451807_1151223 Ga0451807_1151223_64_1086 335
327 3300044684 Ga0466966_0003154 Ga0466966_0003154_3221_4249 335
328 3300046455 Ga0495603_0187281 Ga0495603_0187281_28_1068 335
329 3300046512 Ga0495610_0001010 Ga0495610_0001010_499_1506 335
330 3300046616 Ga0495668_0000064 Ga0495668_0000064_107347_108354 335
331 3300046694 Ga0495649_0055517 Ga0495649_0055517_353_1360 335
332 3300047472 Ga0495686_0002575 Ga0495686_0002575_8772_9779 335
333 3300048927 Ga0496124_0205923 Ga0496124_0205923_370_1377 335
334 3300048929 Ga0496126_0186025 Ga0496126_0186025_280_1290 335
335 3300049665 Ga0501227_001375 Ga0501227_001375_4298_5305 335
336 3300049775 Ga0501279_000660 Ga0501279_000660_2410_3417 335
337 3300050490 nmdc:mga03n38_99544_c1 nmdc:mga03n38_99544_c1_138_1145 335
338 3300050491 nmdc:mga00v17_25948_c1 nmdc:mga00v17_25948_c1_1929_2936 335
339 3300050492 nmdc:mga0yw44_36855_c1 nmdc:mga0yw44_36855_c1_1689_2696 335
340 3300050493 nmdc:mga0k408_134985_c1 nmdc:mga0k408_134985_c1_202_1209 335
341 3300053131 Ga0500652_000007 Ga0500652_000007_60507_61523 335
342 3300053141 Ga0500574_005440 Ga0500574_005440_1373_2464 335
343 3300053155 Ga0500620_035558 Ga0500620_035558_503_1519 335
344 3300053161 Ga0500634_0016121 Ga0500634_0016121_2212_3261 335
345 iso_pu_bacteria 2599185292 2599904353 335
346 iso_pu_bacteria 2775507177 2777762776 335
347 iso_pu_bacteria 2808606370 2808891892 335
348 iso_pu_bacteria 2808606371 2808897002 335
349 iso_pu_bacteria 2821131069 2821134442 335
350 iso_pu_bacteria 2842677519 2842681162 335
351 iso_pu_bacteria 2885374607 2885380165 335
352 iso_pu_bacteria 2904699407 2904706917 335
353 iso_pu_bacteria 2919391150 2919391401 335
354 iso_pu_bacteria 2919462493 2919465264 335
355 iso_pu_bacteria 2932406140 2932408407 335
356 iso_pu_bacteria 2939577877 2939580068 335
357 iso_pu_bacteria 2945916053 2945918338 335
358 iso_pu_bacteria 2946037020 2946037831 335
359 iso_pu_bacteria 2953998280 2953999660 335
360 iso_pu_bacteria 3001267043 3001271538 335
361 iso_pu_bacteria 3001272096 3001272485 335
362 iso_pu_bacteria 3006988479 3006992270 335
363 3300001979 JGI24740J21852_10002056 JGI24740J21852_100020563 336
364 3300001989 JGI24739J22299_10003515 JGI24739J22299_100035155 336
365 3300001989 JGI24739J22299_10021682 JGI24739J22299_100216822 336
366 3300002067 JGI24735J21928_10003656 JGI24735J21928_100036564 336
367 3300002075 JGI24738J21930_10010003 JGI24738J21930_100100032 336
368 3300002705 JGI25156J39149_1000178 JGI25156J39149_100017816 336
369 3300002705 JGI25156J39149_1000226 JGI25156J39149_100022622 336
370 3300002705 JGI25156J39149_1000337 JGI25156J39149_100033721 336
371 3300003773 Ga0055537_1000229 Ga0055537_100022911 336
372 3300003784 Ga0055534_1000081 Ga0055534_100008144 336
373 3300003790 Ga0055528_1000107 Ga0055528_100010744 336
374 3300005327 Ga0070658_10002509 Ga0070658_1000250910 336
375 3300005356 Ga0070674_100116630 Ga0070674_1001166302 336
376 3300005366 Ga0070659_100202824 Ga0070659_1002028241 336
377 3300005366 Ga0070659_100247619 Ga0070659_1002476191 336
378 3300005367 Ga0070667_100229459 Ga0070667_1002294592 336
379 3300005455 Ga0070663_100034260 Ga0070663_1000342603 336
380 3300005455 Ga0070663_100083409 Ga0070663_1000834091 336
381 3300005456 Ga0070678_100070874 Ga0070678_1000708742 336
382 3300005458 Ga0070681_10185792 Ga0070681_101857922 336
383 3300005530 Ga0070679_100099164 Ga0070679_1000991642 336
384 3300005539 Ga0068853_100045570 Ga0068853_1000455703 336
385 3300005548 Ga0070665_100137102 Ga0070665_1001371022 336
386 3300005548 Ga0070665_100213471 Ga0070665_1002134712 336
387 3300005548 Ga0070665_100320649 Ga0070665_1003206492 336
388 3300005563 Ga0068855_100014208 Ga0068855_1000142083 336
389 3300005563 Ga0068855_100026819 Ga0068855_1000268195 336
390 3300005563 Ga0068855_100365544 Ga0068855_1003655442 336
391 3300005578 Ga0068854_100007052 Ga0068854_1000070524 336
392 3300005616 Ga0068852_100046505 Ga0068852_1000465052 336
393 3300005983 Ga0081540_1014084 Ga0081540_10140843 336
394 3300006051 Ga0075364_10112207 Ga0075364_101122072 336
395 3300006186 Ga0075369_10112983 Ga0075369_101129831 336
396 3300006195 Ga0075366_10127546 Ga0075366_101275462 336
397 3300006946 Ga0079104_1001448 Ga0079104_100144815 336
398 3300006948 Ga0099826_10000087 Ga0099826_1000008718 336
399 3300009011 Ga0105251_10000405 Ga0105251_1000040519 336
400 3300009011 Ga0105251_10001416 Ga0105251_100014165 336
401 3300009011 Ga0105251_10008305 Ga0105251_100083052 336
402 3300009011 Ga0105251_10077891 Ga0105251_100778911 336
403 3300009036 Ga0105244_10000864 Ga0105244_1000086413 336
404 3300009093 Ga0105240_10043539 Ga0105240_100435394 336
405 3300009093 Ga0105240_10052645 Ga0105240_100526454 336
406 3300009093 Ga0105240_10112554 Ga0105240_101125542 336
407 3300009177 Ga0105248_10067149 Ga0105248_100671493 336
408 3300009177 Ga0105248_10587945 Ga0105248_105879452 336
409 3300009545 Ga0105237_10019838 Ga0105237_100198387 336
410 3300009551 Ga0105238_10000038 Ga0105238_10000038129 336
411 3300009551 Ga0105238_10088633 Ga0105238_100886332 336
412 3300009551 Ga0105238_10236725 Ga0105238_102367253 336
413 3300010375 Ga0105239_10000303 Ga0105239_1000030320 336
414 3300013100 Ga0157373_10001613 Ga0157373_1000161315 336
415 3300013100 Ga0157373_10009523 Ga0157373_100095235 336
416 3300013104 Ga0157370_10000485 Ga0157370_1000048546 336
417 3300013105 Ga0157369_10000138 Ga0157369_1000013874 336
418 3300013105 Ga0157369_10014085 Ga0157369_100140854 336
419 3300013105 Ga0157369_10034798 Ga0157369_100347982 336
420 3300013105 Ga0157369_10118636 Ga0157369_101186362 336
421 3300013296 Ga0157374_10000056 Ga0157374_1000005642 336
422 3300013296 Ga0157374_10159705 Ga0157374_101597052 336
423 3300013307 Ga0157372_10435499 Ga0157372_104354992 336
424 3300013308 Ga0157375_10221768 Ga0157375_102217681 336
425 3300014497 Ga0182008_10028269 Ga0182008_100282693 336
426 3300014969 Ga0157376_10000001 Ga0157376_10000001704 336
427 3300015261 Ga0182006_1002843 Ga0182006_10028434 336
428 3300015261 Ga0182006_1058423 Ga0182006_10584231 336
429 3300015262 Ga0182007_10002938 Ga0182007_100029382 336
430 3300016635 Ga0183361_10018 Ga0183361_10018118 336
431 3300022467 Ga0224712_10000040 Ga0224712_100000402 336
432 3300025256 Ga0209759_1000228 Ga0209759_100022850 336
433 3300025256 Ga0209759_1000275 Ga0209759_100027535 336
