F489163
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1055 | 501 | 1016 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0445213|Ga0496102_0445213_79_909 |
| Length | 276 |
| Sequence | VKILEAERLSIAFGGVRAVDDVSLAVEAGEVFSIIGPNGAGKTTLFNMISGLYTPAAGRVRLTGEDVTGLAPDRLAHRGLSRTFQNLQIFVRMTALENVMVGCHRHEATGIFAELLHLPSVARQNRTTRDAAAAALGRVGLSSHAARFAAGLPYGALKRLEMARALASAPKVLLLDEPAAGCNPVETAEIAAIIRQFARDGITVVLVEHDMRLVMDISDRIHVLANGRTLAEGTAAVVRANPAVIEAYLGVGACSGERSDSPRKGGGAQEIAGAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 5 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 6 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 7 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 8 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 9 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 10 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 11 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 12 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 13 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 14 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 15 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 16 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 17 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 18 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 19 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 20 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 21 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 22 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 23 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 24 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 25 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 26 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 27 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 28 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 29 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 30 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 31 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 32 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 33 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 34 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 35 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 36 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 37 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 38 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 39 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 40 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 41 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 42 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 43 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 44 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 45 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 46 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 47 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 48 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 49 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 51 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 52 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 56 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 57 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 58 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 60 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 67 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 71 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 83 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 97 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 110 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 112 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 113 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 114 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 115 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 116 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 117 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 118 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 119 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 120 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 121 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 122 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 123 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 124 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 125 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 126 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 127 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 128 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 130 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 131 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 132 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 133 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 137 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 138 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 139 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 140 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 142 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 143 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 144 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 145 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 146 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 147 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 148 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 149 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 150 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 151 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 153 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 168 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 177 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 181 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 184 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 185 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 259 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 263 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 264 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 265 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 266 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 267 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 268 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 269 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 270 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 271 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 272 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 273 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 274 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 275 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 276 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 277 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 279 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 280 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 281 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 282 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 283 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 284 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 286 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 287 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 288 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 289 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 290 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 291 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 292 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 293 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 294 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 296 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 297 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 298 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 299 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 300 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 303 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 305 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 307 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 308 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 309 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 310 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 311 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 312 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 313 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 314 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 315 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 316 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 318 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 319 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 320 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 321 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 322 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 323 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 324 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 325 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 326 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 327 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 328 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 329 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 330 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 331 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 332 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 333 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 334 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 335 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 400 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 401 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 402 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 403 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 404 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 405 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 408 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 409 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 410 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 411 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 412 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 413 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 414 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 415 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 416 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 417 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 418 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 419 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 420 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 421 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 422 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 457 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 458 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 459 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 460 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 461 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 462 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 471 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 478 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 479 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 480 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 481 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 482 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 483 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 484 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 485 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 486 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 487 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 488 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 489 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 490 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 491 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 492 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 493 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 495 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 498 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 499 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 500 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 501 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.21 |
