F489175

General Info

Members Datasets Scaffolds Average Seq Length
1056 362 2112 109

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100377536|Ga0070713_1003775362
Length 115
Sequence MSMSLTVAKRDSLQGSLDLLVLKVVSRRRRLHGYAIMSAIQEMSGDVLRVEEGSLYPALHRMEAAGWIRAEWIRKENGRRARLYELTPAGKKQLGLEESGWQTVTAAVNRVLREA

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
193 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
212 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
237 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
240 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
241 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
242 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
243 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
244 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
245 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
246 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
274 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
308 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
326 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
327 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
328 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
329 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
330 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
331 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
332 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
337 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
338 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
343 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
347 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
348 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
352 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
353 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
354 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
357 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
358 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
359 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
360 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 1.99
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 22.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100377536 3300005436 Bacteria 1320
2 LJQas_1018996 3300000549 Bacteria 799
3 JGI24743J22301_10035696 3300001991 Bacteria 988
4 rootH2_10018443 3300003320 Viruses 23632
5 rootH2_10164600 3300003320 Unclassified 2063
6 Ga0065712_10007270 3300005290 Bacteria 4116
7 Ga0065712_10371216 3300005290 Bacteria 763
8 Ga0065707_10021146 3300005295 Bacteria 1394
9 Ga0070658_10013361 3300005327 Bacteria 6588
10 Ga0070658_10034110 3300005327 Bacteria 4094
11 Ga0070658_10329417 3300005327 Bacteria 1305
12 Ga0070658_10493593 3300005327 Bacteria 1057
13 Ga0070676_10089547 3300005328 Bacteria 1882
14 Ga0070676_11537669 3300005328 Bacteria 513
15 Ga0070683_100002722 3300005329 Bacteria 14114
16 Ga0070683_100028428 3300005329 Bacteria 5052
17 Ga0070683_100046668 3300005329 Bacteria 4003
18 Ga0070683_100223184 3300005329 Bacteria 1791
19 Ga0070683_100521440 3300005329 Unclassified 1136
20 Ga0070683_101963630 3300005329 Unclassified 562
21 Ga0070690_100215992 3300005330 Bacteria 1341
22 Ga0070690_101676153 3300005330 Unclassified 516
23 Ga0070670_100004622 3300005331 Bacteria 11546
24 Ga0070670_100064316 3300005331 Unclassified 3148
25 Ga0070670_101836986 3300005331 Bacteria 558
26 Ga0070677_10212651 3300005333 Unclassified 940
27 Ga0068869_100001480 3300005334 Bacteria 13907
28 Ga0068869_100053182 3300005334 Bacteria 2943
29 Ga0070666_10250285 3300005335 Bacteria 1254
30 Ga0070666_10771240 3300005335 Bacteria 707
31 Ga0070666_10785031 3300005335 Unclassified 701
32 Ga0070666_11007165 3300005335 Unclassified 618
33 Ga0070680_100023336 3300005336 Unclassified 4934
34 Ga0070680_100675101 3300005336 Bacteria 889
35 Ga0070680_100747392 3300005336 Bacteria 842
36 Ga0070680_101200611 3300005336 Unclassified 656
37 Ga0068868_100001675 3300005338 Bacteria 15151
38 Ga0068868_100001769 3300005338 Bacteria 14792
39 Ga0068868_100014180 3300005338 Bacteria 5869
40 Ga0068868_100159395 3300005338 Bacteria 1862
41 Ga0068868_101256856 3300005338 Bacteria 686
42 Ga0070660_100999219 3300005339 Bacteria 707
43 Ga0070689_100045833 3300005340 Bacteria 3368
44 Ga0070689_100078169 3300005340 Bacteria 2594
45 Ga0070689_100985056 3300005340 Bacteria 749
46 Ga0070691_10706992 3300005341 Bacteria 605
47 Ga0070661_100084771 3300005344 Bacteria 2341
48 Ga0070661_100112213 3300005344 Bacteria 2037
49 Ga0070661_100862649 3300005344 Bacteria 746
50 Ga0070692_11206343 3300005345 Unclassified 539
51 Ga0070668_100039692 3300005347 Bacteria 3600
52 Ga0070668_100434834 3300005347 Unclassified 1125
53 Ga0070669_100133379 3300005353 Bacteria 1908
54 Ga0070669_100146696 3300005353 Unclassified 1824
55 Ga0070675_100031843 3300005354 Bacteria 4265
56 Ga0070675_100145745 3300005354 Bacteria 2027
57 Ga0070675_100439117 3300005354 Unclassified 1169
58 Ga0070675_102214286 3300005354 Bacteria 506
59 Ga0070671_100004037 3300005355 Bacteria 11572
60 Ga0070671_100041323 3300005355 Unclassified 3832
61 Ga0070671_100084330 3300005355 Bacteria 2657
62 Ga0070671_101932863 3300005355 Unclassified 525
63 Ga0070674_100309144 3300005356 Unclassified 1263
64 Ga0070674_101759886 3300005356 Bacteria 561
65 Ga0070673_100013898 3300005364 Bacteria 5589
66 Ga0070673_101470166 3300005364 Unclassified 642
67 Ga0070673_101649091 3300005364 Bacteria 606
68 Ga0070688_100276814 3300005365 Bacteria 1204
69 Ga0070688_100351228 3300005365 Bacteria 1080
70 Ga0070659_100094319 3300005366 Bacteria 2403
71 Ga0070659_100650213 3300005366 Bacteria 909
72 Ga0070667_100003404 3300005367 Bacteria 13546
73 Ga0070667_100032935 3300005367 Bacteria 4325
74 Ga0070667_100235046 3300005367 Unclassified 1635
75 Ga0070703_10022023 3300005406 Unclassified 1867
76 Ga0070709_10012929 3300005434 Bacteria 4680
77 Ga0070709_10063972 3300005434 Bacteria 2351
78 Ga0070709_10069335 3300005434 Bacteria 2271
79 Ga0070709_10072151 3300005434 Unclassified 2231
80 Ga0070714_100236264 3300005435 Bacteria 1685
81 Ga0070714_100597241 3300005435 Bacteria 1060
82 Ga0070714_100656646 3300005435 Bacteria 1010
83 Ga0070713_100000756 3300005436 Bacteria 20685
84 Ga0070713_100007628 3300005436 Bacteria 7615
85 Ga0070713_100160209 3300005436 Bacteria 2008
86 Ga0070713_100188167 3300005436 Bacteria 1859
87 Ga0070713_100382572 3300005436 Bacteria 1311
88 Ga0070713_100568576 3300005436 Bacteria 1075
89 Ga0070713_101849202 3300005436 Unclassified 586
90 Ga0070711_100043800 3300005439 Bacteria 3034
91 Ga0070711_100116244 3300005439 Bacteria 1971
92 Ga0070711_100364321 3300005439 Unclassified 1165
93 Ga0070711_100409667 3300005439 Unclassified 1102
94 Ga0070711_100809621 3300005439 Bacteria 795
95 Ga0070705_100007139 3300005440 Bacteria 5497
96 Ga0070705_101030184 3300005440 Bacteria 670
97 Ga0070705_101060988 3300005440 Bacteria 661
98 Ga0070700_100304787 3300005441 Unclassified 1164
99 Ga0070700_101045719 3300005441 Bacteria 674
100 Ga0070694_100088360 3300005444 Unclassified 2170
101 Ga0070694_100947451 3300005444 Unclassified 713
102 Ga0070694_101652594 3300005444 Bacteria 544
103 Ga0070694_101758979 3300005444 Bacteria 528
104 Ga0070708_100004621 3300005445 Bacteria 10844
105 Ga0070708_100152966 3300005445 Bacteria 2146
106 Ga0070663_100133997 3300005455 Bacteria 1885
107 Ga0070663_100758890 3300005455 Bacteria 829
108 Ga0070678_100045286 3300005456 Bacteria 3146
109 Ga0070678_101977698 3300005456 Unclassified 551
110 Ga0070662_100052745 3300005457 Bacteria 2942
111 Ga0070662_100078765 3300005457 Bacteria 2449
112 Ga0070662_100770073 3300005457 Unclassified 817
113 Ga0070681_10010160 3300005458 Bacteria 9282
114 Ga0070681_10109907 3300005458 Bacteria 2696
115 Ga0070681_10162448 3300005458 Bacteria 2157
116 Ga0070681_10632189 3300005458 Unclassified 985
117 Ga0068867_100567600 3300005459 Unclassified 985
118 Ga0068867_100761770 3300005459 Unclassified 860
119 Ga0068867_100942927 3300005459 Bacteria 779
120 Ga0070706_100031675 3300005467 Unclassified 4876
121 Ga0070707_100005736 3300005468 Bacteria 11582
122 Ga0070707_100117531 3300005468 Bacteria 2581
123 Ga0070707_100414082 3300005468 Bacteria 1308
124 Ga0070707_101195532 3300005468 Bacteria 726
125 Ga0070698_101153254 3300005471 Bacteria 724
126 Ga0070698_101949936 3300005471 Unclassified 540
127 Ga0070699_100059693 3300005518 Unclassified 3304
128 Ga0070699_100072400 3300005518 Bacteria 2998
129 Ga0070699_100827946 3300005518 Unclassified 847
130 Ga0070679_100017259 3300005530 Bacteria 6983
131 Ga0070679_100065368 3300005530 Unclassified 3625
132 Ga0070679_100805967 3300005530 Bacteria 882
133 Ga0070684_100040309 3300005535 Bacteria 4021
134 Ga0070684_100046206 3300005535 Bacteria 3773
135 Ga0070684_100046822 3300005535 Bacteria 3747
136 Ga0070684_100129028 3300005535 Bacteria 2280
137 Ga0070684_100179986 3300005535 Unclassified 1922
138 Ga0070684_100231747 3300005535 Bacteria 1686
139 Ga0070684_100325499 3300005535 Bacteria 1412
140 Ga0070684_100611092 3300005535 Unclassified 1014
141 Ga0070684_101378560 3300005535 Bacteria 664
142 Ga0070697_100001864 3300005536 Bacteria 16112
143 Ga0070697_100478920 3300005536 Bacteria 1087
144 Ga0070697_100762635 3300005536 Bacteria 855
145 Ga0070697_100774113 3300005536 Bacteria 848
146 Ga0070697_101516496 3300005536 Unclassified 599
147 Ga0068853_100000760 3300005539 Bacteria 22373
148 Ga0068853_100153545 3300005539 Bacteria 2073
149 Ga0068853_100161770 3300005539 Bacteria 2021
150 Ga0068853_100218878 3300005539 Bacteria 1738
151 Ga0068853_100319680 3300005539 Unclassified 1439
152 Ga0068853_101140774 3300005539 Bacteria 752
153 Ga0068853_102397451 3300005539 Bacteria 511
154 Ga0070672_102043035 3300005543 Bacteria 516
155 Ga0070695_100037111 3300005545 Unclassified 3070
156 Ga0070695_100125661 3300005545 Bacteria 1761
157 Ga0070695_100290222 3300005545 Bacteria 1205
158 Ga0070695_100501560 3300005545 Bacteria 939
159 Ga0070695_100969353 3300005545 Bacteria 690