434 3300025256 Ga0209759_1000543 Ga0209759_100054310 336
435 3300025263 Ga0209565_1000150 Ga0209565_100015046 336
436 3300025273 Ga0209673_1000114 Ga0209673_1000114128 336
437 3300025291 Ga0209675_1000062 Ga0209675_1000062128 336
438 3300025295 Ga0209564_1004984 Ga0209564_10049844 336
439 3300025302 Ga0207426_1002801 Ga0207426_10028017 336
440 3300025735 Ga0207713_1001376 Ga0207713_100137619 336
441 3300025735 Ga0207713_1001567 Ga0207713_100156716 336
442 3300025904 Ga0207647_10011603 Ga0207647_100116031 336
443 3300025904 Ga0207647_10013337 Ga0207647_100133374 336
444 3300025904 Ga0207647_10013559 Ga0207647_100135594 336
445 3300025909 Ga0207705_10005484 Ga0207705_100054843 336
446 3300025912 Ga0207707_10046163 Ga0207707_100461635 336
447 3300025913 Ga0207695_10012277 Ga0207695_100122772 336
448 3300025913 Ga0207695_10012751 Ga0207695_100127516 336
449 3300025914 Ga0207671_10187055 Ga0207671_101870552 336
450 3300025916 Ga0207663_10206381 Ga0207663_102063812 336
451 3300025917 Ga0207660_10178590 Ga0207660_101785902 336
452 3300025919 Ga0207657_10013828 Ga0207657_100138286 336
453 3300025921 Ga0207652_10021290 Ga0207652_100212907 336
454 3300025924 Ga0207694_10000126 Ga0207694_1000012623 336
455 3300025924 Ga0207694_10013637 Ga0207694_100136376 336
456 3300025924 Ga0207694_10279127 Ga0207694_102791272 336
457 3300025932 Ga0207690_10179013 Ga0207690_101790132 336
458 3300025937 Ga0207669_10045061 Ga0207669_100450612 336
459 3300025941 Ga0207711_10026051 Ga0207711_100260512 336
460 3300025941 Ga0207711_10444961 Ga0207711_104449612 336
461 3300025949 Ga0207667_10000427 Ga0207667_100004276 336
462 3300025949 Ga0207667_10028128 Ga0207667_100281282 336
463 3300025949 Ga0207667_10319366 Ga0207667_103193662 336
464 3300025986 Ga0207658_10139733 Ga0207658_101397332 336
465 3300026067 Ga0207678_10106794 Ga0207678_101067942 336
466 3300026067 Ga0207678_10126657 Ga0207678_101266573 336
467 3300026121 Ga0207683_10098198 Ga0207683_100981982 336
468 3300027111 Ga0209281_1001285 Ga0209281_100128515 336
469 3300027666 Ga0209282_1002130 Ga0209282_10021307 336
470 3300028379 Ga0268266_10218115 Ga0268266_102181152 336
471 3300028379 Ga0268266_10284684 Ga0268266_102846842 336
472 3300028800 Ga0265338_10049870 Ga0265338_100498703 336
473 3300031240 Ga0265320_10100830 Ga0265320_101008302 336
474 3300031911 Ga0307412_10000005 Ga0307412_1000000534 336
475 3300031911 Ga0307412_10000069 Ga0307412_100000694 336
476 3300031995 Ga0307409_100364197 Ga0307409_1003641972 336
477 3300032002 Ga0307416_100090969 Ga0307416_1000909693 336
478 3300033442 Ga0315911_1000018 Ga0315911_100001892 336
479 3300037471 Ga0395905_0007879 Ga0395905_0007879_8450_9505 336
480 3300037471 Ga0395905_0008311 Ga0395905_0008311_2167_3180 336
481 3300041406 Ga0439439_0010800 Ga0439439_0010800_523_1539 336
482 3300041411 Ga0439466_0008698 Ga0439466_0008698_1117_2133 336
483 3300042015 Ga0439462_0005035 Ga0439462_0005035_473_1489 336
484 3300042156 Ga0439446_0032084 Ga0439446_0032084_301_1317 336
485 3300042185 Ga0450909_005168 Ga0450909_005168_149_1165 336
486 3300044656 Ga0466969_0003919 Ga0466969_0003919_6349_7386 336
487 3300044658 Ga0466972_0055584 Ga0466972_0055584_608_1645 336
488 3300044659 Ga0466973_0023612 Ga0466973_0023612_1924_2961 336
489 3300044684 Ga0466966_0000008 Ga0466966_0000008_21224_22255 336
490 3300044693 Ga0466961_0007135 Ga0466961_0007135_2677_3708 336
491 3300044693 Ga0466961_0042890 Ga0466961_0042890_898_1935 336
492 3300044694 Ga0466963_0004171 Ga0466963_0004171_4241_5278 336
493 3300044842 Ga0466957_0032011 Ga0466957_0032011_947_1984 336
494 3300044842 Ga0466957_0053462 Ga0466957_0053462_809_1840 336
495 3300046454 Ga0495592_0008737 Ga0495592_0008737_1420_2442 336
496 3300046455 Ga0495603_0021997 Ga0495603_0021997_1101_2123 336
497 3300046455 Ga0495603_0055671 Ga0495603_0055671_440_1462 336
498 3300046457 Ga0495590_0003467 Ga0495590_0003467_4543_5592 336
499 3300046457 Ga0495590_0019222 Ga0495590_0019222_821_1843 336
500 3300046458 Ga0495591_001099 Ga0495591_001099_8225_9247 336
501 3300046459 Ga0495629_0000054 Ga0495629_0000054_35220_36242 336
502 3300046459 Ga0495629_0000099 Ga0495629_0000099_35902_36924 336
503 3300046459 Ga0495629_0047453 Ga0495629_0047453_1377_2399 336
504 3300046459 Ga0495629_0067906 Ga0495629_0067906_1290_2312 336
505 3300046460 Ga0495638_0007214 Ga0495638_0007214_470_1492 336
506 3300046460 Ga0495638_0035271 Ga0495638_0035271_1482_2492 336
507 3300046460 Ga0495638_0120959 Ga0495638_0120959_358_1392 336
508 3300046462 Ga0495651_0036224 Ga0495651_0036224_2194_3216 336
509 3300046462 Ga0495651_0059265 Ga0495651_0059265_587_1609 336
510 3300046462 Ga0495651_0070947 Ga0495651_0070947_235_1257 336
511 3300046463 Ga0495653_0000099 Ga0495653_0000099_35240_36262 336
512 3300046463 Ga0495653_0013098 Ga0495653_0013098_1666_2721 336
513 3300046471 Ga0495650_0001143 Ga0495650_0001143_13107_14123 336
514 3300046471 Ga0495650_0002455 Ga0495650_0002455_8800_9822 336
515 3300046471 Ga0495650_0018748 Ga0495650_0018748_1066_2088 336
516 3300046472 Ga0495580_0000082 Ga0495580_0000082_27251_28273 336
517 3300046472 Ga0495580_0000208 Ga0495580_0000208_4232_5254 336
518 3300046472 Ga0495580_0014112 Ga0495580_0014112_3901_4923 336
519 3300046472 Ga0495580_0015382 Ga0495580_0015382_3717_4739 336
520 3300046472 Ga0495580_0038009 Ga0495580_0038009_1325_2347 336
521 3300046472 Ga0495580_0048682 Ga0495580_0048682_1099_2121 336
522 3300046472 Ga0495580_0054404 Ga0495580_0054404_512_1534 336
523 3300046473 Ga0495582_0008194 Ga0495582_0008194_3525_4547 336
524 3300046473 Ga0495582_0010405 Ga0495582_0010405_1374_2396 336
525 3300046473 Ga0495582_0015819 Ga0495582_0015819_1920_2942 336
526 3300046474 Ga0495605_0002569 Ga0495605_0002569_9546_10580 336
527 3300046474 Ga0495605_0004126 Ga0495605_0004126_5927_6949 336
528 3300046474 Ga0495605_0009441 Ga0495605_0009441_1547_2569 336
529 3300046500 Ga0495596_0001254 Ga0495596_0001254_4002_5024 336
530 3300046500 Ga0495596_0015853 Ga0495596_0015853_764_1786 336
531 3300046506 Ga0495583_0003132 Ga0495583_0003132_4344_5366 336
532 3300046506 Ga0495583_0006321 Ga0495583_0006321_898_1920 336
533 3300046507 Ga0495606_0009476 Ga0495606_0009476_2750_3772 336
534 3300046507 Ga0495606_0020115 Ga0495606_0020115_1559_2581 336
535 3300046507 Ga0495606_0040054 Ga0495606_0040054_1903_2958 336