| Metatranscriptomes | 0.09 |
| Isolates | 3.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.01 |
| Nodule | 1.14 |
| Rhizoplane | 10.14 |
| Rhizosphere | 77.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_6977220 | 2162886011 | Bacteria | 3369 |
| 2 | 2214544908 | 2209111006 | Bacteria | 36473 |
| 3 | ARcpr5oldR_c000009 | 3300000041 | Bacteria | 39838 |
| 4 | ARSoilYngRDRAFT_c00030 | 3300000042 | Bacteria | 22085 |
| 5 | ARcpr5yngRDRAFT_c000008 | 3300000043 | Bacteria | 39878 |
| 6 | ARSoilOldRDRAFT_c000009 | 3300000044 | Bacteria | 45329 |
| 7 | ARCol0oldRDRAFT_c00009 | 3300000045 | Bacteria | 15916 |
| 8 | ARCol0yngRDRAFT_1000008 | 3300000652 | Bacteria | 45358 |
| 9 | JGI24743J22301_10004507 | 3300001991 | Bacteria | 2276 |
| 10 | JGI25152J39213_1020028 | 3300002773 | Bacteria | 1205 |
| 11 | JGI25151J46595_10000697 | 3300003187 | Bacteria | 28184 |
| 12 | JGI25151J46595_10020173 | 3300003187 | Bacteria | 2815 |
| 13 | JGI25153J46596_10003791 | 3300003215 | Bacteria | 8346 |
| 14 | Ga0055524_1000064 | 3300003775 | Bacteria | 133574 |
| 15 | Ga0055536_1004556 | 3300003781 | Bacteria | 7040 |
| 16 | Ga0055528_1007814 | 3300003790 | Bacteria | 4673 |
| 17 | Ga0055530_10007828 | 3300003791 | Bacteria | 4410 |
| 18 | Ga0055540_1000045 | 3300003792 | Bacteria | 152083 |
| 19 | Ga0055531_10000149 | 3300003794 | Bacteria | 80949 |
| 20 | Ga0065716_1001541 | 3300005277 | Bacteria | 7642 |
| 21 | Ga0065704_10070953 | 3300005289 | Bacteria | 14294 |
| 22 | Ga0065712_10074587 | 3300005290 | Bacteria | 4056 |
| 23 | Ga0065712_10079461 | 3300005290 | Bacteria | 3215 |
| 24 | Ga0065715_10119572 | 3300005293 | Bacteria | 2283 |
| 25 | Ga0065707_10095129 | 3300005295 | Bacteria | 3414 |
| 26 | Ga0070658_10012053 | 3300005327 | Bacteria | 6943 |
| 27 | Ga0070658_10222047 | 3300005327 | Bacteria | 1598 |
| 28 | Ga0070676_10042146 | 3300005328 | Bacteria | 2649 |
| 29 | Ga0070676_10229184 | 3300005328 | Bacteria | 1231 |
| 30 | Ga0070683_100067856 | 3300005329 | Bacteria | 3322 |
| 31 | Ga0070683_100343710 | 3300005329 | Bacteria | 1421 |
| 32 | Ga0070690_100031226 | 3300005330 | Bacteria | 3317 |
| 33 | Ga0070690_100040872 | 3300005330 | Bacteria | 2934 |
| 34 | Ga0070670_100034285 | 3300005331 | Bacteria | 4368 |
| 35 | Ga0070670_100045033 | 3300005331 | Bacteria | 3792 |
| 36 | Ga0070670_100054860 | 3300005331 | Bacteria | 3422 |
| 37 | Ga0070670_100489277 | 3300005331 | Bacteria | 1093 |
| 38 | Ga0070677_10021417 | 3300005333 | Bacteria | 2371 |
| 39 | Ga0070677_10051133 | 3300005333 | Bacteria | 1672 |
| 40 | Ga0068869_100076568 | 3300005334 | Bacteria | 2487 |
| 41 | Ga0068869_100219157 | 3300005334 | Bacteria | 1507 |
| 42 | Ga0070666_10082392 | 3300005335 | Bacteria | 2200 |
| 43 | Ga0070666_10200436 | 3300005335 | Bacteria | 1404 |
| 44 | Ga0070680_100001410 | 3300005336 | Bacteria | 17375 |
| 45 | Ga0070680_100007553 | 3300005336 | Bacteria | 8289 |
| 46 | Ga0070680_100061649 | 3300005336 | Bacteria | 3070 |
| 47 | Ga0070680_100197201 | 3300005336 | Bacteria | 1697 |
| 48 | Ga0070680_100441619 | 3300005336 | Bacteria | 1111 |
| 49 | Ga0070682_100085926 | 3300005337 | Bacteria | 2047 |
| 50 | Ga0070682_100317335 | 3300005337 | Bacteria | 1149 |
| 51 | Ga0070682_100360308 | 3300005337 | Bacteria | 1087 |
| 52 | Ga0068868_100065959 | 3300005338 | Bacteria | 2877 |
| 53 | Ga0068868_100197794 | 3300005338 | Bacteria | 1674 |
| 54 | Ga0070660_100001593 | 3300005339 | Bacteria | 15589 |
| 55 | Ga0070660_100007654 | 3300005339 | Bacteria | 7527 |
| 56 | Ga0070660_100234431 | 3300005339 | Bacteria | 1494 |
| 57 | Ga0070660_100376427 | 3300005339 | Bacteria | 1172 |
| 58 | Ga0070689_100031795 | 3300005340 | Bacteria | 4011 |
| 59 | Ga0070689_100116047 | 3300005340 | Bacteria | 2135 |
| 60 | Ga0070689_100641144 | 3300005340 | Bacteria | 923 |
| 61 | Ga0070687_100007937 | 3300005343 | Bacteria | 4466 |
| 62 | Ga0070687_100070207 | 3300005343 | Bacteria | 1878 |
| 63 | Ga0070661_100066713 | 3300005344 | Bacteria | 2644 |
| 64 | Ga0070692_10020011 | 3300005345 | Bacteria | 3238 |
| 65 | Ga0070668_100038614 | 3300005347 | Bacteria | 3650 |
| 66 | Ga0070668_100267347 | 3300005347 | Bacteria | 1424 |
| 67 | Ga0070668_100353053 | 3300005347 | Bacteria | 1245 |
| 68 | Ga0070669_100007294 | 3300005353 | Bacteria | 7929 |
| 69 | Ga0070669_100129903 | 3300005353 | Bacteria | 1931 |
| 70 | Ga0070669_100332861 | 3300005353 | Bacteria | 1228 |
| 71 | Ga0070675_100055984 | 3300005354 | Bacteria | 3248 |
| 72 | Ga0070675_100126767 | 3300005354 | Bacteria | 2172 |
| 73 | Ga0070671_100010470 | 3300005355 | Bacteria | 7440 |
| 74 | Ga0070671_100139366 | 3300005355 | Bacteria | 2046 |
| 75 | Ga0070674_100030100 | 3300005356 | Bacteria | 3584 |
| 76 | Ga0070674_100035925 | 3300005356 | Bacteria | 3322 |
| 77 | Ga0070674_100092683 | 3300005356 | Bacteria | 2184 |
| 78 | Ga0070674_100097805 | 3300005356 | Bacteria | 2132 |
| 79 | Ga0070673_100271202 | 3300005364 | Bacteria | 1485 |
| 80 | Ga0070688_100003872 | 3300005365 | Bacteria | 7754 |
| 81 | Ga0070688_100023242 | 3300005365 | Bacteria | 3644 |
| 82 | Ga0070659_100075313 | 3300005366 | Bacteria | 2690 |
| 83 | Ga0070659_100113504 | 3300005366 | Bacteria | 2189 |
| 84 | Ga0070659_100225823 | 3300005366 | Bacteria | 1547 |
| 85 | Ga0070659_100276957 | 3300005366 | Bacteria | 1395 |
| 86 | Ga0070659_100283983 | 3300005366 | Bacteria | 1377 |
| 87 | Ga0070659_100291966 | 3300005366 | Bacteria | 1358 |
| 88 | Ga0070667_100009854 | 3300005367 | Bacteria | 7921 |
| 89 | Ga0070667_100141341 | 3300005367 | Bacteria | 2108 |
| 90 | Ga0070667_100184817 | 3300005367 | Bacteria | 1844 |
| 91 | Ga0070709_10005422 | 3300005434 | Bacteria | 6909 |
| 92 | Ga0070709_10481325 | 3300005434 | Bacteria | 940 |
| 93 | Ga0070714_100033057 | 3300005435 | Bacteria | 4322 |
| 94 | Ga0070714_100046287 | 3300005435 | Bacteria | 3690 |
| 95 | Ga0070714_100073796 | 3300005435 | Bacteria | 2956 |
| 96 | Ga0070714_100108474 | 3300005435 | Bacteria | 2455 |
| 97 | Ga0070713_100099724 | 3300005436 | Bacteria | 2513 |
| 98 | Ga0070710_10078595 | 3300005437 | Bacteria | 1920 |
| 99 | Ga0070710_10088122 | 3300005437 | Bacteria | 1825 |
| 100 | Ga0070710_10205431 | 3300005437 | Bacteria | 1246 |
| 101 | Ga0070701_10039584 | 3300005438 | Bacteria | 2392 |
| 102 | Ga0070701_10145612 | 3300005438 | Bacteria | 1359 |
| 103 | Ga0070700_100053456 | 3300005441 | Bacteria | 2520 |
| 104 | Ga0070700_100243382 | 3300005441 | Bacteria | 1286 |
| 105 | Ga0070694_100030678 | 3300005444 | Bacteria | 3519 |
| 106 | Ga0070694_100127084 | 3300005444 | Bacteria | 1836 |
| 107 | Ga0070663_100001521 | 3300005455 | Bacteria | 12761 |
| 108 | Ga0070663_100026594 | 3300005455 | Bacteria | 3921 |
| 109 | Ga0070663_100251573 | 3300005455 | Bacteria | 1399 |
| 110 | Ga0070678_100073746 | 3300005456 | Bacteria | 2562 |
| 111 | Ga0070678_100079685 | 3300005456 | Bacteria | 2478 |
| 112 | Ga0070678_100124312 | 3300005456 | Bacteria | 2039 |
| 113 | Ga0070678_100166376 | 3300005456 | Bacteria | 1792 |
| 114 | Ga0070678_100230441 | 3300005456 | Bacteria | 1544 |
| 115 | Ga0070662_100117596 | 3300005457 | Bacteria | 2033 |
| 116 | Ga0070681_10047543 | 3300005458 | Bacteria | 4289 |
| 117 | Ga0070681_10063813 | 3300005458 | Bacteria | 3656 |
| 118 | Ga0068867_100039092 | 3300005459 | Bacteria | 3457 |
| 119 | Ga0068867_100287337 | 3300005459 | Bacteria | 1351 |
| 120 | Ga0070685_10011463 | 3300005466 | Bacteria | 4640 |
| 121 | Ga0070685_10030373 | 3300005466 | Bacteria | 3010 |
| 122 | Ga0070706_100197283 | 3300005467 | Bacteria | 1880 |
| 123 | Ga0070707_100332348 | 3300005468 | Bacteria | 1476 |
| 124 | Ga0070698_100130523 | 3300005471 | Bacteria | 2468 |
| 125 | Ga0070679_100028477 | 3300005530 | Bacteria | 5508 |
| 126 | Ga0070679_100074303 | 3300005530 | Bacteria | 3390 |
| 127 | Ga0070679_100182765 | 3300005530 | Bacteria | 2069 |
| 128 | Ga0070679_100305833 | 3300005530 | Bacteria | 1540 |
| 129 | Ga0070684_100072514 | 3300005535 | Bacteria | 3032 |
| 130 | Ga0070684_100486754 | 3300005535 | Bacteria | 1142 |
| 131 | Ga0070697_100620514 | 3300005536 | Bacteria | 951 |
| 132 | Ga0070672_100206191 | 3300005543 | Bacteria | 1645 |
| 133 | Ga0070695_100003825 | 3300005545 | Bacteria | 8781 |
| 134 | Ga0070695_100120908 | 3300005545 | Bacteria | 1791 |
| 135 | Ga0070693_100017405 | 3300005547 | Bacteria | 3736 |
| 136 | Ga0070693_100052891 | 3300005547 | Bacteria | 2330 |
| 137 | Ga0070665_100002816 | 3300005548 | Bacteria | 18830 |
| 138 | Ga0070665_100051051 | 3300005548 | Bacteria | 4149 |
| 139 | Ga0070665_100409078 | 3300005548 | Bacteria | 1365 |
| 140 | Ga0070665_100478057 | 3300005548 | Bacteria | 1256 |
| 141 | Ga0070704_100127835 | 3300005549 | Bacteria | 1964 |
| 142 | Ga0068855_100017227 | 3300005563 | Bacteria | 8694 |
| 143 | Ga0068855_100567348 | 3300005563 | Bacteria | 1227 |
| 144 | Ga0070664_100198645 | 3300005564 | Bacteria | 1789 |
| 145 | Ga0068857_100141940 | 3300005577 | Bacteria | 2171 |
| 146 | Ga0068854_100056426 | 3300005578 | Bacteria | 2830 |
| 147 | Ga0068854_100360164 | 3300005578 | Bacteria | 1193 |
| 148 | Ga0068856_100280568 | 3300005614 | Bacteria | 1683 |
| 149 | Ga0068852_100166905 | 3300005616 | Bacteria | 2060 |
| 150 | Ga0068852_100193731 | 3300005616 | Bacteria | 1919 |
| 151 | Ga0068852_100236339 | 3300005616 | Bacteria | 1744 |
| 152 | Ga0068852_100463515 | 3300005616 | Bacteria | 1256 |
| 153 | Ga0068859_100036474 | 3300005617 | Bacteria | 4936 |
| 154 | Ga0068859_100052613 | 3300005617 | Bacteria | 4094 |
| 155 | Ga0068859_100252855 | 3300005617 | Bacteria | 1853 |
| 156 | Ga0068859_100680199 | 3300005617 | Bacteria | 1120 |
| 157 | Ga0068864_100008308 | 3300005618 | Bacteria | 8564 |
| 158 | Ga0068864_100015632 | 3300005618 | Bacteria | 6314 |
| 159 | Ga0068864_100029633 | 3300005618 | Bacteria | 4637 |
| 160 | Ga0068864_100157159 | 3300005618 | Bacteria | 2064 |
| 161 | Ga0068866_10012834 | 3300005718 | Bacteria | 3659 |
| 162 | Ga0068866_10031153 | 3300005718 | Bacteria | 2566 |
| 163 | Ga0068861_100050735 | 3300005719 | Bacteria | 3147 |