160 Ga0070695_101107666 3300005545 Bacteria 648
161 Ga0070695_101284788 3300005545 Unclassified 604
162 Ga0070696_100000282 3300005546 Bacteria 30602
163 Ga0070696_100146959 3300005546 Bacteria 1727
164 Ga0070696_100393317 3300005546 Unclassified 1083
165 Ga0070696_100548418 3300005546 Unclassified 926
166 Ga0070693_100004320 3300005547 Bacteria 6709
167 Ga0070693_100701231 3300005547 Bacteria 741
168 Ga0070665_100025124 3300005548 Bacteria 6002
169 Ga0070665_100027471 3300005548 Bacteria 5732
170 Ga0070665_100044342 3300005548 Bacteria 4466
171 Ga0070665_100054299 3300005548 Bacteria 4018
172 Ga0070665_100069455 3300005548 Bacteria 3530
173 Ga0070665_100248617 3300005548 Bacteria 1779
174 Ga0070665_100359191 3300005548 Unclassified 1462
175 Ga0070665_100692401 3300005548 Bacteria 1032
176 Ga0070665_100935778 3300005548 Bacteria 879
177 Ga0070665_101124341 3300005548 Bacteria 797
178 Ga0070665_101873584 3300005548 Unclassified 606
179 Ga0070704_100005557 3300005549 Bacteria 7350
180 Ga0068855_100000250 3300005563 Bacteria 67441
181 Ga0068855_100020057 3300005563 Bacteria 8027
182 Ga0068855_100052552 3300005563 Bacteria 4796
183 Ga0068855_100077582 3300005563 Bacteria 3854
184 Ga0068855_100164099 3300005563 Bacteria 2519
185 Ga0068855_100641259 3300005563 Bacteria 1142
186 Ga0068855_100675242 3300005563 Bacteria 1107
187 Ga0068855_101119833 3300005563 Bacteria 822
188 Ga0068855_101154822 3300005563 Unclassified 807
189 Ga0070664_100019731 3300005564 Bacteria 5549
190 Ga0070664_100655781 3300005564 Bacteria 976
191 Ga0070664_100880020 3300005564 Bacteria 839
192 Ga0068857_100041105 3300005577 Bacteria 4100
193 Ga0068857_100053622 3300005577 Bacteria 3577
194 Ga0068857_100159589 3300005577 Unclassified 2046
195 Ga0068857_100195079 3300005577 Bacteria 1845
196 Ga0068857_100255276 3300005577 Bacteria 1608
197 Ga0068854_100010270 3300005578 Bacteria 6069
198 Ga0068854_100047267 3300005578 Bacteria 3067
199 Ga0068854_100251616 3300005578 Bacteria 1411
200 Ga0068854_100763319 3300005578 Bacteria 840
201 Ga0068854_101301322 3300005578 Unclassified 654
202 Ga0068854_101422303 3300005578 Bacteria 627
203 Ga0068856_100001514 3300005614 Bacteria 24372
204 Ga0068856_100003761 3300005614 Bacteria 15218
205 Ga0068856_100004698 3300005614 Bacteria 13563
206 Ga0068856_100018860 3300005614 Bacteria 6689
207 Ga0068856_100136386 3300005614 Bacteria 2459
208 Ga0068856_101112771 3300005614 Unclassified 807
209 Ga0068856_101164511 3300005614 Bacteria 788
210 Ga0068856_102030820 3300005614 Bacteria 585
211 Ga0068856_102209015 3300005614 Bacteria 559
212 Ga0070702_100323072 3300005615 Bacteria 1076
213 Ga0070702_100706783 3300005615 Bacteria 769
214 Ga0070702_100850092 3300005615 Bacteria 710
215 Ga0068852_100000010 3300005616 Bacteria 141683
216 Ga0068852_100063281 3300005616 Bacteria 3221
217 Ga0068852_100299085 3300005616 Bacteria 1557
218 Ga0068852_100571088 3300005616 Bacteria 1133
219 Ga0068852_100953578 3300005616 Bacteria 876
220 Ga0068852_101372951 3300005616 Bacteria 728
221 Ga0068852_101391669 3300005616 Bacteria 723
222 Ga0068859_100008728 3300005617 Bacteria 10239
223 Ga0068859_100009619 3300005617 Bacteria 9759
224 Ga0068859_100022156 3300005617 Bacteria 6370
225 Ga0068859_100768910 3300005617 Unclassified 1052
226 Ga0068864_100012964 3300005618 Bacteria 6898
227 Ga0068864_100271584 3300005618 Unclassified 1580
228 Ga0068864_100455085 3300005618 Bacteria 1224
229 Ga0068866_10002504 3300005718 Bacteria 7569
230 Ga0068866_10061922 3300005718 Bacteria 1945
231 Ga0068861_100142433 3300005719 Unclassified 1958
232 Ga0068861_101829444 3300005719 Bacteria 603
233 Ga0068851_10003306 3300005834 Bacteria 7162
234 Ga0068851_10006982 3300005834 Bacteria 5178
235 Ga0068851_10139925 3300005834 Unclassified 1316
236 Ga0068851_10250147 3300005834 Bacteria 1005
237 Ga0068870_11193060 3300005840 Unclassified 551
238 Ga0068863_100004433 3300005841 Bacteria 13837
239 Ga0068863_100241060 3300005841 Bacteria 1745
240 Ga0068858_100000894 3300005842 Bacteria 30948
241 Ga0068858_101144752 3300005842 Bacteria 764
242 Ga0068860_100004498 3300005843 Bacteria 14222
243 Ga0068860_100092571 3300005843 Bacteria 2881
244 Ga0068862_100203978 3300005844 Unclassified 1784
245 Ga0068862_101479326 3300005844 Bacteria 684
246 Ga0068862_102248628 3300005844 Bacteria 557
247 Ga0070717_10440085 3300006028 Bacteria 1174
248 Ga0075363_100180006 3300006048 Bacteria 1202
249 Ga0075364_10359278 3300006051 Unclassified 993
250 Ga0075364_10471384 3300006051 Unclassified 858
251 Ga0075364_10726741 3300006051 Unclassified 677
252 Ga0075432_10503628 3300006058 Unclassified 540
253 Ga0070715_10135189 3300006163 Bacteria 1191
254 Ga0070716_100088016 3300006173 Bacteria 1872
255 Ga0070716_100131713 3300006173 Unclassified 1581
256 Ga0070716_100223321 3300006173 Bacteria 1267
257 Ga0070716_100787292 3300006173 Unclassified 735
258 Ga0070712_100011062 3300006175 Bacteria 5711
259 Ga0070712_100016643 3300006175 Bacteria 4751
260 Ga0070712_100054195 3300006175 Bacteria 2803
261 Ga0070712_100085628 3300006175 Unclassified 2295
262 Ga0070712_100232192 3300006175 Bacteria 1465
263 Ga0070712_100319122 3300006175 Bacteria 1263
264 Ga0070712_100645417 3300006175 Bacteria 899
265 Ga0075362_10007621 3300006177 Bacteria 4111
266 Ga0075369_10167346 3300006186 Bacteria 1008
267 Ga0075369_10260322 3300006186 Unclassified 806
268 Ga0097621_100000411 3300006237 Bacteria 29913
269 Ga0097621_100009117 3300006237 Bacteria 7190
270 Ga0097621_100015840 3300006237 Bacteria 5684
271 Ga0097621_100035335 3300006237 Bacteria 3993
272 Ga0097621_100065695 3300006237 Unclassified 2986
273 Ga0097621_100198415 3300006237 Bacteria 1741
274 Ga0097621_100789512 3300006237 Bacteria 879
275 Ga0068871_100002096 3300006358 Bacteria 13503
276 Ga0068871_100771748 3300006358 Unclassified 885
277 Ga0068871_100917908 3300006358 Bacteria 812
278 Ga0068871_101192428 3300006358 Unclassified 714
279 Ga0068871_101297241 3300006358 Bacteria 685
280 Ga0075428_100034181 3300006844 Bacteria 5609
281 Ga0075430_100012143 3300006846 Bacteria 7332
282 Ga0075431_100004580 3300006847 Bacteria 13569
283 Ga0075434_100059402 3300006871 Bacteria 3801
284 Ga0075434_100119188 3300006871 Bacteria 2653
285 Ga0075434_100619405 3300006871 Bacteria 1101
286 Ga0075434_101307561 3300006871 Unclassified 736
287 Ga0075429_100660262 3300006880 Unclassified 916
288 Ga0068865_100001072 3300006881 Bacteria 15770
289 Ga0068865_100048605 3300006881 Bacteria 2920
290 Ga0068865_100994120 3300006881 Unclassified 734
291 Ga0075436_100025051 3300006914 Bacteria 4102
292 Ga0075436_100116732 3300006914 Bacteria 1865
293 Ga0075436_100513652 3300006914 Bacteria 877
294 Ga0075436_101568897 3300006914 Unclassified 500
295 Ga0097620_100008728 3300006931 Bacteria 10239
296 Ga0097620_100009619 3300006931 Bacteria 9759
297 Ga0097620_100022156 3300006931 Bacteria 6370
298 Ga0097620_100768943 3300006931 Unclassified 1052
299 Ga0075435_100000004 3300007076 Bacteria 122128
300 Ga0075435_100172831 3300007076 Unclassified 1823
301 Ga0099794_10467196 3300007265 Bacteria 662
302 Ga0099795_10450023 3300007788 Bacteria 593
303 Ga0099795_10460515 3300007788 Unclassified 587
304 Ga0105240_10000436 3300009093 Bacteria 76985
305 Ga0105240_10004419 3300009093 Bacteria 21435
306 Ga0105240_10012860 3300009093 Bacteria 11531
307 Ga0105240_10025261 3300009093 Bacteria 7810
308 Ga0105240_10032915 3300009093 Bacteria 6704
309 Ga0105240_10036335 3300009093 Bacteria 6340
310 Ga0105240_10050394 3300009093 Bacteria 5250
311 Ga0105240_10148818 3300009093 Bacteria 2791
312 Ga0105240_10177697 3300009093 Bacteria 2515
313 Ga0105240_10251974 3300009093 Bacteria 2041
314 Ga0105240_10565848 3300009093 Bacteria 1256
315 Ga0105240_10637903 3300009093 Bacteria 1169
316 Ga0105240_10899611 3300009093 Bacteria 952
317 Ga0105240_12067885 3300009093 Bacteria 591
318 Ga0105240_12686900 3300009093 Bacteria 514
319 Ga0111539_10016191 3300009094 Bacteria 9252
320 Ga0111539_10042739 3300009094 Bacteria 5439
321 Ga0111539_10051147 3300009094 Unclassified 4922
322 Ga0111539_10078267 3300009094 Unclassified 3890
323 Ga0111539_10106356 3300009094 Bacteria 3291
324 Ga0111539_10233728 3300009094 Bacteria 2140
325 Ga0111539_11189478 3300009094 Unclassified 885
326 Ga0111539_11518405 3300009094 Unclassified 777
327 Ga0111539_11550779 3300009094 Bacteria 768
328 Ga0111539_11700006 3300009094 Unclassified 732
329 Ga0111539_11957415 3300009094 Bacteria 680
330 Ga0105245_10007833 3300009098 Bacteria 9356
331 Ga0105245_10022166 3300009098 Bacteria 5577
332 Ga0105245_10045873 3300009098 Bacteria 3904
333 Ga0105245_10074593 3300009098 Bacteria 3087
334 Ga0105245_10172165 3300009098 Bacteria 2062
335 Ga0105245_10299050 3300009098 Bacteria 1579
336 Ga0105245_10468538 3300009098 Bacteria 1271
337 Ga0105245_10776598 3300009098 Unclassified 995
338 Ga0105245_11334215 3300009098 Bacteria 767
339 Ga0105247_10001551 3300009101 Bacteria 16385
340 Ga0105247_10008463 3300009101 Bacteria 6266
341 Ga0105247_10194451 3300009101 Bacteria 1360
342 Ga0105247_10206434 3300009101 Bacteria 1323
343 Ga0114129_10067192 3300009147 Bacteria 5000
344 Ga0114129_10161994 3300009147 Bacteria 3055
345 Ga0114129_10635297 3300009147 Unclassified 1379
346 Ga0114129_10718018 3300009147 Bacteria 1283
347 Ga0114129_10965531 3300009147 Bacteria 1075
348 Ga0114129_11632626 3300009147 Bacteria 788
349 Ga0105243_11889903 3300009148 Unclassified 630
350 Ga0105241_10000014 3300009174 Bacteria 171306
351 Ga0105241_10000642 3300009174 Bacteria 26220
352 Ga0105241_10005710 3300009174 Bacteria 9183
353 Ga0105241_10026292 3300009174 Unclassified 4329
354 Ga0105241_10047426 3300009174 Bacteria 3267
355 Ga0105241_10064208 3300009174 Bacteria 2834
356 Ga0105241_10128230 3300009174 Bacteria 2051
357 Ga0105241_10295443 3300009174 Bacteria 1388
358 Ga0105241_10295952 3300009174 Bacteria 1387
359 Ga0105241_10529791 3300009174 Bacteria 1055
360 Ga0105241_10831222 3300009174 Bacteria 853
361 Ga0105241_11903163 3300009174 Bacteria 583
362 Ga0105241_12466687 3300009174 Unclassified 520
363 Ga0105241_12559573 3300009174 Unclassified 512