536 3300046507 Ga0495606_0152876 Ga0495606_0152876_249_1283 336
537 3300046514 Ga0495618_0030599 Ga0495618_0030599_1234_2256 336
538 3300046515 Ga0495620_0011883 Ga0495620_0011883_3389_4411 336
539 3300046515 Ga0495620_0016675 Ga0495620_0016675_1214_2263 336
540 3300046516 Ga0495628_0004119 Ga0495628_0004119_8069_9103 336
541 3300046516 Ga0495628_0017922 Ga0495628_0017922_1643_2665 336
542 3300046516 Ga0495628_0065029 Ga0495628_0065029_326_1348 336
543 3300046516 Ga0495628_0065782 Ga0495628_0065782_1399_2421 336
544 3300046516 Ga0495628_0173768 Ga0495628_0173768_176_1198 336
545 3300046517 Ga0495630_0003148 Ga0495630_0003148_9489_10511 336
546 3300046517 Ga0495630_0006005 Ga0495630_0006005_1188_2210 336
547 3300046522 Ga0495643_0045249 Ga0495643_0045249_50_1072 336
548 3300046524 Ga0495648_0052631 Ga0495648_0052631_78_1100 336
549 3300046524 Ga0495648_0114174 Ga0495648_0114174_50_1072 336
550 3300046524 Ga0495648_0149648 Ga0495648_0149648_88_1110 336
551 3300046526 Ga0495666_0054900 Ga0495666_0054900_99_1121 336
552 3300046526 Ga0495666_0064354 Ga0495666_0064354_304_1326 336
553 3300046526 Ga0495666_0130873 Ga0495666_0130873_78_1100 336
554 3300046529 Ga0495652_0024230 Ga0495652_0024230_1532_2587 336
555 3300046529 Ga0495652_0047659 Ga0495652_0047659_1440_2462 336
556 3300046531 Ga0495665_0006780 Ga0495665_0006780_3769_4791 336
557 3300046531 Ga0495665_0010499 Ga0495665_0010499_3935_4957 336
558 3300046531 Ga0495665_0022519 Ga0495665_0022519_676_1731 336
559 3300046531 Ga0495665_0048049 Ga0495665_0048049_1072_2094 336
560 3300046533 Ga0495640_0002986 Ga0495640_0002986_11430_12452 336
561 3300046533 Ga0495640_0006341 Ga0495640_0006341_4646_5668 336
562 3300046533 Ga0495640_0071184 Ga0495640_0071184_196_1218 336
563 3300046535 Ga0495586_0123042 Ga0495586_0123042_195_1217 336
564 3300046557 Ga0495622_0000880 Ga0495622_0000880_2560_3582 336
565 3300046642 Ga0495634_0142422 Ga0495634_0142422_378_1400 336
566 3300046648 Ga0495611_0017239 Ga0495611_0017239_1001_2011 336
567 3300046648 Ga0495611_0046716 Ga0495611_0046716_44_1066 336
568 3300046648 Ga0495611_0117353 Ga0495611_0117353_64_1098 336
569 3300046660 Ga0495625_0049416 Ga0495625_0049416_847_1869 336
570 3300046663 Ga0495635_0029567 Ga0495635_0029567_2220_3275 336
571 3300046665 Ga0495661_0155273 Ga0495661_0155273_140_1174 336
572 3300046675 Ga0495657_0079614 Ga0495657_0079614_406_1428 336
573 3300046678 Ga0495599_0019288 Ga0495599_0019288_2316_3338 336
574 3300046679 Ga0495623_0002988 Ga0495623_0002988_7244_8266 336
575 3300046679 Ga0495623_0034113 Ga0495623_0034113_2026_3048 336
576 3300046679 Ga0495623_0104159 Ga0495623_0104159_40_1062 336
577 3300046680 Ga0495646_0001798 Ga0495646_0001798_5859_6881 336
578 3300046680 Ga0495646_0003633 Ga0495646_0003633_655_1710 336
579 3300046680 Ga0495646_0048346 Ga0495646_0048346_122_1144 336
580 3300046684 Ga0495669_0004952 Ga0495669_0004952_1636_2691 336
581 3300046689 Ga0495613_0007126 Ga0495613_0007126_2656_3678 336
582 3300046689 Ga0495613_0109898 Ga0495613_0109898_95_1117 336
583 3300046690 Ga0495624_0002851 Ga0495624_0002851_2789_3811 336
584 3300046690 Ga0495624_0014790 Ga0495624_0014790_4180_5202 336
585 3300046690 Ga0495624_0016562 Ga0495624_0016562_3903_4925 336
586 3300046690 Ga0495624_0018031 Ga0495624_0018031_3623_4645 336
587 3300046690 Ga0495624_0046239 Ga0495624_0046239_304_1326 336
588 3300046690 Ga0495624_0051742 Ga0495624_0051742_1272_2327 336
589 3300046692 Ga0495671_0020281 Ga0495671_0020281_985_2007 336
590 3300046692 Ga0495671_0023174 Ga0495671_0023174_1523_2545 336
591 3300046694 Ga0495649_0005939 Ga0495649_0005939_1814_2836 336
592 3300046694 Ga0495649_0066462 Ga0495649_0066462_446_1492 336
593 3300046794 Ga0495589_0000928 Ga0495589_0000928_9788_10810 336
594 3300046794 Ga0495589_0025596 Ga0495589_0025596_262_1296 336
595 3300047317 Ga0495604_0018563 Ga0495604_0018563_2572_3594 336
596 3300047317 Ga0495604_0020358 Ga0495604_0020358_3166_4188 336
597 3300047317 Ga0495604_0025620 Ga0495604_0025620_615_1637 336
598 3300047317 Ga0495604_0080016 Ga0495604_0080016_241_1263 336
599 3300047319 Ga0495674_0004220 Ga0495674_0004220_2182_3204 336
600 3300047319 Ga0495674_0007713 Ga0495674_0007713_1955_3028 336
601 3300047319 Ga0495674_0012326 Ga0495674_0012326_1101_2156 336
602 3300047319 Ga0495674_0057474 Ga0495674_0057474_1069_2079 336
603 3300047319 Ga0495674_0118705 Ga0495674_0118705_1136_2158 336
604 3300047319 Ga0495674_0149829 Ga0495674_0149829_376_1398 336
605 3300047319 Ga0495674_0341658 Ga0495674_0341658_114_1136 336
606 3300047320 Ga0495672_0000010 Ga0495672_0000010_48790_49830 336
607 3300047320 Ga0495672_0121310 Ga0495672_0121310_196_1227 336
608 3300047321 Ga0495676_0022045 Ga0495676_0022045_168_1190 336
609 3300047322 Ga0495680_0023583 Ga0495680_0023583_798_1853 336
610 3300047322 Ga0495680_0031745 Ga0495680_0031745_1626_2648 336
611 3300047322 Ga0495680_0069170 Ga0495680_0069170_78_1100 336
612 3300047322 Ga0495680_0076445 Ga0495680_0076445_877_1899 336
613 3300047323 Ga0495683_0002027 Ga0495683_0002027_6200_7249 336
614 3300047323 Ga0495683_0004646 Ga0495683_0004646_2689_3711 336
615 3300047323 Ga0495683_0015176 Ga0495683_0015176_35_1057 336
616 3300047443 Ga0495687_000104 Ga0495687_000104_71356_72402 336
617 3300047443 Ga0495687_014501 Ga0495687_014501_2606_3628 336
618 3300047443 Ga0495687_042575 Ga0495687_042575_564_1598 336
619 3300047444 Ga0495675_0001679 Ga0495675_0001679_10607_11629 336
620 3300047444 Ga0495675_0054579 Ga0495675_0054579_186_1208 336
621 3300047446 Ga0495679_000062 Ga0495679_000062_48432_49454 336
622 3300047446 Ga0495679_000063 Ga0495679_000063_24968_25990 336
623 3300047446 Ga0495679_001490 Ga0495679_001490_10088_11110 336
624 3300047446 Ga0495679_013378 Ga0495679_013378_1383_2405 336
625 3300047469 Ga0495673_0019368 Ga0495673_0019368_1508_2530 336
626 3300047469 Ga0495673_0050304 Ga0495673_0050304_250_1272 336
627 3300047469 Ga0495673_0061242 Ga0495673_0061242_330_1364 336
628 3300047471 Ga0495684_0138695 Ga0495684_0138695_781_1791 336
629 3300047472 Ga0495686_0028742 Ga0495686_0028742_855_1877 336
630 3300047472 Ga0495686_0043715 Ga0495686_0043715_1504_2529 336
631 3300047673 Ga0495593_0019601 Ga0495593_0019601_1859_2881 336
632 3300048088 Ga0495602_0000856 Ga0495602_0000856_3755_4777 336
633 3300048088 Ga0495602_0028550 Ga0495602_0028550_3579_4601 336