| 164 | Ga0068861_100303616 | 3300005719 | Bacteria | 1384 |
| 165 | Ga0068851_10003774 | 3300005834 | Bacteria | 6776 |
| 166 | Ga0068851_10261404 | 3300005834 | Bacteria | 985 |
| 167 | Ga0068870_10021342 | 3300005840 | Bacteria | 3166 |
| 168 | Ga0068870_10057880 | 3300005840 | Bacteria | 2073 |
| 169 | Ga0068863_100087926 | 3300005841 | Bacteria | 2945 |
| 170 | Ga0068863_100129676 | 3300005841 | Bacteria | 2407 |
| 171 | Ga0068863_100612742 | 3300005841 | Bacteria | 1078 |
| 172 | Ga0068863_100907465 | 3300005841 | Bacteria | 881 |
| 173 | Ga0068858_100001279 | 3300005842 | Bacteria | 26017 |
| 174 | Ga0068858_100036464 | 3300005842 | Bacteria | 4560 |
| 175 | Ga0068858_100177287 | 3300005842 | Bacteria | 2011 |
| 176 | Ga0068860_100103357 | 3300005843 | Bacteria | 2719 |
| 177 | Ga0068860_100186511 | 3300005843 | Bacteria | 2006 |
| 178 | Ga0068860_100540591 | 3300005843 | Bacteria | 1166 |
| 179 | Ga0068862_100112390 | 3300005844 | Bacteria | 2392 |
| 180 | Ga0068862_100182861 | 3300005844 | Bacteria | 1882 |
| 181 | Ga0081455_10000858 | 3300005937 | Bacteria | 39172 |
| 182 | Ga0081455_10003340 | 3300005937 | Bacteria | 18499 |
| 183 | Ga0081455_10009294 | 3300005937 | Bacteria | 10123 |
| 184 | Ga0081455_10143757 | 3300005937 | Bacteria | 1849 |
| 185 | Ga0081538_10001857 | 3300005981 | Bacteria | 21297 |
| 186 | Ga0081538_10034940 | 3300005981 | Bacteria | 3313 |
| 187 | Ga0081540_1001455 | 3300005983 | Bacteria | 20460 |
| 188 | Ga0081540_1003099 | 3300005983 | Bacteria | 13317 |
| 189 | Ga0081540_1039591 | 3300005983 | Bacteria | 2469 |
| 190 | Ga0070717_10081002 | 3300006028 | Bacteria | 2725 |
| 191 | Ga0070717_10450305 | 3300006028 | Bacteria | 1160 |
| 192 | Ga0075365_10008924 | 3300006038 | Bacteria | 5726 |
| 193 | Ga0075365_10010677 | 3300006038 | Bacteria | 5364 |
| 194 | Ga0075365_10043532 | 3300006038 | Bacteria | 2939 |
| 195 | Ga0075365_10096405 | 3300006038 | Bacteria | 2021 |
| 196 | Ga0075363_100007861 | 3300006048 | Bacteria | 4933 |
| 197 | Ga0075363_100026897 | 3300006048 | Bacteria | 2946 |
| 198 | Ga0075364_10010874 | 3300006051 | Bacteria | 5514 |
| 199 | Ga0075432_10004288 | 3300006058 | Bacteria | 4853 |
| 200 | Ga0075432_10050644 | 3300006058 | Bacteria | 1465 |
| 201 | Ga0070715_10000623 | 3300006163 | Bacteria | 9367 |
| 202 | Ga0070715_10054022 | 3300006163 | Bacteria | 1738 |
| 203 | Ga0070715_10155350 | 3300006163 | Bacteria | 1125 |
| 204 | Ga0070716_100314000 | 3300006173 | Bacteria | 1095 |
| 205 | Ga0070712_100028977 | 3300006175 | Bacteria | 3709 |
| 206 | Ga0070712_100271120 | 3300006175 | Bacteria | 1363 |
| 207 | Ga0075362_10030106 | 3300006177 | Bacteria | 2343 |
| 208 | Ga0075367_10109898 | 3300006178 | Bacteria | 1691 |
| 209 | Ga0075367_10199806 | 3300006178 | Bacteria | 1249 |
| 210 | Ga0075369_10085027 | 3300006186 | Bacteria | 1407 |
| 211 | Ga0075427_10001837 | 3300006194 | Bacteria | 2776 |
| 212 | Ga0097621_100034889 | 3300006237 | Bacteria | 4015 |
| 213 | Ga0097621_100112776 | 3300006237 | Bacteria | 2299 |
| 214 | Ga0097621_100167011 | 3300006237 | Bacteria | 1895 |
| 215 | Ga0097621_100295049 | 3300006237 | Bacteria | 1430 |
| 216 | Ga0075370_10017813 | 3300006353 | Bacteria | 3842 |
| 217 | Ga0068871_100059967 | 3300006358 | Bacteria | 3102 |
| 218 | Ga0068871_100287677 | 3300006358 | Bacteria | 1439 |
| 219 | Ga0068871_100388319 | 3300006358 | Bacteria | 1241 |
| 220 | Ga0075428_100001371 | 3300006844 | Bacteria | 25896 |
| 221 | Ga0075428_100002667 | 3300006844 | Bacteria | 19383 |
| 222 | Ga0075428_100045387 | 3300006844 | Bacteria | 4828 |
| 223 | Ga0075428_100056055 | 3300006844 | Bacteria | 4317 |
| 224 | Ga0075428_100153128 | 3300006844 | Bacteria | 2505 |
| 225 | Ga0075428_100199973 | 3300006844 | Bacteria | 2161 |
| 226 | Ga0075428_100471572 | 3300006844 | Bacteria | 1344 |
| 227 | Ga0075428_100648358 | 3300006844 | Bacteria | 1126 |
| 228 | Ga0075430_100000770 | 3300006846 | Bacteria | 24728 |
| 229 | Ga0075430_100017979 | 3300006846 | Bacteria | 6018 |
| 230 | Ga0075430_100098009 | 3300006846 | Bacteria | 2449 |
| 231 | Ga0075431_100000399 | 3300006847 | Bacteria | 35027 |
| 232 | Ga0075431_100001861 | 3300006847 | Bacteria | 19979 |
| 233 | Ga0075431_100058238 | 3300006847 | Bacteria | 3986 |
| 234 | Ga0075431_100138863 | 3300006847 | Bacteria | 2505 |
| 235 | Ga0075433_10000374 | 3300006852 | Bacteria | 28158 |
| 236 | Ga0075433_10145154 | 3300006852 | Bacteria | 2110 |
| 237 | Ga0075434_100001253 | 3300006871 | Bacteria | 21152 |
| 238 | Ga0075434_100189166 | 3300006871 | Bacteria | 2079 |
| 239 | Ga0075434_100257538 | 3300006871 | Bacteria | 1764 |
| 240 | Ga0075434_100314024 | 3300006871 | Bacteria | 1588 |
| 241 | Ga0075434_100355241 | 3300006871 | Bacteria | 1486 |
| 242 | Ga0075429_100001469 | 3300006880 | Bacteria | 19383 |
| 243 | Ga0075429_100001959 | 3300006880 | Bacteria | 17088 |
| 244 | Ga0075429_100043337 | 3300006880 | Bacteria | 3916 |
| 245 | Ga0075429_100054135 | 3300006880 | Bacteria | 3491 |
| 246 | Ga0075429_100299777 | 3300006880 | Bacteria | 1407 |
| 247 | Ga0068865_100030560 | 3300006881 | Bacteria | 3584 |
| 248 | Ga0075436_100414980 | 3300006914 | Bacteria | 977 |
| 249 | Ga0097620_100036473 | 3300006931 | Bacteria | 4936 |
| 250 | Ga0097620_100052611 | 3300006931 | Bacteria | 4094 |
| 251 | Ga0097620_100252838 | 3300006931 | Bacteria | 1853 |
| 252 | Ga0097620_100680191 | 3300006931 | Bacteria | 1120 |
| 253 | Ga0075435_100009949 | 3300007076 | Bacteria | 6927 |
| 254 | Ga0075435_100136866 | 3300007076 | Bacteria | 2052 |
| 255 | Ga0105240_10032220 | 3300009093 | Bacteria | 6788 |
| 256 | Ga0105240_10038568 | 3300009093 | Bacteria | 6126 |
| 257 | Ga0105240_10513008 | 3300009093 | Bacteria | 1331 |
| 258 | Ga0111539_10000242 | 3300009094 | Bacteria | 65417 |
| 259 | Ga0111539_10001763 | 3300009094 | Bacteria | 28733 |
| 260 | Ga0111539_10003310 | 3300009094 | Bacteria | 21272 |
| 261 | Ga0111539_10003651 | 3300009094 | Bacteria | 20267 |
| 262 | Ga0111539_10028162 | 3300009094 | Bacteria | 6859 |
| 263 | Ga0111539_10196051 | 3300009094 | Bacteria | 2355 |
| 264 | Ga0111539_10232174 | 3300009094 | Bacteria | 2148 |
| 265 | Ga0111539_10410115 | 3300009094 | Bacteria | 1578 |
| 266 | Ga0111539_10634047 | 3300009094 | Bacteria | 1244 |
| 267 | Ga0111539_11142077 | 3300009094 | Bacteria | 905 |
| 268 | Ga0105245_10000556 | 3300009098 | Bacteria | 33858 |
| 269 | Ga0105245_10003235 | 3300009098 | Bacteria | 14596 |
| 270 | Ga0105245_10289217 | 3300009098 | Bacteria | 1605 |
| 271 | Ga0105245_10360456 | 3300009098 | Bacteria | 1443 |
| 272 | Ga0105247_10000474 | 3300009101 | Bacteria | 33690 |
| 273 | Ga0105247_10039961 | 3300009101 | Bacteria | 2866 |
| 274 | Ga0105247_10316669 | 3300009101 | Bacteria | 1087 |
| 275 | Ga0114129_10000199 | 3300009147 | Bacteria | 66704 |
| 276 | Ga0114129_10001978 | 3300009147 | Bacteria | 28018 |
| 277 | Ga0114129_10007210 | 3300009147 | Bacteria | 15822 |
| 278 | Ga0114129_10020933 | 3300009147 | Bacteria | 9290 |
| 279 | Ga0114129_10033314 | 3300009147 | Bacteria | 7280 |
| 280 | Ga0114129_10085361 | 3300009147 | Bacteria | 4380 |
| 281 | Ga0114129_10088583 | 3300009147 | Bacteria | 4290 |
| 282 | Ga0114129_10120940 | 3300009147 | Bacteria | 3604 |
| 283 | Ga0114129_10436698 | 3300009147 | Bacteria | 1719 |
| 284 | Ga0114129_10466703 | 3300009147 | Bacteria | 1654 |
| 285 | Ga0114129_11222167 | 3300009147 | Bacteria | 935 |
| 286 | Ga0105243_10088495 | 3300009148 | Bacteria | 2544 |
| 287 | Ga0105243_10092321 | 3300009148 | Bacteria | 2496 |
| 288 | Ga0105241_10392172 | 3300009174 | Bacteria | 1216 |
| 289 | Ga0105242_10011728 | 3300009176 | Bacteria | 6744 |
| 290 | Ga0105242_10457040 | 3300009176 | Bacteria | 1205 |
| 291 | Ga0105248_10000873 | 3300009177 | Bacteria | 33799 |
| 292 | Ga0105248_10084018 | 3300009177 | Bacteria | 3581 |
| 293 | Ga0105248_10104607 | 3300009177 | Bacteria | 3192 |
| 294 | Ga0105248_10193366 | 3300009177 | Bacteria | 2292 |
| 295 | Ga0105237_10026808 | 3300009545 | Bacteria | 5889 |
| 296 | Ga0105238_10395151 | 3300009551 | Bacteria | 1375 |
| 297 | Ga0105249_10139027 | 3300009553 | Bacteria | 2327 |
| 298 | Ga0105249_10239323 | 3300009553 | Bacteria | 1794 |
| 299 | Ga0105249_10429619 | 3300009553 | Bacteria | 1356 |
| 300 | Ga0105249_10479340 | 3300009553 | Bacteria | 1287 |
| 301 | Ga0105249_10505332 | 3300009553 | Bacteria | 1254 |
| 302 | Ga0105239_10002642 | 3300010375 | Bacteria | 22634 |
| 303 | Ga0105239_10028385 | 3300010375 | Bacteria | 6156 |
| 304 | Ga0105239_10111018 | 3300010375 | Bacteria | 3039 |
| 305 | Ga0105239_10374928 | 3300010375 | Bacteria | 1608 |
| 306 | Ga0105246_10000220 | 3300011119 | Bacteria | 29009 |
| 307 | Ga0105246_10136766 | 3300011119 | Bacteria | 1837 |
| 308 | Ga0105246_10361447 | 3300011119 | Bacteria | 1193 |
| 309 | Ga0157337_1000858 | 3300012483 | Bacteria | 1457 |
| 310 | Ga0157371_10081856 | 3300013102 | Bacteria | 2286 |
| 311 | Ga0157374_10000524 | 3300013296 | Bacteria | 34473 |
| 312 | Ga0157374_10015100 | 3300013296 | Bacteria | 6771 |
| 313 | Ga0157374_10325716 | 3300013296 | Bacteria | 1523 |
| 314 | Ga0157378_10000591 | 3300013297 | Bacteria | 34042 |
| 315 | Ga0157378_10860880 | 3300013297 | Bacteria | 935 |
| 316 | Ga0163162_10003457 | 3300013306 | Bacteria | 15087 |
| 317 | Ga0163162_10012895 | 3300013306 | Bacteria | 8162 |
| 318 | Ga0163162_10433708 | 3300013306 | Bacteria | 1446 |
| 319 | Ga0163162_10542747 | 3300013306 | Bacteria | 1291 |
| 320 | Ga0157372_10017920 | 3300013307 | Bacteria | 7610 |
| 321 | Ga0157372_10613420 | 3300013307 | Bacteria | 1268 |
| 322 | Ga0157375_10001668 | 3300013308 | Bacteria | 19088 |
| 323 | Ga0157375_10049059 | 3300013308 | Bacteria | 4135 |
| 324 | Ga0163163_10015811 | 3300014325 | Bacteria | 6991 |
| 325 | Ga0163163_10026975 | 3300014325 | Bacteria | 5496 |
| 326 | Ga0163163_10050183 | 3300014325 | Bacteria | 4109 |
| 327 | Ga0163163_10147751 | 3300014325 | Bacteria | 2395 |
| 328 | Ga0163163_10213655 | 3300014325 | Bacteria | 1978 |
| 329 | Ga0157380_10024561 | 3300014326 | Bacteria | 4562 |
| 330 | Ga0157380_10138079 | 3300014326 | Bacteria | 2090 |
| 331 | Ga0157380_10149702 | 3300014326 | Bacteria | 2016 |
| 332 | Ga0157380_10611902 | 3300014326 | Bacteria | 1080 |
| 333 | Ga0182008_10003543 | 3300014497 | Bacteria | 9382 |
| 334 | Ga0182008_10193696 | 3300014497 | Bacteria | 1032 |
| 335 | Ga0157377_10012661 | 3300014745 | Bacteria | 4247 |
| 336 | Ga0157377_10098137 | 3300014745 | Bacteria | 1741 |
| 337 | Ga0157379_10000422 | 3300014968 | Bacteria | 34158 |
| 338 | Ga0157379_10034165 | 3300014968 | Bacteria | 4532 |
| 339 | Ga0157379_10095356 | 3300014968 | Bacteria | 2669 |
| 340 | Ga0157379_10169853 | 3300014968 | Bacteria | 1969 |
| 341 | Ga0157379_10711286 | 3300014968 | Bacteria | 943 |
| 342 | Ga0157376_10000285 | 3300014969 | Bacteria | 34194 |
| 343 | Ga0157376_10138812 | 3300014969 | Bacteria | 2178 |
| 344 | Ga0157376_10225942 | 3300014969 | Bacteria | 1736 |
| 345 | Ga0182007_10001188 | 3300015262 | Bacteria | 14143 |
| 346 | Ga0163161_10066341 | 3300017792 | Bacteria | 2635 |
| 347 | Ga0163161_10328026 | 3300017792 | Bacteria | 1211 |
| 348 | Ga0206353_10740853 | 3300020082 | Bacteria | 3108 |
| 349 | Ga0214542_1000092 | 3300021321 | Bacteria | 117288 |
| 350 | Ga0214543_1000045 | 3300021327 | Bacteria | 152699 |
| 351 | Ga0209129_1000788 | 3300025258 | Bacteria | 19977 |
| 352 | Ga0207666_1007060 | 3300025271 | Bacteria | 1470 |
