F489175
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1056 | 362 | 2112 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100377536|Ga0070713_1003775362 |
| Length | 115 |
| Sequence | MSMSLTVAKRDSLQGSLDLLVLKVVSRRRRLHGYAIMSAIQEMSGDVLRVEEGSLYPALHRMEAAGWIRAEWIRKENGRRARLYELTPAGKKQLGLEESGWQTVTAAVNRVLREA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 193 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 210 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 211 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 219 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 223 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 232 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 233 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 236 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 237 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 238 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 239 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 240 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 241 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 242 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 243 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 244 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 245 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 246 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 247 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 248 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 298 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 307 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 331 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 332 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 333 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 337 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 338 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 345 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 354 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 358 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 359 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 361 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.42 |
| Nodule | 0 |
| Rhizoplane | 1.99 |
| Rhizosphere | 95.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 22.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_100377536 | 3300005436 | Bacteria | 1320 |
| 2 | LJQas_1018996 | 3300000549 | Bacteria | 799 |
| 3 | JGI24743J22301_10035696 | 3300001991 | Bacteria | 988 |
| 4 | rootH2_10018443 | 3300003320 | Viruses | 23632 |
| 5 | rootH2_10164600 | 3300003320 | Unclassified | 2063 |
| 6 | Ga0065712_10007270 | 3300005290 | Bacteria | 4116 |
| 7 | Ga0065712_10371216 | 3300005290 | Bacteria | 763 |
| 8 | Ga0065707_10021146 | 3300005295 | Bacteria | 1394 |
| 9 | Ga0070658_10013361 | 3300005327 | Bacteria | 6588 |
| 10 | Ga0070658_10034110 | 3300005327 | Bacteria | 4094 |
| 11 | Ga0070658_10329417 | 3300005327 | Bacteria | 1305 |
| 12 | Ga0070658_10493593 | 3300005327 | Bacteria | 1057 |
| 13 | Ga0070676_10089547 | 3300005328 | Bacteria | 1882 |
| 14 | Ga0070676_11537669 | 3300005328 | Bacteria | 513 |
| 15 | Ga0070683_100002722 | 3300005329 | Bacteria | 14114 |
| 16 | Ga0070683_100028428 | 3300005329 | Bacteria | 5052 |
| 17 | Ga0070683_100046668 | 3300005329 | Bacteria | 4003 |
| 18 | Ga0070683_100223184 | 3300005329 | Bacteria | 1791 |
| 19 | Ga0070683_100521440 | 3300005329 | Unclassified | 1136 |
| 20 | Ga0070683_101963630 | 3300005329 | Unclassified | 562 |
| 21 | Ga0070690_100215992 | 3300005330 | Bacteria | 1341 |
| 22 | Ga0070690_101676153 | 3300005330 | Unclassified | 516 |
| 23 | Ga0070670_100004622 | 3300005331 | Bacteria | 11546 |
| 24 | Ga0070670_100064316 | 3300005331 | Unclassified | 3148 |
| 25 | Ga0070670_101836986 | 3300005331 | Bacteria | 558 |
| 26 | Ga0070677_10212651 | 3300005333 | Unclassified | 940 |
| 27 | Ga0068869_100001480 | 3300005334 | Bacteria | 13907 |
| 28 | Ga0068869_100053182 | 3300005334 | Bacteria | 2943 |
| 29 | Ga0070666_10250285 | 3300005335 | Bacteria | 1254 |
| 30 | Ga0070666_10771240 | 3300005335 | Bacteria | 707 |
| 31 | Ga0070666_10785031 | 3300005335 | Unclassified | 701 |
| 32 | Ga0070666_11007165 | 3300005335 | Unclassified | 618 |
| 33 | Ga0070680_100023336 | 3300005336 | Unclassified | 4934 |
| 34 | Ga0070680_100675101 | 3300005336 | Bacteria | 889 |
| 35 | Ga0070680_100747392 | 3300005336 | Bacteria | 842 |
| 36 | Ga0070680_101200611 | 3300005336 | Unclassified | 656 |
| 37 | Ga0068868_100001675 | 3300005338 | Bacteria | 15151 |
| 38 | Ga0068868_100001769 | 3300005338 | Bacteria | 14792 |
| 39 | Ga0068868_100014180 | 3300005338 | Bacteria | 5869 |
| 40 | Ga0068868_100159395 | 3300005338 | Bacteria | 1862 |
| 41 | Ga0068868_101256856 | 3300005338 | Bacteria | 686 |
| 42 | Ga0070660_100999219 | 3300005339 | Bacteria | 707 |
| 43 | Ga0070689_100045833 | 3300005340 | Bacteria | 3368 |
| 44 | Ga0070689_100078169 | 3300005340 | Bacteria | 2594 |
| 45 | Ga0070689_100985056 | 3300005340 | Bacteria | 749 |
| 46 | Ga0070691_10706992 | 3300005341 | Bacteria | 605 |
| 47 | Ga0070661_100084771 | 3300005344 | Bacteria | 2341 |
| 48 | Ga0070661_100112213 | 3300005344 | Bacteria | 2037 |
| 49 | Ga0070661_100862649 | 3300005344 | Bacteria | 746 |
| 50 | Ga0070692_11206343 | 3300005345 | Unclassified | 539 |
| 51 | Ga0070668_100039692 | 3300005347 | Bacteria | 3600 |
| 52 | Ga0070668_100434834 | 3300005347 | Unclassified | 1125 |
| 53 | Ga0070669_100133379 | 3300005353 | Bacteria | 1908 |
| 54 | Ga0070669_100146696 | 3300005353 | Unclassified | 1824 |
| 55 | Ga0070675_100031843 | 3300005354 | Bacteria | 4265 |
| 56 | Ga0070675_100145745 | 3300005354 | Bacteria | 2027 |
| 57 | Ga0070675_100439117 | 3300005354 | Unclassified | 1169 |
| 58 | Ga0070675_102214286 | 3300005354 | Bacteria | 506 |
| 59 | Ga0070671_100004037 | 3300005355 | Bacteria | 11572 |
| 60 | Ga0070671_100041323 | 3300005355 | Unclassified | 3832 |
| 61 | Ga0070671_100084330 | 3300005355 | Bacteria | 2657 |
| 62 | Ga0070671_101932863 | 3300005355 | Unclassified | 525 |
| 63 | Ga0070674_100309144 | 3300005356 | Unclassified | 1263 |
| 64 | Ga0070674_101759886 | 3300005356 | Bacteria | 561 |
| 65 | Ga0070673_100013898 | 3300005364 | Bacteria | 5589 |
| 66 | Ga0070673_101470166 | 3300005364 | Unclassified | 642 |
| 67 | Ga0070673_101649091 | 3300005364 | Bacteria | 606 |
| 68 | Ga0070688_100276814 | 3300005365 | Bacteria | 1204 |
| 69 | Ga0070688_100351228 | 3300005365 | Bacteria | 1080 |
| 70 | Ga0070659_100094319 | 3300005366 | Bacteria | 2403 |
| 71 | Ga0070659_100650213 | 3300005366 | Bacteria | 909 |
| 72 | Ga0070667_100003404 | 3300005367 | Bacteria | 13546 |
| 73 | Ga0070667_100032935 | 3300005367 | Bacteria | 4325 |
| 74 | Ga0070667_100235046 | 3300005367 | Unclassified | 1635 |
| 75 | Ga0070703_10022023 | 3300005406 | Unclassified | 1867 |
| 76 | Ga0070709_10012929 | 3300005434 | Bacteria | 4680 |
| 77 | Ga0070709_10063972 | 3300005434 | Bacteria | 2351 |
| 78 | Ga0070709_10069335 | 3300005434 | Bacteria | 2271 |
| 79 | Ga0070709_10072151 | 3300005434 | Unclassified | 2231 |
| 80 | Ga0070714_100236264 | 3300005435 | Bacteria | 1685 |
| 81 | Ga0070714_100597241 | 3300005435 | Bacteria | 1060 |
| 82 | Ga0070714_100656646 | 3300005435 | Bacteria | 1010 |
| 83 | Ga0070713_100000756 | 3300005436 | Bacteria | 20685 |
| 84 | Ga0070713_100007628 | 3300005436 | Bacteria | 7615 |
| 85 | Ga0070713_100160209 | 3300005436 | Bacteria | 2008 |
| 86 | Ga0070713_100188167 | 3300005436 | Bacteria | 1859 |
| 87 | Ga0070713_100382572 | 3300005436 | Bacteria | 1311 |
| 88 | Ga0070713_100568576 | 3300005436 | Bacteria | 1075 |
| 89 | Ga0070713_101849202 | 3300005436 | Unclassified | 586 |
| 90 | Ga0070711_100043800 | 3300005439 | Bacteria | 3034 |
| 91 | Ga0070711_100116244 | 3300005439 | Bacteria | 1971 |
| 92 | Ga0070711_100364321 | 3300005439 | Unclassified | 1165 |
| 93 | Ga0070711_100409667 | 3300005439 | Unclassified | 1102 |
| 94 | Ga0070711_100809621 | 3300005439 | Bacteria | 795 |
| 95 | Ga0070705_100007139 | 3300005440 | Bacteria | 5497 |
| 96 | Ga0070705_101030184 | 3300005440 | Bacteria | 670 |
| 97 | Ga0070705_101060988 | 3300005440 | Bacteria | 661 |
| 98 | Ga0070700_100304787 | 3300005441 | Unclassified | 1164 |
| 99 | Ga0070700_101045719 | 3300005441 | Bacteria | 674 |
| 100 | Ga0070694_100088360 | 3300005444 | Unclassified | 2170 |
| 101 | Ga0070694_100947451 | 3300005444 | Unclassified | 713 |
| 102 | Ga0070694_101652594 | 3300005444 | Bacteria | 544 |
| 103 | Ga0070694_101758979 | 3300005444 | Bacteria | 528 |
| 104 | Ga0070708_100004621 | 3300005445 | Bacteria | 10844 |
| 105 | Ga0070708_100152966 | 3300005445 | Bacteria | 2146 |
| 106 | Ga0070663_100133997 | 3300005455 | Bacteria | 1885 |
| 107 | Ga0070663_100758890 | 3300005455 | Bacteria | 829 |
| 108 | Ga0070678_100045286 | 3300005456 | Bacteria | 3146 |
| 109 | Ga0070678_101977698 | 3300005456 | Unclassified | 551 |
| 110 | Ga0070662_100052745 | 3300005457 | Bacteria | 2942 |
| 111 | Ga0070662_100078765 | 3300005457 | Bacteria | 2449 |
| 112 | Ga0070662_100770073 | 3300005457 | Unclassified | 817 |
| 113 | Ga0070681_10010160 | 3300005458 | Bacteria | 9282 |
| 114 | Ga0070681_10109907 | 3300005458 | Bacteria | 2696 |
| 115 | Ga0070681_10162448 | 3300005458 | Bacteria | 2157 |
| 116 | Ga0070681_10632189 | 3300005458 | Unclassified | 985 |
| 117 | Ga0068867_100567600 | 3300005459 | Unclassified | 985 |
| 118 | Ga0068867_100761770 | 3300005459 | Unclassified | 860 |
| 119 | Ga0068867_100942927 | 3300005459 | Bacteria | 779 |
| 120 | Ga0070706_100031675 | 3300005467 | Unclassified | 4876 |
| 121 | Ga0070707_100005736 | 3300005468 | Bacteria | 11582 |
| 122 | Ga0070707_100117531 | 3300005468 | Bacteria | 2581 |
| 123 | Ga0070707_100414082 | 3300005468 | Bacteria | 1308 |
| 124 | Ga0070707_101195532 | 3300005468 | Bacteria | 726 |
| 125 | Ga0070698_101153254 | 3300005471 | Bacteria | 724 |
| 126 | Ga0070698_101949936 | 3300005471 | Unclassified | 540 |
| 127 | Ga0070699_100059693 | 3300005518 | Unclassified | 3304 |
| 128 | Ga0070699_100072400 | 3300005518 | Bacteria | 2998 |
| 129 | Ga0070699_100827946 | 3300005518 | Unclassified | 847 |
| 130 | Ga0070679_100017259 | 3300005530 | Bacteria | 6983 |
| 131 | Ga0070679_100065368 | 3300005530 | Unclassified | 3625 |
| 132 | Ga0070679_100805967 | 3300005530 | Bacteria | 882 |
| 133 | Ga0070684_100040309 | 3300005535 | Bacteria | 4021 |
| 134 | Ga0070684_100046206 | 3300005535 | Bacteria | 3773 |
| 135 | Ga0070684_100046822 | 3300005535 | Bacteria | 3747 |
| 136 | Ga0070684_100129028 | 3300005535 | Bacteria | 2280 |
| 137 | Ga0070684_100179986 | 3300005535 | Unclassified | 1922 |
| 138 | Ga0070684_100231747 | 3300005535 | Bacteria | 1686 |
| 139 | Ga0070684_100325499 | 3300005535 | Bacteria | 1412 |
| 140 | Ga0070684_100611092 | 3300005535 | Unclassified | 1014 |
| 141 | Ga0070684_101378560 | 3300005535 | Bacteria | 664 |
| 142 | Ga0070697_100001864 | 3300005536 | Bacteria | 16112 |
| 143 | Ga0070697_100478920 | 3300005536 | Bacteria | 1087 |
| 144 | Ga0070697_100762635 | 3300005536 | Bacteria | 855 |
| 145 | Ga0070697_100774113 | 3300005536 | Bacteria | 848 |
| 146 | Ga0070697_101516496 | 3300005536 | Unclassified | 599 |
| 147 | Ga0068853_100000760 | 3300005539 | Bacteria | 22373 |
| 148 | Ga0068853_100153545 | 3300005539 | Bacteria | 2073 |
| 149 | Ga0068853_100161770 | 3300005539 | Bacteria | 2021 |
| 150 | Ga0068853_100218878 | 3300005539 | Bacteria | 1738 |
| 151 | Ga0068853_100319680 | 3300005539 | Unclassified | 1439 |
| 152 | Ga0068853_101140774 | 3300005539 | Bacteria | 752 |
| 153 | Ga0068853_102397451 | 3300005539 | Bacteria | 511 |
| 154 | Ga0070672_102043035 | 3300005543 | Bacteria | 516 |
| 155 | Ga0070695_100037111 | 3300005545 | Unclassified | 3070 |
| 156 | Ga0070695_100125661 | 3300005545 | Bacteria | 1761 |
| 157 | Ga0070695_100290222 | 3300005545 | Bacteria | 1205 |
| 158 | Ga0070695_100501560 | 3300005545 | Bacteria | 939 |
| 159 | Ga0070695_100969353 | 3300005545 | Bacteria | 690 |
| 160 | Ga0070695_101107666 | 3300005545 | Bacteria | 648 |
| 161 | Ga0070695_101284788 | 3300005545 | Unclassified | 604 |
| 162 | Ga0070696_100000282 | 3300005546 | Bacteria | 30602 |
| 163 | Ga0070696_100146959 | 3300005546 | Bacteria | 1727 |
| 164 | Ga0070696_100393317 | 3300005546 | Unclassified | 1083 |
| 165 | Ga0070696_100548418 | 3300005546 | Unclassified | 926 |
| 166 | Ga0070693_100004320 | 3300005547 | Bacteria | 6709 |
| 167 | Ga0070693_100701231 | 3300005547 | Bacteria | 741 |
| 168 | Ga0070665_100025124 | 3300005548 | Bacteria | 6002 |
| 169 | Ga0070665_100027471 | 3300005548 | Bacteria | 5732 |
| 170 | Ga0070665_100044342 | 3300005548 | Bacteria | 4466 |
| 171 | Ga0070665_100054299 | 3300005548 | Bacteria | 4018 |
| 172 | Ga0070665_100069455 | 3300005548 | Bacteria | 3530 |
| 173 | Ga0070665_100248617 | 3300005548 | Bacteria | 1779 |
| 174 | Ga0070665_100359191 | 3300005548 | Unclassified | 1462 |