634 3300048088 Ga0495602_0081496 Ga0495602_0081496_586_1608 336
635 3300048089 Ga0495614_0118602 Ga0495614_0118602_22_1044 336
636 3300048903 Ga0496100_0064098 Ga0496100_0064098_1354_2403 336
637 3300048904 Ga0496101_0001501 Ga0496101_0001501_3043_4092 336
638 3300048904 Ga0496101_0076060 Ga0496101_0076060_962_2017 336
639 3300048905 Ga0496102_0151506 Ga0496102_0151506_197_1231 336
640 3300048905 Ga0496102_0192183 Ga0496102_0192183_250_1299 336
641 3300048905 Ga0496102_0193752 Ga0496102_0193752_530_1552 336
642 3300048906 Ga0496103_0002245 Ga0496103_0002245_4429_5478 336
643 3300048906 Ga0496103_0011170 Ga0496103_0011170_2353_3375 336
644 3300048907 Ga0496104_0099819 Ga0496104_0099819_156_1190 336
645 3300048908 Ga0496105_0018285 Ga0496105_0018285_3111_4166 336
646 3300048910 Ga0496107_0037012 Ga0496107_0037012_1754_2764 336
647 3300048911 Ga0496108_0334082 Ga0496108_0334082_240_1295 336
648 3300048914 Ga0496111_0031413 Ga0496111_0031413_2529_3578 336
649 3300048915 Ga0496112_0113275 Ga0496112_0113275_200_1249 336
650 3300048917 Ga0496114_0065402 Ga0496114_0065402_179_1234 336
651 3300048920 Ga0496117_0003334 Ga0496117_0003334_1897_2919 336
652 3300048920 Ga0496117_0012014 Ga0496117_0012014_5113_6147 336
653 3300048920 Ga0496117_0024611 Ga0496117_0024611_341_1363 336
654 3300048920 Ga0496117_0170475 Ga0496117_0170475_79_1143 336
655 3300048921 Ga0496118_0004252 Ga0496118_0004252_7696_8718 336
656 3300048921 Ga0496118_0016225 Ga0496118_0016225_119_1153 336
657 3300048921 Ga0496118_0044336 Ga0496118_0044336_2407_3456 336
658 3300048921 Ga0496118_0072369 Ga0496118_0072369_654_1676 336
659 3300048924 Ga0496121_0000437 Ga0496121_0000437_73450_74472 336
660 3300048924 Ga0496121_0006494 Ga0496121_0006494_3890_4912 336
661 3300048924 Ga0496121_0009566 Ga0496121_0009566_9749_10798 336
662 3300048924 Ga0496121_0051729 Ga0496121_0051729_1436_2446 336
663 3300048924 Ga0496121_0161963 Ga0496121_0161963_124_1134 336
664 3300048925 Ga0496122_0001630 Ga0496122_0001630_20184_21194 336
665 3300048926 Ga0496123_0001111 Ga0496123_0001111_17602_18612 336
666 3300048926 Ga0496123_0015546 Ga0496123_0015546_2216_3265 336
667 3300048928 Ga0496125_0022722 Ga0496125_0022722_1089_2099 336
668 3300048929 Ga0496126_0000034 Ga0496126_0000034_43368_44402 336
669 3300048929 Ga0496126_0000446 Ga0496126_0000446_19006_20028 336
670 3300048929 Ga0496126_0000882 Ga0496126_0000882_18647_19669 336
671 3300048929 Ga0496126_0006636 Ga0496126_0006636_7971_8993 336
672 3300048929 Ga0496126_0019981 Ga0496126_0019981_1458_2480 336
673 3300048929 Ga0496126_0162752 Ga0496126_0162752_134_1159 336
674 3300049459 Ga0495678_009436 Ga0495678_009436_843_1865 336
675 3300049459 Ga0495678_012518 Ga0495678_012518_1079_2101 336
676 3300049460 Ga0495682_0025422 Ga0495682_0025422_35_1057 336
677 3300050491 nmdc:mga00v17_253000_c1 nmdc:mga00v17_253000_c1_27_1046 336
678 3300050491 nmdc:mga00v17_41288_c1 nmdc:mga00v17_41288_c1_105_1124 336
679 3300050492 nmdc:mga0yw44_246638_c1 nmdc:mga0yw44_246638_c1_89_1108 336
680 3300050493 nmdc:mga0k408_264_c1 nmdc:mga0k408_264_c1_1933_2952 336
681 3300050496 nmdc:mga07m45_18103_c1 nmdc:mga07m45_18103_c1_2625_3635 336
682 3300050496 nmdc:mga07m45_33873_c1 nmdc:mga07m45_33873_c1_1695_2714 336
683 3300053092 Ga0500583_0080956 Ga0500583_0080956_313_1323 336
684 3300053119 Ga0500595_022855 Ga0500595_022855_978_2003 336
685 3300053134 Ga0500658_0028537 Ga0500658_0028537_80_1090 336
686 3300053136 Ga0500559_0051010 Ga0500559_0051010_151_1251 336
687 3300053161 Ga0500634_0048936 Ga0500634_0048936_577_1587 336
688 3300053727 Ga0500611_001649 Ga0500611_001649_1415_2425 336
689 3300061719 Ga0466962_0021693 Ga0466962_0021693_757_1794 336
690 iso_pu_bacteria 2501025501 2501071161 336
691 iso_pu_bacteria 2501025502 2501078646 336
692 iso_pu_bacteria 2501025504 2501414043 336
693 iso_pu_bacteria 2510065045 2510250135 336
694 iso_pu_bacteria 2510917013 2511089293 336
695 iso_pu_bacteria 2510917014 2511094697 336
696 iso_pu_bacteria 2510917015 2511104407 336
697 iso_pu_bacteria 2512047030 2512347686 336
698 iso_pu_bacteria 2513237082 2513555977 336
699 iso_pu_bacteria 2515154122 2515679273 336
700 iso_pu_bacteria 2515154123 2515688480 336
701 iso_pu_bacteria 2515154189 2516017150 336
702 iso_pu_bacteria 2562617112 2563062146 336
703 iso_pu_bacteria 2599185167 2599396456 336
704 iso_pu_bacteria 2599185179 2599453488 336
705 iso_pu_bacteria 2599185190 2599514769 336
706 iso_pu_bacteria 2599185191 2599517249 336
707 iso_pu_bacteria 2599185290 2599893966 336
708 iso_pu_bacteria 2643221628 2644161231 336
709 iso_pu_bacteria 2711768613 2713478006 336
710 iso_pu_bacteria 2718217991 2719639293 336
711 iso_pu_bacteria 2738541296 2738819924 336
712 iso_pu_bacteria 2738541298 2738832404 336
713 iso_pu_bacteria 2738541306 2738873931 336
714 iso_pu_bacteria 2738543002 2739185561 336
715 iso_pu_bacteria 2738543008 2739220529 336
716 iso_pu_bacteria 2744054900 2746092048 336
717 iso_pu_bacteria 2744054901 2746093641 336
718 iso_pu_bacteria 2818991450 2819621039 336
719 iso_pu_bacteria 2842324504 2842331167 336
720 iso_pu_bacteria 2842348783 2842355506 336
721 iso_pu_bacteria 2842454564 2842457895 336
722 iso_pu_bacteria 2857357740 2857364653 336
723 iso_pu_bacteria 2876808645 2876812528 336
724 iso_pu_bacteria 2879110137 2879116171 336
725 iso_pu_bacteria 2883087390 2883093841 336
726 iso_pu_bacteria 2885270888 2885278402 336
727 iso_pu_bacteria 2900634093 2900635452 336
728 iso_pu_bacteria 2900634093 2900636050 336
729 iso_pu_bacteria 2902682994 2902683285 336
730 iso_pu_bacteria 2904615490 2904624589 336
731 iso_pu_bacteria 2919527303 2919530088 336
732 iso_pu_bacteria 2921643360 2921654750 336
733 iso_pu_bacteria 2928108538 2928109842 336
734 iso_pu_bacteria 2928135762 2928136703 336
735 iso_pu_bacteria 2928503688 2928508917 336
736 iso_pu_bacteria 2931390751 2931392655 336
737 iso_pu_bacteria 2945934425 2945935711 336
738 iso_pu_bacteria 2990703756 2990710376 336
739 iso_pu_bacteria 642555112 642594062 336
740 iso_pu_bacteria 642555113 642620476 336
741 iso_pu_bacteria 642555113 642621065 336
742 iso_pu_bacteria 8055266321 8055266537 336
743 iso_pu_bacteria 8055301274 8055305064 336
744 3300002067 JGI24735J21928_10010195 JGI24735J21928_100101952 337
745 3300002705 JGI25156J39149_1007431 JGI25156J39149_10074311 337