| 353 | Ga0209673_1001311 | 3300025273 | Bacteria | 25169 |
| 354 | Ga0207673_1000176 | 3300025290 | Bacteria | 6351 |
| 355 | Ga0209675_1000448 | 3300025291 | Bacteria | 31951 |
| 356 | Ga0209676_1000135 | 3300025292 | Bacteria | 182756 |
| 357 | Ga0209025_1000325 | 3300025294 | Bacteria | 106131 |
| 358 | Ga0209025_1001354 | 3300025294 | Bacteria | 32918 |
| 359 | Ga0209025_1027868 | 3300025294 | Bacteria | 2786 |
| 360 | Ga0209564_1000048 | 3300025295 | Bacteria | 364806 |
| 361 | Ga0209564_1017756 | 3300025295 | Bacteria | 2752 |
| 362 | Ga0209758_1000217 | 3300025297 | Bacteria | 124619 |
| 363 | Ga0209050_1000100 | 3300025298 | Bacteria | 231385 |
| 364 | Ga0209050_1021841 | 3300025298 | Bacteria | 2315 |
| 365 | Ga0209256_1000041 | 3300025299 | Bacteria | 364827 |
| 366 | Ga0209256_1028313 | 3300025299 | Bacteria | 1582 |
| 367 | Ga0209051_1000067 | 3300025303 | Bacteria | 227181 |
| 368 | Ga0209257_1000095 | 3300025304 | Bacteria | 259437 |
| 369 | Ga0207697_10000294 | 3300025315 | Bacteria | 27868 |
| 370 | Ga0207656_10009247 | 3300025321 | Bacteria | 3655 |
| 371 | Ga0207682_10001810 | 3300025893 | Bacteria | 9782 |
| 372 | Ga0207682_10011631 | 3300025893 | Bacteria | 3438 |
| 373 | Ga0207682_10089411 | 3300025893 | Bacteria | 1333 |
| 374 | Ga0207642_10017847 | 3300025899 | Bacteria | 2709 |
| 375 | Ga0207642_10046978 | 3300025899 | Bacteria | 1927 |
| 376 | Ga0207710_10000423 | 3300025900 | Bacteria | 27748 |
| 377 | Ga0207688_10004774 | 3300025901 | Bacteria | 7385 |
| 378 | Ga0207688_10189841 | 3300025901 | Bacteria | 1228 |
| 379 | Ga0207680_10086423 | 3300025903 | Bacteria | 1983 |
| 380 | Ga0207685_10077434 | 3300025905 | Bacteria | 1366 |
| 381 | Ga0207699_10145029 | 3300025906 | Bacteria | 1564 |
| 382 | Ga0207645_10000860 | 3300025907 | Bacteria | 25221 |
| 383 | Ga0207645_10021819 | 3300025907 | Bacteria | 4171 |
| 384 | Ga0207645_10100904 | 3300025907 | Bacteria | 1862 |
| 385 | Ga0207643_10000205 | 3300025908 | Bacteria | 41221 |
| 386 | Ga0207643_10006425 | 3300025908 | Bacteria | 6295 |
| 387 | Ga0207705_10187659 | 3300025909 | Bacteria | 1562 |
| 388 | Ga0207705_10341375 | 3300025909 | Bacteria | 1153 |
| 389 | Ga0207684_10006570 | 3300025910 | Bacteria | 10586 |
| 390 | Ga0207684_10009005 | 3300025910 | Bacteria | 8850 |
| 391 | Ga0207684_10025930 | 3300025910 | Bacteria | 4996 |
| 392 | Ga0207707_10077105 | 3300025912 | Bacteria | 2909 |
| 393 | Ga0207707_10168888 | 3300025912 | Bacteria | 1912 |
| 394 | Ga0207707_10335447 | 3300025912 | Bacteria | 1304 |
| 395 | Ga0207695_10251855 | 3300025913 | Bacteria | 1665 |
| 396 | Ga0207693_10009517 | 3300025915 | Bacteria | 7915 |
| 397 | Ga0207693_10042367 | 3300025915 | Bacteria | 3584 |
| 398 | Ga0207693_10234584 | 3300025915 | Bacteria | 1441 |
| 399 | Ga0207663_10132781 | 3300025916 | Bacteria | 1723 |
| 400 | Ga0207660_10040473 | 3300025917 | Bacteria | 3263 |
| 401 | Ga0207660_10080698 | 3300025917 | Bacteria | 2389 |
| 402 | Ga0207660_10273863 | 3300025917 | Bacteria | 1338 |
| 403 | Ga0207662_10005870 | 3300025918 | Bacteria | 6585 |
| 404 | Ga0207662_10023421 | 3300025918 | Bacteria | 3548 |
| 405 | Ga0207662_10183060 | 3300025918 | Bacteria | 1349 |
| 406 | Ga0207657_10006225 | 3300025919 | Bacteria | 12403 |
| 407 | Ga0207657_10043698 | 3300025919 | Bacteria | 3944 |
| 408 | Ga0207649_10133613 | 3300025920 | Bacteria | 1689 |
| 409 | Ga0207649_10473140 | 3300025920 | Bacteria | 949 |
| 410 | Ga0207652_10028460 | 3300025921 | Bacteria | 4662 |
| 411 | Ga0207652_10364747 | 3300025921 | Bacteria | 1304 |
| 412 | Ga0207681_10138311 | 3300025923 | Bacteria | 1810 |
| 413 | Ga0207681_10175867 | 3300025923 | Bacteria | 1626 |
| 414 | Ga0207681_10192537 | 3300025923 | Bacteria | 1561 |
| 415 | Ga0207650_10162264 | 3300025925 | Bacteria | 1771 |
| 416 | Ga0207650_10171378 | 3300025925 | Bacteria | 1725 |
| 417 | Ga0207650_10254780 | 3300025925 | Bacteria | 1422 |
| 418 | Ga0207650_10265663 | 3300025925 | Bacteria | 1393 |
| 419 | Ga0207659_10008424 | 3300025926 | Bacteria | 6399 |
| 420 | Ga0207659_10173163 | 3300025926 | Bacteria | 1704 |
| 421 | Ga0207659_10245756 | 3300025926 | Bacteria | 1450 |
| 422 | Ga0207687_10001492 | 3300025927 | Bacteria | 16025 |
| 423 | Ga0207687_10004767 | 3300025927 | Bacteria | 9019 |
| 424 | Ga0207687_10109109 | 3300025927 | Bacteria | 2050 |
| 425 | Ga0207687_10399636 | 3300025927 | Bacteria | 1130 |
| 426 | Ga0207700_10146696 | 3300025928 | Bacteria | 1945 |
| 427 | Ga0207664_10164862 | 3300025929 | Bacteria | 1892 |
| 428 | Ga0207664_10168031 | 3300025929 | Bacteria | 1875 |
| 429 | Ga0207644_10124042 | 3300025931 | Bacteria | 1969 |
| 430 | Ga0207644_10125641 | 3300025931 | Bacteria | 1958 |
| 431 | Ga0207690_10079256 | 3300025932 | Bacteria | 2288 |
| 432 | Ga0207690_10211940 | 3300025932 | Bacteria | 1477 |
| 433 | Ga0207706_10002261 | 3300025933 | Bacteria | 18804 |
| 434 | Ga0207706_10037037 | 3300025933 | Bacteria | 4332 |
| 435 | Ga0207706_10110449 | 3300025933 | Bacteria | 2419 |
| 436 | Ga0207686_10043990 | 3300025934 | Bacteria | 2739 |
| 437 | Ga0207686_10127351 | 3300025934 | Bacteria | 1742 |
| 438 | Ga0207686_10310368 | 3300025934 | Bacteria | 1175 |
| 439 | Ga0207709_10004733 | 3300025935 | Bacteria | 7813 |
| 440 | Ga0207670_10007748 | 3300025936 | Bacteria | 6023 |
| 441 | Ga0207670_10034893 | 3300025936 | Bacteria | 3257 |
| 442 | Ga0207669_10132289 | 3300025937 | Bacteria | 1716 |
| 443 | Ga0207669_10230427 | 3300025937 | Bacteria | 1366 |
| 444 | Ga0207669_10266642 | 3300025937 | Bacteria | 1284 |
| 445 | Ga0207665_10051482 | 3300025939 | Bacteria | 2772 |
| 446 | Ga0207665_10069347 | 3300025939 | Bacteria | 2404 |
| 447 | Ga0207691_10041637 | 3300025940 | Bacteria | 4239 |
| 448 | Ga0207691_10056674 | 3300025940 | Bacteria | 3569 |
| 449 | Ga0207691_10106643 | 3300025940 | Bacteria | 2495 |
| 450 | Ga0207691_10213830 | 3300025940 | Bacteria | 1674 |
| 451 | Ga0207711_10005965 | 3300025941 | Bacteria | 10298 |
| 452 | Ga0207711_10154119 | 3300025941 | Bacteria | 2075 |
| 453 | Ga0207689_10000451 | 3300025942 | Bacteria | 38688 |
| 454 | Ga0207689_10164184 | 3300025942 | Bacteria | 1830 |
| 455 | Ga0207661_10083982 | 3300025944 | Bacteria | 2636 |
| 456 | Ga0207679_10134627 | 3300025945 | Bacteria | 1988 |
| 457 | Ga0207667_10088505 | 3300025949 | Bacteria | 3202 |
| 458 | Ga0207667_10229732 | 3300025949 | Bacteria | 1900 |
| 459 | Ga0207667_10258639 | 3300025949 | Bacteria | 1780 |
| 460 | Ga0207667_10390455 | 3300025949 | Bacteria | 1417 |
| 461 | Ga0207667_10582082 | 3300025949 | Bacteria | 1130 |
| 462 | Ga0207651_10159515 | 3300025960 | Bacteria | 1766 |
| 463 | Ga0207651_10583334 | 3300025960 | Bacteria | 975 |
| 464 | Ga0207712_10022771 | 3300025961 | Bacteria | 4130 |
| 465 | Ga0207712_10150472 | 3300025961 | Bacteria | 1797 |
| 466 | Ga0207668_10410868 | 3300025972 | Bacteria | 1146 |
| 467 | Ga0207668_10436034 | 3300025972 | Bacteria | 1115 |
| 468 | Ga0207640_10171174 | 3300025981 | Bacteria | 1618 |
| 469 | Ga0207640_10222185 | 3300025981 | Bacteria | 1447 |
| 470 | Ga0207658_10418137 | 3300025986 | Bacteria | 1181 |
| 471 | Ga0207677_10065980 | 3300026023 | Bacteria | 2528 |
| 472 | Ga0207677_10174422 | 3300026023 | Bacteria | 1685 |
| 473 | Ga0207703_10023848 | 3300026035 | Bacteria | 4811 |
| 474 | Ga0207703_10070592 | 3300026035 | Bacteria | 2883 |
| 475 | Ga0207703_10134630 | 3300026035 | Bacteria | 2138 |
| 476 | Ga0207639_10178370 | 3300026041 | Bacteria | 1805 |
| 477 | Ga0207639_10196363 | 3300026041 | Bacteria | 1727 |
| 478 | Ga0207639_10203555 | 3300026041 | Bacteria | 1699 |
| 479 | Ga0207639_10534069 | 3300026041 | Bacteria | 1075 |
| 480 | Ga0207678_10058032 | 3300026067 | Bacteria | 3331 |
| 481 | Ga0207678_10539024 | 3300026067 | Bacteria | 1020 |
| 482 | Ga0207708_10001624 | 3300026075 | Bacteria | 16729 |
| 483 | Ga0207702_10507337 | 3300026078 | Bacteria | 1176 |
| 484 | Ga0207641_10080191 | 3300026088 | Bacteria | 2831 |
| 485 | Ga0207648_10000390 | 3300026089 | Bacteria | 48543 |
| 486 | Ga0207648_10047851 | 3300026089 | Bacteria | 3747 |
| 487 | Ga0207676_10009516 | 3300026095 | Bacteria | 6917 |
| 488 | Ga0207676_10016105 | 3300026095 | Bacteria | 5407 |
| 489 | Ga0207676_10016716 | 3300026095 | Bacteria | 5312 |
| 490 | Ga0207676_10567161 | 3300026095 | Bacteria | 1086 |
| 491 | Ga0207674_10094836 | 3300026116 | Bacteria | 2970 |
| 492 | Ga0207674_10211351 | 3300026116 | Bacteria | 1889 |
| 493 | Ga0207675_100001090 | 3300026118 | Bacteria | 26881 |
| 494 | Ga0207675_100015233 | 3300026118 | Bacteria | 7173 |
| 495 | Ga0207675_100206992 | 3300026118 | Bacteria | 1885 |
| 496 | Ga0207675_100219881 | 3300026118 | Bacteria | 1830 |
| 497 | Ga0207683_10002061 | 3300026121 | Bacteria | 17777 |
| 498 | Ga0207683_10003939 | 3300026121 | Bacteria | 12881 |
| 499 | Ga0207683_10024494 | 3300026121 | Bacteria | 5199 |
| 500 | Ga0207683_10041267 | 3300026121 | Bacteria | 4028 |
| 501 | Ga0207683_10264680 | 3300026121 | Bacteria | 1570 |
| 502 | Ga0207698_10042937 | 3300026142 | Bacteria | 3383 |
| 503 | Ga0207428_10000417 | 3300027907 | Bacteria | 52860 |
| 504 | Ga0207428_10000666 | 3300027907 | Bacteria | 40250 |
| 505 | Ga0207428_10001271 | 3300027907 | Bacteria | 26982 |
| 506 | Ga0207428_10003318 | 3300027907 | Bacteria | 15655 |
| 507 | Ga0207428_10066465 | 3300027907 | Bacteria | 2841 |
| 508 | Ga0268266_10001063 | 3300028379 | Bacteria | 34421 |
| 509 | Ga0268266_10038124 | 3300028379 | Bacteria | 4092 |
| 510 | Ga0268266_10258047 | 3300028379 | Bacteria | 1614 |
| 511 | Ga0268265_10030511 | 3300028380 | Bacteria | 3884 |
| 512 | Ga0268265_10594543 | 3300028380 | Bacteria | 1056 |
| 513 | Ga0268264_10005764 | 3300028381 | Bacteria | 10502 |
| 514 | Ga0268264_10031479 | 3300028381 | Bacteria | 4348 |
| 515 | Ga0268264_10501491 | 3300028381 | Bacteria | 1184 |
| 516 | Ga0265337_1003658 | 3300028556 | Bacteria | 6592 |
| 517 | Ga0307515_10000636 | 3300028794 | Bacteria | 81268 |
| 518 | Ga0307515_10050958 | 3300028794 | Bacteria | 6185 |
| 519 | Ga0307515_10258369 | 3300028794 | Bacteria | 1482 |
| 520 | Ga0265340_10033735 | 3300031247 | Bacteria | 2547 |
| 521 | Ga0265339_10050492 | 3300031249 | Bacteria | 2274 |
| 522 | Ga0265327_10007017 | 3300031251 | Bacteria | 8830 |
| 523 | Ga0265316_10104946 | 3300031344 | Bacteria | 2144 |
| 524 | Ga0265316_10127589 | 3300031344 | Bacteria | 1918 |
| 525 | Ga0307513_10002157 | 3300031456 | Bacteria | 27520 |
| 526 | Ga0307513_10049621 | 3300031456 | Bacteria | 4544 |
| 527 | Ga0307513_10182335 | 3300031456 | Bacteria | 1961 |
| 528 | Ga0265313_10012769 | 3300031595 | Bacteria | 5099 |
| 529 | Ga0307514_10002611 | 3300031649 | Bacteria | 18435 |
| 530 | Ga0316575_10029884 | 3300031665 | Bacteria | 2129 |
| 531 | Ga0316575_10084681 | 3300031665 | Bacteria | 1280 |
| 532 | Ga0265314_10003227 | 3300031711 | Bacteria | 15941 |
| 533 | Ga0265342_10000319 | 3300031712 | Bacteria | 54575 |
| 534 | Ga0316576_10143503 | 3300031727 | Bacteria | 1798 |
| 535 | Ga0307405_10015237 | 3300031731 | Bacteria | 4158 |
| 536 | Ga0307413_10003248 | 3300031824 | Bacteria | 6808 |
| 537 | Ga0307413_10041893 | 3300031824 | Bacteria | 2686 |
| 538 | Ga0307412_10191080 | 3300031911 | Bacteria | 1548 |
| 539 | Ga0307409_100021337 | 3300031995 | Bacteria | 4438 |
| 540 | Ga0307416_100026408 | 3300032002 | Bacteria | 4278 |
| 541 | Ga0307414_10016739 | 3300032004 | Bacteria | 4467 |
| 542 | Ga0307414_10083086 | 3300032004 | Bacteria | 2351 |