| 175 | Ga0070665_100692401 | 3300005548 | Bacteria | 1032 |
| 176 | Ga0070665_100935778 | 3300005548 | Bacteria | 879 |
| 177 | Ga0070665_101124341 | 3300005548 | Bacteria | 797 |
| 178 | Ga0070665_101873584 | 3300005548 | Unclassified | 606 |
| 179 | Ga0070704_100005557 | 3300005549 | Bacteria | 7350 |
| 180 | Ga0068855_100000250 | 3300005563 | Bacteria | 67441 |
| 181 | Ga0068855_100020057 | 3300005563 | Bacteria | 8027 |
| 182 | Ga0068855_100052552 | 3300005563 | Bacteria | 4796 |
| 183 | Ga0068855_100077582 | 3300005563 | Bacteria | 3854 |
| 184 | Ga0068855_100164099 | 3300005563 | Bacteria | 2519 |
| 185 | Ga0068855_100641259 | 3300005563 | Bacteria | 1142 |
| 186 | Ga0068855_100675242 | 3300005563 | Bacteria | 1107 |
| 187 | Ga0068855_101119833 | 3300005563 | Bacteria | 822 |
| 188 | Ga0068855_101154822 | 3300005563 | Unclassified | 807 |
| 189 | Ga0070664_100019731 | 3300005564 | Bacteria | 5549 |
| 190 | Ga0070664_100655781 | 3300005564 | Bacteria | 976 |
| 191 | Ga0070664_100880020 | 3300005564 | Bacteria | 839 |
| 192 | Ga0068857_100041105 | 3300005577 | Bacteria | 4100 |
| 193 | Ga0068857_100053622 | 3300005577 | Bacteria | 3577 |
| 194 | Ga0068857_100159589 | 3300005577 | Unclassified | 2046 |
| 195 | Ga0068857_100195079 | 3300005577 | Bacteria | 1845 |
| 196 | Ga0068857_100255276 | 3300005577 | Bacteria | 1608 |
| 197 | Ga0068854_100010270 | 3300005578 | Bacteria | 6069 |
| 198 | Ga0068854_100047267 | 3300005578 | Bacteria | 3067 |
| 199 | Ga0068854_100251616 | 3300005578 | Bacteria | 1411 |
| 200 | Ga0068854_100763319 | 3300005578 | Bacteria | 840 |
| 201 | Ga0068854_101301322 | 3300005578 | Unclassified | 654 |
| 202 | Ga0068854_101422303 | 3300005578 | Bacteria | 627 |
| 203 | Ga0068856_100001514 | 3300005614 | Bacteria | 24372 |
| 204 | Ga0068856_100003761 | 3300005614 | Bacteria | 15218 |
| 205 | Ga0068856_100004698 | 3300005614 | Bacteria | 13563 |
| 206 | Ga0068856_100018860 | 3300005614 | Bacteria | 6689 |
| 207 | Ga0068856_100136386 | 3300005614 | Bacteria | 2459 |
| 208 | Ga0068856_101112771 | 3300005614 | Unclassified | 807 |
| 209 | Ga0068856_101164511 | 3300005614 | Bacteria | 788 |
| 210 | Ga0068856_102030820 | 3300005614 | Bacteria | 585 |
| 211 | Ga0068856_102209015 | 3300005614 | Bacteria | 559 |
| 212 | Ga0070702_100323072 | 3300005615 | Bacteria | 1076 |
| 213 | Ga0070702_100706783 | 3300005615 | Bacteria | 769 |
| 214 | Ga0070702_100850092 | 3300005615 | Bacteria | 710 |
| 215 | Ga0068852_100000010 | 3300005616 | Bacteria | 141683 |
| 216 | Ga0068852_100063281 | 3300005616 | Bacteria | 3221 |
| 217 | Ga0068852_100299085 | 3300005616 | Bacteria | 1557 |
| 218 | Ga0068852_100571088 | 3300005616 | Bacteria | 1133 |
| 219 | Ga0068852_100953578 | 3300005616 | Bacteria | 876 |
| 220 | Ga0068852_101372951 | 3300005616 | Bacteria | 728 |
| 221 | Ga0068852_101391669 | 3300005616 | Bacteria | 723 |
| 222 | Ga0068859_100008728 | 3300005617 | Bacteria | 10239 |
| 223 | Ga0068859_100009619 | 3300005617 | Bacteria | 9759 |
| 224 | Ga0068859_100022156 | 3300005617 | Bacteria | 6370 |
| 225 | Ga0068859_100768910 | 3300005617 | Unclassified | 1052 |
| 226 | Ga0068864_100012964 | 3300005618 | Bacteria | 6898 |
| 227 | Ga0068864_100271584 | 3300005618 | Unclassified | 1580 |
| 228 | Ga0068864_100455085 | 3300005618 | Bacteria | 1224 |
| 229 | Ga0068866_10002504 | 3300005718 | Bacteria | 7569 |
| 230 | Ga0068866_10061922 | 3300005718 | Bacteria | 1945 |
| 231 | Ga0068861_100142433 | 3300005719 | Unclassified | 1958 |
| 232 | Ga0068861_101829444 | 3300005719 | Bacteria | 603 |
| 233 | Ga0068851_10003306 | 3300005834 | Bacteria | 7162 |
| 234 | Ga0068851_10006982 | 3300005834 | Bacteria | 5178 |
| 235 | Ga0068851_10139925 | 3300005834 | Unclassified | 1316 |
| 236 | Ga0068851_10250147 | 3300005834 | Bacteria | 1005 |
| 237 | Ga0068870_11193060 | 3300005840 | Unclassified | 551 |
| 238 | Ga0068863_100004433 | 3300005841 | Bacteria | 13837 |
| 239 | Ga0068863_100241060 | 3300005841 | Bacteria | 1745 |
| 240 | Ga0068858_100000894 | 3300005842 | Bacteria | 30948 |
| 241 | Ga0068858_101144752 | 3300005842 | Bacteria | 764 |
| 242 | Ga0068860_100004498 | 3300005843 | Bacteria | 14222 |
| 243 | Ga0068860_100092571 | 3300005843 | Bacteria | 2881 |
| 244 | Ga0068862_100203978 | 3300005844 | Unclassified | 1784 |
| 245 | Ga0068862_101479326 | 3300005844 | Bacteria | 684 |
| 246 | Ga0068862_102248628 | 3300005844 | Bacteria | 557 |
| 247 | Ga0070717_10440085 | 3300006028 | Bacteria | 1174 |
| 248 | Ga0075363_100180006 | 3300006048 | Bacteria | 1202 |
| 249 | Ga0075364_10359278 | 3300006051 | Unclassified | 993 |
| 250 | Ga0075364_10471384 | 3300006051 | Unclassified | 858 |
| 251 | Ga0075364_10726741 | 3300006051 | Unclassified | 677 |
| 252 | Ga0075432_10503628 | 3300006058 | Unclassified | 540 |
| 253 | Ga0070715_10135189 | 3300006163 | Bacteria | 1191 |
| 254 | Ga0070716_100088016 | 3300006173 | Bacteria | 1872 |
| 255 | Ga0070716_100131713 | 3300006173 | Unclassified | 1581 |
| 256 | Ga0070716_100223321 | 3300006173 | Bacteria | 1267 |
| 257 | Ga0070716_100787292 | 3300006173 | Unclassified | 735 |
| 258 | Ga0070712_100011062 | 3300006175 | Bacteria | 5711 |
| 259 | Ga0070712_100016643 | 3300006175 | Bacteria | 4751 |
| 260 | Ga0070712_100054195 | 3300006175 | Bacteria | 2803 |
| 261 | Ga0070712_100085628 | 3300006175 | Unclassified | 2295 |
| 262 | Ga0070712_100232192 | 3300006175 | Bacteria | 1465 |
| 263 | Ga0070712_100319122 | 3300006175 | Bacteria | 1263 |
| 264 | Ga0070712_100645417 | 3300006175 | Bacteria | 899 |
| 265 | Ga0075362_10007621 | 3300006177 | Bacteria | 4111 |
| 266 | Ga0075369_10167346 | 3300006186 | Bacteria | 1008 |
| 267 | Ga0075369_10260322 | 3300006186 | Unclassified | 806 |
| 268 | Ga0097621_100000411 | 3300006237 | Bacteria | 29913 |
| 269 | Ga0097621_100009117 | 3300006237 | Bacteria | 7190 |
| 270 | Ga0097621_100015840 | 3300006237 | Bacteria | 5684 |
| 271 | Ga0097621_100035335 | 3300006237 | Bacteria | 3993 |
| 272 | Ga0097621_100065695 | 3300006237 | Unclassified | 2986 |
| 273 | Ga0097621_100198415 | 3300006237 | Bacteria | 1741 |
| 274 | Ga0097621_100789512 | 3300006237 | Bacteria | 879 |
| 275 | Ga0068871_100002096 | 3300006358 | Bacteria | 13503 |
| 276 | Ga0068871_100771748 | 3300006358 | Unclassified | 885 |
| 277 | Ga0068871_100917908 | 3300006358 | Bacteria | 812 |
| 278 | Ga0068871_101192428 | 3300006358 | Unclassified | 714 |
| 279 | Ga0068871_101297241 | 3300006358 | Bacteria | 685 |
| 280 | Ga0075428_100034181 | 3300006844 | Bacteria | 5609 |
| 281 | Ga0075430_100012143 | 3300006846 | Bacteria | 7332 |
| 282 | Ga0075431_100004580 | 3300006847 | Bacteria | 13569 |
| 283 | Ga0075434_100059402 | 3300006871 | Bacteria | 3801 |
| 284 | Ga0075434_100119188 | 3300006871 | Bacteria | 2653 |
| 285 | Ga0075434_100619405 | 3300006871 | Bacteria | 1101 |
| 286 | Ga0075434_101307561 | 3300006871 | Unclassified | 736 |
| 287 | Ga0075429_100660262 | 3300006880 | Unclassified | 916 |
| 288 | Ga0068865_100001072 | 3300006881 | Bacteria | 15770 |
| 289 | Ga0068865_100048605 | 3300006881 | Bacteria | 2920 |
| 290 | Ga0068865_100994120 | 3300006881 | Unclassified | 734 |
| 291 | Ga0075436_100025051 | 3300006914 | Bacteria | 4102 |
| 292 | Ga0075436_100116732 | 3300006914 | Bacteria | 1865 |
| 293 | Ga0075436_100513652 | 3300006914 | Bacteria | 877 |
| 294 | Ga0075436_101568897 | 3300006914 | Unclassified | 500 |
| 295 | Ga0097620_100008728 | 3300006931 | Bacteria | 10239 |
| 296 | Ga0097620_100009619 | 3300006931 | Bacteria | 9759 |
| 297 | Ga0097620_100022156 | 3300006931 | Bacteria | 6370 |
| 298 | Ga0097620_100768943 | 3300006931 | Unclassified | 1052 |
| 299 | Ga0075435_100000004 | 3300007076 | Bacteria | 122128 |
| 300 | Ga0075435_100172831 | 3300007076 | Unclassified | 1823 |
| 301 | Ga0099794_10467196 | 3300007265 | Bacteria | 662 |
| 302 | Ga0099795_10450023 | 3300007788 | Bacteria | 593 |
| 303 | Ga0099795_10460515 | 3300007788 | Unclassified | 587 |
| 304 | Ga0105240_10000436 | 3300009093 | Bacteria | 76985 |
| 305 | Ga0105240_10004419 | 3300009093 | Bacteria | 21435 |
| 306 | Ga0105240_10012860 | 3300009093 | Bacteria | 11531 |
| 307 | Ga0105240_10025261 | 3300009093 | Bacteria | 7810 |
| 308 | Ga0105240_10032915 | 3300009093 | Bacteria | 6704 |
| 309 | Ga0105240_10036335 | 3300009093 | Bacteria | 6340 |
| 310 | Ga0105240_10050394 | 3300009093 | Bacteria | 5250 |
| 311 | Ga0105240_10148818 | 3300009093 | Bacteria | 2791 |
| 312 | Ga0105240_10177697 | 3300009093 | Bacteria | 2515 |
| 313 | Ga0105240_10251974 | 3300009093 | Bacteria | 2041 |
| 314 | Ga0105240_10565848 | 3300009093 | Bacteria | 1256 |
| 315 | Ga0105240_10637903 | 3300009093 | Bacteria | 1169 |
| 316 | Ga0105240_10899611 | 3300009093 | Bacteria | 952 |
| 317 | Ga0105240_12067885 | 3300009093 | Bacteria | 591 |
| 318 | Ga0105240_12686900 | 3300009093 | Bacteria | 514 |
| 319 | Ga0111539_10016191 | 3300009094 | Bacteria | 9252 |
| 320 | Ga0111539_10042739 | 3300009094 | Bacteria | 5439 |
| 321 | Ga0111539_10051147 | 3300009094 | Unclassified | 4922 |
| 322 | Ga0111539_10078267 | 3300009094 | Unclassified | 3890 |
| 323 | Ga0111539_10106356 | 3300009094 | Bacteria | 3291 |
| 324 | Ga0111539_10233728 | 3300009094 | Bacteria | 2140 |
| 325 | Ga0111539_11189478 | 3300009094 | Unclassified | 885 |
| 326 | Ga0111539_11518405 | 3300009094 | Unclassified | 777 |
| 327 | Ga0111539_11550779 | 3300009094 | Bacteria | 768 |
| 328 | Ga0111539_11700006 | 3300009094 | Unclassified | 732 |
| 329 | Ga0111539_11957415 | 3300009094 | Bacteria | 680 |
| 330 | Ga0105245_10007833 | 3300009098 | Bacteria | 9356 |
| 331 | Ga0105245_10022166 | 3300009098 | Bacteria | 5577 |
| 332 | Ga0105245_10045873 | 3300009098 | Bacteria | 3904 |
| 333 | Ga0105245_10074593 | 3300009098 | Bacteria | 3087 |
| 334 | Ga0105245_10172165 | 3300009098 | Bacteria | 2062 |
| 335 | Ga0105245_10299050 | 3300009098 | Bacteria | 1579 |
| 336 | Ga0105245_10468538 | 3300009098 | Bacteria | 1271 |
| 337 | Ga0105245_10776598 | 3300009098 | Unclassified | 995 |
| 338 | Ga0105245_11334215 | 3300009098 | Bacteria | 767 |
| 339 | Ga0105247_10001551 | 3300009101 | Bacteria | 16385 |
| 340 | Ga0105247_10008463 | 3300009101 | Bacteria | 6266 |
| 341 | Ga0105247_10194451 | 3300009101 | Bacteria | 1360 |
| 342 | Ga0105247_10206434 | 3300009101 | Bacteria | 1323 |
| 343 | Ga0114129_10067192 | 3300009147 | Bacteria | 5000 |
| 344 | Ga0114129_10161994 | 3300009147 | Bacteria | 3055 |
| 345 | Ga0114129_10635297 | 3300009147 | Unclassified | 1379 |
| 346 | Ga0114129_10718018 | 3300009147 | Bacteria | 1283 |
| 347 | Ga0114129_10965531 | 3300009147 | Bacteria | 1075 |
| 348 | Ga0114129_11632626 | 3300009147 | Bacteria | 788 |
| 349 | Ga0105243_11889903 | 3300009148 | Unclassified | 630 |
| 350 | Ga0105241_10000014 | 3300009174 | Bacteria | 171306 |
| 351 | Ga0105241_10000642 | 3300009174 | Bacteria | 26220 |
| 352 | Ga0105241_10005710 | 3300009174 | Bacteria | 9183 |
| 353 | Ga0105241_10026292 | 3300009174 | Unclassified | 4329 |
| 354 | Ga0105241_10047426 | 3300009174 | Bacteria | 3267 |
| 355 | Ga0105241_10064208 | 3300009174 | Bacteria | 2834 |
| 356 | Ga0105241_10128230 | 3300009174 | Bacteria | 2051 |
| 357 | Ga0105241_10295443 | 3300009174 | Bacteria | 1388 |
| 358 | Ga0105241_10295952 | 3300009174 | Bacteria | 1387 |
| 359 | Ga0105241_10529791 | 3300009174 | Bacteria | 1055 |
| 360 | Ga0105241_10831222 | 3300009174 | Bacteria | 853 |
| 361 | Ga0105241_11903163 | 3300009174 | Bacteria | 583 |
| 362 | Ga0105241_12466687 | 3300009174 | Unclassified | 520 |
| 363 | Ga0105241_12559573 | 3300009174 | Unclassified | 512 |
| 364 | Ga0105242_10006845 | 3300009176 | Bacteria | 8787 |
| 365 | Ga0105242_10010294 | 3300009176 | Bacteria | 7170 |
| 366 | Ga0105242_10038242 | 3300009176 | Bacteria | 3858 |
| 367 | Ga0105242_10331236 | 3300009176 | Unclassified | 1400 |
| 368 | Ga0105242_10391417 | 3300009176 | Unclassified | 1294 |
| 369 | Ga0105242_10868325 | 3300009176 | Unclassified | 899 |
| 370 | Ga0105242_10877911 | 3300009176 | Bacteria | 895 |
| 371 | Ga0105242_11359242 | 3300009176 | Unclassified | 736 |
| 372 | Ga0105242_11783419 | 3300009176 | Bacteria | 653 |
| 373 | Ga0105248_10014503 | 3300009177 | Bacteria | 8676 |
| 374 | Ga0105248_10017033 | 3300009177 | Bacteria | 8004 |
| 375 | Ga0105248_10018467 | 3300009177 | Bacteria | 7707 |
| 376 | Ga0105248_10028300 | 3300009177 | Bacteria | 6243 |
| 377 | Ga0105248_10041781 | 3300009177 | Bacteria | 5142 |
| 378 | Ga0105248_10073528 | 3300009177 | Bacteria | 3841 |
| 379 | Ga0105248_10081486 | 3300009177 | Bacteria | 3637 |
| 380 | Ga0105248_10087727 | 3300009177 | Bacteria | 3502 |
| 381 | Ga0105248_10129882 | 3300009177 | Bacteria | 2842 |
| 382 | Ga0105248_10234077 | 3300009177 | Bacteria | 2068 |
| 383 | Ga0105248_10245244 | 3300009177 | Bacteria | 2017 |
| 384 | Ga0105248_10509076 | 3300009177 | Bacteria | 1357 |
| 385 | Ga0105248_12593364 | 3300009177 | Bacteria | 578 |
| 386 | Ga0105237_10007844 | 3300009545 | Bacteria | 11640 |
| 387 | Ga0105237_10007965 | 3300009545 | Bacteria | 11544 |