746 3300003214 JGI25165J46597_1001162 JGI25165J46597_100116212 337
747 3300003756 Ga0055533_1000124 Ga0055533_100012450 337
748 3300003756 Ga0055533_1000563 Ga0055533_10005632 337
749 3300003758 Ga0055532_1000001 Ga0055532_1000001778 337
750 3300003760 Ga0055527_1000014 Ga0055527_1000014236 337
751 3300003761 Ga0055535_1000001 Ga0055535_1000001227 337
752 3300003762 Ga0055542_1000001 Ga0055542_1000001777 337
753 3300003763 Ga0055529_1000001 Ga0055529_1000001227 337
754 3300005262 Ga0065165_1002142 Ga0065165_100214211 337
755 3300005436 Ga0070713_100000597 Ga0070713_1000005979 337
756 3300005437 Ga0070710_10160650 Ga0070710_101606502 337
757 3300005535 Ga0070684_100035112 Ga0070684_1000351125 337
758 3300005539 Ga0068853_100044527 Ga0068853_1000445272 337
759 3300005618 Ga0068864_100022903 Ga0068864_1000229033 337
760 3300005937 Ga0081455_10018727 Ga0081455_100187272 337
761 3300005983 Ga0081540_1014939 Ga0081540_10149393 337
762 3300006051 Ga0075364_10000085 Ga0075364_100000855 337
763 3300006178 Ga0075367_10005597 Ga0075367_100055977 337
764 3300006178 Ga0075367_10007757 Ga0075367_100077574 337
765 3300006186 Ga0075369_10057272 Ga0075369_100572722 337
766 3300006195 Ga0075366_10012147 Ga0075366_100121475 337
767 3300006195 Ga0075366_10020135 Ga0075366_100201353 337
768 3300006195 Ga0075366_10128855 Ga0075366_101288552 337
769 3300006353 Ga0075370_10011056 Ga0075370_100110564 337
770 3300006946 Ga0079104_1001983 Ga0079104_10019834 337
771 3300006946 Ga0079104_1003315 Ga0079104_10033154 337
772 3300009011 Ga0105251_10001189 Ga0105251_1000118915 337
773 3300009011 Ga0105251_10006773 Ga0105251_100067735 337
774 3300009036 Ga0105244_10003298 Ga0105244_100032982 337
775 3300009092 Ga0105250_10009703 Ga0105250_100097033 337
776 3300009101 Ga0105247_10000018 Ga0105247_1000001896 337
777 3300009174 Ga0105241_10000004 Ga0105241_10000004365 337
778 3300009176 Ga0105242_10293720 Ga0105242_102937201 337
779 3300009553 Ga0105249_10117450 Ga0105249_101174503 337
780 3300013102 Ga0157371_10013078 Ga0157371_100130782 337
781 3300013104 Ga0157370_10000756 Ga0157370_1000075619 337
782 3300013296 Ga0157374_10268028 Ga0157374_102680281 337
783 3300013306 Ga0163162_10194891 Ga0163162_101948912 337
784 3300013306 Ga0163162_10433579 Ga0163162_104335792 337
785 3300015261 Ga0182006_1000118 Ga0182006_10001185 337
786 3300017792 Ga0163161_10000004 Ga0163161_1000000427 337
787 3300025226 Ga0209674_100005 Ga0209674_1000051206 337
788 3300025226 Ga0209674_100150 Ga0209674_10015047 337
789 3300025228 Ga0209672_100001 Ga0209672_1000011607 337
790 3300025229 Ga0209147_100001 Ga0209147_1000011607 337
791 3300025230 Ga0209563_100794 Ga0209563_1007943 337
792 3300025231 Ga0207427_100394 Ga0207427_10039420 337
793 3300025242 Ga0209258_100001 Ga0209258_1000011607 337
794 3300025254 Ga0209148_1000003 Ga0209148_10000031607 337
795 3300025256 Ga0209759_1001138 Ga0209759_100113816 337
796 3300025261 Ga0209233_1000016 Ga0209233_1000016569 337
797 3300025272 Ga0209455_1000001 Ga0209455_10000011607 337
798 3300025304 Ga0209257_1010985 Ga0209257_10109853 337
799 3300025711 Ga0207696_1000001 Ga0207696_100000114 337
800 3300025728 Ga0207655_1003515 Ga0207655_10035152 337
801 3300025735 Ga0207713_1000093 Ga0207713_100009347 337
802 3300025735 Ga0207713_1000205 Ga0207713_100020514 337
803 3300025900 Ga0207710_10000016 Ga0207710_10000016362 337
804 3300025911 Ga0207654_10000006 Ga0207654_10000006382 337
805 3300025915 Ga0207693_10265151 Ga0207693_102651511 337
806 3300025928 Ga0207700_10004741 Ga0207700_100047412 337
807 3300025934 Ga0207686_10047434 Ga0207686_100474342 337
808 3300026095 Ga0207676_10041160 Ga0207676_100411601 337
809 3300026118 Ga0207675_100222708 Ga0207675_1002227082 337
810 3300031239 Ga0265328_10007645 Ga0265328_100076452 337
811 3300033180 Ga0307510_10000948 Ga0307510_100009487 337
812 3300037418 Ga0395900_0233979 Ga0395900_0233979_345_1400 337
813 3300037466 Ga0395898_0012898 Ga0395898_0012898_1346_2401 337
814 3300037471 Ga0395905_0000236 Ga0395905_0000236_10693_11724 337
815 3300037471 Ga0395905_0031654 Ga0395905_0031654_1635_2678 337
816 3300037471 Ga0395905_0275078 Ga0395905_0275078_275_1318 337
817 3300038443 Ga0395901_0031280 Ga0395901_0031280_672_1727 337
818 3300042876 Ga0451577_0008941 Ga0451577_0008941_575_1594 337
819 3300044712 Ga0453684_0041659 Ga0453684_0041659_2997_4019 337
820 3300044712 Ga0453684_0094361 Ga0453684_0094361_1626_2645 337
821 3300044712 Ga0453684_0158893 Ga0453684_0158893_1467_2483 337
822 3300046453 Ga0495627_000396 Ga0495627_000396_7742_8776 337
823 3300046515 Ga0495620_0000720 Ga0495620_0000720_4243_5265 337
824 3300046530 Ga0495654_0000424 Ga0495654_0000424_16753_17808 337
825 3300046530 Ga0495654_0045562 Ga0495654_0045562_946_2001 337
826 3300046538 Ga0495609_0000069 Ga0495609_0000069_27965_28987 337
827 3300046539 Ga0495621_0030015 Ga0495621_0030015_799_1818 337
828 3300046542 Ga0495597_0007210 Ga0495597_0007210_2096_3166 337
829 3300046616 Ga0495668_0000319 Ga0495668_0000319_51852_52865 337
830 3300046665 Ga0495661_0017617 Ga0495661_0017617_125_1144 337
831 3300046692 Ga0495671_0047884 Ga0495671_0047884_965_1990 337
832 3300046794 Ga0495589_0000002 Ga0495589_0000002_623896_624948 337
833 3300047443 Ga0495687_013575 Ga0495687_013575_1804_2823 337
834 3300047443 Ga0495687_037021 Ga0495687_037021_854_1879 337
835 3300048903 Ga0496100_0063024 Ga0496100_0063024_261_1277 337
836 3300048904 Ga0496101_0261609 Ga0496101_0261609_176_1195 337
837 3300048905 Ga0496102_0004504 Ga0496102_0004504_1225_2244 337
838 3300048905 Ga0496102_0311666 Ga0496102_0311666_452_1468 337
839 3300048905 Ga0496102_0479345 Ga0496102_0479345_29_1126 337
840 3300048912 Ga0496109_0162694 Ga0496109_0162694_308_1327 337
841 3300048919 Ga0496116_0000031 Ga0496116_0000031_367104_368138 337
842 3300048920 Ga0496117_0001221 Ga0496117_0001221_18950_19984 337
843 3300048921 Ga0496118_0001708 Ga0496118_0001708_11221_12255 337
844 3300048924 Ga0496121_0014837 Ga0496121_0014837_3470_4588 337
845 3300048927 Ga0496124_0000138 Ga0496124_0000138_61739_62755 337
846 3300048928 Ga0496125_0001586 Ga0496125_0001586_10855_11871 337
847 3300049571 Ga0501034_0000042 Ga0501034_0000042_121274_122287 337
848 3300050490 nmdc:mga03n38_23536_c1 nmdc:mga03n38_23536_c1_1419_2432 337
849 3300050491 nmdc:mga00v17_157_c1 nmdc:mga00v17_157_c1_6623_7657 337