| 543 | Ga0316583_10002868 | 3300032133 | Bacteria | 6050 |
| 544 | Ga0373930_0002705 | 3300034816 | Bacteria | 2763 |
| 545 | Ga0373948_0006564 | 3300034817 | Bacteria | 1928 |
| 546 | Ga0373950_0005593 | 3300034818 | Bacteria | 1883 |
| 547 | Ga0373938_0000049 | 3300034957 | Bacteria | 15338 |
| 548 | Ga0373926_0059501 | 3300035083 | Bacteria | 1391 |
| 549 | Ga0373928_0000021 | 3300035084 | Bacteria | 27737 |
| 550 | Ga0373928_0033520 | 3300035084 | Bacteria | 1149 |
| 551 | Ga0373929_0000048 | 3300035085 | Bacteria | 25670 |
| 552 | Ga0373940_0000013 | 3300035088 | Bacteria | 23710 |
| 553 | Ga0373944_0003921 | 3300035089 | Bacteria | 3853 |
| 554 | Ga0373944_0006052 | 3300035089 | Bacteria | 3205 |
| 555 | Ga0373949_0000214 | 3300035090 | Bacteria | 21912 |
| 556 | Ga0373951_0000646 | 3300035091 | Bacteria | 9590 |
| 557 | Ga0373952_0000011 | 3300035092 | Bacteria | 25689 |
| 558 | Ga0373932_0000018 | 3300035112 | Bacteria | 53356 |
| 559 | Ga0373939_0000116 | 3300035114 | Bacteria | 23908 |
| 560 | Ga0373939_0005135 | 3300035114 | Bacteria | 3111 |
| 561 | Ga0373941_0001307 | 3300035115 | Bacteria | 5241 |
| 562 | Ga0373945_0008345 | 3300035116 | Bacteria | 3371 |
| 563 | Ga0373953_0053110 | 3300035117 | Bacteria | 1642 |
| 564 | Ga0373954_0016716 | 3300035118 | Bacteria | 3288 |
| 565 | Ga0373956_0020258 | 3300035119 | Bacteria | 2828 |
| 566 | Ga0373960_0002914 | 3300035121 | Bacteria | 3869 |
| 567 | Ga0373943_0003784 | 3300035170 | Bacteria | 6873 |
| 568 | Ga0373943_0238225 | 3300035170 | Bacteria | 1019 |
| 569 | Ga0373946_0006096 | 3300035171 | Bacteria | 4365 |
| 570 | Ga0373946_0064684 | 3300035171 | Bacteria | 1565 |
| 571 | Ga0373955_0001168 | 3300035172 | Bacteria | 11151 |
| 572 | Ga0373942_0000606 | 3300035207 | Bacteria | 10070 |
| 573 | Ga0373961_0001104 | 3300035241 | Bacteria | 8550 |
| 574 | Ga0316574_0024694 | 3300035398 | Bacteria | 3600 |
| 575 | Ga0373931_0007116 | 3300035691 | Bacteria | 5260 |
| 576 | Ga0373931_0199774 | 3300035691 | Bacteria | 1194 |
| 577 | Ga0373935_0000678 | 3300035692 | Bacteria | 17989 |
| 578 | Ga0373935_0393421 | 3300035692 | Bacteria | 994 |
| 579 | Ga0373927_0001937 | 3300035695 | Bacteria | 15284 |
| 580 | Ga0373927_0013273 | 3300035695 | Bacteria | 5476 |
| 581 | Ga0373927_0022549 | 3300035695 | Bacteria | 4124 |
| 582 | Ga0373927_0026546 | 3300035695 | Bacteria | 3785 |
| 583 | Ga0373933_0009768 | 3300035724 | Bacteria | 5251 |
| 584 | Ga0373947_0000512 | 3300035725 | Bacteria | 22553 |
| 585 | Ga0373947_0019543 | 3300035725 | Bacteria | 3907 |
| 586 | Ga0373947_0030272 | 3300035725 | Bacteria | 3180 |
| 587 | Ga0373947_0053289 | 3300035725 | Bacteria | 2439 |
| 588 | Ga0373937_0015895 | 3300036401 | Bacteria | 6674 |
| 589 | Ga0373937_0034948 | 3300036401 | Bacteria | 4572 |
| 590 | Ga0373937_0247000 | 3300036401 | Bacteria | 1682 |
| 591 | Ga0373937_0734664 | 3300036401 | Bacteria | 934 |
| 592 | Ga0316582_0107213 | 3300036647 | Bacteria | 1856 |
| 593 | Ga0316584_0042274 | 3300036712 | Bacteria | 3399 |
| 594 | Ga0373925_0009707 | 3300037068 | Bacteria | 7000 |
| 595 | Ga0373925_0158233 | 3300037068 | Bacteria | 1783 |
| 596 | Ga0373925_0159201 | 3300037068 | Bacteria | 1777 |
| 597 | Ga0373925_0183545 | 3300037068 | Bacteria | 1657 |
| 598 | Ga0395900_0102690 | 3300037418 | Bacteria | 2937 |
| 599 | Ga0395898_0114153 | 3300037466 | Bacteria | 2588 |
| 600 | Ga0395905_0004682 | 3300037471 | Bacteria | 14144 |
| 601 | Ga0395905_0069654 | 3300037471 | Bacteria | 3295 |
| 602 | Ga0395905_0208565 | 3300037471 | Bacteria | 1831 |
| 603 | Ga0436365_1865970 | 3300039437 | Bacteria | 1261 |
| 604 | Ga0436362_1291563 | 3300039453 | Bacteria | 1084 |
| 605 | Ga0451577_0127016 | 3300042876 | Bacteria | 2285 |
| 606 | Ga0466966_0038191 | 3300044684 | Bacteria | 3094 |
| 607 | Ga0466961_0030412 | 3300044693 | Bacteria | 3470 |
| 608 | Ga0466963_0000333 | 3300044694 | Bacteria | 21482 |
| 609 | Ga0466963_0011090 | 3300044694 | Bacteria | 5480 |
| 610 | Ga0466963_0032397 | 3300044694 | Bacteria | 3384 |
| 611 | Ga0466963_0039521 | 3300044694 | Bacteria | 3089 |
| 612 | Ga0466963_0039590 | 3300044694 | Bacteria | 3087 |
| 613 | Ga0466963_0065666 | 3300044694 | Bacteria | 2433 |
| 614 | Ga0453684_0042476 | 3300044712 | Bacteria | 6128 |
| 615 | Ga0453684_0044084 | 3300044712 | Bacteria | 5979 |
| 616 | Ga0466971_0010404 | 3300044719 | Bacteria | 4065 |
| 617 | Ga0466971_0011623 | 3300044719 | Bacteria | 3854 |
| 618 | Ga0466968_0006794 | 3300044735 | Bacteria | 4327 |
| 619 | Ga0466968_0026467 | 3300044735 | Bacteria | 2381 |
| 620 | Ga0466968_0110608 | 3300044735 | Bacteria | 1235 |
| 621 | Ga0466968_0120622 | 3300044735 | Bacteria | 1186 |
| 622 | Ga0466957_0002407 | 3300044842 | Bacteria | 10043 |
| 623 | Ga0466957_0005553 | 3300044842 | Bacteria | 7085 |
| 624 | Ga0466957_0011232 | 3300044842 | Bacteria | 5158 |
| 625 | Ga0466957_0051591 | 3300044842 | Bacteria | 2504 |
| 626 | Ga0466960_0075909 | 3300044901 | Bacteria | 1682 |
| 627 | Ga0466959_0019196 | 3300045049 | Bacteria | 5026 |
| 628 | Ga0451576_0000057 | 3300045051 | Bacteria | 300798 |
| 629 | Ga0451576_0011125 | 3300045051 | Bacteria | 10266 |
| 630 | Ga0451576_0034096 | 3300045051 | Bacteria | 5408 |
| 631 | Ga0466958_0001168 | 3300045836 | Bacteria | 12216 |
| 632 | Ga0466958_0004245 | 3300045836 | Bacteria | 7538 |
| 633 | Ga0466958_0004419 | 3300045836 | Bacteria | 7423 |
| 634 | Ga0466958_0013380 | 3300045836 | Bacteria | 4670 |
| 635 | Ga0466958_0013508 | 3300045836 | Bacteria | 4650 |
| 636 | Ga0466958_0091685 | 3300045836 | Bacteria | 1881 |
| 637 | Ga0466967_0000297 | 3300045976 | Bacteria | 22234 |
| 638 | Ga0466967_0020232 | 3300045976 | Bacteria | 5373 |
| 639 | Ga0466967_0026963 | 3300045976 | Bacteria | 4770 |
| 640 | Ga0466967_0058365 | 3300045976 | Bacteria | 3411 |
| 641 | Ga0466967_0109721 | 3300045976 | Bacteria | 2533 |
| 642 | Ga0466967_0234549 | 3300045976 | Bacteria | 1748 |
| 643 | Ga0466967_0312618 | 3300045976 | Bacteria | 1514 |
| 644 | Ga0466967_0379427 | 3300045976 | Bacteria | 1372 |
| 645 | Ga0495592_0057799 | 3300046454 | Bacteria | 2863 |
| 646 | Ga0495603_0000910 | 3300046455 | Bacteria | 16994 |
| 647 | Ga0495603_0051213 | 3300046455 | Bacteria | 2454 |
| 648 | Ga0495603_0282256 | 3300046455 | Bacteria | 954 |
| 649 | Ga0495590_0017090 | 3300046457 | Bacteria | 2616 |
| 650 | Ga0495629_0002174 | 3300046459 | Bacteria | 15143 |
| 651 | Ga0495629_0095721 | 3300046459 | Bacteria | 2071 |
| 652 | Ga0495638_0001151 | 3300046460 | Bacteria | 25469 |
| 653 | Ga0495638_0019991 | 3300046460 | Bacteria | 4426 |
| 654 | Ga0495641_0035838 | 3300046461 | Bacteria | 2335 |
| 655 | Ga0495641_0189111 | 3300046461 | Bacteria | 922 |
| 656 | Ga0495580_0038182 | 3300046472 | Bacteria | 3441 |
| 657 | Ga0495582_0019547 | 3300046473 | Bacteria | 3704 |
| 658 | Ga0495605_0027074 | 3300046474 | Bacteria | 2974 |
| 659 | Ga0495605_0058646 | 3300046474 | Bacteria | 1850 |
| 660 | Ga0495639_0003104 | 3300046475 | Bacteria | 7224 |
| 661 | Ga0495662_0031267 | 3300046476 | Bacteria | 2571 |
| 662 | Ga0495664_0114080 | 3300046477 | Bacteria | 1632 |
| 663 | Ga0495594_0068750 | 3300046499 | Bacteria | 1967 |
| 664 | Ga0495607_0098141 | 3300046501 | Bacteria | 1574 |
| 665 | Ga0495583_0011669 | 3300046506 | Bacteria | 5033 |
| 666 | Ga0495616_0060673 | 3300046513 | Bacteria | 1857 |
| 667 | Ga0495618_0003910 | 3300046514 | Bacteria | 9205 |
| 668 | Ga0495618_0017334 | 3300046514 | Bacteria | 4414 |
| 669 | Ga0495620_0029039 | 3300046515 | Bacteria | 2564 |
| 670 | Ga0495620_0072615 | 3300046515 | Bacteria | 1405 |
| 671 | Ga0495630_0226645 | 3300046517 | Bacteria | 1427 |
| 672 | Ga0495643_0012275 | 3300046522 | Bacteria | 5174 |
| 673 | Ga0495643_0014725 | 3300046522 | Bacteria | 4646 |
| 674 | Ga0495644_0046658 | 3300046523 | Bacteria | 1628 |
| 675 | Ga0495644_0130921 | 3300046523 | Bacteria | 956 |
| 676 | Ga0495648_0160294 | 3300046524 | Bacteria | 1164 |
| 677 | Ga0495663_0106013 | 3300046525 | Bacteria | 930 |
| 678 | Ga0495666_0030560 | 3300046526 | Bacteria | 2643 |
| 679 | Ga0495642_0008919 | 3300046528 | Bacteria | 3838 |
| 680 | Ga0495652_0018938 | 3300046529 | Bacteria | 6135 |
| 681 | Ga0495665_0003399 | 3300046531 | Bacteria | 8641 |
| 682 | Ga0495665_0147992 | 3300046531 | Bacteria | 1226 |
| 683 | Ga0495640_0001822 | 3300046533 | Bacteria | 16907 |
| 684 | Ga0495640_0039926 | 3300046533 | Bacteria | 3290 |
| 685 | Ga0495586_0231095 | 3300046535 | Bacteria | 1052 |
| 686 | Ga0495597_0056755 | 3300046542 | Bacteria | 1714 |
| 687 | Ga0495633_0000063 | 3300046558 | Bacteria | 141657 |
| 688 | Ga0495667_0072958 | 3300046559 | Bacteria | 2236 |
| 689 | Ga0495656_0070161 | 3300046615 | Bacteria | 1554 |
| 690 | Ga0495634_0000688 | 3300046642 | Bacteria | 32901 |
| 691 | Ga0495634_0017644 | 3300046642 | Bacteria | 5091 |
| 692 | Ga0495611_0138792 | 3300046648 | Bacteria | 1135 |
| 693 | Ga0495625_0011610 | 3300046660 | Bacteria | 7166 |
| 694 | Ga0495625_0061370 | 3300046660 | Bacteria | 2660 |
| 695 | Ga0495635_0105941 | 3300046663 | Bacteria | 1921 |
| 696 | Ga0495635_0245286 | 3300046663 | Bacteria | 1208 |
| 697 | Ga0495661_0038474 | 3300046665 | Bacteria | 2979 |
| 698 | Ga0495661_0105433 | 3300046665 | Bacteria | 1579 |
| 699 | Ga0495657_0110364 | 3300046675 | Bacteria | 1743 |
| 700 | Ga0495646_0048055 | 3300046680 | Bacteria | 2595 |
| 701 | Ga0495647_0000251 | 3300046681 | Bacteria | 14648 |
| 702 | Ga0495658_0009547 | 3300046683 | Bacteria | 4838 |
| 703 | Ga0495658_0038260 | 3300046683 | Bacteria | 2656 |
| 704 | Ga0495658_0038764 | 3300046683 | Bacteria | 2640 |
| 705 | Ga0495658_0114976 | 3300046683 | Bacteria | 1622 |
| 706 | Ga0495669_0184129 | 3300046684 | Bacteria | 996 |
| 707 | Ga0495613_0053053 | 3300046689 | Bacteria | 2985 |
| 708 | Ga0495613_0071912 | 3300046689 | Bacteria | 2521 |
| 709 | Ga0495613_0153073 | 3300046689 | Bacteria | 1644 |
| 710 | Ga0495624_0019040 | 3300046690 | Bacteria | 4586 |
| 711 | Ga0495670_0184558 | 3300046691 | Bacteria | 1102 |
| 712 | Ga0495671_0086299 | 3300046692 | Bacteria | 1538 |
| 713 | Ga0495649_0014372 | 3300046694 | Bacteria | 4540 |
| 714 | Ga0495660_0015386 | 3300046810 | Bacteria | 4421 |
| 715 | Ga0495581_0005554 | 3300047315 | Bacteria | 7306 |
| 716 | Ga0495581_0042923 | 3300047315 | Bacteria | 2616 |
| 717 | Ga0495604_0037852 | 3300047317 | Bacteria | 3797 |
| 718 | Ga0495604_0063525 | 3300047317 | Bacteria | 2816 |
| 719 | Ga0495674_0001606 | 3300047319 | Bacteria | 22176 |
| 720 | Ga0495674_0205282 | 3300047319 | Bacteria | 1634 |
| 721 | Ga0495674_0361115 | 3300047319 | Bacteria | 1178 |
| 722 | Ga0495674_0446745 | 3300047319 | Bacteria | 1039 |
| 723 | Ga0495676_0001862 | 3300047321 | Bacteria | 18513 |
| 724 | Ga0495676_0010663 | 3300047321 | Bacteria | 8324 |
| 725 | Ga0495680_0004830 | 3300047322 | Bacteria | 12791 |
| 726 | Ga0495683_0037293 | 3300047323 | Bacteria | 2465 |
| 727 | Ga0495687_031905 | 3300047443 | Bacteria | 2410 |
| 728 | Ga0495684_0001239 | 3300047471 | Bacteria | 20563 |
| 729 | Ga0495686_0143651 | 3300047472 | Bacteria | 1406 |
| 730 | Ga0495593_0012124 | 3300047673 | Bacteria | 4932 |
| 731 | Ga0495602_0077707 | 3300048088 | Bacteria | 2807 |
| 732 | Ga0495614_0002092 | 3300048089 | Bacteria | 8813 |
| 733 | Ga0495615_0013716 | 3300048090 | Bacteria | 1698 |
| 734 | Ga0496100_0000310 | 3300048903 | Bacteria | 24113 |
| 735 | Ga0496100_0019395 | 3300048903 | Bacteria | 4056 |