| 388 | Ga0105237_10019667 | 3300009545 | Bacteria | 6972 |
| 389 | Ga0105237_10025505 | 3300009545 | Bacteria | 6046 |
| 390 | Ga0105237_10053597 | 3300009545 | Bacteria | 4045 |
| 391 | Ga0105237_10269959 | 3300009545 | Unclassified | 1704 |
| 392 | Ga0105237_10464862 | 3300009545 | Bacteria | 1271 |
| 393 | Ga0105237_10486393 | 3300009545 | Unclassified | 1240 |
| 394 | Ga0105237_11687675 | 3300009545 | Unclassified | 641 |
| 395 | Ga0105238_10001147 | 3300009551 | Bacteria | 26737 |
| 396 | Ga0105238_10002103 | 3300009551 | Bacteria | 20114 |
| 397 | Ga0105238_10011589 | 3300009551 | Bacteria | 8884 |
| 398 | Ga0105238_10043336 | 3300009551 | Bacteria | 4553 |
| 399 | Ga0105238_10311521 | 3300009551 | Bacteria | 1559 |
| 400 | Ga0105238_10349571 | 3300009551 | Bacteria | 1467 |
| 401 | Ga0105238_10613019 | 3300009551 | Unclassified | 1097 |
| 402 | Ga0105238_10713832 | 3300009551 | Bacteria | 1015 |
| 403 | Ga0105249_10027336 | 3300009553 | Bacteria | 5147 |
| 404 | Ga0105249_10342541 | 3300009553 | Bacteria | 1512 |
| 405 | Ga0105249_11354639 | 3300009553 | Unclassified | 783 |
| 406 | Ga0105249_12947136 | 3300009553 | Unclassified | 546 |
| 407 | Ga0099796_10536976 | 3300010159 | Unclassified | 525 |
| 408 | Ga0105239_10003382 | 3300010375 | Bacteria | 19576 |
| 409 | Ga0105239_10045292 | 3300010375 | Bacteria | 4821 |
| 410 | Ga0105239_10068734 | 3300010375 | Bacteria | 3893 |
| 411 | Ga0105239_10085886 | 3300010375 | Bacteria | 3468 |
| 412 | Ga0105239_10103031 | 3300010375 | Bacteria | 3158 |
| 413 | Ga0105239_10236022 | 3300010375 | Bacteria | 2052 |
| 414 | Ga0105239_10301600 | 3300010375 | Bacteria | 1804 |
| 415 | Ga0105239_10305439 | 3300010375 | Unclassified | 1792 |
| 416 | Ga0105239_10819512 | 3300010375 | Unclassified | 1067 |
| 417 | Ga0105239_10977005 | 3300010375 | Bacteria | 973 |
| 418 | Ga0105239_11556606 | 3300010375 | Bacteria | 764 |
| 419 | Ga0105239_11855527 | 3300010375 | Bacteria | 699 |
| 420 | Ga0105239_12274845 | 3300010375 | Bacteria | 631 |
| 421 | Ga0105239_13048659 | 3300010375 | Bacteria | 546 |
| 422 | Ga0105246_10000506 | 3300011119 | Bacteria | 21241 |
| 423 | Ga0105246_10109102 | 3300011119 | Bacteria | 2030 |
| 424 | Ga0105246_10974744 | 3300011119 | Bacteria | 766 |
| 425 | Ga0157373_10256009 | 3300013100 | Bacteria | 1238 |
| 426 | Ga0157373_10336648 | 3300013100 | Bacteria | 1075 |
| 427 | Ga0157373_10954217 | 3300013100 | Unclassified | 638 |
| 428 | Ga0157373_11306102 | 3300013100 | Bacteria | 549 |
| 429 | Ga0157373_11360099 | 3300013100 | Bacteria | 539 |
| 430 | Ga0157371_10105899 | 3300013102 | Bacteria | 1995 |
| 431 | Ga0157371_10137857 | 3300013102 | Bacteria | 1738 |
| 432 | Ga0157370_10000005 | 3300013104 | Bacteria | 288514 |
| 433 | Ga0157370_10106232 | 3300013104 | Unclassified | 2628 |
| 434 | Ga0157369_10000049 | 3300013105 | Bacteria | 169239 |
| 435 | Ga0157369_10006463 | 3300013105 | Bacteria | 13588 |
| 436 | Ga0157369_10008092 | 3300013105 | Bacteria | 12057 |
| 437 | Ga0157369_10013495 | 3300013105 | Bacteria | 9232 |
| 438 | Ga0157369_10017952 | 3300013105 | Bacteria | 7942 |
| 439 | Ga0157369_10060862 | 3300013105 | Bacteria | 4071 |
| 440 | Ga0157369_10073446 | 3300013105 | Unclassified | 3670 |
| 441 | Ga0157369_10104562 | 3300013105 | Unclassified | 3015 |
| 442 | Ga0157369_10209593 | 3300013105 | Bacteria | 2043 |
| 443 | Ga0157369_10210467 | 3300013105 | Bacteria | 2038 |
| 444 | Ga0157369_10237764 | 3300013105 | Bacteria | 1903 |
| 445 | Ga0157369_10537074 | 3300013105 | Bacteria | 1209 |
| 446 | Ga0157369_10883681 | 3300013105 | Unclassified | 917 |
| 447 | Ga0157369_11554529 | 3300013105 | Bacteria | 673 |
| 448 | Ga0157374_10025354 | 3300013296 | Bacteria | 5323 |
| 449 | Ga0157374_10083752 | 3300013296 | Bacteria | 3030 |
| 450 | Ga0157374_10157517 | 3300013296 | Bacteria | 2211 |
| 451 | Ga0157374_10193138 | 3300013296 | Bacteria | 1991 |
| 452 | Ga0157374_10250360 | 3300013296 | Unclassified | 1743 |
| 453 | Ga0157374_11025517 | 3300013296 | Unclassified | 844 |
| 454 | Ga0157374_11206303 | 3300013296 | Unclassified | 778 |
| 455 | Ga0157374_11513155 | 3300013296 | Bacteria | 694 |
| 456 | Ga0157378_10004806 | 3300013297 | Bacteria | 11837 |
| 457 | Ga0157378_10009528 | 3300013297 | Bacteria | 8456 |
| 458 | Ga0157378_10026122 | 3300013297 | Bacteria | 5148 |
| 459 | Ga0157378_10055476 | 3300013297 | Unclassified | 3530 |
| 460 | Ga0157378_10154791 | 3300013297 | Bacteria | 2138 |
| 461 | Ga0157378_10272551 | 3300013297 | Bacteria | 1628 |
| 462 | Ga0157378_10639700 | 3300013297 | Bacteria | 1078 |
| 463 | Ga0163162_10788057 | 3300013306 | Unclassified | 1068 |
| 464 | Ga0163162_11075292 | 3300013306 | Bacteria | 911 |
| 465 | Ga0157372_10000047 | 3300013307 | Bacteria | 145881 |
| 466 | Ga0157372_10006634 | 3300013307 | Bacteria | 12320 |
| 467 | Ga0157372_10011629 | 3300013307 | Bacteria | 9370 |
| 468 | Ga0157372_10017955 | 3300013307 | Bacteria | 7601 |
| 469 | Ga0157372_10068757 | 3300013307 | Bacteria | 3982 |
| 470 | Ga0157372_10110844 | 3300013307 | Bacteria | 3143 |
| 471 | Ga0157372_10192210 | 3300013307 | Bacteria | 2364 |
| 472 | Ga0157372_10196288 | 3300013307 | Bacteria | 2338 |
| 473 | Ga0157372_10264704 | 3300013307 | Bacteria | 1996 |
| 474 | Ga0157372_11227389 | 3300013307 | Bacteria | 866 |
| 475 | Ga0157372_11363379 | 3300013307 | Bacteria | 818 |
| 476 | Ga0157375_10004406 | 3300013308 | Bacteria | 12226 |
| 477 | Ga0157375_10035664 | 3300013308 | Bacteria | 4750 |
| 478 | Ga0157375_10084450 | 3300013308 | Bacteria | 3223 |
| 479 | Ga0157375_10489164 | 3300013308 | Bacteria | 1395 |
| 480 | Ga0157375_11227167 | 3300013308 | Bacteria | 880 |
| 481 | Ga0163163_10001403 | 3300014325 | Bacteria | 20325 |
| 482 | Ga0163163_10068653 | 3300014325 | Unclassified | 3527 |
| 483 | Ga0163163_10112559 | 3300014325 | Bacteria | 2751 |
| 484 | Ga0163163_10258020 | 3300014325 | Unclassified | 1794 |
| 485 | Ga0163163_10739423 | 3300014325 | Bacteria | 1047 |
| 486 | Ga0163163_11735681 | 3300014325 | Bacteria | 685 |
| 487 | Ga0157380_10019586 | 3300014326 | Bacteria | 5044 |
| 488 | Ga0157380_10026942 | 3300014326 | Unclassified | 4367 |
| 489 | Ga0157380_10075251 | 3300014326 | Bacteria | 2743 |
| 490 | Ga0157380_10503630 | 3300014326 | Unclassified | 1177 |
| 491 | Ga0157380_10614379 | 3300014326 | Unclassified | 1078 |
| 492 | Ga0157380_11995570 | 3300014326 | Unclassified | 642 |
| 493 | Ga0157380_12463362 | 3300014326 | Unclassified | 586 |
| 494 | Ga0157379_10000404 | 3300014968 | Bacteria | 35030 |
| 495 | Ga0157379_10031031 | 3300014968 | Bacteria | 4761 |
| 496 | Ga0157379_10042708 | 3300014968 | Bacteria | 4048 |
| 497 | Ga0157379_10154427 | 3300014968 | Bacteria | 2070 |
| 498 | Ga0157379_11556752 | 3300014968 | Bacteria | 644 |
| 499 | Ga0157379_11948584 | 3300014968 | Unclassified | 580 |
| 500 | Ga0157376_10000652 | 3300014969 | Bacteria | 22457 |
| 501 | Ga0157376_10230925 | 3300014969 | Bacteria | 1719 |
| 502 | Ga0157376_10294783 | 3300014969 | Bacteria | 1533 |
| 503 | Ga0157376_10335447 | 3300014969 | Bacteria | 1442 |
| 504 | Ga0157376_11099192 | 3300014969 | Unclassified | 821 |
| 505 | Ga0157376_11788892 | 3300014969 | Bacteria | 650 |
| 506 | Ga0157376_12790479 | 3300014969 | Unclassified | 528 |
| 507 | Ga0182005_1146378 | 3300015265 | Bacteria | 685 |
| 508 | Ga0163161_10020772 | 3300017792 | Bacteria | 4610 |
| 509 | Ga0163161_11057728 | 3300017792 | Unclassified | 695 |
| 510 | Ga0213875_10063176 | 3300021388 | Unclassified | 1731 |
| 511 | Ga0228598_1011828 | 3300024227 | Bacteria | 1736 |
| 512 | Ga0207656_10027863 | 3300025321 | Bacteria | 2314 |
| 513 | Ga0207656_10101589 | 3300025321 | Bacteria | 1319 |
| 514 | Ga0207656_10115706 | 3300025321 | Bacteria | 1244 |
| 515 | Ga0207656_10115995 | 3300025321 | Bacteria | 1242 |
| 516 | Ga0207653_10087475 | 3300025885 | Bacteria | 1087 |
| 517 | Ga0207653_10229852 | 3300025885 | Unclassified | 706 |
| 518 | Ga0207642_10005676 | 3300025899 | Bacteria | 4088 |
| 519 | Ga0207710_10000869 | 3300025900 | Bacteria | 16199 |
| 520 | Ga0207710_10099065 | 3300025900 | Bacteria | 1372 |
| 521 | Ga0207710_10529802 | 3300025900 | Unclassified | 613 |
| 522 | Ga0207688_10529688 | 3300025901 | Bacteria | 739 |
| 523 | Ga0207680_10149836 | 3300025903 | Bacteria | 1554 |
| 524 | Ga0207680_10215581 | 3300025903 | Bacteria | 1314 |
| 525 | Ga0207680_10721107 | 3300025903 | Bacteria | 715 |
| 526 | Ga0207647_10024516 | 3300025904 | Bacteria | 3977 |
| 527 | Ga0207647_10026139 | 3300025904 | Bacteria | 3823 |
| 528 | Ga0207685_10024287 | 3300025905 | Bacteria | 2076 |
| 529 | Ga0207685_10086249 | 3300025905 | Bacteria | 1311 |
| 530 | Ga0207699_10020265 | 3300025906 | Bacteria | 3560 |
| 531 | Ga0207699_10116693 | 3300025906 | Bacteria | 1720 |
| 532 | Ga0207699_10342529 | 3300025906 | Unclassified | 1053 |
| 533 | Ga0207645_10037493 | 3300025907 | Bacteria | 3110 |
| 534 | Ga0207645_10318167 | 3300025907 | Bacteria | 1038 |
| 535 | Ga0207705_10077458 | 3300025909 | Bacteria | 2419 |
| 536 | Ga0207705_10242598 | 3300025909 | Bacteria | 1373 |
| 537 | Ga0207705_10342464 | 3300025909 | Bacteria | 1151 |
| 538 | Ga0207705_10807248 | 3300025909 | Bacteria | 728 |
| 539 | Ga0207684_10026923 | 3300025910 | Unclassified | 4904 |
| 540 | Ga0207654_10001162 | 3300025911 | Bacteria | 14158 |
| 541 | Ga0207654_10073895 | 3300025911 | Bacteria | 2033 |
| 542 | Ga0207654_10202996 | 3300025911 | Bacteria | 1306 |
| 543 | Ga0207654_10354128 | 3300025911 | Bacteria | 1011 |
| 544 | Ga0207654_10626404 | 3300025911 | Bacteria | 769 |
| 545 | Ga0207707_10034688 | 3300025912 | Bacteria | 4414 |
| 546 | Ga0207707_10091889 | 3300025912 | Bacteria | 2652 |
| 547 | Ga0207707_10269563 | 3300025912 | Unclassified | 1476 |
| 548 | Ga0207707_10349962 | 3300025912 | Unclassified | 1273 |
| 549 | Ga0207707_10518131 | 3300025912 | Unclassified | 1016 |
| 550 | Ga0207695_10000137 | 3300025913 | Bacteria | 217180 |
| 551 | Ga0207695_10000507 | 3300025913 | Bacteria | 82878 |
| 552 | Ga0207695_10000977 | 3300025913 | Bacteria | 50828 |
| 553 | Ga0207695_10010221 | 3300025913 | Bacteria | 11509 |
| 554 | Ga0207695_10071410 | 3300025913 | Bacteria | 3546 |
| 555 | Ga0207695_10181029 | 3300025913 | Bacteria | 2028 |
| 556 | Ga0207695_10590627 | 3300025913 | Bacteria | 992 |
| 557 | Ga0207695_11248471 | 3300025913 | Bacteria | 623 |
| 558 | Ga0207695_11380941 | 3300025913 | Unclassified | 585 |
| 559 | Ga0207671_10000715 | 3300025914 | Bacteria | 42550 |
| 560 | Ga0207671_10018855 | 3300025914 | Bacteria | 5287 |
| 561 | Ga0207671_10131047 | 3300025914 | Unclassified | 1924 |
| 562 | Ga0207671_10274026 | 3300025914 | Bacteria | 1330 |
| 563 | Ga0207671_10284223 | 3300025914 | Bacteria | 1305 |
| 564 | Ga0207671_10521365 | 3300025914 | Bacteria | 947 |
| 565 | Ga0207693_10019524 | 3300025915 | Bacteria | 5390 |
| 566 | Ga0207693_10030149 | 3300025915 | Unclassified | 4284 |
| 567 | Ga0207693_10062742 | 3300025915 | Unclassified | 2911 |
| 568 | Ga0207693_10232893 | 3300025915 | Bacteria | 1446 |
| 569 | Ga0207693_10297967 | 3300025915 | Unclassified | 1263 |
| 570 | Ga0207693_10536621 | 3300025915 | Bacteria | 913 |
| 571 | Ga0207693_10750347 | 3300025915 | Bacteria | 754 |
| 572 | Ga0207663_10044163 | 3300025916 | Bacteria | 2734 |
| 573 | Ga0207663_10117955 | 3300025916 | Bacteria | 1812 |
| 574 | Ga0207663_10359508 | 3300025916 | Unclassified | 1104 |
| 575 | Ga0207663_10781252 | 3300025916 | Bacteria | 760 |
| 576 | Ga0207663_11733765 | 3300025916 | Bacteria | 502 |
| 577 | Ga0207660_10017429 | 3300025917 | Unclassified | 4772 |
| 578 | Ga0207660_10600428 | 3300025917 | Unclassified | 896 |
| 579 | Ga0207660_10654522 | 3300025917 | Unclassified | 857 |
| 580 | Ga0207660_11156870 | 3300025917 | Bacteria | 630 |
| 581 | Ga0207662_10138679 | 3300025918 | Bacteria | 1539 |
| 582 | Ga0207657_10604815 | 3300025919 | Bacteria | 855 |
| 583 | Ga0207649_10108589 | 3300025920 | Bacteria | 1850 |
| 584 | Ga0207649_10263870 | 3300025920 | Bacteria | 1246 |
| 585 | Ga0207649_10474467 | 3300025920 | Unclassified | 948 |
| 586 | Ga0207649_10805609 | 3300025920 | Bacteria | 733 |
| 587 | Ga0207652_10010717 | 3300025921 | Bacteria | 7380 |
| 588 | Ga0207652_10824770 | 3300025921 | Bacteria | 822 |
| 589 | Ga0207646_10000274 | 3300025922 | Bacteria | 70391 |
| 590 | Ga0207646_10124793 | 3300025922 | Bacteria | 2314 |
| 591 | Ga0207646_11270205 | 3300025922 | Unclassified | 644 |
| 592 | Ga0207681_10067441 | 3300025923 | Bacteria | 2481 |
| 593 | Ga0207681_10142669 | 3300025923 | Unclassified | 1786 |
| 594 | Ga0207681_10279623 | 3300025923 | Bacteria | 1314 |
| 595 | Ga0207681_10542913 | 3300025923 | Bacteria | 956 |
| 596 | Ga0207694_10000489 | 3300025924 | Bacteria | 35937 |
| 597 | Ga0207694_10001113 | 3300025924 | Bacteria | 23254 |
| 598 | Ga0207694_10058812 | 3300025924 | Bacteria | 2990 |
| 599 | Ga0207694_10397932 | 3300025924 | Unclassified | 1145 |
| 600 | Ga0207694_10706995 | 3300025924 | Bacteria | 850 |