364 Ga0105242_10006845 3300009176 Bacteria 8787
365 Ga0105242_10010294 3300009176 Bacteria 7170
366 Ga0105242_10038242 3300009176 Bacteria 3858
367 Ga0105242_10331236 3300009176 Unclassified 1400
368 Ga0105242_10391417 3300009176 Unclassified 1294
369 Ga0105242_10868325 3300009176 Unclassified 899
370 Ga0105242_10877911 3300009176 Bacteria 895
371 Ga0105242_11359242 3300009176 Unclassified 736
372 Ga0105242_11783419 3300009176 Bacteria 653
373 Ga0105248_10014503 3300009177 Bacteria 8676
374 Ga0105248_10017033 3300009177 Bacteria 8004
375 Ga0105248_10018467 3300009177 Bacteria 7707
376 Ga0105248_10028300 3300009177 Bacteria 6243
377 Ga0105248_10041781 3300009177 Bacteria 5142
378 Ga0105248_10073528 3300009177 Bacteria 3841
379 Ga0105248_10081486 3300009177 Bacteria 3637
380 Ga0105248_10087727 3300009177 Bacteria 3502
381 Ga0105248_10129882 3300009177 Bacteria 2842
382 Ga0105248_10234077 3300009177 Bacteria 2068
383 Ga0105248_10245244 3300009177 Bacteria 2017
384 Ga0105248_10509076 3300009177 Bacteria 1357
385 Ga0105248_12593364 3300009177 Bacteria 578
386 Ga0105237_10007844 3300009545 Bacteria 11640
387 Ga0105237_10007965 3300009545 Bacteria 11544
388 Ga0105237_10019667 3300009545 Bacteria 6972
389 Ga0105237_10025505 3300009545 Bacteria 6046
390 Ga0105237_10053597 3300009545 Bacteria 4045
391 Ga0105237_10269959 3300009545 Unclassified 1704
392 Ga0105237_10464862 3300009545 Bacteria 1271
393 Ga0105237_10486393 3300009545 Unclassified 1240
394 Ga0105237_11687675 3300009545 Unclassified 641
395 Ga0105238_10001147 3300009551 Bacteria 26737
396 Ga0105238_10002103 3300009551 Bacteria 20114
397 Ga0105238_10011589 3300009551 Bacteria 8884
398 Ga0105238_10043336 3300009551 Bacteria 4553
399 Ga0105238_10311521 3300009551 Bacteria 1559
400 Ga0105238_10349571 3300009551 Bacteria 1467
401 Ga0105238_10613019 3300009551 Unclassified 1097
402 Ga0105238_10713832 3300009551 Bacteria 1015
403 Ga0105249_10027336 3300009553 Bacteria 5147
404 Ga0105249_10342541 3300009553 Bacteria 1512
405 Ga0105249_11354639 3300009553 Unclassified 783
406 Ga0105249_12947136 3300009553 Unclassified 546
407 Ga0099796_10536976 3300010159 Unclassified 525
408 Ga0105239_10003382 3300010375 Bacteria 19576
409 Ga0105239_10045292 3300010375 Bacteria 4821
410 Ga0105239_10068734 3300010375 Bacteria 3893
411 Ga0105239_10085886 3300010375 Bacteria 3468
412 Ga0105239_10103031 3300010375 Bacteria 3158
413 Ga0105239_10236022 3300010375 Bacteria 2052
414 Ga0105239_10301600 3300010375 Bacteria 1804
415 Ga0105239_10305439 3300010375 Unclassified 1792
416 Ga0105239_10819512 3300010375 Unclassified 1067
417 Ga0105239_10977005 3300010375 Bacteria 973
418 Ga0105239_11556606 3300010375 Bacteria 764
419 Ga0105239_11855527 3300010375 Bacteria 699
420 Ga0105239_12274845 3300010375 Bacteria 631
421 Ga0105239_13048659 3300010375 Bacteria 546
422 Ga0105246_10000506 3300011119 Bacteria 21241
423 Ga0105246_10109102 3300011119 Bacteria 2030
424 Ga0105246_10974744 3300011119 Bacteria 766
425 Ga0157373_10256009 3300013100 Bacteria 1238
426 Ga0157373_10336648 3300013100 Bacteria 1075
427 Ga0157373_10954217 3300013100 Unclassified 638
428 Ga0157373_11306102 3300013100 Bacteria 549
429 Ga0157373_11360099 3300013100 Bacteria 539
430 Ga0157371_10105899 3300013102 Bacteria 1995
431 Ga0157371_10137857 3300013102 Bacteria 1738
432 Ga0157370_10000005 3300013104 Bacteria 288514
433 Ga0157370_10106232 3300013104 Unclassified 2628
434 Ga0157369_10000049 3300013105 Bacteria 169239
435 Ga0157369_10006463 3300013105 Bacteria 13588
436 Ga0157369_10008092 3300013105 Bacteria 12057
437 Ga0157369_10013495 3300013105 Bacteria 9232
438 Ga0157369_10017952 3300013105 Bacteria 7942
439 Ga0157369_10060862 3300013105 Bacteria 4071
440 Ga0157369_10073446 3300013105 Unclassified 3670
441 Ga0157369_10104562 3300013105 Unclassified 3015
442 Ga0157369_10209593 3300013105 Bacteria 2043
443 Ga0157369_10210467 3300013105 Bacteria 2038
444 Ga0157369_10237764 3300013105 Bacteria 1903
445 Ga0157369_10537074 3300013105 Bacteria 1209
446 Ga0157369_10883681 3300013105 Unclassified 917
447 Ga0157369_11554529 3300013105 Bacteria 673
448 Ga0157374_10025354 3300013296 Bacteria 5323
449 Ga0157374_10083752 3300013296 Bacteria 3030
450 Ga0157374_10157517 3300013296 Bacteria 2211
451 Ga0157374_10193138 3300013296 Bacteria 1991
452 Ga0157374_10250360 3300013296 Unclassified 1743
453 Ga0157374_11025517 3300013296 Unclassified 844
454 Ga0157374_11206303 3300013296 Unclassified 778
455 Ga0157374_11513155 3300013296 Bacteria 694
456 Ga0157378_10004806 3300013297 Bacteria 11837
457 Ga0157378_10009528 3300013297 Bacteria 8456
458 Ga0157378_10026122 3300013297 Bacteria 5148
459 Ga0157378_10055476 3300013297 Unclassified 3530
460 Ga0157378_10154791 3300013297 Bacteria 2138
461 Ga0157378_10272551 3300013297 Bacteria 1628
462 Ga0157378_10639700 3300013297 Bacteria 1078
463 Ga0163162_10788057 3300013306 Unclassified 1068
464 Ga0163162_11075292 3300013306 Bacteria 911
465 Ga0157372_10000047 3300013307 Bacteria 145881
466 Ga0157372_10006634 3300013307 Bacteria 12320
467 Ga0157372_10011629 3300013307 Bacteria 9370
468 Ga0157372_10017955 3300013307 Bacteria 7601
469 Ga0157372_10068757 3300013307 Bacteria 3982
470 Ga0157372_10110844 3300013307 Bacteria 3143
471 Ga0157372_10192210 3300013307 Bacteria 2364
472 Ga0157372_10196288 3300013307 Bacteria 2338
473 Ga0157372_10264704 3300013307 Bacteria 1996
474 Ga0157372_11227389 3300013307 Bacteria 866
475 Ga0157372_11363379 3300013307 Bacteria 818
476 Ga0157375_10004406 3300013308 Bacteria 12226
477 Ga0157375_10035664 3300013308 Bacteria 4750
478 Ga0157375_10084450 3300013308 Bacteria 3223
479 Ga0157375_10489164 3300013308 Bacteria 1395
480 Ga0157375_11227167 3300013308 Bacteria 880
481 Ga0163163_10001403 3300014325 Bacteria 20325
482 Ga0163163_10068653 3300014325 Unclassified 3527
483 Ga0163163_10112559 3300014325 Bacteria 2751
484 Ga0163163_10258020 3300014325 Unclassified 1794
485 Ga0163163_10739423 3300014325 Bacteria 1047
486 Ga0163163_11735681 3300014325 Bacteria 685
487 Ga0157380_10019586 3300014326 Bacteria 5044
488 Ga0157380_10026942 3300014326 Unclassified 4367
489 Ga0157380_10075251 3300014326 Bacteria 2743
490 Ga0157380_10503630 3300014326 Unclassified 1177
491 Ga0157380_10614379 3300014326 Unclassified 1078
492 Ga0157380_11995570 3300014326 Unclassified 642
493 Ga0157380_12463362 3300014326 Unclassified 586
494 Ga0157379_10000404 3300014968 Bacteria 35030
495 Ga0157379_10031031 3300014968 Bacteria 4761
496 Ga0157379_10042708 3300014968 Bacteria 4048
497 Ga0157379_10154427 3300014968 Bacteria 2070
498 Ga0157379_11556752 3300014968 Bacteria 644
499 Ga0157379_11948584 3300014968 Unclassified 580
500 Ga0157376_10000652 3300014969 Bacteria 22457
501 Ga0157376_10230925 3300014969 Bacteria 1719
502 Ga0157376_10294783 3300014969 Bacteria 1533
503 Ga0157376_10335447 3300014969 Bacteria 1442
504 Ga0157376_11099192 3300014969 Unclassified 821
505 Ga0157376_11788892 3300014969 Bacteria 650
506 Ga0157376_12790479 3300014969 Unclassified 528
507 Ga0182005_1146378 3300015265 Bacteria 685
508 Ga0163161_10020772 3300017792 Bacteria 4610
509 Ga0163161_11057728 3300017792 Unclassified 695
510 Ga0213875_10063176 3300021388 Unclassified 1731
511 Ga0228598_1011828 3300024227 Bacteria 1736
512 Ga0207656_10027863 3300025321 Bacteria 2314
513 Ga0207656_10101589 3300025321 Bacteria 1319
514 Ga0207656_10115706 3300025321 Bacteria 1244
515 Ga0207656_10115995 3300025321 Bacteria 1242
516 Ga0207653_10087475 3300025885 Bacteria 1087
517 Ga0207653_10229852 3300025885 Unclassified 706
518 Ga0207642_10005676 3300025899 Bacteria 4088
519 Ga0207710_10000869 3300025900 Bacteria 16199
520 Ga0207710_10099065 3300025900 Bacteria 1372
521 Ga0207710_10529802 3300025900 Unclassified 613
522 Ga0207688_10529688 3300025901 Bacteria 739
523 Ga0207680_10149836 3300025903 Bacteria 1554
524 Ga0207680_10215581 3300025903 Bacteria 1314
525 Ga0207680_10721107 3300025903 Bacteria 715
526 Ga0207647_10024516 3300025904 Bacteria 3977
527 Ga0207647_10026139 3300025904 Bacteria 3823
528 Ga0207685_10024287 3300025905 Bacteria 2076
529 Ga0207685_10086249 3300025905 Bacteria 1311
530 Ga0207699_10020265 3300025906 Bacteria 3560
531 Ga0207699_10116693 3300025906 Bacteria 1720
532 Ga0207699_10342529 3300025906 Unclassified 1053
533 Ga0207645_10037493 3300025907 Bacteria 3110
534 Ga0207645_10318167 3300025907 Bacteria 1038
535 Ga0207705_10077458 3300025909 Bacteria 2419
536 Ga0207705_10242598 3300025909 Bacteria 1373
537 Ga0207705_10342464 3300025909 Bacteria 1151
538 Ga0207705_10807248 3300025909 Bacteria 728
539 Ga0207684_10026923 3300025910 Unclassified 4904
540 Ga0207654_10001162 3300025911 Bacteria 14158
541 Ga0207654_10073895 3300025911 Bacteria 2033
542 Ga0207654_10202996 3300025911 Bacteria 1306
543 Ga0207654_10354128 3300025911 Bacteria 1011
544 Ga0207654_10626404 3300025911 Bacteria 769
545 Ga0207707_10034688 3300025912 Bacteria 4414
546 Ga0207707_10091889 3300025912 Bacteria 2652
547 Ga0207707_10269563 3300025912 Unclassified 1476
548 Ga0207707_10349962 3300025912 Unclassified 1273
549 Ga0207707_10518131 3300025912 Unclassified 1016
550 Ga0207695_10000137 3300025913 Bacteria 217180
551 Ga0207695_10000507 3300025913 Bacteria 82878
552 Ga0207695_10000977 3300025913 Bacteria 50828
553 Ga0207695_10010221 3300025913 Bacteria 11509
554 Ga0207695_10071410 3300025913 Bacteria 3546
555 Ga0207695_10181029 3300025913 Bacteria 2028
556 Ga0207695_10590627 3300025913 Bacteria 992
557 Ga0207695_11248471 3300025913 Bacteria 623
558 Ga0207695_11380941 3300025913 Unclassified 585
559 Ga0207671_10000715 3300025914 Bacteria 42550
560 Ga0207671_10018855 3300025914 Bacteria 5287
561 Ga0207671_10131047 3300025914 Unclassified 1924
562 Ga0207671_10274026 3300025914 Bacteria 1330
563 Ga0207671_10284223 3300025914 Bacteria 1305
564 Ga0207671_10521365 3300025914 Bacteria 947
565 Ga0207693_10019524 3300025915 Bacteria 5390
566 Ga0207693_10030149 3300025915 Unclassified 4284
567 Ga0207693_10062742 3300025915 Unclassified 2911
568 Ga0207693_10232893 3300025915 Bacteria 1446
569 Ga0207693_10297967 3300025915 Unclassified 1263