| 736 | Ga0496100_0026719 | 3300048903 | Bacteria | 3542 |
| 737 | Ga0496100_0256854 | 3300048903 | Bacteria | 1294 |
| 738 | Ga0496100_0280340 | 3300048903 | Bacteria | 1242 |
| 739 | Ga0496101_0000500 | 3300048904 | Bacteria | 24613 |
| 740 | Ga0496101_0006351 | 3300048904 | Bacteria | 7608 |
| 741 | Ga0496101_0011376 | 3300048904 | Bacteria | 5903 |
| 742 | Ga0496101_0011880 | 3300048904 | Bacteria | 5797 |
| 743 | Ga0496101_0482904 | 3300048904 | Bacteria | 978 |
| 744 | Ga0496102_0000679 | 3300048905 | Bacteria | 34025 |
| 745 | Ga0496102_0016989 | 3300048905 | Bacteria | 6367 |
| 746 | Ga0496102_0036207 | 3300048905 | Bacteria | 4445 |
| 747 | Ga0496102_0050469 | 3300048905 | Bacteria | 3788 |
| 748 | Ga0496102_0088989 | 3300048905 | Bacteria | 2855 |
| 749 | Ga0496102_0130122 | 3300048905 | Bacteria | 2355 |
| 750 | Ga0496102_0278265 | 3300048905 | Bacteria | 1577 |
| 751 | Ga0496102_0304938 | 3300048905 | Bacteria | 1501 |
| 752 | Ga0496102_0445213 | 3300048905 | Bacteria | 1215 |
| 753 | Ga0496103_0000777 | 3300048906 | Bacteria | 23523 |
| 754 | Ga0496103_0012623 | 3300048906 | Bacteria | 5011 |
| 755 | Ga0496103_0026169 | 3300048906 | Bacteria | 3531 |
| 756 | Ga0496103_0052199 | 3300048906 | Bacteria | 2532 |
| 757 | Ga0496104_0000500 | 3300048907 | Bacteria | 33808 |
| 758 | Ga0496104_0003660 | 3300048907 | Bacteria | 13270 |
| 759 | Ga0496104_0007218 | 3300048907 | Bacteria | 9800 |
| 760 | Ga0496104_0008355 | 3300048907 | Bacteria | 9200 |
| 761 | Ga0496104_0043116 | 3300048907 | Bacteria | 4237 |
| 762 | Ga0496104_0046659 | 3300048907 | Bacteria | 4080 |
| 763 | Ga0496104_0083212 | 3300048907 | Bacteria | 3052 |
| 764 | Ga0496104_0086082 | 3300048907 | Bacteria | 3000 |
| 765 | Ga0496104_0616958 | 3300048907 | Bacteria | 994 |
| 766 | Ga0496104_0715172 | 3300048907 | Bacteria | 909 |
| 767 | Ga0496105_0000525 | 3300048908 | Bacteria | 25344 |
| 768 | Ga0496105_0009717 | 3300048908 | Bacteria | 7535 |
| 769 | Ga0496105_0027920 | 3300048908 | Bacteria | 4615 |
| 770 | Ga0496105_0028263 | 3300048908 | Bacteria | 4587 |
| 771 | Ga0496105_0140192 | 3300048908 | Bacteria | 1990 |
| 772 | Ga0496106_0000323 | 3300048909 | Bacteria | 33743 |
| 773 | Ga0496106_0023005 | 3300048909 | Bacteria | 4629 |
| 774 | Ga0496106_0058250 | 3300048909 | Bacteria | 2924 |
| 775 | Ga0496106_0080140 | 3300048909 | Bacteria | 2507 |
| 776 | Ga0496106_0160185 | 3300048909 | Bacteria | 1779 |
| 777 | Ga0496106_0203361 | 3300048909 | Bacteria | 1576 |
| 778 | Ga0496106_0576156 | 3300048909 | Bacteria | 902 |
| 779 | Ga0496107_0003179 | 3300048910 | Bacteria | 10921 |
| 780 | Ga0496107_0020418 | 3300048910 | Bacteria | 4679 |
| 781 | Ga0496107_0088609 | 3300048910 | Bacteria | 2259 |
| 782 | Ga0496107_0113779 | 3300048910 | Bacteria | 1990 |
| 783 | Ga0496107_0165338 | 3300048910 | Bacteria | 1640 |
| 784 | Ga0496107_0388727 | 3300048910 | Bacteria | 1038 |
| 785 | Ga0496108_0001888 | 3300048911 | Bacteria | 16784 |
| 786 | Ga0496108_0003718 | 3300048911 | Bacteria | 12234 |
| 787 | Ga0496108_0032005 | 3300048911 | Bacteria | 4365 |
| 788 | Ga0496108_0056998 | 3300048911 | Bacteria | 3283 |
| 789 | Ga0496108_0107602 | 3300048911 | Bacteria | 2381 |
| 790 | Ga0496108_0162035 | 3300048911 | Bacteria | 1933 |
| 791 | Ga0496108_0182308 | 3300048911 | Bacteria | 1818 |
| 792 | Ga0496109_0000493 | 3300048912 | Bacteria | 33784 |
| 793 | Ga0496109_0010883 | 3300048912 | Bacteria | 7789 |
| 794 | Ga0496109_0020842 | 3300048912 | Bacteria | 5792 |
| 795 | Ga0496109_0026456 | 3300048912 | Bacteria | 5174 |
| 796 | Ga0496109_0032798 | 3300048912 | Bacteria | 4671 |
| 797 | Ga0496109_0073582 | 3300048912 | Bacteria | 3140 |
| 798 | Ga0496109_0098334 | 3300048912 | Bacteria | 2713 |
| 799 | Ga0496109_0213456 | 3300048912 | Bacteria | 1815 |
| 800 | Ga0496109_0351492 | 3300048912 | Bacteria | 1392 |
| 801 | Ga0496110_0003830 | 3300048913 | Bacteria | 11584 |
| 802 | Ga0496110_0011097 | 3300048913 | Bacteria | 7360 |
| 803 | Ga0496110_0011459 | 3300048913 | Bacteria | 7257 |
| 804 | Ga0496110_0013354 | 3300048913 | Bacteria | 6786 |
| 805 | Ga0496110_0042347 | 3300048913 | Bacteria | 3974 |
| 806 | Ga0496110_0112651 | 3300048913 | Bacteria | 2446 |
| 807 | Ga0496111_0001343 | 3300048914 | Bacteria | 13890 |
| 808 | Ga0496111_0005703 | 3300048914 | Bacteria | 8023 |
| 809 | Ga0496111_0016571 | 3300048914 | Bacteria | 5080 |
| 810 | Ga0496111_0041058 | 3300048914 | Bacteria | 3319 |
| 811 | Ga0496111_0148208 | 3300048914 | Bacteria | 1740 |
| 812 | Ga0496111_0156803 | 3300048914 | Bacteria | 1689 |
| 813 | Ga0496111_0319292 | 3300048914 | Bacteria | 1150 |
| 814 | Ga0496112_0001321 | 3300048915 | Bacteria | 18847 |
| 815 | Ga0496112_0011501 | 3300048915 | Bacteria | 8084 |
| 816 | Ga0496112_0018168 | 3300048915 | Bacteria | 6617 |
| 817 | Ga0496112_0053484 | 3300048915 | Bacteria | 3966 |
| 818 | Ga0496112_0075196 | 3300048915 | Bacteria | 3341 |
| 819 | Ga0496113_0000869 | 3300048916 | Bacteria | 15820 |
| 820 | Ga0496113_0001628 | 3300048916 | Bacteria | 12652 |
| 821 | Ga0496113_0009474 | 3300048916 | Bacteria | 6388 |
| 822 | Ga0496113_0036308 | 3300048916 | Bacteria | 3610 |
| 823 | Ga0496113_0037654 | 3300048916 | Bacteria | 3552 |
| 824 | Ga0496113_0153801 | 3300048916 | Bacteria | 1816 |
| 825 | Ga0496113_0219364 | 3300048916 | Bacteria | 1515 |
| 826 | Ga0496113_0354671 | 3300048916 | Bacteria | 1177 |
| 827 | Ga0496113_0580105 | 3300048916 | Bacteria | 898 |
| 828 | Ga0496114_0005594 | 3300048917 | Bacteria | 9851 |
| 829 | Ga0496114_0073191 | 3300048917 | Bacteria | 2883 |
| 830 | Ga0496114_0147392 | 3300048917 | Bacteria | 2041 |
| 831 | Ga0496114_0157425 | 3300048917 | Bacteria | 1973 |
| 832 | Ga0496114_0181580 | 3300048917 | Bacteria | 1838 |
| 833 | Ga0496114_0184021 | 3300048917 | Bacteria | 1825 |
| 834 | Ga0496114_0189620 | 3300048917 | Bacteria | 1798 |
| 835 | Ga0496115_0001322 | 3300048918 | Bacteria | 17672 |
| 836 | Ga0496115_0044026 | 3300048918 | Bacteria | 3559 |
| 837 | Ga0496115_0065754 | 3300048918 | Bacteria | 2929 |
| 838 | Ga0496115_0172643 | 3300048918 | Bacteria | 1788 |
| 839 | Ga0496115_0477898 | 3300048918 | Bacteria | 1004 |
| 840 | Ga0496115_0523387 | 3300048918 | Bacteria | 951 |
| 841 | Ga0496116_0041215 | 3300048919 | Bacteria | 3170 |
| 842 | Ga0496117_0008368 | 3300048920 | Bacteria | 9837 |
| 843 | Ga0496117_0176720 | 3300048920 | Bacteria | 1232 |
| 844 | Ga0496118_0008003 | 3300048921 | Bacteria | 11047 |
| 845 | Ga0496121_0000643 | 3300048924 | Bacteria | 65217 |
| 846 | Ga0496121_0059299 | 3300048924 | Bacteria | 3157 |
| 847 | Ga0496121_0064933 | 3300048924 | Bacteria | 2973 |
| 848 | Ga0496122_0119563 | 3300048925 | Bacteria | 1703 |
| 849 | Ga0496122_0170271 | 3300048925 | Bacteria | 1314 |
| 850 | Ga0496123_0029826 | 3300048926 | Bacteria | 4005 |
| 851 | Ga0496124_0118073 | 3300048927 | Bacteria | 2124 |
| 852 | Ga0496124_0498302 | 3300048927 | Bacteria | 817 |
| 853 | Ga0496125_0047289 | 3300048928 | Bacteria | 3600 |
| 854 | Ga0496125_0112820 | 3300048928 | Bacteria | 1963 |
| 855 | Ga0496126_0365379 | 3300048929 | Bacteria | 1178 |
| 856 | Ga0495678_041849 | 3300049459 | Bacteria | 1830 |
| 857 | Ga0501031_0005436 | 3300049568 | Bacteria | 8293 |
| 858 | Ga0501031_0190025 | 3300049568 | Bacteria | 1341 |
| 859 | Ga0501032_0017369 | 3300049569 | Bacteria | 5052 |
| 860 | Ga0501033_0003024 | 3300049570 | Bacteria | 14013 |
| 861 | Ga0501033_0086874 | 3300049570 | Bacteria | 2289 |
| 862 | Ga0501034_0004465 | 3300049571 | Bacteria | 15554 |
| 863 | Ga0501034_0005912 | 3300049571 | Bacteria | 13279 |
| 864 | Ga0501034_0008051 | 3300049571 | Bacteria | 11187 |
| 865 | Ga0501034_0363252 | 3300049571 | Bacteria | 1375 |
| 866 | Ga0501036_0073195 | 3300049572 | Bacteria | 2897 |
| 867 | Ga0501037_0010019 | 3300049573 | Bacteria | 6951 |
| 868 | Ga0501038_0003860 | 3300049574 | Bacteria | 13931 |
| 869 | Ga0501039_0006970 | 3300049575 | Bacteria | 8606 |
| 870 | Ga0501039_0015604 | 3300049575 | Bacteria | 5813 |
| 871 | Ga0501039_0648091 | 3300049575 | Bacteria | 827 |
| 872 | Ga0501040_0335103 | 3300049576 | Bacteria | 1083 |
| 873 | Ga0501041_0002801 | 3300049577 | Bacteria | 9960 |
| 874 | Ga0501041_0422764 | 3300049577 | Bacteria | 845 |
| 875 | Ga0501042_0004936 | 3300049578 | Bacteria | 8541 |
| 876 | Ga0501042_0066842 | 3300049578 | Bacteria | 2570 |
| 877 | Ga0501043_0008009 | 3300049579 | Bacteria | 8341 |
| 878 | Ga0501046_0061889 | 3300049580 | Bacteria | 2925 |
| 879 | Ga0501047_0005106 | 3300049581 | Bacteria | 12316 |
| 880 | Ga0501047_0119207 | 3300049581 | Bacteria | 2521 |
| 881 | Ga0501047_0195397 | 3300049581 | Bacteria | 1885 |
| 882 | Ga0501048_0006714 | 3300049582 | Bacteria | 8742 |
| 883 | Ga0501048_0426245 | 3300049582 | Bacteria | 949 |
| 884 | Ga0501067_0051323 | 3300049583 | Bacteria | 2286 |
| 885 | Ga0501068_0001358 | 3300049584 | Bacteria | 12976 |
| 886 | Ga0501068_0017296 | 3300049584 | Bacteria | 4169 |
| 887 | Ga0501069_0002413 | 3300049585 | Bacteria | 9501 |
| 888 | Ga0501069_0109390 | 3300049585 | Bacteria | 1573 |
| 889 | Ga0501070_0023475 | 3300049586 | Bacteria | 5166 |
| 890 | Ga0501070_0023781 | 3300049586 | Bacteria | 5135 |
| 891 | Ga0501071_0006163 | 3300049587 | Bacteria | 7774 |
| 892 | Ga0501071_0195123 | 3300049587 | Bacteria | 1519 |
| 893 | Ga0501072_0004774 | 3300049588 | Bacteria | 10318 |
| 894 | Ga0501072_0015146 | 3300049588 | Bacteria | 5913 |
| 895 | Ga0501073_0004766 | 3300049589 | Bacteria | 10179 |
| 896 | Ga0501074_0020411 | 3300049590 | Bacteria | 4815 |
| 897 | Ga0501075_0015205 | 3300049591 | Bacteria | 5520 |
| 898 | Ga0501075_0028467 | 3300049591 | Bacteria | 4124 |
| 899 | Ga0501075_0040374 | 3300049591 | Bacteria | 3494 |
| 900 | Ga0501075_0364602 | 3300049591 | Bacteria | 1101 |
| 901 | Ga0501076_0004393 | 3300049592 | Bacteria | 10022 |
| 902 | Ga0501076_0015056 | 3300049592 | Bacteria | 5840 |
| 903 | Ga0501076_0022336 | 3300049592 | Bacteria | 4863 |
| 904 | Ga0501077_0005390 | 3300049593 | Bacteria | 7774 |
| 905 | Ga0501077_0049664 | 3300049593 | Bacteria | 2665 |
| 906 | Ga0501079_0003856 | 3300049741 | Bacteria | 11063 |
| 907 | Ga0501079_0070516 | 3300049741 | Bacteria | 2699 |
| 908 | Ga0501079_0088355 | 3300049741 | Bacteria | 2400 |
| 909 | Ga0501080_0003042 | 3300049742 | Bacteria | 14800 |
| 910 | Ga0501080_0556852 | 3300049742 | Bacteria | 1021 |
| 911 | Ga0501080_0984115 | 3300049742 | Bacteria | 732 |
| 912 | Ga0501081_0085219 | 3300049743 | Bacteria | 2217 |
| 913 | Ga0501083_0002239 | 3300049744 | Bacteria | 13224 |
| 914 | Ga0501083_0053884 | 3300049744 | Bacteria | 2700 |
| 915 | Ga0501035_0004259 | 3300049822 | Bacteria | 13581 |
| 916 | Ga0501044_0023054 | 3300049823 | Bacteria | 6626 |
| 917 | Ga0501044_0034557 | 3300049823 | Bacteria | 5300 |
| 918 | Ga0501044_0079274 | 3300049823 | Bacteria | 3328 |
| 919 | Ga0501045_0005270 | 3300049824 | Bacteria | 8950 |
| 920 | Ga0501045_0005895 | 3300049824 | Bacteria | 8477 |
| 921 | Ga0501045_0156553 | 3300049824 | Bacteria | 1695 |
| 922 | nmdc:mga03683_28853_c1 | 3300050489 | Bacteria | 2209 |
| 923 | nmdc:mga03683_72291_c1 | 3300050489 | Bacteria | 1477 |
| 924 | nmdc:mga00v17_130434_c1 | 3300050491 | Bacteria | 1606 |
| 925 | nmdc:mga00v17_178915_c1 | 3300050491 | Bacteria | 1368 |
| 926 | nmdc:mga00v17_31_c1 | 3300050491 | Bacteria | 87312 |
| 927 | nmdc:mga0yw44_104652_c1 | 3300050492 | Bacteria | 1807 |
| 928 | nmdc:mga0yw44_18397_c1 | 3300050492 | Bacteria | 3826 |