| 601 | Ga0207650_10027803 | 3300025925 | Bacteria | 4051 |
| 602 | Ga0207650_11423400 | 3300025925 | Bacteria | 590 |
| 603 | Ga0207659_10071458 | 3300025926 | Bacteria | 2534 |
| 604 | Ga0207659_10355874 | 3300025926 | Unclassified | 1216 |
| 605 | Ga0207687_10005043 | 3300025927 | Bacteria | 8741 |
| 606 | Ga0207687_10030962 | 3300025927 | Bacteria | 3613 |
| 607 | Ga0207687_10305447 | 3300025927 | Bacteria | 1283 |
| 608 | Ga0207687_10480375 | 3300025927 | Bacteria | 1035 |
| 609 | Ga0207700_10022606 | 3300025928 | Bacteria | 4318 |
| 610 | Ga0207700_10347729 | 3300025928 | Bacteria | 1290 |
| 611 | Ga0207700_10435179 | 3300025928 | Bacteria | 1154 |
| 612 | Ga0207700_10609600 | 3300025928 | Bacteria | 972 |
| 613 | Ga0207700_11237745 | 3300025928 | Bacteria | 666 |
| 614 | Ga0207700_11589087 | 3300025928 | Unclassified | 579 |
| 615 | Ga0207664_10293073 | 3300025929 | Unclassified | 1430 |
| 616 | Ga0207664_10353376 | 3300025929 | Bacteria | 1301 |
| 617 | Ga0207664_10460067 | 3300025929 | Unclassified | 1136 |
| 618 | Ga0207664_10503319 | 3300025929 | Bacteria | 1085 |
| 619 | Ga0207664_10633943 | 3300025929 | Bacteria | 960 |
| 620 | Ga0207644_10005460 | 3300025931 | Bacteria | 8280 |
| 621 | Ga0207644_10114322 | 3300025931 | Unclassified | 2045 |
| 622 | Ga0207644_10242016 | 3300025931 | Bacteria | 1437 |
| 623 | Ga0207690_10042768 | 3300025932 | Bacteria | 2978 |
| 624 | Ga0207690_10049097 | 3300025932 | Bacteria | 2811 |
| 625 | Ga0207706_10021398 | 3300025933 | Bacteria | 5809 |
| 626 | Ga0207706_10216158 | 3300025933 | Bacteria | 1679 |
| 627 | Ga0207686_10251662 | 3300025934 | Bacteria | 1291 |
| 628 | Ga0207686_10940930 | 3300025934 | Bacteria | 699 |
| 629 | Ga0207670_10024415 | 3300025936 | Bacteria | 3778 |
| 630 | Ga0207670_11792564 | 3300025936 | Unclassified | 522 |
| 631 | Ga0207669_10056819 | 3300025937 | Bacteria | 2379 |
| 632 | Ga0207704_10014768 | 3300025938 | Bacteria | 3956 |
| 633 | Ga0207704_10055232 | 3300025938 | Bacteria | 2426 |
| 634 | Ga0207665_10007240 | 3300025939 | Bacteria | 7340 |
| 635 | Ga0207665_10029176 | 3300025939 | Unclassified | 3648 |
| 636 | Ga0207665_10264480 | 3300025939 | Bacteria | 1275 |
| 637 | Ga0207665_10658681 | 3300025939 | Unclassified | 821 |
| 638 | Ga0207665_10821320 | 3300025939 | Unclassified | 735 |
| 639 | Ga0207665_10870883 | 3300025939 | Unclassified | 714 |
| 640 | Ga0207691_10756684 | 3300025940 | Bacteria | 818 |
| 641 | Ga0207711_10000013 | 3300025941 | Bacteria | 514850 |
| 642 | Ga0207711_10004831 | 3300025941 | Bacteria | 11454 |
| 643 | Ga0207711_10011288 | 3300025941 | Bacteria | 7420 |
| 644 | Ga0207711_10075652 | 3300025941 | Bacteria | 2931 |
| 645 | Ga0207711_10127868 | 3300025941 | Bacteria | 2275 |
| 646 | Ga0207711_10139883 | 3300025941 | Unclassified | 2177 |
| 647 | Ga0207711_10243888 | 3300025941 | Bacteria | 1648 |
| 648 | Ga0207711_10793284 | 3300025941 | Bacteria | 882 |
| 649 | Ga0207711_11630623 | 3300025941 | Unclassified | 588 |
| 650 | Ga0207689_10005697 | 3300025942 | Bacteria | 11077 |
| 651 | Ga0207689_10041297 | 3300025942 | Bacteria | 3817 |
| 652 | Ga0207661_10000798 | 3300025944 | Bacteria | 20562 |
| 653 | Ga0207661_10041920 | 3300025944 | Bacteria | 3607 |
| 654 | Ga0207661_10117610 | 3300025944 | Bacteria | 2258 |
| 655 | Ga0207661_10134645 | 3300025944 | Bacteria | 2121 |
| 656 | Ga0207661_10484172 | 3300025944 | Unclassified | 1130 |
| 657 | Ga0207661_10643845 | 3300025944 | Bacteria | 974 |
| 658 | Ga0207661_11140228 | 3300025944 | Bacteria | 718 |
| 659 | Ga0207679_10006047 | 3300025945 | Bacteria | 7628 |
| 660 | Ga0207679_11216993 | 3300025945 | Bacteria | 691 |
| 661 | Ga0207679_11832945 | 3300025945 | Bacteria | 554 |
| 662 | Ga0207667_10000949 | 3300025949 | Bacteria | 36988 |
| 663 | Ga0207667_10018161 | 3300025949 | Bacteria | 7896 |
| 664 | Ga0207667_10018186 | 3300025949 | Bacteria | 7889 |
| 665 | Ga0207667_10934724 | 3300025949 | Bacteria | 857 |
| 666 | Ga0207667_11860129 | 3300025949 | Unclassified | 565 |
| 667 | Ga0207667_12159665 | 3300025949 | Unclassified | 514 |
| 668 | Ga0207651_10255046 | 3300025960 | Bacteria | 1437 |
| 669 | Ga0207651_10791363 | 3300025960 | Bacteria | 840 |
| 670 | Ga0207712_10558982 | 3300025961 | Unclassified | 985 |
| 671 | Ga0207712_11453660 | 3300025961 | Bacteria | 614 |
| 672 | Ga0207668_10318246 | 3300025972 | Bacteria | 1290 |
| 673 | Ga0207668_10387326 | 3300025972 | Unclassified | 1178 |
| 674 | Ga0207640_10009374 | 3300025981 | Bacteria | 5480 |
| 675 | Ga0207640_10879917 | 3300025981 | Bacteria | 781 |
| 676 | Ga0207640_10929768 | 3300025981 | Bacteria | 761 |
| 677 | Ga0207640_10989176 | 3300025981 | Unclassified | 739 |
| 678 | Ga0207658_10001464 | 3300025986 | Bacteria | 18403 |
| 679 | Ga0207658_10147840 | 3300025986 | Bacteria | 1910 |
| 680 | Ga0207677_10000778 | 3300026023 | Bacteria | 18330 |
| 681 | Ga0207677_10118110 | 3300026023 | Bacteria | 1989 |
| 682 | Ga0207677_10505136 | 3300026023 | Bacteria | 1046 |
| 683 | Ga0207703_10001909 | 3300026035 | Bacteria | 18473 |
| 684 | Ga0207703_10011249 | 3300026035 | Bacteria | 6962 |
| 685 | Ga0207703_10976433 | 3300026035 | Bacteria | 812 |
| 686 | Ga0207639_10009769 | 3300026041 | Bacteria | 6629 |
| 687 | Ga0207639_10035702 | 3300026041 | Bacteria | 3679 |
| 688 | Ga0207639_10123026 | 3300026041 | Bacteria | 2135 |
| 689 | Ga0207639_10163037 | 3300026041 | Bacteria | 1880 |
| 690 | Ga0207639_10754385 | 3300026041 | Bacteria | 905 |
| 691 | Ga0207678_10209812 | 3300026067 | Bacteria | 1666 |
| 692 | Ga0207678_10351868 | 3300026067 | Unclassified | 1270 |
| 693 | Ga0207708_10059743 | 3300026075 | Unclassified | 2910 |
| 694 | Ga0207708_10326206 | 3300026075 | Unclassified | 1254 |
| 695 | Ga0207708_10786606 | 3300026075 | Unclassified | 818 |
| 696 | Ga0207702_10000993 | 3300026078 | Bacteria | 29058 |
| 697 | Ga0207702_10010856 | 3300026078 | Bacteria | 7597 |
| 698 | Ga0207702_10047430 | 3300026078 | Bacteria | 3620 |
| 699 | Ga0207702_10053630 | 3300026078 | Bacteria | 3414 |
| 700 | Ga0207702_10130688 | 3300026078 | Bacteria | 2259 |
| 701 | Ga0207702_10695650 | 3300026078 | Bacteria | 1002 |
| 702 | Ga0207702_11038180 | 3300026078 | Unclassified | 813 |
| 703 | Ga0207702_12122749 | 3300026078 | Bacteria | 551 |
| 704 | Ga0207641_10005473 | 3300026088 | Bacteria | 10831 |
| 705 | Ga0207641_10208489 | 3300026088 | Bacteria | 1806 |
| 706 | Ga0207641_12460237 | 3300026088 | Bacteria | 519 |
| 707 | Ga0207641_12536709 | 3300026088 | Unclassified | 511 |
| 708 | Ga0207648_10053848 | 3300026089 | Bacteria | 3516 |
| 709 | Ga0207648_10262782 | 3300026089 | Bacteria | 1540 |
| 710 | Ga0207648_10426940 | 3300026089 | Unclassified | 1204 |
| 711 | Ga0207648_10673594 | 3300026089 | Bacteria | 957 |
| 712 | Ga0207648_11620935 | 3300026089 | Unclassified | 608 |
| 713 | Ga0207676_10008589 | 3300026095 | Bacteria | 7257 |
| 714 | Ga0207676_10017059 | 3300026095 | Bacteria | 5261 |
| 715 | Ga0207676_10436942 | 3300026095 | Bacteria | 1231 |
| 716 | Ga0207676_10549555 | 3300026095 | Unclassified | 1103 |
| 717 | Ga0207676_11102017 | 3300026095 | Bacteria | 785 |
| 718 | Ga0207674_10006657 | 3300026116 | Bacteria | 13574 |
| 719 | Ga0207674_10013263 | 3300026116 | Bacteria | 9154 |
| 720 | Ga0207674_10064133 | 3300026116 | Bacteria | 3706 |
| 721 | Ga0207674_10071193 | 3300026116 | Bacteria | 3494 |
| 722 | Ga0207674_10077229 | 3300026116 | Bacteria | 3336 |
| 723 | Ga0207674_10102867 | 3300026116 | Bacteria | 2836 |
| 724 | Ga0207674_10112268 | 3300026116 | Bacteria | 2699 |
| 725 | Ga0207675_101191715 | 3300026118 | Unclassified | 782 |
| 726 | Ga0207698_10000003 | 3300026142 | Bacteria | 321303 |
| 727 | Ga0207698_10333792 | 3300026142 | Bacteria | 1425 |
| 728 | Ga0207698_10914499 | 3300026142 | Bacteria | 885 |
| 729 | Ga0207698_11044170 | 3300026142 | Bacteria | 829 |
| 730 | Ga0207698_12463396 | 3300026142 | Bacteria | 531 |
| 731 | Ga0207428_10005795 | 3300027907 | Bacteria | 11458 |
| 732 | Ga0207428_10087962 | 3300027907 | Unclassified | 2416 |
| 733 | Ga0207428_10121757 | 3300027907 | Bacteria | 2000 |
| 734 | Ga0207428_10216907 | 3300027907 | Bacteria | 1436 |
| 735 | Ga0207428_10409387 | 3300027907 | Unclassified | 992 |
| 736 | Ga0265354_1000083 | 3300028016 | Bacteria | 16178 |
| 737 | Ga0265354_1001617 | 3300028016 | Bacteria | 3147 |
| 738 | Ga0265357_1004030 | 3300028023 | Bacteria | 1304 |
| 739 | Ga0268266_10009093 | 3300028379 | Bacteria | 8772 |
| 740 | Ga0268266_10016382 | 3300028379 | Bacteria | 6338 |
| 741 | Ga0268266_10016622 | 3300028379 | Bacteria | 6287 |
| 742 | Ga0268266_10018097 | 3300028379 | Bacteria | 6006 |
| 743 | Ga0268266_10173735 | 3300028379 | Bacteria | 1957 |
| 744 | Ga0268266_10275155 | 3300028379 | Bacteria | 1564 |
| 745 | Ga0268266_11172728 | 3300028379 | Bacteria | 743 |
| 746 | Ga0268266_12339006 | 3300028379 | Unclassified | 505 |
| 747 | Ga0268265_10968660 | 3300028380 | Unclassified | 839 |
| 748 | Ga0268265_11304118 | 3300028380 | Bacteria | 726 |
| 749 | Ga0268264_10003955 | 3300028381 | Bacteria | 12691 |
| 750 | Ga0268264_10455431 | 3300028381 | Bacteria | 1240 |
| 751 | Ga0268264_10653453 | 3300028381 | Bacteria | 1041 |
| 752 | Ga0268264_12150693 | 3300028381 | Bacteria | 566 |
| 753 | Ga0265318_10113568 | 3300028577 | Unclassified | 996 |
| 754 | Ga0265338_10000633 | 3300028800 | Bacteria | 61054 |
| 755 | Ga0265338_11018929 | 3300028800 | Unclassified | 560 |
| 756 | Ga0265338_11104122 | 3300028800 | Unclassified | 534 |
| 757 | Ga0265316_10003465 | 3300031344 | Bacteria | 15942 |
| 758 | Ga0265316_10054004 | 3300031344 | Bacteria | 3146 |
| 759 | Ga0265316_10910816 | 3300031344 | Bacteria | 614 |
| 760 | Ga0307408_100292809 | 3300031548 | Bacteria | 1360 |
| 761 | Ga0265342_10230523 | 3300031712 | Bacteria | 995 |
| 762 | Ga0307413_10248456 | 3300031824 | Bacteria | 1318 |
| 763 | Ga0307412_10379672 | 3300031911 | Bacteria | 1144 |
| 764 | Ga0307409_100060772 | 3300031995 | Bacteria | 2949 |
| 765 | Ga0307416_100139569 | 3300032002 | Bacteria | 2200 |
| 766 | Ga0307416_100210889 | 3300032002 | Unclassified | 1853 |
| 767 | Ga0307411_11243477 | 3300032005 | Bacteria | 676 |
| 768 | Ga0307415_102591393 | 3300032126 | Bacteria | 500 |
| 769 | Ga0307510_10035621 | 3300033180 | Bacteria | 5554 |
| 770 | Ga0307510_10055224 | 3300033180 | Bacteria | 4150 |
| 771 | Ga0316212_1003127 | 3300033547 | Bacteria | 2383 |
| 772 | Ga0373926_0433779 | 3300035083 | Bacteria | 521 |
| 773 | Ga0373934_0003047 | 3300035086 | Bacteria | 6121 |
| 774 | Ga0373934_0339498 | 3300035086 | Bacteria | 625 |
| 775 | Ga0373944_0053675 | 3300035089 | Bacteria | 1276 |
| 776 | Ga0373923_0078233 | 3300035111 | Bacteria | 1431 |
| 777 | Ga0373923_0403385 | 3300035111 | Bacteria | 658 |
| 778 | Ga0373945_0196239 | 3300035116 | Bacteria | 836 |
| 779 | Ga0373953_0392920 | 3300035117 | Unclassified | 610 |
| 780 | Ga0373954_0310448 | 3300035118 | Unclassified | 778 |
| 781 | Ga0373956_0050296 | 3300035119 | Bacteria | 1871 |
| 782 | Ga0373957_0002475 | 3300035120 | Bacteria | 5284 |
| 783 | Ga0373957_0061884 | 3300035120 | Bacteria | 1452 |
| 784 | Ga0373943_0001766 | 3300035170 | Bacteria | 9785 |
| 785 | Ga0373943_0226182 | 3300035170 | Bacteria | 1044 |
| 786 | Ga0373946_0148313 | 3300035171 | Bacteria | 1092 |
| 787 | Ga0373955_0017602 | 3300035172 | Bacteria | 3540 |
| 788 | Ga0373955_0080341 | 3300035172 | Unclassified | 1841 |
| 789 | Ga0373955_0365746 | 3300035172 | Bacteria | 874 |
| 790 | Ga0373962_0015765 | 3300035242 | Bacteria | 1942 |
| 791 | Ga0373924_0061798 | 3300035410 | Bacteria | 1568 |
| 792 | Ga0373931_0573099 | 3300035691 | Bacteria | 735 |
| 793 | Ga0373935_0073152 | 3300035692 | Bacteria | 2214 |
| 794 | Ga0373935_0196278 | 3300035692 | Bacteria | 1393 |
| 795 | Ga0373935_0348944 | 3300035692 | Bacteria | 1055 |
| 796 | Ga0373935_0864008 | 3300035692 | Unclassified | 669 |
| 797 | Ga0373927_0719385 | 3300035695 | Bacteria | 660 |
| 798 | Ga0373933_0013083 | 3300035724 | Bacteria | 4594 |
| 799 | Ga0373933_0210974 | 3300035724 | Bacteria | 1244 |
| 800 | Ga0373933_0320853 | 3300035724 | Bacteria | 1004 |
| 801 | Ga0373947_0016792 | 3300035725 | Bacteria | 4206 |
| 802 | Ga0373947_0561951 | 3300035725 | Unclassified | 777 |
| 803 | Ga0373947_1007862 | 3300035725 | Bacteria | 568 |
| 804 | Ga0373937_0000128 | 3300036401 | Bacteria | 73001 |
| 805 | Ga0373937_0038684 | 3300036401 | Bacteria | 4347 |
| 806 | Ga0373937_0380166 | 3300036401 | Bacteria | 1339 |
| 807 | Ga0373937_0490443 | 3300036401 | Bacteria | 1167 |
| 808 | Ga0373937_0659105 | 3300036401 | Bacteria | 992 |
| 809 | Ga0373937_0736884 | 3300036401 | Bacteria | 933 |
| 810 | Ga0373937_1240238 | 3300036401 | Bacteria | 694 |
| 811 | Ga0373937_1412561 | 3300036401 | Bacteria | 644 |
| 812 | Ga0373925_0102695 | 3300037068 | Bacteria | 2200 |
| 813 | Ga0373925_0348076 | 3300037068 | Bacteria | 1203 |
| 814 | Ga0373925_0639282 | 3300037068 | Bacteria | 877 |
| 815 | Ga0395900_0242309 | 3300037418 | Unclassified | 1808 |
| 816 | Ga0395898_0085889 | 3300037466 | Unclassified | 3033 |