570 Ga0207693_10536621 3300025915 Bacteria 913
571 Ga0207693_10750347 3300025915 Bacteria 754
572 Ga0207663_10044163 3300025916 Bacteria 2734
573 Ga0207663_10117955 3300025916 Bacteria 1812
574 Ga0207663_10359508 3300025916 Unclassified 1104
575 Ga0207663_10781252 3300025916 Bacteria 760
576 Ga0207663_11733765 3300025916 Bacteria 502
577 Ga0207660_10017429 3300025917 Unclassified 4772
578 Ga0207660_10600428 3300025917 Unclassified 896
579 Ga0207660_10654522 3300025917 Unclassified 857
580 Ga0207660_11156870 3300025917 Bacteria 630
581 Ga0207662_10138679 3300025918 Bacteria 1539
582 Ga0207657_10604815 3300025919 Bacteria 855
583 Ga0207649_10108589 3300025920 Bacteria 1850
584 Ga0207649_10263870 3300025920 Bacteria 1246
585 Ga0207649_10474467 3300025920 Unclassified 948
586 Ga0207649_10805609 3300025920 Bacteria 733
587 Ga0207652_10010717 3300025921 Bacteria 7380
588 Ga0207652_10824770 3300025921 Bacteria 822
589 Ga0207646_10000274 3300025922 Bacteria 70391
590 Ga0207646_10124793 3300025922 Bacteria 2314
591 Ga0207646_11270205 3300025922 Unclassified 644
592 Ga0207681_10067441 3300025923 Bacteria 2481
593 Ga0207681_10142669 3300025923 Unclassified 1786
594 Ga0207681_10279623 3300025923 Bacteria 1314
595 Ga0207681_10542913 3300025923 Bacteria 956
596 Ga0207694_10000489 3300025924 Bacteria 35937
597 Ga0207694_10001113 3300025924 Bacteria 23254
598 Ga0207694_10058812 3300025924 Bacteria 2990
599 Ga0207694_10397932 3300025924 Unclassified 1145
600 Ga0207694_10706995 3300025924 Bacteria 850
601 Ga0207650_10027803 3300025925 Bacteria 4051
602 Ga0207650_11423400 3300025925 Bacteria 590
603 Ga0207659_10071458 3300025926 Bacteria 2534
604 Ga0207659_10355874 3300025926 Unclassified 1216
605 Ga0207687_10005043 3300025927 Bacteria 8741
606 Ga0207687_10030962 3300025927 Bacteria 3613
607 Ga0207687_10305447 3300025927 Bacteria 1283
608 Ga0207687_10480375 3300025927 Bacteria 1035
609 Ga0207700_10022606 3300025928 Bacteria 4318
610 Ga0207700_10347729 3300025928 Bacteria 1290
611 Ga0207700_10435179 3300025928 Bacteria 1154
612 Ga0207700_10609600 3300025928 Bacteria 972
613 Ga0207700_11237745 3300025928 Bacteria 666
614 Ga0207700_11589087 3300025928 Unclassified 579
615 Ga0207664_10293073 3300025929 Unclassified 1430
616 Ga0207664_10353376 3300025929 Bacteria 1301
617 Ga0207664_10460067 3300025929 Unclassified 1136
618 Ga0207664_10503319 3300025929 Bacteria 1085
619 Ga0207664_10633943 3300025929 Bacteria 960
620 Ga0207644_10005460 3300025931 Bacteria 8280
621 Ga0207644_10114322 3300025931 Unclassified 2045
622 Ga0207644_10242016 3300025931 Bacteria 1437
623 Ga0207690_10042768 3300025932 Bacteria 2978
624 Ga0207690_10049097 3300025932 Bacteria 2811
625 Ga0207706_10021398 3300025933 Bacteria 5809
626 Ga0207706_10216158 3300025933 Bacteria 1679
627 Ga0207686_10251662 3300025934 Bacteria 1291
628 Ga0207686_10940930 3300025934 Bacteria 699
629 Ga0207670_10024415 3300025936 Bacteria 3778
630 Ga0207670_11792564 3300025936 Unclassified 522
631 Ga0207669_10056819 3300025937 Bacteria 2379
632 Ga0207704_10014768 3300025938 Bacteria 3956
633 Ga0207704_10055232 3300025938 Bacteria 2426
634 Ga0207665_10007240 3300025939 Bacteria 7340
635 Ga0207665_10029176 3300025939 Unclassified 3648
636 Ga0207665_10264480 3300025939 Bacteria 1275
637 Ga0207665_10658681 3300025939 Unclassified 821
638 Ga0207665_10821320 3300025939 Unclassified 735
639 Ga0207665_10870883 3300025939 Unclassified 714
640 Ga0207691_10756684 3300025940 Bacteria 818
641 Ga0207711_10000013 3300025941 Bacteria 514850
642 Ga0207711_10004831 3300025941 Bacteria 11454
643 Ga0207711_10011288 3300025941 Bacteria 7420
644 Ga0207711_10075652 3300025941 Bacteria 2931
645 Ga0207711_10127868 3300025941 Bacteria 2275
646 Ga0207711_10139883 3300025941 Unclassified 2177
647 Ga0207711_10243888 3300025941 Bacteria 1648
648 Ga0207711_10793284 3300025941 Bacteria 882
649 Ga0207711_11630623 3300025941 Unclassified 588
650 Ga0207689_10005697 3300025942 Bacteria 11077
651 Ga0207689_10041297 3300025942 Bacteria 3817
652 Ga0207661_10000798 3300025944 Bacteria 20562
653 Ga0207661_10041920 3300025944 Bacteria 3607
654 Ga0207661_10117610 3300025944 Bacteria 2258
655 Ga0207661_10134645 3300025944 Bacteria 2121
656 Ga0207661_10484172 3300025944 Unclassified 1130
657 Ga0207661_10643845 3300025944 Bacteria 974
658 Ga0207661_11140228 3300025944 Bacteria 718
659 Ga0207679_10006047 3300025945 Bacteria 7628
660 Ga0207679_11216993 3300025945 Bacteria 691
661 Ga0207679_11832945 3300025945 Bacteria 554
662 Ga0207667_10000949 3300025949 Bacteria 36988
663 Ga0207667_10018161 3300025949 Bacteria 7896
664 Ga0207667_10018186 3300025949 Bacteria 7889
665 Ga0207667_10934724 3300025949 Bacteria 857
666 Ga0207667_11860129 3300025949 Unclassified 565
667 Ga0207667_12159665 3300025949 Unclassified 514
668 Ga0207651_10255046 3300025960 Bacteria 1437
669 Ga0207651_10791363 3300025960 Bacteria 840
670 Ga0207712_10558982 3300025961 Unclassified 985
671 Ga0207712_11453660 3300025961 Bacteria 614
672 Ga0207668_10318246 3300025972 Bacteria 1290
673 Ga0207668_10387326 3300025972 Unclassified 1178
674 Ga0207640_10009374 3300025981 Bacteria 5480
675 Ga0207640_10879917 3300025981 Bacteria 781
676 Ga0207640_10929768 3300025981 Bacteria 761
677 Ga0207640_10989176 3300025981 Unclassified 739
678 Ga0207658_10001464 3300025986 Bacteria 18403
679 Ga0207658_10147840 3300025986 Bacteria 1910
680 Ga0207677_10000778 3300026023 Bacteria 18330
681 Ga0207677_10118110 3300026023 Bacteria 1989
682 Ga0207677_10505136 3300026023 Bacteria 1046
683 Ga0207703_10001909 3300026035 Bacteria 18473
684 Ga0207703_10011249 3300026035 Bacteria 6962
685 Ga0207703_10976433 3300026035 Bacteria 812
686 Ga0207639_10009769 3300026041 Bacteria 6629
687 Ga0207639_10035702 3300026041 Bacteria 3679
688 Ga0207639_10123026 3300026041 Bacteria 2135
689 Ga0207639_10163037 3300026041 Bacteria 1880
690 Ga0207639_10754385 3300026041 Bacteria 905
691 Ga0207678_10209812 3300026067 Bacteria 1666
692 Ga0207678_10351868 3300026067 Unclassified 1270
693 Ga0207708_10059743 3300026075 Unclassified 2910
694 Ga0207708_10326206 3300026075 Unclassified 1254
695 Ga0207708_10786606 3300026075 Unclassified 818
696 Ga0207702_10000993 3300026078 Bacteria 29058
697 Ga0207702_10010856 3300026078 Bacteria 7597
698 Ga0207702_10047430 3300026078 Bacteria 3620
699 Ga0207702_10053630 3300026078 Bacteria 3414
700 Ga0207702_10130688 3300026078 Bacteria 2259
701 Ga0207702_10695650 3300026078 Bacteria 1002
702 Ga0207702_11038180 3300026078 Unclassified 813
703 Ga0207702_12122749 3300026078 Bacteria 551
704 Ga0207641_10005473 3300026088 Bacteria 10831
705 Ga0207641_10208489 3300026088 Bacteria 1806
706 Ga0207641_12460237 3300026088 Bacteria 519
707 Ga0207641_12536709 3300026088 Unclassified 511
708 Ga0207648_10053848 3300026089 Bacteria 3516
709 Ga0207648_10262782 3300026089 Bacteria 1540
710 Ga0207648_10426940 3300026089 Unclassified 1204
711 Ga0207648_10673594 3300026089 Bacteria 957
712 Ga0207648_11620935 3300026089 Unclassified 608
713 Ga0207676_10008589 3300026095 Bacteria 7257
714 Ga0207676_10017059 3300026095 Bacteria 5261
715 Ga0207676_10436942 3300026095 Bacteria 1231
716 Ga0207676_10549555 3300026095 Unclassified 1103
717 Ga0207676_11102017 3300026095 Bacteria 785
718 Ga0207674_10006657 3300026116 Bacteria 13574
719 Ga0207674_10013263 3300026116 Bacteria 9154
720 Ga0207674_10064133 3300026116 Bacteria 3706
721 Ga0207674_10071193 3300026116 Bacteria 3494
722 Ga0207674_10077229 3300026116 Bacteria 3336
723 Ga0207674_10102867 3300026116 Bacteria 2836
724 Ga0207674_10112268 3300026116 Bacteria 2699
725 Ga0207675_101191715 3300026118 Unclassified 782
726 Ga0207698_10000003 3300026142 Bacteria 321303
727 Ga0207698_10333792 3300026142 Bacteria 1425
728 Ga0207698_10914499 3300026142 Bacteria 885
729 Ga0207698_11044170 3300026142 Bacteria 829
730 Ga0207698_12463396 3300026142 Bacteria 531
731 Ga0207428_10005795 3300027907 Bacteria 11458
732 Ga0207428_10087962 3300027907 Unclassified 2416
733 Ga0207428_10121757 3300027907 Bacteria 2000
734 Ga0207428_10216907 3300027907 Bacteria 1436
735 Ga0207428_10409387 3300027907 Unclassified 992
736 Ga0265354_1000083 3300028016 Bacteria 16178
737 Ga0265354_1001617 3300028016 Bacteria 3147
738 Ga0265357_1004030 3300028023 Bacteria 1304
739 Ga0268266_10009093 3300028379 Bacteria 8772
740 Ga0268266_10016382 3300028379 Bacteria 6338
741 Ga0268266_10016622 3300028379 Bacteria 6287
742 Ga0268266_10018097 3300028379 Bacteria 6006
743 Ga0268266_10173735 3300028379 Bacteria 1957
744 Ga0268266_10275155 3300028379 Bacteria 1564
745 Ga0268266_11172728 3300028379 Bacteria 743
746 Ga0268266_12339006 3300028379 Unclassified 505
747 Ga0268265_10968660 3300028380 Unclassified 839
748 Ga0268265_11304118 3300028380 Bacteria 726
749 Ga0268264_10003955 3300028381 Bacteria 12691
750 Ga0268264_10455431 3300028381 Bacteria 1240
751 Ga0268264_10653453 3300028381 Bacteria 1041
752 Ga0268264_12150693 3300028381 Bacteria 566
753 Ga0265318_10113568 3300028577 Unclassified 996
754 Ga0265338_10000633 3300028800 Bacteria 61054
755 Ga0265338_11018929 3300028800 Unclassified 560
756 Ga0265338_11104122 3300028800 Unclassified 534
757 Ga0265316_10003465 3300031344 Bacteria 15942
758 Ga0265316_10054004 3300031344 Bacteria 3146
759 Ga0265316_10910816 3300031344 Bacteria 614
760 Ga0307408_100292809 3300031548 Bacteria 1360
761 Ga0265342_10230523 3300031712 Bacteria 995
762 Ga0307413_10248456 3300031824 Bacteria 1318
763 Ga0307412_10379672 3300031911 Bacteria 1144
764 Ga0307409_100060772 3300031995 Bacteria 2949
765 Ga0307416_100139569 3300032002 Bacteria 2200
766 Ga0307416_100210889 3300032002 Unclassified 1853
767 Ga0307411_11243477 3300032005 Bacteria 676
768 Ga0307415_102591393 3300032126 Bacteria 500
769 Ga0307510_10035621 3300033180 Bacteria 5554
770 Ga0307510_10055224 3300033180 Bacteria 4150
771 Ga0316212_1003127 3300033547 Bacteria 2383
772 Ga0373926_0433779 3300035083 Bacteria 521
773 Ga0373934_0003047 3300035086 Bacteria 6121
774 Ga0373934_0339498 3300035086 Bacteria 625
775 Ga0373944_0053675 3300035089 Bacteria 1276