850 3300050492 nmdc:mga0yw44_152651_c1 nmdc:mga0yw44_152651_c1_371_1384 337
851 3300050493 nmdc:mga0k408_15670_c1 nmdc:mga0k408_15670_c1_1769_2818 337
852 3300050494 nmdc:mga06z11_43335_c1 nmdc:mga06z11_43335_c1_778_1833 337
853 3300050496 nmdc:mga07m45_101710_c1 nmdc:mga07m45_101710_c1_443_1456 337
854 3300059660 Ga0587124_000762 Ga0587124_000762_760_1773 337
855 iso_pu_bacteria 2508501125 2509127460 337
856 iso_pu_bacteria 2513237151 2513962164 337
857 iso_pu_bacteria 2526164713 2527076825 337
858 iso_pu_bacteria 2600255067 2600812632 337
859 iso_pu_bacteria 2904483920 2904484146 337
860 iso_pu_bacteria 2945972063 2945973934 337
861 3300003792 Ga0055540_1000641 Ga0055540_10006418 338
862 3300005289 Ga0065704_10081616 Ga0065704_100816162 338
863 3300005335 Ga0070666_10034313 Ga0070666_100343134 338
864 3300005539 Ga0068853_100228122 Ga0068853_1002281222 338
865 3300005548 Ga0070665_100260884 Ga0070665_1002608842 338
866 3300005563 Ga0068855_100074389 Ga0068855_1000743893 338
867 3300005578 Ga0068854_100244785 Ga0068854_1002447851 338
868 3300006177 Ga0075362_10002319 Ga0075362_100023192 338
869 3300006186 Ga0075369_10094925 Ga0075369_100949251 338
870 3300006195 Ga0075366_10011587 Ga0075366_100115873 338
871 3300009093 Ga0105240_10037364 Ga0105240_100373644 338
872 3300009093 Ga0105240_10234108 Ga0105240_102341082 338
873 3300009098 Ga0105245_10233232 Ga0105245_102332322 338
874 3300009101 Ga0105247_10025401 Ga0105247_100254012 338
875 3300009174 Ga0105241_10038817 Ga0105241_100388175 338
876 3300009177 Ga0105248_10038127 Ga0105248_100381274 338
877 3300009545 Ga0105237_10059278 Ga0105237_100592785 338
878 3300009553 Ga0105249_10000243 Ga0105249_1000024335 338
879 3300009553 Ga0105249_10127223 Ga0105249_101272232 338
880 3300013104 Ga0157370_10012877 Ga0157370_100128774 338
881 3300013105 Ga0157369_10000510 Ga0157369_1000051019 338
882 3300013105 Ga0157369_10024923 Ga0157369_100249234 338
883 3300013105 Ga0157369_10035030 Ga0157369_100350303 338
884 3300013307 Ga0157372_10018305 Ga0157372_1001830512 338
885 3300014325 Ga0163163_10014066 Ga0163163_100140663 338
886 3300014497 Ga0182008_10004707 Ga0182008_100047076 338
887 3300015261 Ga0182006_1008317 Ga0182006_10083173 338
888 3300022467 Ga0224712_10058763 Ga0224712_100587632 338
889 3300025292 Ga0209676_1021981 Ga0209676_10219813 338
890 3300025298 Ga0209050_1000904 Ga0209050_100090419 338
891 3300025303 Ga0209051_1000208 Ga0209051_100020835 338
892 3300025904 Ga0207647_10000430 Ga0207647_1000043024 338
893 3300025913 Ga0207695_10063221 Ga0207695_100632214 338
894 3300025914 Ga0207671_10171065 Ga0207671_101710652 338
895 3300025949 Ga0207667_10148183 Ga0207667_101481832 338
896 3300025961 Ga0207712_10000433 Ga0207712_1000043345 338
897 3300025981 Ga0207640_10236046 Ga0207640_102360461 338
898 3300026078 Ga0207702_10278497 Ga0207702_102784972 338
899 3300026088 Ga0207641_10129547 Ga0207641_101295472 338
900 3300026116 Ga0207674_10244418 Ga0207674_102444181 338
901 3300031251 Ga0265327_10005493 Ga0265327_100054937 338
902 3300037471 Ga0395905_0036002 Ga0395905_0036002_2159_3181 338
903 3300046507 Ga0495606_0000240 Ga0495606_0000240_34192_35229 338
904 3300047443 Ga0495687_026210 Ga0495687_026210_580_1602 338
905 3300047443 Ga0495687_030850 Ga0495687_030850_795_1871 338
906 3300047673 Ga0495593_0011480 Ga0495593_0011480_3638_4762 338
907 3300048906 Ga0496103_0098874 Ga0496103_0098874_354_1430 338
908 3300048922 Ga0496119_0000468 Ga0496119_0000468_17144_18163 338
909 3300048923 Ga0496120_0000137 Ga0496120_0000137_91897_92916 338
910 3300048927 Ga0496124_0000017 Ga0496124_0000017_137505_138524 338
911 3300048928 Ga0496125_0118496 Ga0496125_0118496_501_1577 338
912 3300048929 Ga0496126_0126700 Ga0496126_0126700_777_1838 338
913 3300049570 Ga0501033_0173407 Ga0501033_0173407_178_1224 338
914 3300049581 Ga0501047_0024493 Ga0501047_0024493_1549_2595 338
915 3300049822 Ga0501035_0026358 Ga0501035_0026358_1822_2868 338
916 3300049823 Ga0501044_0001443 Ga0501044_0001443_292_1338 338
917 3300050489 nmdc:mga03683_490_c1 nmdc:mga03683_490_c1_5652_6689 338
918 3300050490 nmdc:mga03n38_32004_c1 nmdc:mga03n38_32004_c1_454_1530 338
919 3300053091 Ga0500647_0001969 Ga0500647_0001969_4904_5980 338
920 3300053105 Ga0500557_000056 Ga0500557_000056_3872_4948 338
921 3300053108 Ga0500562_008953 Ga0500562_008953_1066_2190 338
922 3300053110 Ga0500571_000008 Ga0500571_000008_14446_15570 338
923 3300053119 Ga0500595_006780 Ga0500595_006780_1833_2909 338
924 3300053134 Ga0500658_0000085 Ga0500658_0000085_29916_31043 338
925 3300053134 Ga0500658_0017903 Ga0500658_0017903_184_1260 338
926 3300053136 Ga0500559_0005262 Ga0500559_0005262_164_1288 338
927 3300053139 Ga0500568_0001205 Ga0500568_0001205_2776_3900 338
928 3300053146 Ga0500588_0003547 Ga0500588_0003547_560_1636 338
929 3300053177 Ga0500636_0073472 Ga0500636_0073472_189_1313 338
930 iso_pu_bacteria 2517093001 2517105405 338
931 iso_pu_bacteria 2738541277 2738717898 338
932 iso_pu_bacteria 2738543019 2739278584 338
933 iso_pu_bacteria 2904449895 2904454136 338
934 iso_pu_bacteria 2904456579 2904462007 338
935 iso_pu_bacteria 2904541872 2904542026 338
936 iso_pu_bacteria 2928084124 2928084515 338
937 iso_pu_bacteria 2929160207 2929167316 338
938 3300000549 LJQas_1008444 LJQas_10084441 339
939 3300003187 JGI25151J46595_10001061 JGI25151J46595_1000106115 339
940 3300003575 Ga0007409J51694_1005204 Ga0007409J51694_10052047 339
941 3300003577 Ga0007416J51690_1004145 Ga0007416J51690_10041457 339
942 3300003693 Ga0032354_1011833 Ga0032354_10118337 339
943 3300003751 Ga0055538_1000002 Ga0055538_1000002683 339
944 3300003752 Ga0055539_1000002 Ga0055539_1000002683 339
945 3300003756 Ga0055533_1000004 Ga0055533_1000004683 339
946 3300003759 Ga0055525_1000002 Ga0055525_1000002683 339
947 3300003781 Ga0055536_1002843 Ga0055536_10028434 339
948 3300003841 Ga0055541_1000002 Ga0055541_1000002160 339
949 3300005459 Ga0068867_100004040 Ga0068867_1000040403 339
950 3300005578 Ga0068854_100006860 Ga0068854_1000068605 339
951 3300005578 Ga0068854_100048170 Ga0068854_1000481703 339
952 3300005834 Ga0068851_10000255 Ga0068851_1000025515 339
953 3300009011 Ga0105251_10000869 Ga0105251_1000086916 339
954 3300009011 Ga0105251_10042879 Ga0105251_100428791 339
955 3300009036 Ga0105244_10030368 Ga0105244_100303682 339
956 3300009092 Ga0105250_10075631 Ga0105250_100756311 339