| 817 | Ga0395898_0215743 | 3300037466 | Bacteria | 1830 |
| 818 | Ga0395898_0470717 | 3300037466 | Unclassified | 1196 |
| 819 | Ga0395898_1971467 | 3300037466 | Bacteria | 503 |
| 820 | Ga0436364_0070346 | 3300037853 | Unclassified | 1003 |
| 821 | Ga0436364_0535317 | 3300037853 | Unclassified | 1869 |
| 822 | Ga0395901_2006214 | 3300038443 | Bacteria | 525 |
| 823 | Ga0436365_1510286 | 3300039437 | Bacteria | 1893 |
| 824 | Ga0436365_1548667 | 3300039437 | Bacteria | 1476 |
| 825 | Ga0436360_0002192 | 3300039438 | Bacteria | 2917 |
| 826 | Ga0436361_0140635 | 3300039447 | Bacteria | 1214 |
| 827 | Ga0436361_0187674 | 3300039447 | Bacteria | 6084 |
| 828 | Ga0436361_0406737 | 3300039447 | Unclassified | 1199 |
| 829 | Ga0436363_1004445 | 3300039450 | Bacteria | 787 |
| 830 | Ga0436362_1130226 | 3300039453 | Bacteria | 780 |
| 831 | Ga0451804_0927833 | 3300041463 | Unclassified | 642 |
| 832 | Ga0439448_0099134 | 3300042005 | Bacteria | 989 |
| 833 | Ga0439457_110910 | 3300042014 | Bacteria | 644 |
| 834 | Ga0450898_045807 | 3300042134 | Bacteria | 836 |
| 835 | Ga0450910_021168 | 3300042147 | Unclassified | 984 |
| 836 | Ga0439444_0023254 | 3300042437 | Unclassified | 1111 |
| 837 | Ga0466961_0046544 | 3300044693 | Bacteria | 2774 |
| 838 | Ga0466963_0000875 | 3300044694 | Bacteria | 15265 |
| 839 | Ga0466963_0013109 | 3300044694 | Bacteria | 5085 |
| 840 | Ga0466963_0094757 | 3300044694 | Bacteria | 2037 |
| 841 | Ga0466963_1169399 | 3300044694 | Unclassified | 541 |
| 842 | Ga0466957_0813307 | 3300044842 | Bacteria | 664 |
| 843 | Ga0466957_1070052 | 3300044842 | Bacteria | 581 |
| 844 | Ga0466959_0636856 | 3300045049 | Unclassified | 716 |
| 845 | Ga0451576_0663548 | 3300045051 | Bacteria | 1096 |
| 846 | Ga0466958_0106011 | 3300045836 | Bacteria | 1752 |
| 847 | Ga0466958_0188991 | 3300045836 | Bacteria | 1309 |
| 848 | Ga0466958_0616003 | 3300045836 | Bacteria | 706 |
| 849 | Ga0466967_0011480 | 3300045976 | Bacteria | 6713 |
| 850 | Ga0466967_0026524 | 3300045976 | Bacteria | 4801 |
| 851 | Ga0466967_0363195 | 3300045976 | Bacteria | 1403 |
| 852 | Ga0466967_1216879 | 3300045976 | Bacteria | 750 |
| 853 | Ga0466967_1276418 | 3300045976 | Unclassified | 731 |
| 854 | Ga0466967_1333253 | 3300045976 | Bacteria | 715 |
| 855 | Ga0466967_1779275 | 3300045976 | Bacteria | 613 |
| 856 | Ga0495592_0437696 | 3300046454 | Bacteria | 822 |
| 857 | Ga0495592_0696265 | 3300046454 | Bacteria | 612 |
| 858 | Ga0495651_0014543 | 3300046462 | Bacteria | 6085 |
| 859 | Ga0495651_0203781 | 3300046462 | Unclassified | 1382 |
| 860 | Ga0495580_0007919 | 3300046472 | Bacteria | 8499 |
| 861 | Ga0495580_0140239 | 3300046472 | Bacteria | 1676 |
| 862 | Ga0495580_0527700 | 3300046472 | Unclassified | 786 |
| 863 | Ga0495582_0121512 | 3300046473 | Bacteria | 1472 |
| 864 | Ga0495639_0293504 | 3300046475 | Unclassified | 810 |
| 865 | Ga0495639_0731891 | 3300046475 | Bacteria | 512 |
| 866 | Ga0495662_0038863 | 3300046476 | Bacteria | 2299 |
| 867 | Ga0495662_0441551 | 3300046476 | Bacteria | 639 |
| 868 | Ga0495664_0111147 | 3300046477 | Bacteria | 1654 |
| 869 | Ga0495664_0156465 | 3300046477 | Bacteria | 1383 |
| 870 | Ga0495664_0476989 | 3300046477 | Bacteria | 746 |
| 871 | Ga0495583_0211198 | 3300046506 | Bacteria | 786 |
| 872 | Ga0495608_0906505 | 3300046511 | Unclassified | 516 |
| 873 | Ga0495618_0461267 | 3300046514 | Bacteria | 770 |
| 874 | Ga0495628_0111608 | 3300046516 | Unclassified | 2102 |
| 875 | Ga0495628_0189925 | 3300046516 | Bacteria | 1551 |
| 876 | Ga0495630_0836674 | 3300046517 | Bacteria | 702 |
| 877 | Ga0495630_1120294 | 3300046517 | Bacteria | 596 |
| 878 | Ga0495632_0077348 | 3300046519 | Bacteria | 1591 |
| 879 | Ga0495643_0433222 | 3300046522 | Bacteria | 575 |
| 880 | Ga0495644_0107635 | 3300046523 | Bacteria | 1057 |
| 881 | Ga0495666_0238273 | 3300046526 | Bacteria | 831 |
| 882 | Ga0495642_0094834 | 3300046528 | Bacteria | 1266 |
| 883 | Ga0495642_0244331 | 3300046528 | Bacteria | 785 |
| 884 | Ga0495652_0132405 | 3300046529 | Bacteria | 1972 |
| 885 | Ga0495652_0222440 | 3300046529 | Unclassified | 1418 |
| 886 | Ga0495652_0429922 | 3300046529 | Bacteria | 929 |
| 887 | Ga0495665_0228283 | 3300046531 | Bacteria | 962 |
| 888 | Ga0495665_0269507 | 3300046531 | Unclassified | 875 |
| 889 | Ga0495665_0308116 | 3300046531 | Bacteria | 810 |
| 890 | Ga0495665_0365725 | 3300046531 | Bacteria | 734 |
| 891 | Ga0495640_0134369 | 3300046533 | Bacteria | 1599 |
| 892 | Ga0495587_0013184 | 3300046536 | Bacteria | 5198 |
| 893 | Ga0495587_0152782 | 3300046536 | Bacteria | 1316 |
| 894 | Ga0495587_0178516 | 3300046536 | Bacteria | 1205 |
| 895 | Ga0495587_0186875 | 3300046536 | Unclassified | 1174 |
| 896 | Ga0495621_0001440 | 3300046539 | Bacteria | 6160 |
| 897 | Ga0495645_0007238 | 3300046543 | Bacteria | 7723 |
| 898 | Ga0495645_0072644 | 3300046543 | Unclassified | 2479 |
| 899 | Ga0495645_0096774 | 3300046543 | Bacteria | 2103 |
| 900 | Ga0495645_0329025 | 3300046543 | Bacteria | 990 |
| 901 | Ga0495645_0348118 | 3300046543 | Unclassified | 955 |
| 902 | Ga0495645_0453740 | 3300046543 | Bacteria | 808 |
| 903 | Ga0495622_0328423 | 3300046557 | Unclassified | 664 |
| 904 | Ga0495667_0016197 | 3300046559 | Bacteria | 5036 |
| 905 | Ga0495656_0237859 | 3300046615 | Unclassified | 916 |
| 906 | Ga0495625_0013264 | 3300046660 | Bacteria | 6630 |
| 907 | Ga0495625_0078240 | 3300046660 | Bacteria | 2309 |
| 908 | Ga0495625_0182317 | 3300046660 | Bacteria | 1395 |
| 909 | Ga0495635_0047508 | 3300046663 | Bacteria | 2960 |
| 910 | Ga0495635_0432344 | 3300046663 | Bacteria | 872 |
| 911 | Ga0495657_0256866 | 3300046675 | Bacteria | 1051 |
| 912 | Ga0495657_0665732 | 3300046675 | Bacteria | 600 |
| 913 | Ga0495599_0224628 | 3300046678 | Bacteria | 1148 |
| 914 | Ga0495623_0033455 | 3300046679 | Bacteria | 3298 |
| 915 | Ga0495623_0430243 | 3300046679 | Bacteria | 706 |
| 916 | Ga0495623_0714883 | 3300046679 | Bacteria | 512 |
| 917 | Ga0495647_0404051 | 3300046681 | Unclassified | 628 |
| 918 | Ga0495658_0376940 | 3300046683 | Unclassified | 903 |
| 919 | Ga0495658_1021613 | 3300046683 | Bacteria | 528 |
| 920 | Ga0495669_0023858 | 3300046684 | Bacteria | 2665 |
| 921 | Ga0495669_0410793 | 3300046684 | Unclassified | 656 |
| 922 | Ga0495613_0141923 | 3300046689 | Bacteria | 1716 |
| 923 | Ga0495613_0194136 | 3300046689 | Bacteria | 1434 |
| 924 | Ga0495613_0422626 | 3300046689 | Bacteria | 907 |
| 925 | Ga0495649_0051662 | 3300046694 | Bacteria | 2229 |
| 926 | Ga0495581_0849511 | 3300047315 | Bacteria | 522 |
| 927 | Ga0495604_0295119 | 3300047317 | Bacteria | 1090 |
| 928 | Ga0495674_0095645 | 3300047319 | Bacteria | 2532 |
| 929 | Ga0495674_0271743 | 3300047319 | Unclassified | 1390 |
| 930 | Ga0495674_0488278 | 3300047319 | Bacteria | 986 |
| 931 | Ga0495680_0260179 | 3300047322 | Bacteria | 1227 |
| 932 | Ga0495680_0939060 | 3300047322 | Unclassified | 556 |
| 933 | Ga0495684_0010939 | 3300047471 | Bacteria | 7015 |
| 934 | Ga0495684_0087349 | 3300047471 | Bacteria | 2363 |
| 935 | Ga0495684_0299208 | 3300047471 | Bacteria | 1156 |
| 936 | Ga0495684_0776834 | 3300047471 | Bacteria | 628 |
| 937 | Ga0495684_0821433 | 3300047471 | Bacteria | 605 |
| 938 | Ga0495602_0064498 | 3300048088 | Unclassified | 3167 |
| 939 | Ga0495602_0178557 | 3300048088 | Bacteria | 1640 |
| 940 | Ga0495602_0197982 | 3300048088 | Bacteria | 1535 |
| 941 | Ga0495602_0246388 | 3300048088 | Bacteria | 1334 |
| 942 | Ga0495602_0406509 | 3300048088 | Bacteria | 970 |
| 943 | Ga0495602_0657658 | 3300048088 | Bacteria | 715 |
| 944 | Ga0496102_0456470 | 3300048905 | Bacteria | 1199 |
| 945 | Ga0496102_1461873 | 3300048905 | Unclassified | 602 |
| 946 | Ga0496104_0054117 | 3300048907 | Bacteria | 3793 |
| 947 | Ga0496104_1129462 | 3300048907 | Unclassified | 687 |
| 948 | Ga0496104_1221726 | 3300048907 | Bacteria | 655 |
| 949 | Ga0496106_0727480 | 3300048909 | Bacteria | 790 |
| 950 | Ga0496107_1311659 | 3300048910 | Unclassified | 518 |
| 951 | Ga0496108_0059022 | 3300048911 | Bacteria | 3226 |
| 952 | Ga0496109_0071771 | 3300048912 | Bacteria | 3180 |
| 953 | Ga0496110_0902567 | 3300048913 | Bacteria | 790 |
| 954 | Ga0496112_0010236 | 3300048915 | Bacteria | 8501 |
| 955 | Ga0496112_0042857 | 3300048915 | Bacteria | 4429 |
| 956 | Ga0496112_0230180 | 3300048915 | Bacteria | 1808 |
| 957 | Ga0496112_0848066 | 3300048915 | Bacteria | 837 |
| 958 | Ga0496113_0015241 | 3300048916 | Bacteria | 5276 |
| 959 | Ga0496114_1244938 | 3300048917 | Unclassified | 631 |
| 960 | Ga0496115_0046507 | 3300048918 | Plasmid | 3469 |
| 961 | Ga0496115_0189957 | 3300048918 | Unclassified | 1697 |
| 962 | Ga0496115_0261138 | 3300048918 | Bacteria | 1424 |
| 963 | Ga0496115_0462612 | 3300048918 | Bacteria | 1023 |
| 964 | Ga0496126_0003557 | 3300048929 | Bacteria | 19573 |
| 965 | Ga0495682_0020421 | 3300049460 | Bacteria | 2487 |
| 966 | Ga0495682_0096380 | 3300049460 | Bacteria | 1062 |
| 967 | Ga0495682_0177594 | 3300049460 | Bacteria | 757 |
| 968 | Ga0501031_0004907 | 3300049568 | Bacteria | 8692 |
| 969 | Ga0501031_0184343 | 3300049568 | Bacteria | 1363 |
| 970 | Ga0501031_0314796 | 3300049568 | Bacteria | 1014 |
| 971 | Ga0501032_0001053 | 3300049569 | Bacteria | 22060 |
| 972 | Ga0501032_0324618 | 3300049569 | Bacteria | 993 |
| 973 | Ga0501033_0011227 | 3300049570 | Bacteria | 6859 |
| 974 | Ga0501033_0515890 | 3300049570 | Bacteria | 826 |
| 975 | Ga0501033_0546726 | 3300049570 | Bacteria | 798 |
| 976 | Ga0501034_0007884 | 3300049571 | Bacteria | 11319 |
| 977 | Ga0501036_0007012 | 3300049572 | Bacteria | 9173 |
| 978 | Ga0501037_0009727 | 3300049573 | Bacteria | 7057 |
| 979 | Ga0501038_0002358 | 3300049574 | Bacteria | 17603 |
| 980 | Ga0501039_0031801 | 3300049575 | Bacteria | 4069 |
| 981 | Ga0501039_0190301 | 3300049575 | Unclassified | 1614 |
| 982 | Ga0501042_0162494 | 3300049578 | Bacteria | 1611 |
| 983 | Ga0501043_0000445 | 3300049579 | Bacteria | 37181 |
| 984 | Ga0501043_0733027 | 3300049579 | Bacteria | 720 |
| 985 | Ga0501046_0000036 | 3300049580 | Bacteria | 159823 |
| 986 | Ga0501047_0000401 | 3300049581 | Bacteria | 48785 |
| 987 | Ga0501048_0538894 | 3300049582 | Unclassified | 837 |
| 988 | Ga0501048_1103363 | 3300049582 | Bacteria | 571 |
| 989 | Ga0501068_0552876 | 3300049584 | Bacteria | 748 |
| 990 | Ga0501069_0619017 | 3300049585 | Bacteria | 650 |
| 991 | Ga0501070_0108996 | 3300049586 | Bacteria | 2288 |
| 992 | Ga0501071_0136913 | 3300049587 | Unclassified | 1822 |
| 993 | Ga0501073_0036298 | 3300049589 | Bacteria | 3502 |
| 994 | Ga0501073_1072865 | 3300049589 | Bacteria | 554 |
| 995 | Ga0501074_0869555 | 3300049590 | Bacteria | 635 |
| 996 | Ga0501075_1392700 | 3300049591 | Bacteria | 531 |
| 997 | Ga0501076_0273277 | 3300049592 | Bacteria | 1384 |
| 998 | Ga0501077_0295874 | 3300049593 | Bacteria | 1031 |
| 999 | Ga0501209_085533 | 3300049656 | Bacteria | 913 |
| 1000 | Ga0501216_151238 | 3300049660 | Bacteria | 552 |
| 1001 | Ga0501217_177167 | 3300049661 | Bacteria | 652 |
| 1002 | Ga0501080_0689457 | 3300049742 | Bacteria | 902 |
| 1003 | Ga0501081_0956885 | 3300049743 | Unclassified | 646 |
| 1004 | Ga0501083_0878987 | 3300049744 | Unclassified | 583 |
| 1005 | Ga0501263_097533 | 3300049760 | Bacteria | 502 |
| 1006 | Ga0501268_038471 | 3300049765 | Bacteria | 892 |
| 1007 | Ga0501270_165014 | 3300049767 | Bacteria | 514 |
| 1008 | Ga0501035_0037475 | 3300049822 | Bacteria | 4391 |
| 1009 | Ga0501044_0106294 | 3300049823 | Bacteria | 2819 |
| 1010 | Ga0501044_0107514 | 3300049823 | Bacteria | 2800 |
| 1011 | Ga0501044_0474344 | 3300049823 | Bacteria | 1155 |
| 1012 | Ga0501045_0338297 | 3300049824 | Bacteria | 1120 |
| 1013 | nmdc:mga03683_62635_c1 | 3300050489 | Bacteria | 1576 |
| 1014 | nmdc:mga00v17_424188_c1 | 3300050491 | Unclassified | 864 |
| 1015 | nmdc:mga00v17_548755_c1 | 3300050491 | Unclassified | 747 |
| 1016 | nmdc:mga0k408_23088_c1 | 3300050493 | Unclassified | 2219 |
| 1017 | nmdc:mga05p37_12177_c1 | 3300050507 | Bacteria | 10270 |
| 1018 | nmdc:mga05p37_1604076_c1 | 3300050507 | Unclassified | 641 |
| 1019 | nmdc:mga05p37_1668157_c1 | 3300050507 | Bacteria | 623 |
| 1020 | nmdc:mga05p37_362476_c1 | 3300050507 | Bacteria | 1703 |
| 1021 | nmdc:mga05p37_485758_c1 | 3300050507 | Bacteria | 1421 |
| 1022 | nmdc:mga05p37_972315_c1 | 3300050507 | Bacteria | 906 |
| 1023 | nmdc:mga09592_14839_c1 | 3300050508 | Bacteria | 3885 |
| 1024 | nmdc:mga0qj67_11613_c1 | 3300050509 | Bacteria | 6604 |
| 1025 | nmdc:mga06r32_30750_c1 | 3300050510 | Bacteria | 5039 |
| 1026 | nmdc:mga08y16_105683_c1 | 3300050511 | Unclassified | 2931 |
| 1027 | nmdc:mga08y16_128892_c1 | 3300050511 | Bacteria | 2632 |
| 1028 | nmdc:mga08y16_1444664_c1 | 3300050511 | Unclassified | 650 |
| 1029 | nmdc:mga08y16_1736026_c1 | 3300050511 | Bacteria | 579 |
| 1030 | nmdc:mga08y16_225902_c1 | 3300050511 | Unclassified | 1937 |
| 1031 | nmdc:mga08y16_280977_c1 | 3300050511 | Bacteria | 1717 |
| 1032 | nmdc:mga08y16_319318_c1 | 3300050511 | Unclassified | 1599 |