776 Ga0373923_0078233 3300035111 Bacteria 1431
777 Ga0373923_0403385 3300035111 Bacteria 658
778 Ga0373945_0196239 3300035116 Bacteria 836
779 Ga0373953_0392920 3300035117 Unclassified 610
780 Ga0373954_0310448 3300035118 Unclassified 778
781 Ga0373956_0050296 3300035119 Bacteria 1871
782 Ga0373957_0002475 3300035120 Bacteria 5284
783 Ga0373957_0061884 3300035120 Bacteria 1452
784 Ga0373943_0001766 3300035170 Bacteria 9785
785 Ga0373943_0226182 3300035170 Bacteria 1044
786 Ga0373946_0148313 3300035171 Bacteria 1092
787 Ga0373955_0017602 3300035172 Bacteria 3540
788 Ga0373955_0080341 3300035172 Unclassified 1841
789 Ga0373955_0365746 3300035172 Bacteria 874
790 Ga0373962_0015765 3300035242 Bacteria 1942
791 Ga0373924_0061798 3300035410 Bacteria 1568
792 Ga0373931_0573099 3300035691 Bacteria 735
793 Ga0373935_0073152 3300035692 Bacteria 2214
794 Ga0373935_0196278 3300035692 Bacteria 1393
795 Ga0373935_0348944 3300035692 Bacteria 1055
796 Ga0373935_0864008 3300035692 Unclassified 669
797 Ga0373927_0719385 3300035695 Bacteria 660
798 Ga0373933_0013083 3300035724 Bacteria 4594
799 Ga0373933_0210974 3300035724 Bacteria 1244
800 Ga0373933_0320853 3300035724 Bacteria 1004
801 Ga0373947_0016792 3300035725 Bacteria 4206
802 Ga0373947_0561951 3300035725 Unclassified 777
803 Ga0373947_1007862 3300035725 Bacteria 568
804 Ga0373937_0000128 3300036401 Bacteria 73001
805 Ga0373937_0038684 3300036401 Bacteria 4347
806 Ga0373937_0380166 3300036401 Bacteria 1339
807 Ga0373937_0490443 3300036401 Bacteria 1167
808 Ga0373937_0659105 3300036401 Bacteria 992
809 Ga0373937_0736884 3300036401 Bacteria 933
810 Ga0373937_1240238 3300036401 Bacteria 694
811 Ga0373937_1412561 3300036401 Bacteria 644
812 Ga0373925_0102695 3300037068 Bacteria 2200
813 Ga0373925_0348076 3300037068 Bacteria 1203
814 Ga0373925_0639282 3300037068 Bacteria 877
815 Ga0395900_0242309 3300037418 Unclassified 1808
816 Ga0395898_0085889 3300037466 Unclassified 3033
817 Ga0395898_0215743 3300037466 Bacteria 1830
818 Ga0395898_0470717 3300037466 Unclassified 1196
819 Ga0395898_1971467 3300037466 Bacteria 503
820 Ga0436364_0070346 3300037853 Unclassified 1003
821 Ga0436364_0535317 3300037853 Unclassified 1869
822 Ga0395901_2006214 3300038443 Bacteria 525
823 Ga0436365_1510286 3300039437 Bacteria 1893
824 Ga0436365_1548667 3300039437 Bacteria 1476
825 Ga0436360_0002192 3300039438 Bacteria 2917
826 Ga0436361_0140635 3300039447 Bacteria 1214
827 Ga0436361_0187674 3300039447 Bacteria 6084
828 Ga0436361_0406737 3300039447 Unclassified 1199
829 Ga0436363_1004445 3300039450 Bacteria 787
830 Ga0436362_1130226 3300039453 Bacteria 780
831 Ga0451804_0927833 3300041463 Unclassified 642
832 Ga0439448_0099134 3300042005 Bacteria 989
833 Ga0439457_110910 3300042014 Bacteria 644
834 Ga0450898_045807 3300042134 Bacteria 836
835 Ga0450910_021168 3300042147 Unclassified 984
836 Ga0439444_0023254 3300042437 Unclassified 1111
837 Ga0466961_0046544 3300044693 Bacteria 2774
838 Ga0466963_0000875 3300044694 Bacteria 15265
839 Ga0466963_0013109 3300044694 Bacteria 5085
840 Ga0466963_0094757 3300044694 Bacteria 2037
841 Ga0466963_1169399 3300044694 Unclassified 541
842 Ga0466957_0813307 3300044842 Bacteria 664
843 Ga0466957_1070052 3300044842 Bacteria 581
844 Ga0466959_0636856 3300045049 Unclassified 716
845 Ga0451576_0663548 3300045051 Bacteria 1096
846 Ga0466958_0106011 3300045836 Bacteria 1752
847 Ga0466958_0188991 3300045836 Bacteria 1309
848 Ga0466958_0616003 3300045836 Bacteria 706
849 Ga0466967_0011480 3300045976 Bacteria 6713
850 Ga0466967_0026524 3300045976 Bacteria 4801
851 Ga0466967_0363195 3300045976 Bacteria 1403
852 Ga0466967_1216879 3300045976 Bacteria 750
853 Ga0466967_1276418 3300045976 Unclassified 731
854 Ga0466967_1333253 3300045976 Bacteria 715
855 Ga0466967_1779275 3300045976 Bacteria 613
856 Ga0495592_0437696 3300046454 Bacteria 822
857 Ga0495592_0696265 3300046454 Bacteria 612
858 Ga0495651_0014543 3300046462 Bacteria 6085
859 Ga0495651_0203781 3300046462 Unclassified 1382
860 Ga0495580_0007919 3300046472 Bacteria 8499
861 Ga0495580_0140239 3300046472 Bacteria 1676
862 Ga0495580_0527700 3300046472 Unclassified 786
863 Ga0495582_0121512 3300046473 Bacteria 1472
864 Ga0495639_0293504 3300046475 Unclassified 810
865 Ga0495639_0731891 3300046475 Bacteria 512
866 Ga0495662_0038863 3300046476 Bacteria 2299
867 Ga0495662_0441551 3300046476 Bacteria 639
868 Ga0495664_0111147 3300046477 Bacteria 1654
869 Ga0495664_0156465 3300046477 Bacteria 1383
870 Ga0495664_0476989 3300046477 Bacteria 746
871 Ga0495583_0211198 3300046506 Bacteria 786
872 Ga0495608_0906505 3300046511 Unclassified 516
873 Ga0495618_0461267 3300046514 Bacteria 770
874 Ga0495628_0111608 3300046516 Unclassified 2102
875 Ga0495628_0189925 3300046516 Bacteria 1551
876 Ga0495630_0836674 3300046517 Bacteria 702
877 Ga0495630_1120294 3300046517 Bacteria 596
878 Ga0495632_0077348 3300046519 Bacteria 1591
879 Ga0495643_0433222 3300046522 Bacteria 575
880 Ga0495644_0107635 3300046523 Bacteria 1057
881 Ga0495666_0238273 3300046526 Bacteria 831
882 Ga0495642_0094834 3300046528 Bacteria 1266
883 Ga0495642_0244331 3300046528 Bacteria 785
884 Ga0495652_0132405 3300046529 Bacteria 1972
885 Ga0495652_0222440 3300046529 Unclassified 1418
886 Ga0495652_0429922 3300046529 Bacteria 929
887 Ga0495665_0228283 3300046531 Bacteria 962
888 Ga0495665_0269507 3300046531 Unclassified 875
889 Ga0495665_0308116 3300046531 Bacteria 810
890 Ga0495665_0365725 3300046531 Bacteria 734
891 Ga0495640_0134369 3300046533 Bacteria 1599
892 Ga0495587_0013184 3300046536 Bacteria 5198
893 Ga0495587_0152782 3300046536 Bacteria 1316
894 Ga0495587_0178516 3300046536 Bacteria 1205
895 Ga0495587_0186875 3300046536 Unclassified 1174
896 Ga0495621_0001440 3300046539 Bacteria 6160
897 Ga0495645_0007238 3300046543 Bacteria 7723
898 Ga0495645_0072644 3300046543 Unclassified 2479
899 Ga0495645_0096774 3300046543 Bacteria 2103
900 Ga0495645_0329025 3300046543 Bacteria 990
901 Ga0495645_0348118 3300046543 Unclassified 955
902 Ga0495645_0453740 3300046543 Bacteria 808
903 Ga0495622_0328423 3300046557 Unclassified 664
904 Ga0495667_0016197 3300046559 Bacteria 5036
905 Ga0495656_0237859 3300046615 Unclassified 916
906 Ga0495625_0013264 3300046660 Bacteria 6630
907 Ga0495625_0078240 3300046660 Bacteria 2309
908 Ga0495625_0182317 3300046660 Bacteria 1395
909 Ga0495635_0047508 3300046663 Bacteria 2960
910 Ga0495635_0432344 3300046663 Bacteria 872
911 Ga0495657_0256866 3300046675 Bacteria 1051
912 Ga0495657_0665732 3300046675 Bacteria 600
913 Ga0495599_0224628 3300046678 Bacteria 1148
914 Ga0495623_0033455 3300046679 Bacteria 3298
915 Ga0495623_0430243 3300046679 Bacteria 706
916 Ga0495623_0714883 3300046679 Bacteria 512
917 Ga0495647_0404051 3300046681 Unclassified 628
918 Ga0495658_0376940 3300046683 Unclassified 903
919 Ga0495658_1021613 3300046683 Bacteria 528
920 Ga0495669_0023858 3300046684 Bacteria 2665
921 Ga0495669_0410793 3300046684 Unclassified 656
922 Ga0495613_0141923 3300046689 Bacteria 1716
923 Ga0495613_0194136 3300046689 Bacteria 1434
924 Ga0495613_0422626 3300046689 Bacteria 907
925 Ga0495649_0051662 3300046694 Bacteria 2229
926 Ga0495581_0849511 3300047315 Bacteria 522
927 Ga0495604_0295119 3300047317 Bacteria 1090
928 Ga0495674_0095645 3300047319 Bacteria 2532
929 Ga0495674_0271743 3300047319 Unclassified 1390
930 Ga0495674_0488278 3300047319 Bacteria 986
931 Ga0495680_0260179 3300047322 Bacteria 1227
932 Ga0495680_0939060 3300047322 Unclassified 556
933 Ga0495684_0010939 3300047471 Bacteria 7015
934 Ga0495684_0087349 3300047471 Bacteria 2363
935 Ga0495684_0299208 3300047471 Bacteria 1156
936 Ga0495684_0776834 3300047471 Bacteria 628
937 Ga0495684_0821433 3300047471 Bacteria 605
938 Ga0495602_0064498 3300048088 Unclassified 3167
939 Ga0495602_0178557 3300048088 Bacteria 1640
940 Ga0495602_0197982 3300048088 Bacteria 1535
941 Ga0495602_0246388 3300048088 Bacteria 1334
942 Ga0495602_0406509 3300048088 Bacteria 970
943 Ga0495602_0657658 3300048088 Bacteria 715
944 Ga0496102_0456470 3300048905 Bacteria 1199
945 Ga0496102_1461873 3300048905 Unclassified 602
946 Ga0496104_0054117 3300048907 Bacteria 3793
947 Ga0496104_1129462 3300048907 Unclassified 687
948 Ga0496104_1221726 3300048907 Bacteria 655
949 Ga0496106_0727480 3300048909 Bacteria 790
950 Ga0496107_1311659 3300048910 Unclassified 518
951 Ga0496108_0059022 3300048911 Bacteria 3226
952 Ga0496109_0071771 3300048912 Bacteria 3180
953 Ga0496110_0902567 3300048913 Bacteria 790
954 Ga0496112_0010236 3300048915 Bacteria 8501
955 Ga0496112_0042857 3300048915 Bacteria 4429
956 Ga0496112_0230180 3300048915 Bacteria 1808
957 Ga0496112_0848066 3300048915 Bacteria 837
958 Ga0496113_0015241 3300048916 Bacteria 5276
959 Ga0496114_1244938 3300048917 Unclassified 631
960 Ga0496115_0046507 3300048918 Plasmid 3469
961 Ga0496115_0189957 3300048918 Unclassified 1697
962 Ga0496115_0261138 3300048918 Bacteria 1424
963 Ga0496115_0462612 3300048918 Bacteria 1023
964 Ga0496126_0003557 3300048929 Bacteria 19573
965 Ga0495682_0020421 3300049460 Bacteria 2487
966 Ga0495682_0096380 3300049460 Bacteria 1062
967 Ga0495682_0177594 3300049460 Bacteria 757
968 Ga0501031_0004907 3300049568 Bacteria 8692
969 Ga0501031_0184343 3300049568 Bacteria 1363
970 Ga0501031_0314796 3300049568 Bacteria 1014
971 Ga0501032_0001053 3300049569 Bacteria 22060
972 Ga0501032_0324618 3300049569 Bacteria 993
973 Ga0501033_0011227 3300049570 Bacteria 6859
974 Ga0501033_0515890 3300049570 Bacteria 826
975 Ga0501033_0546726 3300049570 Bacteria 798
976 Ga0501034_0007884 3300049571 Bacteria 11319
977 Ga0501036_0007012 3300049572 Bacteria 9173
978 Ga0501037_0009727 3300049573 Bacteria 7057
979 Ga0501038_0002358 3300049574 Bacteria 17603
980 Ga0501039_0031801 3300049575 Bacteria 4069
981 Ga0501039_0190301 3300049575 Unclassified 1614
982 Ga0501042_0162494 3300049578 Bacteria 1611
983 Ga0501043_0000445 3300049579 Bacteria 37181
984 Ga0501043_0733027 3300049579 Bacteria 720
985 Ga0501046_0000036 3300049580 Bacteria 159823
986 Ga0501047_0000401 3300049581 Bacteria 48785
987 Ga0501048_0538894 3300049582 Unclassified 837