957 3300013100 Ga0157373_10000633 Ga0157373_1000063314 339
958 3300013100 Ga0157373_10000981 Ga0157373_1000098111 339
959 3300013102 Ga0157371_10005108 Ga0157371_1000510811 339
960 3300013104 Ga0157370_10013422 Ga0157370_100134226 339
961 3300013105 Ga0157369_10103667 Ga0157369_101036673 339
962 3300013308 Ga0157375_10456583 Ga0157375_104565831 339
963 3300014497 Ga0182008_10000556 Ga0182008_1000055615 339
964 3300017792 Ga0163161_10000738 Ga0163161_1000073813 339
965 3300025224 Ga0209784_100002 Ga0209784_100002906 339
966 3300025225 Ga0209566_100003 Ga0209566_100003906 339
967 3300025226 Ga0209674_100004 Ga0209674_100004906 339
968 3300025230 Ga0209563_100006 Ga0209563_100006906 339
969 3300025253 Ga0209677_100003 Ga0209677_100003906 339
970 3300025254 Ga0209148_1000620 Ga0209148_100062019 339
971 3300025292 Ga0209676_1000164 Ga0209676_100016463 339
972 3300025292 Ga0209676_1000244 Ga0209676_100024433 339
973 3300025294 Ga0209025_1000191 Ga0209025_100019159 339
974 3300025321 Ga0207656_10001797 Ga0207656_100017975 339
975 3300025728 Ga0207655_1001151 Ga0207655_100115113 339
976 3300025735 Ga0207713_1000699 Ga0207713_100069919 339
977 3300025904 Ga0207647_10000410 Ga0207647_1000041035 339
978 3300025907 Ga0207645_10008061 Ga0207645_100080615 339
979 3300025981 Ga0207640_10077107 Ga0207640_100771072 339
980 3300031239 Ga0265328_10000002 Ga0265328_1000000277 339
981 3300031250 Ga0265331_10053560 Ga0265331_100535602 339
982 3300031548 Ga0307408_100009230 Ga0307408_1000092301 339
983 3300031548 Ga0307408_100030979 Ga0307408_1000309794 339
984 3300031548 Ga0307408_100087687 Ga0307408_1000876872 339
985 3300031731 Ga0307405_10026202 Ga0307405_100262022 339
986 3300031731 Ga0307405_10109589 Ga0307405_101095891 339
987 3300031824 Ga0307413_10253810 Ga0307413_102538102 339
988 3300031852 Ga0307410_10010788 Ga0307410_100107886 339
989 3300031903 Ga0307407_10048464 Ga0307407_100484642 339
990 3300031911 Ga0307412_10009054 Ga0307412_100090542 339
991 3300031911 Ga0307412_10020542 Ga0307412_100205423 339
992 3300031995 Ga0307409_100006258 Ga0307409_1000062582 339
993 3300032002 Ga0307416_100008505 Ga0307416_1000085051 339
994 3300032004 Ga0307414_10100900 Ga0307414_101009002 339
995 3300037312 Ga0395899_0040683 Ga0395899_0040683_1037_2086 339
996 3300037418 Ga0395900_0052659 Ga0395900_0052659_111_1136 339
997 3300037466 Ga0395898_0131666 Ga0395898_0131666_518_1567 339
998 3300037471 Ga0395905_0015581 Ga0395905_0015581_3664_4704 339
999 3300037471 Ga0395905_0165040 Ga0395905_0165040_139_1188 339
1000 3300042007 Ga0439449_0011594 Ga0439449_0011594_1109_2236 339
1001 3300042016 Ga0439463_004189 Ga0439463_004189_1124_2155 339
1002 3300044694 Ga0466963_0003221 Ga0466963_0003221_4910_5953 339
1003 3300044706 Ga0466964_0005801 Ga0466964_0005801_270_1313 339
1004 3300045049 Ga0466959_0000027 Ga0466959_0000027_75359_76402 339
1005 3300046453 Ga0495627_000231 Ga0495627_000231_28879_29916 339
1006 3300046457 Ga0495590_0000062 Ga0495590_0000062_51713_52765 339
1007 3300046473 Ga0495582_0019610 Ga0495582_0019610_2037_3080 339
1008 3300046474 Ga0495605_0000250 Ga0495605_0000250_52982_54034 339
1009 3300046477 Ga0495664_0012257 Ga0495664_0012257_1586_2629 339
1010 3300046512 Ga0495610_0005858 Ga0495610_0005858_2952_4004 339
1011 3300046518 Ga0495631_0000932 Ga0495631_0000932_7808_8845 339
1012 3300046524 Ga0495648_0003217 Ga0495648_0003217_8584_9636 339
1013 3300046528 Ga0495642_0000006 Ga0495642_0000006_118035_119087 339
1014 3300046530 Ga0495654_0010213 Ga0495654_0010213_1645_2697 339
1015 3300046531 Ga0495665_0012030 Ga0495665_0012030_2086_3129 339
1016 3300046535 Ga0495586_0030103 Ga0495586_0030103_112_1155 339
1017 3300046535 Ga0495586_0195080 Ga0495586_0195080_60_1103 339
1018 3300046536 Ga0495587_0041837 Ga0495587_0041837_960_2003 339
1019 3300046543 Ga0495645_0018667 Ga0495645_0018667_1858_2901 339
1020 3300046559 Ga0495667_0004661 Ga0495667_0004661_2175_3218 339
1021 3300046616 Ga0495668_0025365 Ga0495668_0025365_1983_3035 339
1022 3300046660 Ga0495625_0172162 Ga0495625_0172162_364_1416 339
1023 3300046675 Ga0495657_0021542 Ga0495657_0021542_1431_2474 339
1024 3300046684 Ga0495669_0008446 Ga0495669_0008446_1661_2713 339
1025 3300046692 Ga0495671_0001569 Ga0495671_0001569_3763_4800 339
1026 3300046692 Ga0495671_0045650 Ga0495671_0045650_531_1583 339
1027 3300046694 Ga0495649_0000844 Ga0495649_0000844_16545_17597 339
1028 3300046809 Ga0495600_0004096 Ga0495600_0004096_5923_6966 339
1029 3300047315 Ga0495581_0014339 Ga0495581_0014339_3208_4251 339
1030 3300047320 Ga0495672_0000158 Ga0495672_0000158_51387_52439 339
1031 3300047320 Ga0495672_0014192 Ga0495672_0014192_950_1987 339
1032 3300047323 Ga0495683_0026041 Ga0495683_0026041_1111_2163 339
1033 3300047444 Ga0495675_0072682 Ga0495675_0072682_498_1541 339
1034 3300047446 Ga0495679_002444 Ga0495679_002444_4926_5957 339
1035 3300047469 Ga0495673_0001271 Ga0495673_0001271_3056_4108 339
1036 3300047673 Ga0495593_0044331 Ga0495593_0044331_685_1728 339
1037 3300048904 Ga0496101_0009824 Ga0496101_0009824_1927_2970 339
1038 3300048905 Ga0496102_0085628 Ga0496102_0085628_1238_2281 339
1039 3300048905 Ga0496102_0179263 Ga0496102_0179263_342_1361 339
1040 3300048906 Ga0496103_0001546 Ga0496103_0001546_10796_11839 339
1041 3300048909 Ga0496106_0002122 Ga0496106_0002122_2397_3440 339
1042 3300048910 Ga0496107_0025617 Ga0496107_0025617_1163_2206 339
1043 3300048913 Ga0496110_0005967 Ga0496110_0005967_1761_2804 339
1044 3300048925 Ga0496122_0002855 Ga0496122_0002855_11077_12108 339
1045 3300048926 Ga0496123_0003528 Ga0496123_0003528_5041_6072 339
1046 3300048927 Ga0496124_0002733 Ga0496124_0002733_11325_12356 339
1047 3300048929 Ga0496126_0034277 Ga0496126_0034277_2836_3873 339
1048 3300049574 Ga0501038_0241156 Ga0501038_0241156_312_1340 339
1049 3300053149 Ga0500600_0024281 Ga0500600_0024281_1328_2431 339
1050 3300059424 Ga0590075_026072 Ga0590075_026072_417_1442 339
1051 3300059510 Ga0587090_000446 Ga0587090_000446_2270_3289 339
1052 3300059643 Ga0587072_000808 Ga0587072_000808_2232_3251 339
1053 3300061719 Ga0466962_0006642 Ga0466962_0006642_3301_4344 339
1054 iso_pu_bacteria 2513237083 2513565530 339
1055 iso_pu_bacteria 2721755763 2723877632 339
1056 iso_pu_bacteria 8003955200 8003961804 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