| 1033 | nmdc:mga08y16_6711_c1 | 3300050511 | Bacteria | 8193 |
| 1034 | nmdc:mga08y16_69785_c1 | 3300050511 | Unclassified | 3663 |
| 1035 | nmdc:mga08y16_740277_c1 | 3300050511 | Bacteria | 980 |
| 1036 | nmdc:mga0n895_1589850_c1 | 3300050512 | Bacteria | 618 |
| 1037 | nmdc:mga0n895_1676672_c1 | 3300050512 | Unclassified | 599 |
| 1038 | nmdc:mga0n895_278644_c1 | 3300050512 | Unclassified | 1696 |
| 1039 | nmdc:mga0n895_403705_c1 | 3300050512 | Bacteria | 1382 |
| 1040 | nmdc:mga0n895_6_c1 | 3300050512 | Bacteria | 122829 |
| 1041 | nmdc:mga0n895_946177_c1 | 3300050512 | Unclassified | 845 |
| 1042 | nmdc:mga0rr50_7_c1 | 3300050513 | Bacteria | 297175 |
| 1043 | nmdc:mga08x19_19330_c1 | 3300050514 | Bacteria | 4179 |
| 1044 | nmdc:mga08x19_497501_c2 | 3300050514 | Unclassified | 566 |
| 1045 | nmdc:mga08x19_769705_c1 | 3300050514 | Unclassified | 684 |
| 1046 | nmdc:mga0sz30_240149_c1 | 3300050516 | Unclassified | 806 |
| 1047 | Ga0495601_0068385 | 3300053077 | Bacteria | 2264 |
| 1048 | Ga0495619_0160201 | 3300053085 | Bacteria | 1554 |
| 1049 | Ga0500644_0010547 | 3300053088 | Bacteria | 2503 |
| 1050 | Ga0500595_068531 | 3300053119 | Bacteria | 1056 |
| 1051 | Ga0500573_0389849 | 3300053140 | Bacteria | 663 |
| 1052 | Ga0501084_0051231 | 3300054114 | Unclassified | 3455 |
| 1053 | Ga0501084_1119007 | 3300054114 | Unclassified | 661 |
| 1054 | Ga0590074_076958 | 3300059423 | Unclassified | 634 |
| 1055 | Ga0501082_0426066 | 3300060353 | Bacteria | 1159 |
| 1056 | 2884218423 | 2884215851 | Bacteria | 4554841 |
| 1057 | Ga0070713_100377536 | |||
| 1058 | LJQas_1018996 | |||
| 1059 | JGI24743J22301_10035696 | |||
| 1060 | rootH2_10018443 | |||
| 1061 | rootH2_10164600 | |||
| 1062 | Ga0065712_10007270 | |||
| 1063 | Ga0065712_10371216 | |||
| 1064 | Ga0065707_10021146 | |||
| 1065 | Ga0070658_10013361 | |||
| 1066 | Ga0070658_10034110 | |||
| 1067 | Ga0070658_10329417 | |||
| 1068 | Ga0070658_10493593 | |||
| 1069 | Ga0070676_10089547 | |||
| 1070 | Ga0070676_11537669 | |||
| 1071 | Ga0070683_100002722 | |||
| 1072 | Ga0070683_100028428 | |||
| 1073 | Ga0070683_100046668 | |||
| 1074 | Ga0070683_100223184 | |||
| 1075 | Ga0070683_100521440 | |||
| 1076 | Ga0070683_101963630 | |||
| 1077 | Ga0070690_100215992 | |||
| 1078 | Ga0070690_101676153 | |||
| 1079 | Ga0070670_100004622 | |||
| 1080 | Ga0070670_100064316 | |||
| 1081 | Ga0070670_101836986 | |||
| 1082 | Ga0070677_10212651 | |||
| 1083 | Ga0068869_100001480 | |||
| 1084 | Ga0068869_100053182 | |||
| 1085 | Ga0070666_10250285 | |||
| 1086 | Ga0070666_10771240 | |||
| 1087 | Ga0070666_10785031 | |||
| 1088 | Ga0070666_11007165 | |||
| 1089 | Ga0070680_100023336 | |||
| 1090 | Ga0070680_100675101 | |||
| 1091 | Ga0070680_100747392 | |||
| 1092 | Ga0070680_101200611 | |||
| 1093 | Ga0068868_100001675 | |||
| 1094 | Ga0068868_100001769 | |||
| 1095 | Ga0068868_100014180 | |||
| 1096 | Ga0068868_100159395 | |||
| 1097 | Ga0068868_101256856 | |||
| 1098 | Ga0070660_100999219 | |||
| 1099 | Ga0070689_100045833 | |||
| 1100 | Ga0070689_100078169 | |||
| 1101 | Ga0070689_100985056 | |||
| 1102 | Ga0070691_10706992 | |||
| 1103 | Ga0070661_100084771 | |||
| 1104 | Ga0070661_100112213 | |||
| 1105 | Ga0070661_100862649 | |||
| 1106 | Ga0070692_11206343 | |||
| 1107 | Ga0070668_100039692 | |||
| 1108 | Ga0070668_100434834 | |||
| 1109 | Ga0070669_100133379 | |||
| 1110 | Ga0070669_100146696 | |||
| 1111 | Ga0070675_100031843 | |||
| 1112 | Ga0070675_100145745 | |||
| 1113 | Ga0070675_100439117 | |||
| 1114 | Ga0070675_102214286 | |||
| 1115 | Ga0070671_100004037 | |||
| 1116 | Ga0070671_100041323 | |||
| 1117 | Ga0070671_100084330 | |||
| 1118 | Ga0070671_101932863 | |||
| 1119 | Ga0070674_100309144 | |||
| 1120 | Ga0070674_101759886 | |||
| 1121 | Ga0070673_100013898 | |||
| 1122 | Ga0070673_101470166 | |||
| 1123 | Ga0070673_101649091 | |||
| 1124 | Ga0070688_100276814 | |||
| 1125 | Ga0070688_100351228 | |||
| 1126 | Ga0070659_100094319 | |||
| 1127 | Ga0070659_100650213 | |||
| 1128 | Ga0070667_100003404 | |||
| 1129 | Ga0070667_100032935 | |||
| 1130 | Ga0070667_100235046 | |||
| 1131 | Ga0070703_10022023 | |||
| 1132 | Ga0070709_10012929 | |||
| 1133 | Ga0070709_10063972 | |||
| 1134 | Ga0070709_10069335 | |||
| 1135 | Ga0070709_10072151 | |||
| 1136 | Ga0070714_100236264 | |||
| 1137 | Ga0070714_100597241 | |||
| 1138 | Ga0070714_100656646 | |||
| 1139 | Ga0070713_100000756 | |||
| 1140 | Ga0070713_100007628 | |||
| 1141 | Ga0070713_100160209 | |||
| 1142 | Ga0070713_100188167 | |||
| 1143 | Ga0070713_100382572 | |||
| 1144 | Ga0070713_100568576 | |||
| 1145 | Ga0070713_101849202 | |||
| 1146 | Ga0070711_100043800 | |||
| 1147 | Ga0070711_100116244 | |||
| 1148 | Ga0070711_100364321 | |||
| 1149 | Ga0070711_100409667 | |||
| 1150 | Ga0070711_100809621 | |||
| 1151 | Ga0070705_100007139 | |||
| 1152 | Ga0070705_101030184 | |||
| 1153 | Ga0070705_101060988 | |||
| 1154 | Ga0070700_100304787 | |||
| 1155 | Ga0070700_101045719 | |||
| 1156 | Ga0070694_100088360 | |||
| 1157 | Ga0070694_100947451 | |||
| 1158 | Ga0070694_101652594 | |||
| 1159 | Ga0070694_101758979 | |||
| 1160 | Ga0070708_100004621 | |||
| 1161 | Ga0070708_100152966 | |||
| 1162 | Ga0070663_100133997 | |||
| 1163 | Ga0070663_100758890 | |||
| 1164 | Ga0070678_100045286 | |||
| 1165 | Ga0070678_101977698 | |||
| 1166 | Ga0070662_100052745 | |||
| 1167 | Ga0070662_100078765 | |||
| 1168 | Ga0070662_100770073 | |||
| 1169 | Ga0070681_10010160 | |||
| 1170 | Ga0070681_10109907 | |||
| 1171 | Ga0070681_10162448 | |||
| 1172 | Ga0070681_10632189 | |||
| 1173 | Ga0068867_100567600 | |||
| 1174 | Ga0068867_100761770 | |||
| 1175 | Ga0068867_100942927 | |||
| 1176 | Ga0070706_100031675 | |||
| 1177 | Ga0070707_100005736 | |||
| 1178 | Ga0070707_100117531 | |||
| 1179 | Ga0070707_100414082 | |||
| 1180 | Ga0070707_101195532 | |||
| 1181 | Ga0070698_101153254 | |||
| 1182 | Ga0070698_101949936 | |||
| 1183 | Ga0070699_100059693 | |||
| 1184 | Ga0070699_100072400 | |||
| 1185 | Ga0070699_100827946 | |||
| 1186 | Ga0070679_100017259 | |||
| 1187 | Ga0070679_100065368 | |||
| 1188 | Ga0070679_100805967 | |||
| 1189 | Ga0070684_100040309 | |||
| 1190 | Ga0070684_100046206 | |||
| 1191 | Ga0070684_100046822 | |||
| 1192 | Ga0070684_100129028 | |||
| 1193 | Ga0070684_100179986 | |||
| 1194 | Ga0070684_100231747 | |||
| 1195 | Ga0070684_100325499 | |||
| 1196 | Ga0070684_100611092 | |||
| 1197 | Ga0070684_101378560 | |||
| 1198 | Ga0070697_100001864 | |||
| 1199 | Ga0070697_100478920 | |||
| 1200 | Ga0070697_100762635 | |||
| 1201 | Ga0070697_100774113 | |||
| 1202 | Ga0070697_101516496 | |||
| 1203 | Ga0068853_100000760 | |||
| 1204 | Ga0068853_100153545 | |||
| 1205 | Ga0068853_100161770 | |||
| 1206 | Ga0068853_100218878 | |||
| 1207 | Ga0068853_100319680 | |||
| 1208 | Ga0068853_101140774 | |||
| 1209 | Ga0068853_102397451 | |||
| 1210 | Ga0070672_102043035 | |||
| 1211 | Ga0070695_100037111 | |||
| 1212 | Ga0070695_100125661 | |||
| 1213 | Ga0070695_100290222 | |||
| 1214 | Ga0070695_100501560 | |||
| 1215 | Ga0070695_100969353 | |||
| 1216 | Ga0070695_101107666 | |||
| 1217 | Ga0070695_101284788 | |||
| 1218 | Ga0070696_100000282 | |||
| 1219 | Ga0070696_100146959 | |||
| 1220 | Ga0070696_100393317 | |||
| 1221 | Ga0070696_100548418 | |||
| 1222 | Ga0070693_100004320 | |||
| 1223 | Ga0070693_100701231 | |||
| 1224 | Ga0070665_100025124 | |||
| 1225 | Ga0070665_100027471 | |||
| 1226 | Ga0070665_100044342 | |||
| 1227 | Ga0070665_100054299 | |||
| 1228 | Ga0070665_100069455 | |||
| 1229 | Ga0070665_100248617 | |||
| 1230 | Ga0070665_100359191 | |||
| 1231 | Ga0070665_100692401 | |||
| 1232 | Ga0070665_100935778 | |||
| 1233 | Ga0070665_101124341 | |||
| 1234 | Ga0070665_101873584 | |||
| 1235 | Ga0070704_100005557 | |||
| 1236 | Ga0068855_100000250 | |||
| 1237 | Ga0068855_100020057 | |||
| 1238 | Ga0068855_100052552 | |||
| 1239 | Ga0068855_100077582 | |||
| 1240 | Ga0068855_100164099 | |||
| 1241 | Ga0068855_100641259 | |||
| 1242 | Ga0068855_100675242 | |||
| 1243 | Ga0068855_101119833 | |||
| 1244 | Ga0068855_101154822 | |||
| 1245 | Ga0070664_100019731 | |||
| 1246 | Ga0070664_100655781 | |||
| 1247 | Ga0070664_100880020 | |||
| 1248 | Ga0068857_100041105 | |||
| 1249 | Ga0068857_100053622 | |||
| 1250 | Ga0068857_100159589 | |||
| 1251 | Ga0068857_100195079 | |||
| 1252 | Ga0068857_100255276 | |||
| 1253 | Ga0068854_100010270 | |||
| 1254 | Ga0068854_100047267 | |||
| 1255 | Ga0068854_100251616 | |||
| 1256 | Ga0068854_100763319 | |||
| 1257 | Ga0068854_101301322 | |||
| 1258 | Ga0068854_101422303 | |||
| 1259 | Ga0068856_100001514 | |||
| 1260 | Ga0068856_100003761 | |||
| 1261 | Ga0068856_100004698 | |||
| 1262 | Ga0068856_100018860 | |||
| 1263 | Ga0068856_100136386 | |||
| 1264 | Ga0068856_101112771 | |||
| 1265 | Ga0068856_101164511 | |||
| 1266 | Ga0068856_102030820 | |||
| 1267 | Ga0068856_102209015 | |||
| 1268 | Ga0070702_100323072 | |||
| 1269 | Ga0070702_100706783 | |||
| 1270 | Ga0070702_100850092 | |||
| 1271 | Ga0068852_100000010 | |||
| 1272 | Ga0068852_100063281 | |||
| 1273 | Ga0068852_100299085 | |||
| 1274 | Ga0068852_100571088 | |||
| 1275 | Ga0068852_100953578 | |||
| 1276 | Ga0068852_101372951 | |||
| 1277 | Ga0068852_101391669 | |||
| 1278 | Ga0068859_100008728 | |||
| 1279 | Ga0068859_100009619 | |||
| 1280 | Ga0068859_100022156 | |||
| 1281 | Ga0068859_100768910 | |||
| 1282 | Ga0068864_100012964 | |||
| 1283 | Ga0068864_100271584 | |||
| 1284 | Ga0068864_100455085 | |||
| 1285 | Ga0068866_10002504 | |||
| 1286 | Ga0068866_10061922 | |||
| 1287 | Ga0068861_100142433 | |||
| 1288 | Ga0068861_101829444 | |||
| 1289 | Ga0068851_10003306 | |||
| 1290 | Ga0068851_10006982 | |||
| 1291 | Ga0068851_10139925 | |||
| 1292 | Ga0068851_10250147 | |||
| 1293 | Ga0068870_11193060 | |||
| 1294 | Ga0068863_100004433 | |||
| 1295 | Ga0068863_100241060 | |||
| 1296 | Ga0068858_100000894 | |||
| 1297 | Ga0068858_101144752 | |||
| 1298 | Ga0068860_100004498 | |||
| 1299 | Ga0068860_100092571 | |||
| 1300 | Ga0068862_100203978 | |||
| 1301 | Ga0068862_101479326 | |||
| 1302 | Ga0068862_102248628 | |||
| 1303 | Ga0070717_10440085 | |||
| 1304 | Ga0075363_100180006 | |||
| 1305 | Ga0075364_10359278 | |||
| 1306 | Ga0075364_10471384 | |||
| 1307 | Ga0075364_10726741 | |||
| 1308 | Ga0075432_10503628 | |||
| 1309 | Ga0070715_10135189 | |||
| 1310 | Ga0070716_100088016 | |||
| 1311 | Ga0070716_100131713 | |||
| 1312 | Ga0070716_100223321 | |||
| 1313 | Ga0070716_100787292 | |||
| 1314 | Ga0070712_100011062 | |||
| 1315 | Ga0070712_100016643 | |||
| 1316 | Ga0070712_100054195 | |||
| 1317 | Ga0070712_100085628 | |||
| 1318 | Ga0070712_100232192 | |||
| 1319 | Ga0070712_100319122 | |||
| 1320 | Ga0070712_100645417 | |||
| 1321 | Ga0075362_10007621 | |||
| 1322 | Ga0075369_10167346 | |||
| 1323 | Ga0075369_10260322 | |||
| 1324 | Ga0097621_100000411 | |||
| 1325 | Ga0097621_100009117 | |||
| 1326 | Ga0097621_100015840 | |||
| 1327 | Ga0097621_100035335 | |||
| 1328 | Ga0097621_100065695 | |||
| 1329 | Ga0097621_100198415 | |||
| 1330 | Ga0097621_100789512 | |||
| 1331 | Ga0068871_100002096 | |||
| 1332 | Ga0068871_100771748 | |||
| 1333 | Ga0068871_100917908 | |||
| 1334 | Ga0068871_101192428 | |||
| 1335 | Ga0068871_101297241 | |||
| 1336 | Ga0075428_100034181 | |||
| 1337 | Ga0075430_100012143 | |||
| 1338 | Ga0075431_100004580 | |||
| 1339 | Ga0075434_100059402 | |||
| 1340 | Ga0075434_100119188 | |||
| 1341 | Ga0075434_100619405 | |||
| 1342 | Ga0075434_101307561 | |||
| 1343 | Ga0075429_100660262 | |||
| 1344 | Ga0068865_100001072 | |||
| 1345 | Ga0068865_100048605 | |||
| 1346 | Ga0068865_100994120 | |||
| 1347 | Ga0075436_100025051 | |||
| 1348 | Ga0075436_100116732 | |||
| 1349 | Ga0075436_100513652 | |||
| 1350 | Ga0075436_101568897 | |||
| 1351 | Ga0097620_100008728 | |||
| 1352 | Ga0097620_100009619 | |||
| 1353 | Ga0097620_100022156 | |||
| 1354 | Ga0097620_100768943 | |||
| 1355 | Ga0075435_100000004 | |||
| 1356 | Ga0075435_100172831 | |||
| 1357 | Ga0099794_10467196 | |||
| 1358 | Ga0099795_10450023 | |||
| 1359 | Ga0099795_10460515 | |||
| 1360 | Ga0105240_10000436 | |||
| 1361 | Ga0105240_10004419 | |||
| 1362 | Ga0105240_10012860 | |||
| 1363 | Ga0105240_10025261 | |||
| 1364 | Ga0105240_10032915 | |||
| 1365 | Ga0105240_10036335 | |||
| 1366 | Ga0105240_10050394 | |||
| 1367 | Ga0105240_10148818 | |||
| 1368 | Ga0105240_10177697 | |||
| 1369 | Ga0105240_10251974 | |||
| 1370 | Ga0105240_10565848 | |||
| 1371 | Ga0105240_10637903 | |||
| 1372 | Ga0105240_10899611 | |||
| 1373 | Ga0105240_12067885 | |||
| 1374 | Ga0105240_12686900 | |||
| 1375 | Ga0111539_10016191 | |||
| 1376 | Ga0111539_10042739 | |||
| 1377 | Ga0111539_10051147 | |||
| 1378 | Ga0111539_10078267 | |||
| 1379 | Ga0111539_10106356 | |||
| 1380 | Ga0111539_10233728 | |||
| 1381 | Ga0111539_11189478 | |||
| 1382 | Ga0111539_11518405 | |||
| 1383 | Ga0111539_11550779 | |||
| 1384 | Ga0111539_11700006 | |||
| 1385 | Ga0111539_11957415 | |||