988 Ga0501048_1103363 3300049582 Bacteria 571
989 Ga0501068_0552876 3300049584 Bacteria 748
990 Ga0501069_0619017 3300049585 Bacteria 650
991 Ga0501070_0108996 3300049586 Bacteria 2288
992 Ga0501071_0136913 3300049587 Unclassified 1822
993 Ga0501073_0036298 3300049589 Bacteria 3502
994 Ga0501073_1072865 3300049589 Bacteria 554
995 Ga0501074_0869555 3300049590 Bacteria 635
996 Ga0501075_1392700 3300049591 Bacteria 531
997 Ga0501076_0273277 3300049592 Bacteria 1384
998 Ga0501077_0295874 3300049593 Bacteria 1031
999 Ga0501209_085533 3300049656 Bacteria 913
1000 Ga0501216_151238 3300049660 Bacteria 552
1001 Ga0501217_177167 3300049661 Bacteria 652
1002 Ga0501080_0689457 3300049742 Bacteria 902
1003 Ga0501081_0956885 3300049743 Unclassified 646
1004 Ga0501083_0878987 3300049744 Unclassified 583
1005 Ga0501263_097533 3300049760 Bacteria 502
1006 Ga0501268_038471 3300049765 Bacteria 892
1007 Ga0501270_165014 3300049767 Bacteria 514
1008 Ga0501035_0037475 3300049822 Bacteria 4391
1009 Ga0501044_0106294 3300049823 Bacteria 2819
1010 Ga0501044_0107514 3300049823 Bacteria 2800
1011 Ga0501044_0474344 3300049823 Bacteria 1155
1012 Ga0501045_0338297 3300049824 Bacteria 1120
1013 nmdc:mga03683_62635_c1 3300050489 Bacteria 1576
1014 nmdc:mga00v17_424188_c1 3300050491 Unclassified 864
1015 nmdc:mga00v17_548755_c1 3300050491 Unclassified 747
1016 nmdc:mga0k408_23088_c1 3300050493 Unclassified 2219
1017 nmdc:mga05p37_12177_c1 3300050507 Bacteria 10270
1018 nmdc:mga05p37_1604076_c1 3300050507 Unclassified 641
1019 nmdc:mga05p37_1668157_c1 3300050507 Bacteria 623
1020 nmdc:mga05p37_362476_c1 3300050507 Bacteria 1703
1021 nmdc:mga05p37_485758_c1 3300050507 Bacteria 1421
1022 nmdc:mga05p37_972315_c1 3300050507 Bacteria 906
1023 nmdc:mga09592_14839_c1 3300050508 Bacteria 3885
1024 nmdc:mga0qj67_11613_c1 3300050509 Bacteria 6604
1025 nmdc:mga06r32_30750_c1 3300050510 Bacteria 5039
1026 nmdc:mga08y16_105683_c1 3300050511 Unclassified 2931
1027 nmdc:mga08y16_128892_c1 3300050511 Bacteria 2632
1028 nmdc:mga08y16_1444664_c1 3300050511 Unclassified 650
1029 nmdc:mga08y16_1736026_c1 3300050511 Bacteria 579
1030 nmdc:mga08y16_225902_c1 3300050511 Unclassified 1937
1031 nmdc:mga08y16_280977_c1 3300050511 Bacteria 1717
1032 nmdc:mga08y16_319318_c1 3300050511 Unclassified 1599
1033 nmdc:mga08y16_6711_c1 3300050511 Bacteria 8193
1034 nmdc:mga08y16_69785_c1 3300050511 Unclassified 3663
1035 nmdc:mga08y16_740277_c1 3300050511 Bacteria 980
1036 nmdc:mga0n895_1589850_c1 3300050512 Bacteria 618
1037 nmdc:mga0n895_1676672_c1 3300050512 Unclassified 599
1038 nmdc:mga0n895_278644_c1 3300050512 Unclassified 1696
1039 nmdc:mga0n895_403705_c1 3300050512 Bacteria 1382
1040 nmdc:mga0n895_6_c1 3300050512 Bacteria 122829
1041 nmdc:mga0n895_946177_c1 3300050512 Unclassified 845
1042 nmdc:mga0rr50_7_c1 3300050513 Bacteria 297175
1043 nmdc:mga08x19_19330_c1 3300050514 Bacteria 4179
1044 nmdc:mga08x19_497501_c2 3300050514 Unclassified 566
1045 nmdc:mga08x19_769705_c1 3300050514 Unclassified 684
1046 nmdc:mga0sz30_240149_c1 3300050516 Unclassified 806
1047 Ga0495601_0068385 3300053077 Bacteria 2264
1048 Ga0495619_0160201 3300053085 Bacteria 1554
1049 Ga0500644_0010547 3300053088 Bacteria 2503
1050 Ga0500595_068531 3300053119 Bacteria 1056
1051 Ga0500573_0389849 3300053140 Bacteria 663
1052 Ga0501084_0051231 3300054114 Unclassified 3455
1053 Ga0501084_1119007 3300054114 Unclassified 661
1054 Ga0590074_076958 3300059423 Unclassified 634
1055 Ga0501082_0426066 3300060353 Bacteria 1159
1056 2884218423 2884215851 Bacteria 4554841
1057 Ga0070713_100377536
1058 LJQas_1018996
1059 JGI24743J22301_10035696
1060 rootH2_10018443
1061 rootH2_10164600
1062 Ga0065712_10007270
1063 Ga0065712_10371216
1064 Ga0065707_10021146
1065 Ga0070658_10013361
1066 Ga0070658_10034110
1067 Ga0070658_10329417
1068 Ga0070658_10493593
1069 Ga0070676_10089547
1070 Ga0070676_11537669
1071 Ga0070683_100002722
1072 Ga0070683_100028428
1073 Ga0070683_100046668
1074 Ga0070683_100223184
1075 Ga0070683_100521440
1076 Ga0070683_101963630
1077 Ga0070690_100215992
1078 Ga0070690_101676153
1079 Ga0070670_100004622
1080 Ga0070670_100064316
1081 Ga0070670_101836986
1082 Ga0070677_10212651
1083 Ga0068869_100001480
1084 Ga0068869_100053182
1085 Ga0070666_10250285
1086 Ga0070666_10771240
1087 Ga0070666_10785031
1088 Ga0070666_11007165
1089 Ga0070680_100023336
1090 Ga0070680_100675101
1091 Ga0070680_100747392
1092 Ga0070680_101200611
1093 Ga0068868_100001675
1094 Ga0068868_100001769
1095 Ga0068868_100014180
1096 Ga0068868_100159395
1097 Ga0068868_101256856
1098 Ga0070660_100999219
1099 Ga0070689_100045833
1100 Ga0070689_100078169
1101 Ga0070689_100985056
1102 Ga0070691_10706992
1103 Ga0070661_100084771
1104 Ga0070661_100112213
1105 Ga0070661_100862649
1106 Ga0070692_11206343
1107 Ga0070668_100039692
1108 Ga0070668_100434834
1109 Ga0070669_100133379
1110 Ga0070669_100146696
1111 Ga0070675_100031843
1112 Ga0070675_100145745
1113 Ga0070675_100439117
1114 Ga0070675_102214286
1115 Ga0070671_100004037
1116 Ga0070671_100041323
1117 Ga0070671_100084330
1118 Ga0070671_101932863
1119 Ga0070674_100309144
1120 Ga0070674_101759886
1121 Ga0070673_100013898
1122 Ga0070673_101470166
1123 Ga0070673_101649091
1124 Ga0070688_100276814
1125 Ga0070688_100351228
1126 Ga0070659_100094319
1127 Ga0070659_100650213
1128 Ga0070667_100003404
1129 Ga0070667_100032935
1130 Ga0070667_100235046
1131 Ga0070703_10022023
1132 Ga0070709_10012929
1133 Ga0070709_10063972
1134 Ga0070709_10069335
1135 Ga0070709_10072151
1136 Ga0070714_100236264
1137 Ga0070714_100597241
1138 Ga0070714_100656646
1139 Ga0070713_100000756
1140 Ga0070713_100007628
1141 Ga0070713_100160209
1142 Ga0070713_100188167
1143 Ga0070713_100382572
1144 Ga0070713_100568576
1145 Ga0070713_101849202
1146 Ga0070711_100043800
1147 Ga0070711_100116244
1148 Ga0070711_100364321
1149 Ga0070711_100409667
1150 Ga0070711_100809621
1151 Ga0070705_100007139
1152 Ga0070705_101030184
1153 Ga0070705_101060988
1154 Ga0070700_100304787
1155 Ga0070700_101045719
1156 Ga0070694_100088360
1157 Ga0070694_100947451
1158 Ga0070694_101652594
1159 Ga0070694_101758979
1160 Ga0070708_100004621
1161 Ga0070708_100152966
1162 Ga0070663_100133997
1163 Ga0070663_100758890
1164 Ga0070678_100045286
1165 Ga0070678_101977698
1166 Ga0070662_100052745
1167 Ga0070662_100078765
1168 Ga0070662_100770073
1169 Ga0070681_10010160
1170 Ga0070681_10109907
1171 Ga0070681_10162448
1172 Ga0070681_10632189
1173 Ga0068867_100567600
1174 Ga0068867_100761770
1175 Ga0068867_100942927
1176 Ga0070706_100031675
1177 Ga0070707_100005736
1178 Ga0070707_100117531
1179 Ga0070707_100414082
1180 Ga0070707_101195532
1181 Ga0070698_101153254
1182 Ga0070698_101949936
1183 Ga0070699_100059693
1184 Ga0070699_100072400
1185 Ga0070699_100827946
1186 Ga0070679_100017259
1187 Ga0070679_100065368
1188 Ga0070679_100805967
1189 Ga0070684_100040309
1190 Ga0070684_100046206
1191 Ga0070684_100046822
1192 Ga0070684_100129028
1193 Ga0070684_100179986
1194 Ga0070684_100231747
1195 Ga0070684_100325499
1196 Ga0070684_100611092
1197 Ga0070684_101378560
1198 Ga0070697_100001864
1199 Ga0070697_100478920
1200 Ga0070697_100762635
1201 Ga0070697_100774113
1202 Ga0070697_101516496
1203 Ga0068853_100000760
1204 Ga0068853_100153545
1205 Ga0068853_100161770
1206 Ga0068853_100218878
1207 Ga0068853_100319680
1208 Ga0068853_101140774
1209 Ga0068853_102397451
1210 Ga0070672_102043035
1211 Ga0070695_100037111
1212 Ga0070695_100125661
1213 Ga0070695_100290222
1214 Ga0070695_100501560
1215 Ga0070695_100969353
1216 Ga0070695_101107666
1217 Ga0070695_101284788
1218 Ga0070696_100000282
1219 Ga0070696_100146959
1220 Ga0070696_100393317
1221 Ga0070696_100548418
1222 Ga0070693_100004320
1223 Ga0070693_100701231
1224 Ga0070665_100025124
1225 Ga0070665_100027471
1226 Ga0070665_100044342
1227 Ga0070665_100054299
1228 Ga0070665_100069455
1229 Ga0070665_100248617
1230 Ga0070665_100359191
1231 Ga0070665_100692401
1232 Ga0070665_100935778
1233 Ga0070665_101124341
1234 Ga0070665_101873584
1235 Ga0070704_100005557
1236 Ga0068855_100000250
1237 Ga0068855_100020057
1238 Ga0068855_100052552
1239 Ga0068855_100077582
1240 Ga0068855_100164099
1241 Ga0068855_100641259
1242 Ga0068855_100675242
1243 Ga0068855_101119833
1244 Ga0068855_101154822
1245 Ga0070664_100019731
1246 Ga0070664_100655781
1247 Ga0070664_100880020
1248 Ga0068857_100041105
1249 Ga0068857_100053622
1250 Ga0068857_100159589
1251 Ga0068857_100195079
1252 Ga0068857_100255276
1253 Ga0068854_100010270
1254 Ga0068854_100047267
1255 Ga0068854_100251616
1256 Ga0068854_100763319
1257 Ga0068854_101301322
1258 Ga0068854_101422303
1259 Ga0068856_100001514
1260 Ga0068856_100003761
1261 Ga0068856_100004698
1262 Ga0068856_100018860
1263 Ga0068856_100136386
1264 Ga0068856_101112771
1265 Ga0068856_101164511
1266 Ga0068856_102030820
1267 Ga0068856_102209015
1268 Ga0070702_100323072
1269 Ga0070702_100706783
1270 Ga0070702_100850092
1271 Ga0068852_100000010
1272 Ga0068852_100063281
1273 Ga0068852_100299085
1274 Ga0068852_100571088
1275 Ga0068852_100953578
1276 Ga0068852_101372951
1277 Ga0068852_101391669
1278 Ga0068859_100008728
1279 Ga0068859_100009619
1280 Ga0068859_100022156
1281 Ga0068859_100768910
1282 Ga0068864_100012964
1283 Ga0068864_100271584
1284 Ga0068864_100455085
1285 Ga0068866_10002504
1286 Ga0068866_10061922
1287 Ga0068861_100142433
1288 Ga0068861_101829444
1289 Ga0068851_10003306
1290 Ga0068851_10006982
1291 Ga0068851_10139925
1292 Ga0068851_10250147
1293 Ga0068870_11193060
1294 Ga0068863_100004433
1295 Ga0068863_100241060
1296 Ga0068858_100000894
1297 Ga0068858_101144752
1298 Ga0068860_100004498
1299 Ga0068860_100092571
1300 Ga0068862_100203978
1301 Ga0068862_101479326
1302 Ga0068862_102248628
1303 Ga0070717_10440085
1304 Ga0075363_100180006
1305 Ga0075364_10359278
1306 Ga0075364_10471384
1307 Ga0075364_10726741
1308 Ga0075432_10503628
1309 Ga0070715_10135189
1310 Ga0070716_100088016
1311 Ga0070716_100131713
1312 Ga0070716_100223321
1313 Ga0070716_100787292
1314 Ga0070712_100011062
1315 Ga0070712_100016643
1316 Ga0070712_100054195
1317 Ga0070712_100085628
1318 Ga0070712_100232192
1319 Ga0070712_100319122