| 929 | nmdc:mga0yw44_186330_c1 | 3300050492 | Bacteria | 1367 |
| 930 | nmdc:mga0yw44_2715_c1 | 3300050492 | Bacteria | 7645 |
| 931 | nmdc:mga0yw44_58881_c1 | 3300050492 | Bacteria | 2348 |
| 932 | nmdc:mga0k408_3653_c1 | 3300050493 | Bacteria | 8142 |
| 933 | nmdc:mga06z11_159847_c1 | 3300050494 | Bacteria | 1287 |
| 934 | nmdc:mga07m45_279627_c1 | 3300050496 | Bacteria | 971 |
| 935 | nmdc:mga07m45_39299_c1 | 3300050496 | Bacteria | 2643 |
| 936 | nmdc:mga05p37_120842_c1 | 3300050507 | Bacteria | 3218 |
| 937 | nmdc:mga05p37_24147_c1 | 3300050507 | Bacteria | 7385 |
| 938 | nmdc:mga05p37_276593_c1 | 3300050507 | Bacteria | 2004 |
| 939 | nmdc:mga05p37_383_c1 | 3300050507 | Bacteria | 47792 |
| 940 | nmdc:mga05p37_44079_c1 | 3300050507 | Bacteria | 5489 |
| 941 | nmdc:mga05p37_531_c1 | 3300050507 | Bacteria | 42040 |
| 942 | nmdc:mga09592_247433_c1 | 3300050508 | Bacteria | 1545 |
| 943 | nmdc:mga09592_274481_c1 | 3300050508 | Bacteria | 1462 |
| 944 | nmdc:mga09592_4666_c1 | 3300050508 | Bacteria | 11094 |
| 945 | nmdc:mga09592_78098_c1 | 3300050508 | Bacteria | 2817 |
| 946 | nmdc:mga09592_8311_c1 | 3300050508 | Bacteria | 8442 |
| 947 | nmdc:mga09592_84470_c1 | 3300050508 | Bacteria | 2707 |
| 948 | nmdc:mga0qj67_14148_c1 | 3300050509 | Bacteria | 6027 |
| 949 | nmdc:mga0qj67_413_c1 | 3300050509 | Bacteria | 29228 |
| 950 | nmdc:mga0qj67_61543_c1 | 3300050509 | Bacteria | 2981 |
| 951 | nmdc:mga0qj67_72216_c1 | 3300050509 | Bacteria | 2755 |
| 952 | nmdc:mga0qj67_92854_c1 | 3300050509 | Bacteria | 2426 |
| 953 | nmdc:mga06r32_173575_c1 | 3300050510 | Bacteria | 2140 |
| 954 | nmdc:mga06r32_1915_c1 | 3300050510 | Bacteria | 18535 |
| 955 | nmdc:mga06r32_711_c2 | 3300050510 | Bacteria | 27826 |
| 956 | nmdc:mga08y16_114652_c1 | 3300050511 | Bacteria | 2806 |
| 957 | nmdc:mga08y16_23328_c1 | 3300050511 | Bacteria | 6536 |
| 958 | nmdc:mga08y16_369_c1 | 3300050511 | Bacteria | 40785 |
| 959 | nmdc:mga08y16_417932_c1 | 3300050511 | Bacteria | 1371 |
| 960 | nmdc:mga08y16_67091_c1 | 3300050511 | Bacteria | 3743 |
| 961 | nmdc:mga08y16_73920_c1 | 3300050511 | Bacteria | 3552 |
| 962 | nmdc:mga0n895_137616_c1 | 3300050512 | Bacteria | 2469 |
| 963 | nmdc:mga0n895_209_c1 | 3300050512 | Bacteria | 36635 |
| 964 | nmdc:mga0n895_260850_c1 | 3300050512 | Bacteria | 1758 |
| 965 | nmdc:mga0n895_313143_c1 | 3300050512 | Bacteria | 1591 |
| 966 | nmdc:mga0n895_36911_c1 | 3300050512 | Bacteria | 4722 |
| 967 | nmdc:mga0n895_515963_c1 | 3300050512 | Bacteria | 1203 |
| 968 | nmdc:mga0rr50_591_c1 | 3300050513 | Bacteria | 19417 |
| 969 | nmdc:mga0rr50_91735_c1 | 3300050513 | Bacteria | 2367 |
| 970 | nmdc:mga0a205_1233_c1 | 3300050515 | Bacteria | 21462 |
| 971 | nmdc:mga0a205_135810_c1 | 3300050515 | Bacteria | 2360 |
| 972 | nmdc:mga0a205_318146_c1 | 3300050515 | Bacteria | 1427 |
| 973 | nmdc:mga0a205_83824_c1 | 3300050515 | Bacteria | 3079 |
| 974 | nmdc:mga0sz30_22184_c1 | 3300050516 | Bacteria | 2575 |
| 975 | Ga0495601_0000647 | 3300053077 | Bacteria | 18571 |
| 976 | Ga0495601_0002386 | 3300053077 | Bacteria | 10655 |
| 977 | Ga0495601_0063468 | 3300053077 | Bacteria | 2348 |
| 978 | Ga0495612_0006165 | 3300053078 | Bacteria | 4934 |
| 979 | Ga0500610_0086566 | 3300053079 | Bacteria | 1630 |
| 980 | Ga0495655_0024574 | 3300053083 | Bacteria | 1401 |
| 981 | Ga0495595_0000537 | 3300053084 | Bacteria | 14481 |
| 982 | Ga0495595_0097936 | 3300053084 | Bacteria | 1413 |
| 983 | Ga0495595_0165472 | 3300053084 | Bacteria | 1093 |
| 984 | Ga0495619_0022151 | 3300053085 | Bacteria | 4062 |
| 985 | Ga0495619_0029197 | 3300053085 | Bacteria | 3562 |
| 986 | Ga0495619_0041968 | 3300053085 | Bacteria | 2994 |
| 987 | Ga0500643_021588 | 3300053087 | Bacteria | 2084 |
| 988 | Ga0500566_0011276 | 3300053094 | Bacteria | 5265 |
| 989 | Ga0500650_0000958 | 3300053098 | Bacteria | 8142 |
| 990 | Ga0500562_005421 | 3300053108 | Bacteria | 3204 |
| 991 | Ga0500608_018675 | 3300053122 | Bacteria | 3168 |
| 992 | Ga0500618_001056 | 3300053125 | Bacteria | 13684 |
| 993 | Ga0500618_024229 | 3300053125 | Bacteria | 1463 |
| 994 | Ga0500655_013080 | 3300053133 | Bacteria | 1512 |
| 995 | Ga0500559_0000932 | 3300053136 | Bacteria | 18458 |
| 996 | Ga0500568_0002600 | 3300053139 | Bacteria | 10494 |
| 997 | Ga0500574_038835 | 3300053141 | Bacteria | 1319 |
| 998 | Ga0500590_049704 | 3300053148 | Bacteria | 2134 |
| 999 | Ga0500604_0026027 | 3300053151 | Bacteria | 1685 |
| 1000 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 1001 | Ga0500622_0000073 | 3300053156 | Bacteria | 111045 |
| 1002 | Ga0500634_0000656 | 3300053161 | Bacteria | 11746 |
| 1003 | Ga0500638_015637 | 3300053162 | Bacteria | 3485 |
| 1004 | Ga0500636_0000712 | 3300053177 | Bacteria | 17867 |
| 1005 | Ga0500636_0069941 | 3300053177 | Bacteria | 2037 |
| 1006 | Ga0500645_044128 | 3300053730 | Bacteria | 1312 |
| 1007 | Ga0501084_0011336 | 3300054114 | Bacteria | 7383 |
| 1008 | Ga0501084_0014881 | 3300054114 | Bacteria | 6452 |
| 1009 | Ga0501084_0404894 | 3300054114 | Bacteria | 1153 |
| 1010 | Ga0501082_0005629 | 3300060353 | Bacteria | 10874 |
| 1011 | Ga0501082_0535132 | 3300060353 | Bacteria | 1024 |
| 1012 | Ga0466962_0017570 | 3300061719 | Bacteria | 3443 |
| 1013 | Ga0466962_0038099 | 3300061719 | Bacteria | 2303 |
| 1014 | Ga0466962_0144013 | 3300061719 | Bacteria | 1155 |
| 1015 | Ga0530510_0015211 | 3300061734 | Bacteria | 5433 |
| 1016 | Ga0530510_0140646 | 3300061734 | Bacteria | 1778 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10466703 | Ga0114129_104667032 | 207 |
| 2 | 3300044693 | Ga0466961_0030412 | Ga0466961_0030412_2620_3264 | 207 |
| 3 | 3300044694 | Ga0466963_0032397 | Ga0466963_0032397_1616_2260 | 207 |
| 4 | 3300044735 | Ga0466968_0006794 | Ga0466968_0006794_2041_2685 | 207 |
| 5 | 3300044842 | Ga0466957_0005553 | Ga0466957_0005553_208_852 | 207 |
| 6 | 3300045049 | Ga0466959_0019196 | Ga0466959_0019196_3131_3775 | 207 |
| 7 | 3300045836 | Ga0466958_0013508 | Ga0466958_0013508_62_706 | 207 |
| 8 | 3300061719 | Ga0466962_0017570 | Ga0466962_0017570_208_852 | 207 |
| 9 | 3300037418 | Ga0395900_0102690 | Ga0395900_0102690_2236_2901 | 214 |
| 10 | 3300046454 | Ga0495592_0057799 | Ga0495592_0057799_443_1108 | 214 |
| 11 | 3300045976 | Ga0466967_0058365 | Ga0466967_0058365_2237_2905 | 215 |
| 12 | 3300045976 | Ga0466967_0234549 | Ga0466967_0234549_857_1525 | 215 |
| 13 | 3300044694 | Ga0466963_0011090 | Ga0466963_0011090_497_1168 | 216 |
| 14 | 3300044735 | Ga0466968_0026467 | Ga0466968_0026467_235_906 | 216 |
| 15 | 3300045836 | Ga0466958_0004245 | Ga0466958_0004245_4185_4856 | 216 |
| 16 | 3300045976 | Ga0466967_0379427 | Ga0466967_0379427_211_882 | 216 |
| 17 | 3300048917 | Ga0496114_0157425 | Ga0496114_0157425_1185_1862 | 218 |
| 18 | 3300005435 | Ga0070714_100046287 | Ga0070714_1000462873 | 219 |
| 19 | 3300045976 | Ga0466967_0026963 | Ga0466967_0026963_3206_3892 | 221 |
| 20 | 3300035171 | Ga0373946_0064684 | Ga0373946_0064684_176_964 | 222 |
| 21 | 3300005937 | Ga0081455_10143757 | Ga0081455_101437571 | 225 |
| 22 | 3300046684 | Ga0495669_0184129 | Ga0495669_0184129_11_709 | 226 |
| 23 | 3300048909 | Ga0496106_0576156 | Ga0496106_0576156_13_720 | 226 |
| 24 | 3300049742 | Ga0501080_0984115 | Ga0501080_0984115_21_719 | 226 |
| 25 | 3300005618 | Ga0068864_100157159 | Ga0068864_1001571591 | 227 |
| 26 | 3300014325 | Ga0163163_10147751 | Ga0163163_101477513 | 227 |
| 27 | 3300014497 | Ga0182008_10193696 | Ga0182008_101936962 | 227 |
| 28 | 3300026095 | Ga0207676_10567161 | Ga0207676_105671612 | 227 |
| 29 | 3300026118 | Ga0207675_100206992 | Ga0207675_1002069922 | 227 |
| 30 | 3300005328 | Ga0070676_10042146 | Ga0070676_100421463 | 228 |
| 31 | 3300005329 | Ga0070683_100343710 | Ga0070683_1003437102 | 228 |
| 32 | 3300005334 | Ga0068869_100076568 | Ga0068869_1000765682 | 228 |
| 33 | 3300005336 | Ga0070680_100007553 | Ga0070680_1000075538 | 228 |
| 34 | 3300005337 | Ga0070682_100360308 | Ga0070682_1003603082 | 228 |
| 35 | 3300005339 | Ga0070660_100376427 | Ga0070660_1003764272 | 228 |
| 36 | 3300005366 | Ga0070659_100075313 | Ga0070659_1000753132 | 228 |
| 37 | 3300005444 | Ga0070694_100030678 | Ga0070694_1000306784 | 228 |
| 38 | 3300005530 | Ga0070679_100074303 | Ga0070679_1000743033 | 228 |
| 39 | 3300005535 | Ga0070684_100072514 | Ga0070684_1000725143 | 228 |
| 40 | 3300005547 | Ga0070693_100017405 | Ga0070693_1000174051 | 228 |
| 41 | 3300005578 | Ga0068854_100360164 | Ga0068854_1003601642 | 228 |
| 42 | 3300005719 | Ga0068861_100303616 | Ga0068861_1003036162 | 228 |
| 43 | 3300006058 | Ga0075432_10004288 | Ga0075432_100042884 | 228 |
| 44 | 3300006844 | Ga0075428_100001371 | Ga0075428_1000013719 | 228 |
| 45 | 3300006880 | Ga0075429_100043337 | Ga0075429_1000433373 | 228 |
| 46 | 3300009094 | Ga0111539_10003651 | Ga0111539_100036517 | 228 |
| 47 | 3300009098 | Ga0105245_10003235 | Ga0105245_100032354 | 228 |
| 48 | 3300009147 | Ga0114129_10007210 | Ga0114129_1000721012 | 228 |
| 49 | 3300009148 | Ga0105243_10092321 | Ga0105243_100923212 | 228 |
| 50 | 3300009551 | Ga0105238_10395151 | Ga0105238_103951512 | 228 |
| 51 | 3300010375 | Ga0105239_10028385 | Ga0105239_100283854 | 228 |
| 52 | 3300014745 | Ga0157377_10012661 | Ga0157377_100126613 | 228 |
| 53 | 3300025901 | Ga0207688_10004774 | Ga0207688_100047746 | 228 |
| 54 | 3300025907 | Ga0207645_10100904 | Ga0207645_101009042 | 228 |
| 55 | 3300025912 | Ga0207707_10168888 | Ga0207707_101688882 | 228 |
| 56 | 3300025926 | Ga0207659_10245756 | Ga0207659_102457562 | 228 |
| 57 | 3300025927 | Ga0207687_10004767 | Ga0207687_100047676 | 228 |
| 58 | 3300025933 | Ga0207706_10110449 | Ga0207706_101104491 | 228 |
| 59 | 3300025935 | Ga0207709_10004733 | Ga0207709_100047332 | 228 |
| 60 | 3300025949 | Ga0207667_10582082 | Ga0207667_105820822 | 228 |
| 61 | 3300026041 | Ga0207639_10203555 | Ga0207639_102035552 | 228 |
| 62 | 3300027907 | Ga0207428_10001271 | Ga0207428_100012719 | 228 |
| 63 | 3300044901 | Ga0466960_0075909 | Ga0466960_0075909_425_1132 | 228 |
| 64 | 3300049572 | Ga0501036_0073195 | Ga0501036_0073195_464_1243 | 228 |
| 65 | 3300049575 | Ga0501039_0015604 | Ga0501039_0015604_1686_2465 | 228 |
| 66 | 3300049578 | Ga0501042_0066842 | Ga0501042_0066842_551_1330 | 228 |
| 67 | 3300049580 | Ga0501046_0061889 | Ga0501046_0061889_1460_2239 | 228 |
| 68 | 3300049584 | Ga0501068_0017296 | Ga0501068_0017296_2209_2988 | 228 |
| 69 | 3300049585 | Ga0501069_0109390 | Ga0501069_0109390_655_1434 | 228 |
| 70 | 3300049586 | Ga0501070_0023475 | Ga0501070_0023475_1754_2533 | 228 |
| 71 | 3300049587 | Ga0501071_0195123 | Ga0501071_0195123_262_1041 | 228 |
| 72 | 3300049588 | Ga0501072_0004774 | Ga0501072_0004774_8933_9712 | 228 |
| 73 | 3300049591 | Ga0501075_0028467 | Ga0501075_0028467_2657_3436 | 228 |
| 74 | 3300049592 | Ga0501076_0015056 | Ga0501076_0015056_3376_4155 | 228 |
| 75 | 3300049593 | Ga0501077_0049664 | Ga0501077_0049664_99_878 | 228 |
| 76 | 3300049742 | Ga0501080_0003042 | Ga0501080_0003042_6588_7367 | 228 |
| 77 | 3300049744 | Ga0501083_0053884 | Ga0501083_0053884_1385_2164 | 228 |
| 78 | 3300049824 | Ga0501045_0005895 | Ga0501045_0005895_6792_7571 | 228 |
| 79 | 3300050507 | nmdc:mga05p37_44079_c1 | nmdc:mga05p37_44079_c1_3424_4203 | 228 |
| 80 | 3300050508 | nmdc:mga09592_84470_c1 | nmdc:mga09592_84470_c1_1653_2432 | 228 |
| 81 | 3300050511 | nmdc:mga08y16_114652_c1 | nmdc:mga08y16_114652_c1_830_1609 | 228 |