| 1386 | Ga0105245_10007833 | |||
| 1387 | Ga0105245_10022166 | |||
| 1388 | Ga0105245_10045873 | |||
| 1389 | Ga0105245_10074593 | |||
| 1390 | Ga0105245_10172165 | |||
| 1391 | Ga0105245_10299050 | |||
| 1392 | Ga0105245_10468538 | |||
| 1393 | Ga0105245_10776598 | |||
| 1394 | Ga0105245_11334215 | |||
| 1395 | Ga0105247_10001551 | |||
| 1396 | Ga0105247_10008463 | |||
| 1397 | Ga0105247_10194451 | |||
| 1398 | Ga0105247_10206434 | |||
| 1399 | Ga0114129_10067192 | |||
| 1400 | Ga0114129_10161994 | |||
| 1401 | Ga0114129_10635297 | |||
| 1402 | Ga0114129_10718018 | |||
| 1403 | Ga0114129_10965531 | |||
| 1404 | Ga0114129_11632626 | |||
| 1405 | Ga0105243_11889903 | |||
| 1406 | Ga0105241_10000014 | |||
| 1407 | Ga0105241_10000642 | |||
| 1408 | Ga0105241_10005710 | |||
| 1409 | Ga0105241_10026292 | |||
| 1410 | Ga0105241_10047426 | |||
| 1411 | Ga0105241_10064208 | |||
| 1412 | Ga0105241_10128230 | |||
| 1413 | Ga0105241_10295443 | |||
| 1414 | Ga0105241_10295952 | |||
| 1415 | Ga0105241_10529791 | |||
| 1416 | Ga0105241_10831222 | |||
| 1417 | Ga0105241_11903163 | |||
| 1418 | Ga0105241_12466687 | |||
| 1419 | Ga0105241_12559573 | |||
| 1420 | Ga0105242_10006845 | |||
| 1421 | Ga0105242_10010294 | |||
| 1422 | Ga0105242_10038242 | |||
| 1423 | Ga0105242_10331236 | |||
| 1424 | Ga0105242_10391417 | |||
| 1425 | Ga0105242_10868325 | |||
| 1426 | Ga0105242_10877911 | |||
| 1427 | Ga0105242_11359242 | |||
| 1428 | Ga0105242_11783419 | |||
| 1429 | Ga0105248_10014503 | |||
| 1430 | Ga0105248_10017033 | |||
| 1431 | Ga0105248_10018467 | |||
| 1432 | Ga0105248_10028300 | |||
| 1433 | Ga0105248_10041781 | |||
| 1434 | Ga0105248_10073528 | |||
| 1435 | Ga0105248_10081486 | |||
| 1436 | Ga0105248_10087727 | |||
| 1437 | Ga0105248_10129882 | |||
| 1438 | Ga0105248_10234077 | |||
| 1439 | Ga0105248_10245244 | |||
| 1440 | Ga0105248_10509076 | |||
| 1441 | Ga0105248_12593364 | |||
| 1442 | Ga0105237_10007844 | |||
| 1443 | Ga0105237_10007965 | |||
| 1444 | Ga0105237_10019667 | |||
| 1445 | Ga0105237_10025505 | |||
| 1446 | Ga0105237_10053597 | |||
| 1447 | Ga0105237_10269959 | |||
| 1448 | Ga0105237_10464862 | |||
| 1449 | Ga0105237_10486393 | |||
| 1450 | Ga0105237_11687675 | |||
| 1451 | Ga0105238_10001147 | |||
| 1452 | Ga0105238_10002103 | |||
| 1453 | Ga0105238_10011589 | |||
| 1454 | Ga0105238_10043336 | |||
| 1455 | Ga0105238_10311521 | |||
| 1456 | Ga0105238_10349571 | |||
| 1457 | Ga0105238_10613019 | |||
| 1458 | Ga0105238_10713832 | |||
| 1459 | Ga0105249_10027336 | |||
| 1460 | Ga0105249_10342541 | |||
| 1461 | Ga0105249_11354639 | |||
| 1462 | Ga0105249_12947136 | |||
| 1463 | Ga0099796_10536976 | |||
| 1464 | Ga0105239_10003382 | |||
| 1465 | Ga0105239_10045292 | |||
| 1466 | Ga0105239_10068734 | |||
| 1467 | Ga0105239_10085886 | |||
| 1468 | Ga0105239_10103031 | |||
| 1469 | Ga0105239_10236022 | |||
| 1470 | Ga0105239_10301600 | |||
| 1471 | Ga0105239_10305439 | |||
| 1472 | Ga0105239_10819512 | |||
| 1473 | Ga0105239_10977005 | |||
| 1474 | Ga0105239_11556606 | |||
| 1475 | Ga0105239_11855527 | |||
| 1476 | Ga0105239_12274845 | |||
| 1477 | Ga0105239_13048659 | |||
| 1478 | Ga0105246_10000506 | |||
| 1479 | Ga0105246_10109102 | |||
| 1480 | Ga0105246_10974744 | |||
| 1481 | Ga0157373_10256009 | |||
| 1482 | Ga0157373_10336648 | |||
| 1483 | Ga0157373_10954217 | |||
| 1484 | Ga0157373_11306102 | |||
| 1485 | Ga0157373_11360099 | |||
| 1486 | Ga0157371_10105899 | |||
| 1487 | Ga0157371_10137857 | |||
| 1488 | Ga0157370_10000005 | |||
| 1489 | Ga0157370_10106232 | |||
| 1490 | Ga0157369_10000049 | |||
| 1491 | Ga0157369_10006463 | |||
| 1492 | Ga0157369_10008092 | |||
| 1493 | Ga0157369_10013495 | |||
| 1494 | Ga0157369_10017952 | |||
| 1495 | Ga0157369_10060862 | |||
| 1496 | Ga0157369_10073446 | |||
| 1497 | Ga0157369_10104562 | |||
| 1498 | Ga0157369_10209593 | |||
| 1499 | Ga0157369_10210467 | |||
| 1500 | Ga0157369_10237764 | |||
| 1501 | Ga0157369_10537074 | |||
| 1502 | Ga0157369_10883681 | |||
| 1503 | Ga0157369_11554529 | |||
| 1504 | Ga0157374_10025354 | |||
| 1505 | Ga0157374_10083752 | |||
| 1506 | Ga0157374_10157517 | |||
| 1507 | Ga0157374_10193138 | |||
| 1508 | Ga0157374_10250360 | |||
| 1509 | Ga0157374_11025517 | |||
| 1510 | Ga0157374_11206303 | |||
| 1511 | Ga0157374_11513155 | |||
| 1512 | Ga0157378_10004806 | |||
| 1513 | Ga0157378_10009528 | |||
| 1514 | Ga0157378_10026122 | |||
| 1515 | Ga0157378_10055476 | |||
| 1516 | Ga0157378_10154791 | |||
| 1517 | Ga0157378_10272551 | |||
| 1518 | Ga0157378_10639700 | |||
| 1519 | Ga0163162_10788057 | |||
| 1520 | Ga0163162_11075292 | |||
| 1521 | Ga0157372_10000047 | |||
| 1522 | Ga0157372_10006634 | |||
| 1523 | Ga0157372_10011629 | |||
| 1524 | Ga0157372_10017955 | |||
| 1525 | Ga0157372_10068757 | |||
| 1526 | Ga0157372_10110844 | |||
| 1527 | Ga0157372_10192210 | |||
| 1528 | Ga0157372_10196288 | |||
| 1529 | Ga0157372_10264704 | |||
| 1530 | Ga0157372_11227389 | |||
| 1531 | Ga0157372_11363379 | |||
| 1532 | Ga0157375_10004406 | |||
| 1533 | Ga0157375_10035664 | |||
| 1534 | Ga0157375_10084450 | |||
| 1535 | Ga0157375_10489164 | |||
| 1536 | Ga0157375_11227167 | |||
| 1537 | Ga0163163_10001403 | |||
| 1538 | Ga0163163_10068653 | |||
| 1539 | Ga0163163_10112559 | |||
| 1540 | Ga0163163_10258020 | |||
| 1541 | Ga0163163_10739423 | |||
| 1542 | Ga0163163_11735681 | |||
| 1543 | Ga0157380_10019586 | |||
| 1544 | Ga0157380_10026942 | |||
| 1545 | Ga0157380_10075251 | |||
| 1546 | Ga0157380_10503630 | |||
| 1547 | Ga0157380_10614379 | |||
| 1548 | Ga0157380_11995570 | |||
| 1549 | Ga0157380_12463362 | |||
| 1550 | Ga0157379_10000404 | |||
| 1551 | Ga0157379_10031031 | |||
| 1552 | Ga0157379_10042708 | |||
| 1553 | Ga0157379_10154427 | |||
| 1554 | Ga0157379_11556752 | |||
| 1555 | Ga0157379_11948584 | |||
| 1556 | Ga0157376_10000652 | |||
| 1557 | Ga0157376_10230925 | |||
| 1558 | Ga0157376_10294783 | |||
| 1559 | Ga0157376_10335447 | |||
| 1560 | Ga0157376_11099192 | |||
| 1561 | Ga0157376_11788892 | |||
| 1562 | Ga0157376_12790479 | |||
| 1563 | Ga0182005_1146378 | |||
| 1564 | Ga0163161_10020772 | |||
| 1565 | Ga0163161_11057728 | |||
| 1566 | Ga0213875_10063176 | |||
| 1567 | Ga0228598_1011828 | |||
| 1568 | Ga0207656_10027863 | |||
| 1569 | Ga0207656_10101589 | |||
| 1570 | Ga0207656_10115706 | |||
| 1571 | Ga0207656_10115995 | |||
| 1572 | Ga0207653_10087475 | |||
| 1573 | Ga0207653_10229852 | |||
| 1574 | Ga0207642_10005676 | |||
| 1575 | Ga0207710_10000869 | |||
| 1576 | Ga0207710_10099065 | |||
| 1577 | Ga0207710_10529802 | |||
| 1578 | Ga0207688_10529688 | |||
| 1579 | Ga0207680_10149836 | |||
| 1580 | Ga0207680_10215581 | |||
| 1581 | Ga0207680_10721107 | |||
| 1582 | Ga0207647_10024516 | |||
| 1583 | Ga0207647_10026139 | |||
| 1584 | Ga0207685_10024287 | |||
| 1585 | Ga0207685_10086249 | |||
| 1586 | Ga0207699_10020265 | |||
| 1587 | Ga0207699_10116693 | |||
| 1588 | Ga0207699_10342529 | |||
| 1589 | Ga0207645_10037493 | |||
| 1590 | Ga0207645_10318167 | |||
| 1591 | Ga0207705_10077458 | |||
| 1592 | Ga0207705_10242598 | |||
| 1593 | Ga0207705_10342464 | |||
| 1594 | Ga0207705_10807248 | |||
| 1595 | Ga0207684_10026923 | |||
| 1596 | Ga0207654_10001162 | |||
| 1597 | Ga0207654_10073895 | |||
| 1598 | Ga0207654_10202996 | |||
| 1599 | Ga0207654_10354128 | |||
| 1600 | Ga0207654_10626404 | |||
| 1601 | Ga0207707_10034688 | |||
| 1602 | Ga0207707_10091889 | |||
| 1603 | Ga0207707_10269563 | |||
| 1604 | Ga0207707_10349962 | |||
| 1605 | Ga0207707_10518131 | |||
| 1606 | Ga0207695_10000137 | |||
| 1607 | Ga0207695_10000507 | |||
| 1608 | Ga0207695_10000977 | |||
| 1609 | Ga0207695_10010221 | |||
| 1610 | Ga0207695_10071410 | |||
| 1611 | Ga0207695_10181029 | |||
| 1612 | Ga0207695_10590627 | |||
| 1613 | Ga0207695_11248471 | |||
| 1614 | Ga0207695_11380941 | |||
| 1615 | Ga0207671_10000715 | |||
| 1616 | Ga0207671_10018855 | |||
| 1617 | Ga0207671_10131047 | |||
| 1618 | Ga0207671_10274026 | |||
| 1619 | Ga0207671_10284223 | |||
| 1620 | Ga0207671_10521365 | |||
| 1621 | Ga0207693_10019524 | |||
| 1622 | Ga0207693_10030149 | |||
| 1623 | Ga0207693_10062742 | |||
| 1624 | Ga0207693_10232893 | |||
| 1625 | Ga0207693_10297967 | |||
| 1626 | Ga0207693_10536621 | |||
| 1627 | Ga0207693_10750347 | |||
| 1628 | Ga0207663_10044163 | |||
| 1629 | Ga0207663_10117955 | |||
| 1630 | Ga0207663_10359508 | |||
| 1631 | Ga0207663_10781252 | |||
| 1632 | Ga0207663_11733765 | |||
| 1633 | Ga0207660_10017429 | |||
| 1634 | Ga0207660_10600428 | |||
| 1635 | Ga0207660_10654522 | |||
| 1636 | Ga0207660_11156870 | |||
| 1637 | Ga0207662_10138679 | |||
| 1638 | Ga0207657_10604815 | |||
| 1639 | Ga0207649_10108589 | |||
| 1640 | Ga0207649_10263870 | |||
| 1641 | Ga0207649_10474467 | |||
| 1642 | Ga0207649_10805609 | |||
| 1643 | Ga0207652_10010717 | |||
| 1644 | Ga0207652_10824770 | |||
| 1645 | Ga0207646_10000274 | |||
| 1646 | Ga0207646_10124793 | |||
| 1647 | Ga0207646_11270205 | |||
| 1648 | Ga0207681_10067441 | |||
| 1649 | Ga0207681_10142669 | |||
| 1650 | Ga0207681_10279623 | |||
| 1651 | Ga0207681_10542913 | |||
| 1652 | Ga0207694_10000489 | |||
| 1653 | Ga0207694_10001113 | |||
| 1654 | Ga0207694_10058812 | |||
| 1655 | Ga0207694_10397932 | |||
| 1656 | Ga0207694_10706995 | |||
| 1657 | Ga0207650_10027803 | |||
| 1658 | Ga0207650_11423400 | |||
| 1659 | Ga0207659_10071458 | |||
| 1660 | Ga0207659_10355874 | |||
| 1661 | Ga0207687_10005043 | |||
| 1662 | Ga0207687_10030962 | |||
| 1663 | Ga0207687_10305447 | |||
| 1664 | Ga0207687_10480375 | |||
| 1665 | Ga0207700_10022606 | |||
| 1666 | Ga0207700_10347729 | |||
| 1667 | Ga0207700_10435179 | |||
| 1668 | Ga0207700_10609600 | |||
| 1669 | Ga0207700_11237745 | |||
| 1670 | Ga0207700_11589087 | |||
| 1671 | Ga0207664_10293073 | |||
| 1672 | Ga0207664_10353376 | |||
| 1673 | Ga0207664_10460067 | |||
| 1674 | Ga0207664_10503319 | |||
| 1675 | Ga0207664_10633943 | |||
| 1676 | Ga0207644_10005460 | |||
| 1677 | Ga0207644_10114322 | |||
| 1678 | Ga0207644_10242016 | |||
| 1679 | Ga0207690_10042768 | |||
| 1680 | Ga0207690_10049097 | |||
| 1681 | Ga0207706_10021398 | |||
| 1682 | Ga0207706_10216158 | |||
| 1683 | Ga0207686_10251662 | |||
| 1684 | Ga0207686_10940930 | |||
| 1685 | Ga0207670_10024415 | |||
| 1686 | Ga0207670_11792564 | |||
| 1687 | Ga0207669_10056819 | |||
| 1688 | Ga0207704_10014768 | |||
| 1689 | Ga0207704_10055232 | |||
| 1690 | Ga0207665_10007240 | |||
| 1691 | Ga0207665_10029176 | |||
| 1692 | Ga0207665_10264480 | |||
| 1693 | Ga0207665_10658681 | |||
| 1694 | Ga0207665_10821320 | |||
| 1695 | Ga0207665_10870883 | |||
| 1696 | Ga0207691_10756684 | |||
| 1697 | Ga0207711_10000013 | |||
| 1698 | Ga0207711_10004831 | |||
| 1699 | Ga0207711_10011288 | |||
| 1700 | Ga0207711_10075652 | |||
| 1701 | Ga0207711_10127868 | |||
| 1702 | Ga0207711_10139883 | |||
| 1703 | Ga0207711_10243888 | |||
| 1704 | Ga0207711_10793284 | |||
| 1705 | Ga0207711_11630623 | |||
| 1706 | Ga0207689_10005697 | |||
| 1707 | Ga0207689_10041297 | |||
| 1708 | Ga0207661_10000798 | |||
| 1709 | Ga0207661_10041920 | |||
| 1710 | Ga0207661_10117610 | |||
| 1711 | Ga0207661_10134645 | |||
| 1712 | Ga0207661_10484172 | |||
| 1713 | Ga0207661_10643845 | |||
| 1714 | Ga0207661_11140228 | |||
| 1715 | Ga0207679_10006047 | |||
| 1716 | Ga0207679_11216993 | |||
| 1717 | Ga0207679_11832945 | |||
| 1718 | Ga0207667_10000949 | |||
| 1719 | Ga0207667_10018161 | |||
| 1720 | Ga0207667_10018186 | |||
| 1721 | Ga0207667_10934724 | |||
| 1722 | Ga0207667_11860129 | |||
| 1723 | Ga0207667_12159665 | |||
| 1724 | Ga0207651_10255046 | |||
| 1725 | Ga0207651_10791363 | |||
| 1726 | Ga0207712_10558982 | |||
| 1727 | Ga0207712_11453660 | |||
| 1728 | Ga0207668_10318246 | |||
| 1729 | Ga0207668_10387326 | |||
| 1730 | Ga0207640_10009374 | |||
| 1731 | Ga0207640_10879917 | |||
| 1732 | Ga0207640_10929768 | |||
| 1733 | Ga0207640_10989176 | |||
| 1734 | Ga0207658_10001464 | |||
| 1735 | Ga0207658_10147840 | |||
| 1736 | Ga0207677_10000778 | |||
| 1737 | Ga0207677_10118110 | |||
| 1738 | Ga0207677_10505136 | |||
| 1739 | Ga0207703_10001909 | |||
| 1740 | Ga0207703_10011249 | |||
| 1741 | Ga0207703_10976433 | |||
| 1742 | Ga0207639_10009769 | |||
| 1743 | Ga0207639_10035702 | |||
| 1744 | Ga0207639_10123026 | |||
| 1745 | Ga0207639_10163037 | |||
| 1746 | Ga0207639_10754385 | |||
| 1747 | Ga0207678_10209812 | |||
| 1748 | Ga0207678_10351868 | |||
| 1749 | Ga0207708_10059743 | |||
| 1750 | Ga0207708_10326206 | |||
| 1751 | Ga0207708_10786606 | |||
| 1752 | Ga0207702_10000993 | |||
| 1753 | Ga0207702_10010856 | |||
| 1754 | Ga0207702_10047430 | |||
| 1755 | Ga0207702_10053630 | |||
| 1756 | Ga0207702_10130688 | |||
| 1757 | Ga0207702_10695650 | |||
| 1758 | Ga0207702_11038180 | |||
| 1759 | Ga0207702_12122749 | |||
| 1760 | Ga0207641_10005473 | |||
| 1761 | Ga0207641_10208489 | |||
| 1762 | Ga0207641_12460237 | |||
| 1763 | Ga0207641_12536709 | |||
| 1764 | Ga0207648_10053848 | |||
| 1765 | Ga0207648_10262782 | |||
| 1766 | Ga0207648_10426940 | |||
| 1767 | Ga0207648_10673594 | |||