1320 Ga0070712_100645417
1321 Ga0075362_10007621
1322 Ga0075369_10167346
1323 Ga0075369_10260322
1324 Ga0097621_100000411
1325 Ga0097621_100009117
1326 Ga0097621_100015840
1327 Ga0097621_100035335
1328 Ga0097621_100065695
1329 Ga0097621_100198415
1330 Ga0097621_100789512
1331 Ga0068871_100002096
1332 Ga0068871_100771748
1333 Ga0068871_100917908
1334 Ga0068871_101192428
1335 Ga0068871_101297241
1336 Ga0075428_100034181
1337 Ga0075430_100012143
1338 Ga0075431_100004580
1339 Ga0075434_100059402
1340 Ga0075434_100119188
1341 Ga0075434_100619405
1342 Ga0075434_101307561
1343 Ga0075429_100660262
1344 Ga0068865_100001072
1345 Ga0068865_100048605
1346 Ga0068865_100994120
1347 Ga0075436_100025051
1348 Ga0075436_100116732
1349 Ga0075436_100513652
1350 Ga0075436_101568897
1351 Ga0097620_100008728
1352 Ga0097620_100009619
1353 Ga0097620_100022156
1354 Ga0097620_100768943
1355 Ga0075435_100000004
1356 Ga0075435_100172831
1357 Ga0099794_10467196
1358 Ga0099795_10450023
1359 Ga0099795_10460515
1360 Ga0105240_10000436
1361 Ga0105240_10004419
1362 Ga0105240_10012860
1363 Ga0105240_10025261
1364 Ga0105240_10032915
1365 Ga0105240_10036335
1366 Ga0105240_10050394
1367 Ga0105240_10148818
1368 Ga0105240_10177697
1369 Ga0105240_10251974
1370 Ga0105240_10565848
1371 Ga0105240_10637903
1372 Ga0105240_10899611
1373 Ga0105240_12067885
1374 Ga0105240_12686900
1375 Ga0111539_10016191
1376 Ga0111539_10042739
1377 Ga0111539_10051147
1378 Ga0111539_10078267
1379 Ga0111539_10106356
1380 Ga0111539_10233728
1381 Ga0111539_11189478
1382 Ga0111539_11518405
1383 Ga0111539_11550779
1384 Ga0111539_11700006
1385 Ga0111539_11957415
1386 Ga0105245_10007833
1387 Ga0105245_10022166
1388 Ga0105245_10045873
1389 Ga0105245_10074593
1390 Ga0105245_10172165
1391 Ga0105245_10299050
1392 Ga0105245_10468538
1393 Ga0105245_10776598
1394 Ga0105245_11334215
1395 Ga0105247_10001551
1396 Ga0105247_10008463
1397 Ga0105247_10194451
1398 Ga0105247_10206434
1399 Ga0114129_10067192
1400 Ga0114129_10161994
1401 Ga0114129_10635297
1402 Ga0114129_10718018
1403 Ga0114129_10965531
1404 Ga0114129_11632626
1405 Ga0105243_11889903
1406 Ga0105241_10000014
1407 Ga0105241_10000642
1408 Ga0105241_10005710
1409 Ga0105241_10026292
1410 Ga0105241_10047426
1411 Ga0105241_10064208
1412 Ga0105241_10128230
1413 Ga0105241_10295443
1414 Ga0105241_10295952
1415 Ga0105241_10529791
1416 Ga0105241_10831222
1417 Ga0105241_11903163
1418 Ga0105241_12466687
1419 Ga0105241_12559573
1420 Ga0105242_10006845
1421 Ga0105242_10010294
1422 Ga0105242_10038242
1423 Ga0105242_10331236
1424 Ga0105242_10391417
1425 Ga0105242_10868325
1426 Ga0105242_10877911
1427 Ga0105242_11359242
1428 Ga0105242_11783419
1429 Ga0105248_10014503
1430 Ga0105248_10017033
1431 Ga0105248_10018467
1432 Ga0105248_10028300
1433 Ga0105248_10041781
1434 Ga0105248_10073528
1435 Ga0105248_10081486
1436 Ga0105248_10087727
1437 Ga0105248_10129882
1438 Ga0105248_10234077
1439 Ga0105248_10245244
1440 Ga0105248_10509076
1441 Ga0105248_12593364
1442 Ga0105237_10007844
1443 Ga0105237_10007965
1444 Ga0105237_10019667
1445 Ga0105237_10025505
1446 Ga0105237_10053597
1447 Ga0105237_10269959
1448 Ga0105237_10464862
1449 Ga0105237_10486393
1450 Ga0105237_11687675
1451 Ga0105238_10001147
1452 Ga0105238_10002103
1453 Ga0105238_10011589
1454 Ga0105238_10043336
1455 Ga0105238_10311521
1456 Ga0105238_10349571
1457 Ga0105238_10613019
1458 Ga0105238_10713832
1459 Ga0105249_10027336
1460 Ga0105249_10342541
1461 Ga0105249_11354639
1462 Ga0105249_12947136
1463 Ga0099796_10536976
1464 Ga0105239_10003382
1465 Ga0105239_10045292
1466 Ga0105239_10068734
1467 Ga0105239_10085886
1468 Ga0105239_10103031
1469 Ga0105239_10236022
1470 Ga0105239_10301600
1471 Ga0105239_10305439
1472 Ga0105239_10819512
1473 Ga0105239_10977005
1474 Ga0105239_11556606
1475 Ga0105239_11855527
1476 Ga0105239_12274845
1477 Ga0105239_13048659
1478 Ga0105246_10000506
1479 Ga0105246_10109102
1480 Ga0105246_10974744
1481 Ga0157373_10256009
1482 Ga0157373_10336648
1483 Ga0157373_10954217
1484 Ga0157373_11306102
1485 Ga0157373_11360099
1486 Ga0157371_10105899
1487 Ga0157371_10137857
1488 Ga0157370_10000005
1489 Ga0157370_10106232
1490 Ga0157369_10000049
1491 Ga0157369_10006463
1492 Ga0157369_10008092
1493 Ga0157369_10013495
1494 Ga0157369_10017952
1495 Ga0157369_10060862
1496 Ga0157369_10073446
1497 Ga0157369_10104562
1498 Ga0157369_10209593
1499 Ga0157369_10210467
1500 Ga0157369_10237764
1501 Ga0157369_10537074
1502 Ga0157369_10883681
1503 Ga0157369_11554529
1504 Ga0157374_10025354
1505 Ga0157374_10083752
1506 Ga0157374_10157517
1507 Ga0157374_10193138
1508 Ga0157374_10250360
1509 Ga0157374_11025517
1510 Ga0157374_11206303
1511 Ga0157374_11513155
1512 Ga0157378_10004806
1513 Ga0157378_10009528
1514 Ga0157378_10026122
1515 Ga0157378_10055476
1516 Ga0157378_10154791
1517 Ga0157378_10272551
1518 Ga0157378_10639700
1519 Ga0163162_10788057
1520 Ga0163162_11075292
1521 Ga0157372_10000047
1522 Ga0157372_10006634
1523 Ga0157372_10011629
1524 Ga0157372_10017955
1525 Ga0157372_10068757
1526 Ga0157372_10110844
1527 Ga0157372_10192210
1528 Ga0157372_10196288
1529 Ga0157372_10264704
1530 Ga0157372_11227389
1531 Ga0157372_11363379
1532 Ga0157375_10004406
1533 Ga0157375_10035664
1534 Ga0157375_10084450
1535 Ga0157375_10489164
1536 Ga0157375_11227167
1537 Ga0163163_10001403
1538 Ga0163163_10068653
1539 Ga0163163_10112559
1540 Ga0163163_10258020
1541 Ga0163163_10739423
1542 Ga0163163_11735681
1543 Ga0157380_10019586
1544 Ga0157380_10026942
1545 Ga0157380_10075251
1546 Ga0157380_10503630
1547 Ga0157380_10614379
1548 Ga0157380_11995570
1549 Ga0157380_12463362
1550 Ga0157379_10000404
1551 Ga0157379_10031031
1552 Ga0157379_10042708
1553 Ga0157379_10154427
1554 Ga0157379_11556752
1555 Ga0157379_11948584
1556 Ga0157376_10000652
1557 Ga0157376_10230925
1558 Ga0157376_10294783
1559 Ga0157376_10335447
1560 Ga0157376_11099192
1561 Ga0157376_11788892
1562 Ga0157376_12790479
1563 Ga0182005_1146378
1564 Ga0163161_10020772
1565 Ga0163161_11057728
1566 Ga0213875_10063176
1567 Ga0228598_1011828
1568 Ga0207656_10027863
1569 Ga0207656_10101589
1570 Ga0207656_10115706
1571 Ga0207656_10115995
1572 Ga0207653_10087475
1573 Ga0207653_10229852
1574 Ga0207642_10005676
1575 Ga0207710_10000869
1576 Ga0207710_10099065
1577 Ga0207710_10529802
1578 Ga0207688_10529688
1579 Ga0207680_10149836
1580 Ga0207680_10215581
1581 Ga0207680_10721107
1582 Ga0207647_10024516
1583 Ga0207647_10026139
1584 Ga0207685_10024287
1585 Ga0207685_10086249
1586 Ga0207699_10020265
1587 Ga0207699_10116693
1588 Ga0207699_10342529
1589 Ga0207645_10037493
1590 Ga0207645_10318167
1591 Ga0207705_10077458
1592 Ga0207705_10242598
1593 Ga0207705_10342464
1594 Ga0207705_10807248
1595 Ga0207684_10026923
1596 Ga0207654_10001162
1597 Ga0207654_10073895
1598 Ga0207654_10202996
1599 Ga0207654_10354128
1600 Ga0207654_10626404
1601 Ga0207707_10034688
1602 Ga0207707_10091889
1603 Ga0207707_10269563
1604 Ga0207707_10349962
1605 Ga0207707_10518131
1606 Ga0207695_10000137
1607 Ga0207695_10000507
1608 Ga0207695_10000977
1609 Ga0207695_10010221
1610 Ga0207695_10071410
1611 Ga0207695_10181029
1612 Ga0207695_10590627
1613 Ga0207695_11248471
1614 Ga0207695_11380941
1615 Ga0207671_10000715
1616 Ga0207671_10018855
1617 Ga0207671_10131047
1618 Ga0207671_10274026
1619 Ga0207671_10284223
1620 Ga0207671_10521365
1621 Ga0207693_10019524
1622 Ga0207693_10030149
1623 Ga0207693_10062742
1624 Ga0207693_10232893
1625 Ga0207693_10297967
1626 Ga0207693_10536621
1627 Ga0207693_10750347
1628 Ga0207663_10044163
1629 Ga0207663_10117955
1630 Ga0207663_10359508
1631 Ga0207663_10781252
1632 Ga0207663_11733765
1633 Ga0207660_10017429
1634 Ga0207660_10600428
1635 Ga0207660_10654522
1636 Ga0207660_11156870
1637 Ga0207662_10138679
1638 Ga0207657_10604815
1639 Ga0207649_10108589
1640 Ga0207649_10263870
1641 Ga0207649_10474467
1642 Ga0207649_10805609
1643 Ga0207652_10010717
1644 Ga0207652_10824770
1645 Ga0207646_10000274
1646 Ga0207646_10124793
1647 Ga0207646_11270205
1648 Ga0207681_10067441
1649 Ga0207681_10142669
1650 Ga0207681_10279623
1651 Ga0207681_10542913
1652 Ga0207694_10000489
1653 Ga0207694_10001113
1654 Ga0207694_10058812
1655 Ga0207694_10397932
1656 Ga0207694_10706995
1657 Ga0207650_10027803
1658 Ga0207650_11423400
1659 Ga0207659_10071458
1660 Ga0207659_10355874
1661 Ga0207687_10005043
1662 Ga0207687_10030962
1663 Ga0207687_10305447
1664 Ga0207687_10480375
1665 Ga0207700_10022606
1666 Ga0207700_10347729
1667 Ga0207700_10435179
1668 Ga0207700_10609600
1669 Ga0207700_11237745
1670 Ga0207700_11589087
1671 Ga0207664_10293073
1672 Ga0207664_10353376
1673 Ga0207664_10460067
1674 Ga0207664_10503319
1675 Ga0207664_10633943
1676 Ga0207644_10005460
1677 Ga0207644_10114322
1678 Ga0207644_10242016
1679 Ga0207690_10042768
1680 Ga0207690_10049097
1681 Ga0207706_10021398
1682 Ga0207706_10216158
1683 Ga0207686_10251662
1684 Ga0207686_10940930
1685 Ga0207670_10024415
1686 Ga0207670_11792564
1687 Ga0207669_10056819
1688 Ga0207704_10014768
1689 Ga0207704_10055232
1690 Ga0207665_10007240
1691 Ga0207665_10029176
1692 Ga0207665_10264480
1693 Ga0207665_10658681
1694 Ga0207665_10821320
1695 Ga0207665_10870883
1696 Ga0207691_10756684
1697 Ga0207711_10000013
1698 Ga0207711_10004831
1699 Ga0207711_10011288
1700 Ga0207711_10075652
1701 Ga0207711_10127868
1702 Ga0207711_10139883
1703 Ga0207711_10243888
1704 Ga0207711_10793284
1705 Ga0207711_11630623
1706 Ga0207689_10005697
1707 Ga0207689_10041297
1708 Ga0207661_10000798
1709 Ga0207661_10041920
1710 Ga0207661_10117610
1711 Ga0207661_10134645
1712 Ga0207661_10484172
1713 Ga0207661_10643845
1714 Ga0207661_11140228
1715 Ga0207679_10006047
1716 Ga0207679_11216993
1717 Ga0207679_11832945
1718 Ga0207667_10000949
1719 Ga0207667_10018161
1720 Ga0207667_10018186
1721 Ga0207667_10934724
1722 Ga0207667_11860129
1723 Ga0207667_12159665
1724 Ga0207651_10255046
1725 Ga0207651_10791363
1726 Ga0207712_10558982
1727 Ga0207712_11453660
1728 Ga0207668_10318246
1729 Ga0207668_10387326
1730 Ga0207640_10009374
1731 Ga0207640_10879917
1732 Ga0207640_10929768
1733 Ga0207640_10989176
1734 Ga0207658_10001464
1735 Ga0207658_10147840
1736 Ga0207677_10000778