76

244

0.96

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

78

336

0.94

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

79

239

0.88

PF05368

NmrA

NmrA-like family

78

213

0.87

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

79

399

0.86

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

78

260

0.83

PF08659

KR

KR domain

77

210

0.81

PF13460

NAD_binding_10

NAD(P)H-binding

82

248

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i3n-assembly1.cif.gz_B molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase 0.9915 2 335
7xpq-assembly1.cif.gz_A crystal structure of udp-glc/glcnac 4-epimerase with nad/udp-glcnac 0.9907 2 335
3enk-assembly1.cif.gz_B 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei 0.9897 2 334
1kvr-assembly1.cif.gz_A-2 udp-galactose 4-epimerase complexed with udp-phenol 0.9887 1 335
1kvt-assembly1.cif.gz_A-2 udp-galactose 4-epimerase complexed with udp-phenol 0.9886 1 335
ID Description Score Start End Superfamily
3enkB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9761 1 261 3.40.50.720
af_P18645_3_269_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9757 1 261 3.40.50.720
4lisA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9749 181 337 3.90.25.10
3enkB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9715 1 261 3.40.50.720
af_A0A1D6I245_15_71_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9636 6 57 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A661Y9Y6-F1-model_v4 deleted 0.9953 1 153
AF-A0A7Y0BJL8-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) 0.9921 1 335 GO:0003978
GO:0005829
GO:0006012
AF-A0A3L8RXC4-F1-model_v4 UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.2) (EC 5.1.3.7) 0.9919 2 335 GO:0003974
GO:0003978
GO:0005829
GO:0033499
AF-A0A2J6M7Q8-F1-model_v4 deleted 0.9917 2 335
AF-A0A5E4A169-F1-model_v4 UDP-N-acetylglucosamine 4-epimerase (EC 4.1.3.4) (EC 5.1.3.2) (EC 5.1.3.7) 0.9912 2 334 GO:0003974
GO:0003978
GO:0004419
GO:0005829
GO:0033499

Feature Viewer

pLDDT pTM Quality
95.43 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map