| 1768 | Ga0207648_11620935 | |||
| 1769 | Ga0207676_10008589 | |||
| 1770 | Ga0207676_10017059 | |||
| 1771 | Ga0207676_10436942 | |||
| 1772 | Ga0207676_10549555 | |||
| 1773 | Ga0207676_11102017 | |||
| 1774 | Ga0207674_10006657 | |||
| 1775 | Ga0207674_10013263 | |||
| 1776 | Ga0207674_10064133 | |||
| 1777 | Ga0207674_10071193 | |||
| 1778 | Ga0207674_10077229 | |||
| 1779 | Ga0207674_10102867 | |||
| 1780 | Ga0207674_10112268 | |||
| 1781 | Ga0207675_101191715 | |||
| 1782 | Ga0207698_10000003 | |||
| 1783 | Ga0207698_10333792 | |||
| 1784 | Ga0207698_10914499 | |||
| 1785 | Ga0207698_11044170 | |||
| 1786 | Ga0207698_12463396 | |||
| 1787 | Ga0207428_10005795 | |||
| 1788 | Ga0207428_10087962 | |||
| 1789 | Ga0207428_10121757 | |||
| 1790 | Ga0207428_10216907 | |||
| 1791 | Ga0207428_10409387 | |||
| 1792 | Ga0265354_1000083 | |||
| 1793 | Ga0265354_1001617 | |||
| 1794 | Ga0265357_1004030 | |||
| 1795 | Ga0268266_10009093 | |||
| 1796 | Ga0268266_10016382 | |||
| 1797 | Ga0268266_10016622 | |||
| 1798 | Ga0268266_10018097 | |||
| 1799 | Ga0268266_10173735 | |||
| 1800 | Ga0268266_10275155 | |||
| 1801 | Ga0268266_11172728 | |||
| 1802 | Ga0268266_12339006 | |||
| 1803 | Ga0268265_10968660 | |||
| 1804 | Ga0268265_11304118 | |||
| 1805 | Ga0268264_10003955 | |||
| 1806 | Ga0268264_10455431 | |||
| 1807 | Ga0268264_10653453 | |||
| 1808 | Ga0268264_12150693 | |||
| 1809 | Ga0265318_10113568 | |||
| 1810 | Ga0265338_10000633 | |||
| 1811 | Ga0265338_11018929 | |||
| 1812 | Ga0265338_11104122 | |||
| 1813 | Ga0265316_10003465 | |||
| 1814 | Ga0265316_10054004 | |||
| 1815 | Ga0265316_10910816 | |||
| 1816 | Ga0307408_100292809 | |||
| 1817 | Ga0265342_10230523 | |||
| 1818 | Ga0307413_10248456 | |||
| 1819 | Ga0307412_10379672 | |||
| 1820 | Ga0307409_100060772 | |||
| 1821 | Ga0307416_100139569 | |||
| 1822 | Ga0307416_100210889 | |||
| 1823 | Ga0307411_11243477 | |||
| 1824 | Ga0307415_102591393 | |||
| 1825 | Ga0307510_10035621 | |||
| 1826 | Ga0307510_10055224 | |||
| 1827 | Ga0316212_1003127 | |||
| 1828 | Ga0373926_0433779 | |||
| 1829 | Ga0373934_0003047 | |||
| 1830 | Ga0373934_0339498 | |||
| 1831 | Ga0373944_0053675 | |||
| 1832 | Ga0373923_0078233 | |||
| 1833 | Ga0373923_0403385 | |||
| 1834 | Ga0373945_0196239 | |||
| 1835 | Ga0373953_0392920 | |||
| 1836 | Ga0373954_0310448 | |||
| 1837 | Ga0373956_0050296 | |||
| 1838 | Ga0373957_0002475 | |||
| 1839 | Ga0373957_0061884 | |||
| 1840 | Ga0373943_0001766 | |||
| 1841 | Ga0373943_0226182 | |||
| 1842 | Ga0373946_0148313 | |||
| 1843 | Ga0373955_0017602 | |||
| 1844 | Ga0373955_0080341 | |||
| 1845 | Ga0373955_0365746 | |||
| 1846 | Ga0373962_0015765 | |||
| 1847 | Ga0373924_0061798 | |||
| 1848 | Ga0373931_0573099 | |||
| 1849 | Ga0373935_0073152 | |||
| 1850 | Ga0373935_0196278 | |||
| 1851 | Ga0373935_0348944 | |||
| 1852 | Ga0373935_0864008 | |||
| 1853 | Ga0373927_0719385 | |||
| 1854 | Ga0373933_0013083 | |||
| 1855 | Ga0373933_0210974 | |||
| 1856 | Ga0373933_0320853 | |||
| 1857 | Ga0373947_0016792 | |||
| 1858 | Ga0373947_0561951 | |||
| 1859 | Ga0373947_1007862 | |||
| 1860 | Ga0373937_0000128 | |||
| 1861 | Ga0373937_0038684 | |||
| 1862 | Ga0373937_0380166 | |||
| 1863 | Ga0373937_0490443 | |||
| 1864 | Ga0373937_0659105 | |||
| 1865 | Ga0373937_0736884 | |||
| 1866 | Ga0373937_1240238 | |||
| 1867 | Ga0373937_1412561 | |||
| 1868 | Ga0373925_0102695 | |||
| 1869 | Ga0373925_0348076 | |||
| 1870 | Ga0373925_0639282 | |||
| 1871 | Ga0395900_0242309 | |||
| 1872 | Ga0395898_0085889 | |||
| 1873 | Ga0395898_0215743 | |||
| 1874 | Ga0395898_0470717 | |||
| 1875 | Ga0395898_1971467 | |||
| 1876 | Ga0436364_0070346 | |||
| 1877 | Ga0436364_0535317 | |||
| 1878 | Ga0395901_2006214 | |||
| 1879 | Ga0436365_1510286 | |||
| 1880 | Ga0436365_1548667 | |||
| 1881 | Ga0436360_0002192 | |||
| 1882 | Ga0436361_0140635 | |||
| 1883 | Ga0436361_0187674 | |||
| 1884 | Ga0436361_0406737 | |||
| 1885 | Ga0436363_1004445 | |||
| 1886 | Ga0436362_1130226 | |||
| 1887 | Ga0451804_0927833 | |||
| 1888 | Ga0439448_0099134 | |||
| 1889 | Ga0439457_110910 | |||
| 1890 | Ga0450898_045807 | |||
| 1891 | Ga0450910_021168 | |||
| 1892 | Ga0439444_0023254 | |||
| 1893 | Ga0466961_0046544 | |||
| 1894 | Ga0466963_0000875 | |||
| 1895 | Ga0466963_0013109 | |||
| 1896 | Ga0466963_0094757 | |||
| 1897 | Ga0466963_1169399 | |||
| 1898 | Ga0466957_0813307 | |||
| 1899 | Ga0466957_1070052 | |||
| 1900 | Ga0466959_0636856 | |||
| 1901 | Ga0451576_0663548 | |||
| 1902 | Ga0466958_0106011 | |||
| 1903 | Ga0466958_0188991 | |||
| 1904 | Ga0466958_0616003 | |||
| 1905 | Ga0466967_0011480 | |||
| 1906 | Ga0466967_0026524 | |||
| 1907 | Ga0466967_0363195 | |||
| 1908 | Ga0466967_1216879 | |||
| 1909 | Ga0466967_1276418 | |||
| 1910 | Ga0466967_1333253 | |||
| 1911 | Ga0466967_1779275 | |||
| 1912 | Ga0495592_0437696 | |||
| 1913 | Ga0495592_0696265 | |||
| 1914 | Ga0495651_0014543 | |||
| 1915 | Ga0495651_0203781 | |||
| 1916 | Ga0495580_0007919 | |||
| 1917 | Ga0495580_0140239 | |||
| 1918 | Ga0495580_0527700 | |||
| 1919 | Ga0495582_0121512 | |||
| 1920 | Ga0495639_0293504 | |||
| 1921 | Ga0495639_0731891 | |||
| 1922 | Ga0495662_0038863 | |||
| 1923 | Ga0495662_0441551 | |||
| 1924 | Ga0495664_0111147 | |||
| 1925 | Ga0495664_0156465 | |||
| 1926 | Ga0495664_0476989 | |||
| 1927 | Ga0495583_0211198 | |||
| 1928 | Ga0495608_0906505 | |||
| 1929 | Ga0495618_0461267 | |||
| 1930 | Ga0495628_0111608 | |||
| 1931 | Ga0495628_0189925 | |||
| 1932 | Ga0495630_0836674 | |||
| 1933 | Ga0495630_1120294 | |||
| 1934 | Ga0495632_0077348 | |||
| 1935 | Ga0495643_0433222 | |||
| 1936 | Ga0495644_0107635 | |||
| 1937 | Ga0495666_0238273 | |||
| 1938 | Ga0495642_0094834 | |||
| 1939 | Ga0495642_0244331 | |||
| 1940 | Ga0495652_0132405 | |||
| 1941 | Ga0495652_0222440 | |||
| 1942 | Ga0495652_0429922 | |||
| 1943 | Ga0495665_0228283 | |||
| 1944 | Ga0495665_0269507 | |||
| 1945 | Ga0495665_0308116 | |||
| 1946 | Ga0495665_0365725 | |||
| 1947 | Ga0495640_0134369 | |||
| 1948 | Ga0495587_0013184 | |||
| 1949 | Ga0495587_0152782 | |||
| 1950 | Ga0495587_0178516 | |||
| 1951 | Ga0495587_0186875 | |||
| 1952 | Ga0495621_0001440 | |||
| 1953 | Ga0495645_0007238 | |||
| 1954 | Ga0495645_0072644 | |||
| 1955 | Ga0495645_0096774 | |||
| 1956 | Ga0495645_0329025 | |||
| 1957 | Ga0495645_0348118 | |||
| 1958 | Ga0495645_0453740 | |||
| 1959 | Ga0495622_0328423 | |||
| 1960 | Ga0495667_0016197 | |||
| 1961 | Ga0495656_0237859 | |||
| 1962 | Ga0495625_0013264 | |||
| 1963 | Ga0495625_0078240 | |||
| 1964 | Ga0495625_0182317 | |||
| 1965 | Ga0495635_0047508 | |||
| 1966 | Ga0495635_0432344 | |||
| 1967 | Ga0495657_0256866 | |||
| 1968 | Ga0495657_0665732 | |||
| 1969 | Ga0495599_0224628 | |||
| 1970 | Ga0495623_0033455 | |||
| 1971 | Ga0495623_0430243 | |||
| 1972 | Ga0495623_0714883 | |||
| 1973 | Ga0495647_0404051 | |||
| 1974 | Ga0495658_0376940 | |||
| 1975 | Ga0495658_1021613 | |||
| 1976 | Ga0495669_0023858 | |||
| 1977 | Ga0495669_0410793 | |||
| 1978 | Ga0495613_0141923 | |||
| 1979 | Ga0495613_0194136 | |||
| 1980 | Ga0495613_0422626 | |||
| 1981 | Ga0495649_0051662 | |||
| 1982 | Ga0495581_0849511 | |||
| 1983 | Ga0495604_0295119 | |||
| 1984 | Ga0495674_0095645 | |||
| 1985 | Ga0495674_0271743 | |||
| 1986 | Ga0495674_0488278 | |||
| 1987 | Ga0495680_0260179 | |||
| 1988 | Ga0495680_0939060 | |||
| 1989 | Ga0495684_0010939 | |||
| 1990 | Ga0495684_0087349 | |||
| 1991 | Ga0495684_0299208 | |||
| 1992 | Ga0495684_0776834 | |||
| 1993 | Ga0495684_0821433 | |||
| 1994 | Ga0495602_0064498 | |||
| 1995 | Ga0495602_0178557 | |||
| 1996 | Ga0495602_0197982 | |||
| 1997 | Ga0495602_0246388 | |||
| 1998 | Ga0495602_0406509 | |||
| 1999 | Ga0495602_0657658 | |||
| 2000 | Ga0496102_0456470 | |||
| 2001 | Ga0496102_1461873 | |||
| 2002 | Ga0496104_0054117 | |||
| 2003 | Ga0496104_1129462 | |||
| 2004 | Ga0496104_1221726 | |||
| 2005 | Ga0496106_0727480 | |||
| 2006 | Ga0496107_1311659 | |||
| 2007 | Ga0496108_0059022 | |||
| 2008 | Ga0496109_0071771 | |||
| 2009 | Ga0496110_0902567 | |||
| 2010 | Ga0496112_0010236 | |||
| 2011 | Ga0496112_0042857 | |||
| 2012 | Ga0496112_0230180 | |||
| 2013 | Ga0496112_0848066 | |||
| 2014 | Ga0496113_0015241 | |||
| 2015 | Ga0496114_1244938 | |||
| 2016 | Ga0496115_0046507 | |||
| 2017 | Ga0496115_0189957 | |||
| 2018 | Ga0496115_0261138 | |||
| 2019 | Ga0496115_0462612 | |||
| 2020 | Ga0496126_0003557 | |||
| 2021 | Ga0495682_0020421 | |||
| 2022 | Ga0495682_0096380 | |||
| 2023 | Ga0495682_0177594 | |||
| 2024 | Ga0501031_0004907 | |||
| 2025 | Ga0501031_0184343 | |||
| 2026 | Ga0501031_0314796 | |||
| 2027 | Ga0501032_0001053 | |||
| 2028 | Ga0501032_0324618 | |||
| 2029 | Ga0501033_0011227 | |||
| 2030 | Ga0501033_0515890 | |||
| 2031 | Ga0501033_0546726 | |||
| 2032 | Ga0501034_0007884 | |||
| 2033 | Ga0501036_0007012 | |||
| 2034 | Ga0501037_0009727 | |||
| 2035 | Ga0501038_0002358 | |||
| 2036 | Ga0501039_0031801 | |||
| 2037 | Ga0501039_0190301 | |||
| 2038 | Ga0501042_0162494 | |||
| 2039 | Ga0501043_0000445 | |||
| 2040 | Ga0501043_0733027 | |||
| 2041 | Ga0501046_0000036 | |||
| 2042 | Ga0501047_0000401 | |||
| 2043 | Ga0501048_0538894 | |||
| 2044 | Ga0501048_1103363 | |||
| 2045 | Ga0501068_0552876 | |||
| 2046 | Ga0501069_0619017 | |||
| 2047 | Ga0501070_0108996 | |||
| 2048 | Ga0501071_0136913 | |||
| 2049 | Ga0501073_0036298 | |||
| 2050 | Ga0501073_1072865 | |||
| 2051 | Ga0501074_0869555 | |||
| 2052 | Ga0501075_1392700 | |||
| 2053 | Ga0501076_0273277 | |||
| 2054 | Ga0501077_0295874 | |||
| 2055 | Ga0501209_085533 | |||
| 2056 | Ga0501216_151238 | |||
| 2057 | Ga0501217_177167 | |||
| 2058 | Ga0501080_0689457 | |||
| 2059 | Ga0501081_0956885 | |||
| 2060 | Ga0501083_0878987 | |||
| 2061 | Ga0501263_097533 | |||
| 2062 | Ga0501268_038471 | |||
| 2063 | Ga0501270_165014 | |||
| 2064 | Ga0501035_0037475 | |||
| 2065 | Ga0501044_0106294 | |||
| 2066 | Ga0501044_0107514 | |||
| 2067 | Ga0501044_0474344 | |||
| 2068 | Ga0501045_0338297 | |||
| 2069 | nmdc:mga03683_62635_c1 | |||
| 2070 | nmdc:mga00v17_424188_c1 | |||
| 2071 | nmdc:mga00v17_548755_c1 | |||
| 2072 | nmdc:mga0k408_23088_c1 | |||
| 2073 | nmdc:mga05p37_12177_c1 | |||
| 2074 | nmdc:mga05p37_1604076_c1 | |||
| 2075 | nmdc:mga05p37_1668157_c1 | |||
| 2076 | nmdc:mga05p37_362476_c1 | |||
| 2077 | nmdc:mga05p37_485758_c1 | |||
| 2078 | nmdc:mga05p37_972315_c1 | |||
| 2079 | nmdc:mga09592_14839_c1 | |||
| 2080 | nmdc:mga0qj67_11613_c1 | |||
| 2081 | nmdc:mga06r32_30750_c1 | |||
| 2082 | nmdc:mga08y16_105683_c1 | |||
| 2083 | nmdc:mga08y16_128892_c1 | |||
| 2084 | nmdc:mga08y16_1444664_c1 | |||
| 2085 | nmdc:mga08y16_1736026_c1 | |||
| 2086 | nmdc:mga08y16_225902_c1 | |||
| 2087 | nmdc:mga08y16_280977_c1 | |||
| 2088 | nmdc:mga08y16_319318_c1 | |||
| 2089 | nmdc:mga08y16_6711_c1 | |||
| 2090 | nmdc:mga08y16_69785_c1 | |||
| 2091 | nmdc:mga08y16_740277_c1 | |||
| 2092 | nmdc:mga0n895_1589850_c1 | |||
| 2093 | nmdc:mga0n895_1676672_c1 | |||
| 2094 | nmdc:mga0n895_278644_c1 | |||
| 2095 | nmdc:mga0n895_403705_c1 | |||
| 2096 | nmdc:mga0n895_6_c1 | |||
| 2097 | nmdc:mga0n895_946177_c1 | |||
| 2098 | nmdc:mga0rr50_7_c1 | |||
| 2099 | nmdc:mga08x19_19330_c1 | |||
| 2100 | nmdc:mga08x19_497501_c2 | |||
| 2101 | nmdc:mga08x19_769705_c1 | |||
| 2102 | nmdc:mga0sz30_240149_c1 | |||
| 2103 | Ga0495601_0068385 | |||
| 2104 | Ga0495619_0160201 | |||
| 2105 | Ga0500644_0010547 | |||
| 2106 | Ga0500595_068531 | |||
| 2107 | Ga0500573_0389849 | |||
| 2108 | Ga0501084_0051231 | |||
| 2109 | Ga0501084_1119007 | |||
| 2110 | Ga0590074_076958 | |||
| 2111 | Ga0501082_0426066 | |||
| 2112 | 2884218423 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9365 | 4 | 84 |
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9356 | 2 | 87 |
| 3l7w-assembly1.cif.gz_A-2 | the crystal structure of smu.1704 from streptococcus mutans ua159 | 0.9275 | 2 | 89 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9265 | 4 | 84 |
| 3hhh-assembly1.cif.gz_A | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9201 | 2 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUS4_1_110_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9284 | 2 | 84 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9265 | 4 | 84 | 1.10.10.10 |
| af_I6X7F9_1_101_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9239 | 2 | 86 | 1.10.10.10 |
| 3l7wA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9159 | 2 | 89 | 1.10.10.10 |
| 5dymA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8901 | 1 | 88 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2TGT5-F1-model_v4 | PadR family transcriptional regulator | 0.9959 | 5 | 87 |
|
| AF-A0A2V9A638-F1-model_v4 | PadR family transcriptional regulator | 0.9957 | 2 | 69 |
|
| AF-A0A7W7ZJD9-F1-model_v4 | Transcriptional regulator | 0.9954 | 5 | 88 |
|
| AF-A0A2V9H684-F1-model_v4 | PadR family transcriptional regulator | 0.993 | 5 | 74 |
|
| AF-A0A4Q7XXC7-F1-model_v4 | PadR family transcriptional regulator | 0.9928 | 5 | 87 |
GO:0000150
GO:0003677 |