1737 Ga0207677_10118110
1738 Ga0207677_10505136
1739 Ga0207703_10001909
1740 Ga0207703_10011249
1741 Ga0207703_10976433
1742 Ga0207639_10009769
1743 Ga0207639_10035702
1744 Ga0207639_10123026
1745 Ga0207639_10163037
1746 Ga0207639_10754385
1747 Ga0207678_10209812
1748 Ga0207678_10351868
1749 Ga0207708_10059743
1750 Ga0207708_10326206
1751 Ga0207708_10786606
1752 Ga0207702_10000993
1753 Ga0207702_10010856
1754 Ga0207702_10047430
1755 Ga0207702_10053630
1756 Ga0207702_10130688
1757 Ga0207702_10695650
1758 Ga0207702_11038180
1759 Ga0207702_12122749
1760 Ga0207641_10005473
1761 Ga0207641_10208489
1762 Ga0207641_12460237
1763 Ga0207641_12536709
1764 Ga0207648_10053848
1765 Ga0207648_10262782
1766 Ga0207648_10426940
1767 Ga0207648_10673594
1768 Ga0207648_11620935
1769 Ga0207676_10008589
1770 Ga0207676_10017059
1771 Ga0207676_10436942
1772 Ga0207676_10549555
1773 Ga0207676_11102017
1774 Ga0207674_10006657
1775 Ga0207674_10013263
1776 Ga0207674_10064133
1777 Ga0207674_10071193
1778 Ga0207674_10077229
1779 Ga0207674_10102867
1780 Ga0207674_10112268
1781 Ga0207675_101191715
1782 Ga0207698_10000003
1783 Ga0207698_10333792
1784 Ga0207698_10914499
1785 Ga0207698_11044170
1786 Ga0207698_12463396
1787 Ga0207428_10005795
1788 Ga0207428_10087962
1789 Ga0207428_10121757
1790 Ga0207428_10216907
1791 Ga0207428_10409387
1792 Ga0265354_1000083
1793 Ga0265354_1001617
1794 Ga0265357_1004030
1795 Ga0268266_10009093
1796 Ga0268266_10016382
1797 Ga0268266_10016622
1798 Ga0268266_10018097
1799 Ga0268266_10173735
1800 Ga0268266_10275155
1801 Ga0268266_11172728
1802 Ga0268266_12339006
1803 Ga0268265_10968660
1804 Ga0268265_11304118
1805 Ga0268264_10003955
1806 Ga0268264_10455431
1807 Ga0268264_10653453
1808 Ga0268264_12150693
1809 Ga0265318_10113568
1810 Ga0265338_10000633
1811 Ga0265338_11018929
1812 Ga0265338_11104122
1813 Ga0265316_10003465
1814 Ga0265316_10054004
1815 Ga0265316_10910816
1816 Ga0307408_100292809
1817 Ga0265342_10230523
1818 Ga0307413_10248456
1819 Ga0307412_10379672
1820 Ga0307409_100060772
1821 Ga0307416_100139569
1822 Ga0307416_100210889
1823 Ga0307411_11243477
1824 Ga0307415_102591393
1825 Ga0307510_10035621
1826 Ga0307510_10055224
1827 Ga0316212_1003127
1828 Ga0373926_0433779
1829 Ga0373934_0003047
1830 Ga0373934_0339498
1831 Ga0373944_0053675
1832 Ga0373923_0078233
1833 Ga0373923_0403385
1834 Ga0373945_0196239
1835 Ga0373953_0392920
1836 Ga0373954_0310448
1837 Ga0373956_0050296
1838 Ga0373957_0002475
1839 Ga0373957_0061884
1840 Ga0373943_0001766
1841 Ga0373943_0226182
1842 Ga0373946_0148313
1843 Ga0373955_0017602
1844 Ga0373955_0080341
1845 Ga0373955_0365746
1846 Ga0373962_0015765
1847 Ga0373924_0061798
1848 Ga0373931_0573099
1849 Ga0373935_0073152
1850 Ga0373935_0196278
1851 Ga0373935_0348944
1852 Ga0373935_0864008
1853 Ga0373927_0719385
1854 Ga0373933_0013083
1855 Ga0373933_0210974
1856 Ga0373933_0320853
1857 Ga0373947_0016792
1858 Ga0373947_0561951
1859 Ga0373947_1007862
1860 Ga0373937_0000128
1861 Ga0373937_0038684
1862 Ga0373937_0380166
1863 Ga0373937_0490443
1864 Ga0373937_0659105
1865 Ga0373937_0736884
1866 Ga0373937_1240238
1867 Ga0373937_1412561
1868 Ga0373925_0102695
1869 Ga0373925_0348076
1870 Ga0373925_0639282
1871 Ga0395900_0242309
1872 Ga0395898_0085889
1873 Ga0395898_0215743
1874 Ga0395898_0470717
1875 Ga0395898_1971467
1876 Ga0436364_0070346
1877 Ga0436364_0535317
1878 Ga0395901_2006214
1879 Ga0436365_1510286
1880 Ga0436365_1548667
1881 Ga0436360_0002192
1882 Ga0436361_0140635
1883 Ga0436361_0187674
1884 Ga0436361_0406737
1885 Ga0436363_1004445
1886 Ga0436362_1130226
1887 Ga0451804_0927833
1888 Ga0439448_0099134
1889 Ga0439457_110910
1890 Ga0450898_045807
1891 Ga0450910_021168
1892 Ga0439444_0023254
1893 Ga0466961_0046544
1894 Ga0466963_0000875
1895 Ga0466963_0013109
1896 Ga0466963_0094757
1897 Ga0466963_1169399
1898 Ga0466957_0813307
1899 Ga0466957_1070052
1900 Ga0466959_0636856
1901 Ga0451576_0663548
1902 Ga0466958_0106011
1903 Ga0466958_0188991
1904 Ga0466958_0616003
1905 Ga0466967_0011480
1906 Ga0466967_0026524
1907 Ga0466967_0363195
1908 Ga0466967_1216879
1909 Ga0466967_1276418
1910 Ga0466967_1333253
1911 Ga0466967_1779275
1912 Ga0495592_0437696
1913 Ga0495592_0696265
1914 Ga0495651_0014543
1915 Ga0495651_0203781
1916 Ga0495580_0007919
1917 Ga0495580_0140239
1918 Ga0495580_0527700
1919 Ga0495582_0121512
1920 Ga0495639_0293504
1921 Ga0495639_0731891
1922 Ga0495662_0038863
1923 Ga0495662_0441551
1924 Ga0495664_0111147
1925 Ga0495664_0156465
1926 Ga0495664_0476989
1927 Ga0495583_0211198
1928 Ga0495608_0906505
1929 Ga0495618_0461267
1930 Ga0495628_0111608
1931 Ga0495628_0189925
1932 Ga0495630_0836674
1933 Ga0495630_1120294
1934 Ga0495632_0077348
1935 Ga0495643_0433222
1936 Ga0495644_0107635
1937 Ga0495666_0238273
1938 Ga0495642_0094834
1939 Ga0495642_0244331
1940 Ga0495652_0132405
1941 Ga0495652_0222440
1942 Ga0495652_0429922
1943 Ga0495665_0228283
1944 Ga0495665_0269507
1945 Ga0495665_0308116
1946 Ga0495665_0365725
1947 Ga0495640_0134369
1948 Ga0495587_0013184
1949 Ga0495587_0152782
1950 Ga0495587_0178516
1951 Ga0495587_0186875
1952 Ga0495621_0001440
1953 Ga0495645_0007238
1954 Ga0495645_0072644
1955 Ga0495645_0096774
1956 Ga0495645_0329025
1957 Ga0495645_0348118
1958 Ga0495645_0453740
1959 Ga0495622_0328423
1960 Ga0495667_0016197
1961 Ga0495656_0237859
1962 Ga0495625_0013264
1963 Ga0495625_0078240
1964 Ga0495625_0182317
1965 Ga0495635_0047508
1966 Ga0495635_0432344
1967 Ga0495657_0256866
1968 Ga0495657_0665732
1969 Ga0495599_0224628
1970 Ga0495623_0033455
1971 Ga0495623_0430243
1972 Ga0495623_0714883
1973 Ga0495647_0404051
1974 Ga0495658_0376940
1975 Ga0495658_1021613
1976 Ga0495669_0023858
1977 Ga0495669_0410793
1978 Ga0495613_0141923
1979 Ga0495613_0194136
1980 Ga0495613_0422626
1981 Ga0495649_0051662
1982 Ga0495581_0849511
1983 Ga0495604_0295119
1984 Ga0495674_0095645
1985 Ga0495674_0271743
1986 Ga0495674_0488278
1987 Ga0495680_0260179
1988 Ga0495680_0939060
1989 Ga0495684_0010939
1990 Ga0495684_0087349
1991 Ga0495684_0299208
1992 Ga0495684_0776834
1993 Ga0495684_0821433
1994 Ga0495602_0064498
1995 Ga0495602_0178557
1996 Ga0495602_0197982
1997 Ga0495602_0246388
1998 Ga0495602_0406509
1999 Ga0495602_0657658
2000 Ga0496102_0456470
2001 Ga0496102_1461873
2002 Ga0496104_0054117
2003 Ga0496104_1129462
2004 Ga0496104_1221726
2005 Ga0496106_0727480
2006 Ga0496107_1311659
2007 Ga0496108_0059022
2008 Ga0496109_0071771
2009 Ga0496110_0902567
2010 Ga0496112_0010236
2011 Ga0496112_0042857
2012 Ga0496112_0230180
2013 Ga0496112_0848066
2014 Ga0496113_0015241
2015 Ga0496114_1244938
2016 Ga0496115_0046507
2017 Ga0496115_0189957
2018 Ga0496115_0261138
2019 Ga0496115_0462612
2020 Ga0496126_0003557
2021 Ga0495682_0020421
2022 Ga0495682_0096380
2023 Ga0495682_0177594
2024 Ga0501031_0004907
2025 Ga0501031_0184343
2026 Ga0501031_0314796
2027 Ga0501032_0001053
2028 Ga0501032_0324618
2029 Ga0501033_0011227
2030 Ga0501033_0515890
2031 Ga0501033_0546726
2032 Ga0501034_0007884
2033 Ga0501036_0007012
2034 Ga0501037_0009727
2035 Ga0501038_0002358
2036 Ga0501039_0031801
2037 Ga0501039_0190301
2038 Ga0501042_0162494
2039 Ga0501043_0000445
2040 Ga0501043_0733027
2041 Ga0501046_0000036
2042 Ga0501047_0000401
2043 Ga0501048_0538894
2044 Ga0501048_1103363
2045 Ga0501068_0552876
2046 Ga0501069_0619017
2047 Ga0501070_0108996
2048 Ga0501071_0136913
2049 Ga0501073_0036298
2050 Ga0501073_1072865
2051 Ga0501074_0869555
2052 Ga0501075_1392700
2053 Ga0501076_0273277
2054 Ga0501077_0295874
2055 Ga0501209_085533
2056 Ga0501216_151238
2057 Ga0501217_177167
2058 Ga0501080_0689457
2059 Ga0501081_0956885
2060 Ga0501083_0878987
2061 Ga0501263_097533
2062 Ga0501268_038471
2063 Ga0501270_165014
2064 Ga0501035_0037475
2065 Ga0501044_0106294
2066 Ga0501044_0107514
2067 Ga0501044_0474344
2068 Ga0501045_0338297
2069 nmdc:mga03683_62635_c1
2070 nmdc:mga00v17_424188_c1
2071 nmdc:mga00v17_548755_c1
2072 nmdc:mga0k408_23088_c1
2073 nmdc:mga05p37_12177_c1
2074 nmdc:mga05p37_1604076_c1
2075 nmdc:mga05p37_1668157_c1
2076 nmdc:mga05p37_362476_c1
2077 nmdc:mga05p37_485758_c1
2078 nmdc:mga05p37_972315_c1
2079 nmdc:mga09592_14839_c1
2080 nmdc:mga0qj67_11613_c1
2081 nmdc:mga06r32_30750_c1
2082 nmdc:mga08y16_105683_c1
2083 nmdc:mga08y16_128892_c1
2084 nmdc:mga08y16_1444664_c1
2085 nmdc:mga08y16_1736026_c1
2086 nmdc:mga08y16_225902_c1
2087 nmdc:mga08y16_280977_c1
2088 nmdc:mga08y16_319318_c1
2089 nmdc:mga08y16_6711_c1
2090 nmdc:mga08y16_69785_c1
2091 nmdc:mga08y16_740277_c1
2092 nmdc:mga0n895_1589850_c1
2093 nmdc:mga0n895_1676672_c1
2094 nmdc:mga0n895_278644_c1
2095 nmdc:mga0n895_403705_c1
2096 nmdc:mga0n895_6_c1
2097 nmdc:mga0n895_946177_c1
2098 nmdc:mga0rr50_7_c1
2099 nmdc:mga08x19_19330_c1
2100 nmdc:mga08x19_497501_c2
2101 nmdc:mga08x19_769705_c1
2102 nmdc:mga0sz30_240149_c1
2103 Ga0495601_0068385
2104 Ga0495619_0160201
2105 Ga0500644_0010547
2106 Ga0500595_068531
2107 Ga0500573_0389849
2108 Ga0501084_0051231
2109 Ga0501084_1119007
2110 Ga0590074_076958
2111 Ga0501082_0426066
2112 2884218423

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

21

96

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9365 4 84
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9356 2 87
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9275 2 89
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9265 4 84
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9201 2 89
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9284 2 84 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9265 4 84 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9239 2 86 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9159 2 89 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8901 1 88 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1F2TGT5-F1-model_v4 PadR family transcriptional regulator 0.9959 5 87
AF-A0A2V9A638-F1-model_v4 PadR family transcriptional regulator 0.9957 2 69
AF-A0A7W7ZJD9-F1-model_v4 Transcriptional regulator 0.9954 5 88
AF-A0A2V9H684-F1-model_v4 PadR family transcriptional regulator 0.993 5 74
AF-A0A4Q7XXC7-F1-model_v4 PadR family transcriptional regulator 0.9928 5 87 GO:0000150
GO:0003677

Map