| 82 | 3300054114 | Ga0501084_0011336 | Ga0501084_0011336_5882_6661 | 228 |
| 83 | 3300061734 | Ga0530510_0015211 | Ga0530510_0015211_2035_2814 | 228 |
| 84 | 3300045976 | Ga0466967_0312618 | Ga0466967_0312618_116_826 | 229 |
| 85 | 3300048911 | Ga0496108_0056998 | Ga0496108_0056998_1685_2395 | 229 |
| 86 | 3300048912 | Ga0496109_0032798 | Ga0496109_0032798_3716_4426 | 229 |
| 87 | 3300048916 | Ga0496113_0037654 | Ga0496113_0037654_1004_1714 | 229 |
| 88 | 3300048917 | Ga0496114_0147392 | Ga0496114_0147392_945_1655 | 229 |
| 89 | 3300049568 | Ga0501031_0005436 | Ga0501031_0005436_2761_3471 | 229 |
| 90 | 3300049569 | Ga0501032_0017369 | Ga0501032_0017369_4326_5036 | 229 |
| 91 | 3300049570 | Ga0501033_0003024 | Ga0501033_0003024_5318_6028 | 229 |
| 92 | 3300049571 | Ga0501034_0004465 | Ga0501034_0004465_10875_11585 | 229 |
| 93 | 3300049573 | Ga0501037_0010019 | Ga0501037_0010019_3486_4196 | 229 |
| 94 | 3300049574 | Ga0501038_0003860 | Ga0501038_0003860_8235_8945 | 229 |
| 95 | 3300049575 | Ga0501039_0006970 | Ga0501039_0006970_6525_7235 | 229 |
| 96 | 3300049577 | Ga0501041_0002801 | Ga0501041_0002801_4080_4790 | 229 |
| 97 | 3300049578 | Ga0501042_0004936 | Ga0501042_0004936_3486_4196 | 229 |
| 98 | 3300049579 | Ga0501043_0008009 | Ga0501043_0008009_4181_4891 | 229 |
| 99 | 3300049581 | Ga0501047_0195397 | Ga0501047_0195397_673_1383 | 229 |
| 100 | 3300049582 | Ga0501048_0006714 | Ga0501048_0006714_3687_4397 | 229 |
| 101 | 3300049584 | Ga0501068_0001358 | Ga0501068_0001358_3911_4621 | 229 |
| 102 | 3300049585 | Ga0501069_0002413 | Ga0501069_0002413_2927_3637 | 229 |
| 103 | 3300049586 | Ga0501070_0023781 | Ga0501070_0023781_1500_2210 | 229 |
| 104 | 3300049587 | Ga0501071_0006163 | Ga0501071_0006163_3486_4196 | 229 |
| 105 | 3300049588 | Ga0501072_0015146 | Ga0501072_0015146_2276_2986 | 229 |
| 106 | 3300049589 | Ga0501073_0004766 | Ga0501073_0004766_4289_4999 | 229 |
| 107 | 3300049590 | Ga0501074_0020411 | Ga0501074_0020411_1372_2082 | 229 |
| 108 | 3300049591 | Ga0501075_0040374 | Ga0501075_0040374_1500_2210 | 229 |
| 109 | 3300049592 | Ga0501076_0004393 | Ga0501076_0004393_3830_4540 | 229 |
| 110 | 3300049593 | Ga0501077_0005390 | Ga0501077_0005390_3579_4289 | 229 |
| 111 | 3300049744 | Ga0501083_0002239 | Ga0501083_0002239_5224_5934 | 229 |
| 112 | 3300049822 | Ga0501035_0004259 | Ga0501035_0004259_7672_8382 | 229 |
| 113 | 3300049823 | Ga0501044_0023054 | Ga0501044_0023054_2304_3014 | 229 |
| 114 | 3300049824 | Ga0501045_0005270 | Ga0501045_0005270_5313_6023 | 229 |
| 115 | 3300060353 | Ga0501082_0005629 | Ga0501082_0005629_5178_5888 | 229 |
| 116 | 3300049741 | Ga0501079_0070516 | Ga0501079_0070516_27_740 | 230 |
| 117 | 3300049575 | Ga0501039_0648091 | Ga0501039_0648091_38_787 | 232 |
| 118 | 3300005331 | Ga0070670_100034285 | Ga0070670_1000342852 | 235 |
| 119 | 3300005435 | Ga0070714_100073796 | Ga0070714_1000737963 | 235 |
| 120 | 3300005563 | Ga0068855_100017227 | Ga0068855_1000172277 | 235 |
| 121 | 3300006871 | Ga0075434_100355241 | Ga0075434_1003552412 | 235 |
| 122 | 3300009094 | Ga0111539_10410115 | Ga0111539_104101152 | 235 |
| 123 | 3300009101 | Ga0105247_10316669 | Ga0105247_103166691 | 235 |
| 124 | 3300009147 | Ga0114129_10033314 | Ga0114129_100333148 | 235 |
| 125 | 3300013306 | Ga0163162_10542747 | Ga0163162_105427471 | 235 |
| 126 | 3300014325 | Ga0163163_10026975 | Ga0163163_100269752 | 235 |
| 127 | 3300014968 | Ga0157379_10711286 | Ga0157379_107112862 | 235 |
| 128 | 3300025919 | Ga0207657_10006225 | Ga0207657_100062259 | 235 |
| 129 | 3300025925 | Ga0207650_10254780 | Ga0207650_102547801 | 235 |
| 130 | 3300025929 | Ga0207664_10164862 | Ga0207664_101648622 | 235 |
| 131 | 3300025949 | Ga0207667_10088505 | Ga0207667_100885053 | 235 |
| 132 | 3300026041 | Ga0207639_10178370 | Ga0207639_101783702 | 235 |
| 133 | 3300035084 | Ga0373928_0033520 | Ga0373928_0033520_221_1009 | 235 |
| 134 | 3300046457 | Ga0495590_0017090 | Ga0495590_0017090_1611_2396 | 235 |
| 135 | 3300046513 | Ga0495616_0060673 | Ga0495616_0060673_190_975 | 235 |
| 136 | 3300046522 | Ga0495643_0012275 | Ga0495643_0012275_3414_4199 | 235 |
| 137 | 3300046542 | Ga0495597_0056755 | Ga0495597_0056755_590_1375 | 235 |
| 138 | 3300046648 | Ga0495611_0138792 | Ga0495611_0138792_303_1088 | 235 |
| 139 | 3300046660 | Ga0495625_0061370 | Ga0495625_0061370_680_1465 | 235 |
| 140 | 3300047323 | Ga0495683_0037293 | Ga0495683_0037293_1034_1819 | 235 |
| 141 | 3300048905 | Ga0496102_0088989 | Ga0496102_0088989_1793_2581 | 235 |
| 142 | 3300048906 | Ga0496103_0052199 | Ga0496103_0052199_427_1215 | 235 |
| 143 | 3300048907 | Ga0496104_0046659 | Ga0496104_0046659_3048_3836 | 235 |
| 144 | 3300048908 | Ga0496105_0009717 | Ga0496105_0009717_6504_7292 | 235 |
| 145 | 3300048909 | Ga0496106_0160185 | Ga0496106_0160185_357_1145 | 235 |
| 146 | 3300048910 | Ga0496107_0113779 | Ga0496107_0113779_531_1319 | 235 |
| 147 | 3300048911 | Ga0496108_0003718 | Ga0496108_0003718_7853_8641 | 235 |
| 148 | 3300048912 | Ga0496109_0010883 | Ga0496109_0010883_6820_7608 | 235 |
| 149 | 3300048914 | Ga0496111_0005703 | Ga0496111_0005703_6492_7280 | 235 |
| 150 | 3300048915 | Ga0496112_0018168 | Ga0496112_0018168_29_817 | 235 |
| 151 | 3300048916 | Ga0496113_0001628 | Ga0496113_0001628_7477_8265 | 235 |
| 152 | 3300048917 | Ga0496114_0184021 | Ga0496114_0184021_847_1635 | 235 |
| 153 | 3300049459 | Ga0495678_041849 | Ga0495678_041849_857_1642 | 235 |
| 154 | 3300050507 | nmdc:mga05p37_24147_c1 | nmdc:mga05p37_24147_c1_3173_3961 | 235 |
| 155 | 3300050511 | nmdc:mga08y16_417932_c1 | nmdc:mga08y16_417932_c1_339_1127 | 235 |
| 156 | 3300050512 | nmdc:mga0n895_313143_c1 | nmdc:mga0n895_313143_c1_373_1161 | 235 |
| 157 | 3300005563 | Ga0068855_100567348 | Ga0068855_1005673482 | 236 |
| 158 | 3300039453 | Ga0436362_1291563 | Ga0436362_1291563_305_1072 | 236 |
| 159 | 3300044694 | Ga0466963_0039521 | Ga0466963_0039521_1116_1883 | 236 |
| 160 | 3300044694 | Ga0466963_0065666 | Ga0466963_0065666_304_1071 | 236 |
| 161 | 3300044719 | Ga0466971_0011623 | Ga0466971_0011623_1989_2756 | 236 |
| 162 | 3300044735 | Ga0466968_0120622 | Ga0466968_0120622_183_950 | 236 |
| 163 | 3300044842 | Ga0466957_0002407 | Ga0466957_0002407_4761_5528 | 236 |
| 164 | 3300045836 | Ga0466958_0001168 | Ga0466958_0001168_4641_5408 | 236 |
| 165 | 3300046506 | Ga0495583_0011669 | Ga0495583_0011669_3186_3971 | 236 |
| 166 | 3300046694 | Ga0495649_0014372 | Ga0495649_0014372_685_1470 | 236 |
| 167 | 3300046810 | Ga0495660_0015386 | Ga0495660_0015386_3171_3956 | 236 |
| 168 | 3300047443 | Ga0495687_031905 | Ga0495687_031905_176_961 | 236 |
| 169 | 3300047472 | Ga0495686_0143651 | Ga0495686_0143651_196_981 | 236 |
| 170 | 3300061719 | Ga0466962_0038099 | Ga0466962_0038099_1039_1806 | 236 |
| 171 | 3300061719 | Ga0466962_0144013 | Ga0466962_0144013_10_777 | 236 |
| 172 | 3300005337 | Ga0070682_100317335 | Ga0070682_1003173352 | 237 |
| 173 | 3300005456 | Ga0070678_100230441 | Ga0070678_1002304412 | 237 |
| 174 | 3300005458 | Ga0070681_10063813 | Ga0070681_100638133 | 237 |
| 175 | 3300005530 | Ga0070679_100182765 | Ga0070679_1001827652 | 237 |
| 176 | 3300005545 | Ga0070695_100003825 | Ga0070695_1000038256 | 237 |
| 177 | 3300005841 | Ga0068863_100612742 | Ga0068863_1006127421 | 237 |
| 178 | 3300009093 | Ga0105240_10032220 | Ga0105240_100322204 | 237 |
| 179 | 3300009545 | Ga0105237_10026808 | Ga0105237_100268083 | 237 |
| 180 | 3300013307 | Ga0157372_10017920 | Ga0157372_100179205 | 237 |
| 181 | 3300025912 | Ga0207707_10077105 | Ga0207707_100771052 | 237 |
| 182 | 3300025913 | Ga0207695_10251855 | Ga0207695_102518552 | 237 |
| 183 | 3300025915 | Ga0207693_10234584 | Ga0207693_102345842 | 237 |
| 184 | 3300025916 | Ga0207663_10132781 | Ga0207663_101327812 | 237 |
| 185 | 3300025921 | Ga0207652_10364747 | Ga0207652_103647472 | 237 |
| 186 | 3300026121 | Ga0207683_10264680 | Ga0207683_102646802 | 237 |
| 187 | 3300031824 | Ga0307413_10041893 | Ga0307413_100418932 | 237 |
| 188 | 3300039437 | Ga0436365_1865970 | Ga0436365_1865970_472_1236 | 237 |
| 189 | 3300044694 | Ga0466963_0000333 | Ga0466963_0000333_13523_14296 | 237 |
| 190 | 3300044694 | Ga0466963_0039590 | Ga0466963_0039590_1976_2740 | 237 |
| 191 | 3300044735 | Ga0466968_0110608 | Ga0466968_0110608_290_1063 | 237 |
| 192 | 3300044842 | Ga0466957_0011232 | Ga0466957_0011232_86_859 | 237 |
| 193 | 3300044842 | Ga0466957_0051591 | Ga0466957_0051591_1206_1979 | 237 |
| 194 | 3300045836 | Ga0466958_0004419 | Ga0466958_0004419_3771_4544 | 237 |
| 195 | 3300045836 | Ga0466958_0091685 | Ga0466958_0091685_152_916 | 237 |
| 196 | 3300045976 | Ga0466967_0000297 | Ga0466967_0000297_18768_19541 | 237 |
| 197 | 3300045976 | Ga0466967_0020232 | Ga0466967_0020232_1378_2142 | 237 |
| 198 | 3300048905 | Ga0496102_0036207 | Ga0496102_0036207_2952_3725 | 237 |
| 199 | 3300048906 | Ga0496103_0012623 | Ga0496103_0012623_94_867 | 237 |
| 200 | 3300031824 | Ga0307413_10003248 | Ga0307413_100032486 | 238 |
| 201 | 3300031911 | Ga0307412_10191080 | Ga0307412_101910801 | 238 |
| 202 | 3300031995 | Ga0307409_100021337 | Ga0307409_1000213372 | 238 |
| 203 | 3300032002 | Ga0307416_100026408 | Ga0307416_1000264084 | 238 |
| 204 | 3300032004 | Ga0307414_10083086 | Ga0307414_100830862 | 238 |
| 205 | 3300045976 | Ga0466967_0109721 | Ga0466967_0109721_330_1100 | 238 |
| 206 | 3300006175 | Ga0070712_100271120 | Ga0070712_1002711202 | 239 |
| 207 | 3300025915 | Ga0207693_10009517 | Ga0207693_100095176 | 239 |
| 208 | iso_pu_bacteria | 2939631187 | 2939634463 | 239 |
| 209 | 3300048904 | Ga0496101_0006351 | Ga0496101_0006351_4836_5600 | 240 |
| 210 | 3300025294 | Ga0209025_1027868 | Ga0209025_10278683 | 241 |
| 211 | 3300025298 | Ga0209050_1021841 | Ga0209050_10218412 | 241 |
| 212 | 3300035114 | Ga0373939_0005135 | Ga0373939_0005135_1940_2728 | 241 |
| 213 | 3300048919 | Ga0496116_0041215 | Ga0496116_0041215_2224_2982 | 241 |
| 214 | 3300048920 | Ga0496117_0176720 | Ga0496117_0176720_88_846 | 241 |
| 215 | 3300048924 | Ga0496121_0064933 | Ga0496121_0064933_2128_2886 | 241 |
| 216 | 3300048926 | Ga0496123_0029826 | Ga0496123_0029826_1331_2089 | 241 |
| 217 | 3300048928 | Ga0496125_0112820 | Ga0496125_0112820_219_977 | 241 |
| 218 | 3300050512 | nmdc:mga0n895_515963_c1 | nmdc:mga0n895_515963_c1_443_1186 | 241 |
| 219 | 3300003187 | JGI25151J46595_10020173 | JGI25151J46595_100201733 | 242 |
| 220 | 3300025294 | Ga0209025_1000325 | Ga0209025_100032530 | 242 |
| 221 | iso_pu_bacteria | 2643221658 | 2644325202 | 242 |
| 222 | iso_pu_bacteria | 2738541307 | 2738883099 | 242 |
| 223 | 3300009094 | Ga0111539_11142077 | Ga0111539_111420771 | 243 |
| 224 | 3300025937 | Ga0207669_10266642 | Ga0207669_102666422 | 243 |
| 225 | 3300026067 | Ga0207678_10539024 | Ga0207678_105390242 | 243 |
| 226 | 3300048918 | Ga0496115_0523387 | Ga0496115_0523387_86_880 | 243 |
| 227 | iso_pu_bacteria | 2904541872 | 2904548939 | 243 |
| 228 | iso_pu_bacteria | 2929160207 | 2929160942 | 243 |
| 229 | iso_pu_bacteria | 8054563764 | 8054568490 | 243 |
| 230 | 3300006194 | Ga0075427_10001837 | Ga0075427_100018373 | 244 |
| 231 | 3300006844 | Ga0075428_100002667 | Ga0075428_1000026679 | 244 |
| 232 | 3300006846 | Ga0075430_100000770 | Ga0075430_1000007704 | 244 |
| 233 | 3300006847 | Ga0075431_100000399 | Ga0075431_10000039923 | 244 |
| 234 | 3300006852 | Ga0075433_10000374 | Ga0075433_100003747 | 244 |
| 235 | 3300006871 | Ga0075434_100001253 | Ga0075434_10000125316 | 244 |
| 236 | 3300006880 | Ga0075429_100001469 | Ga0075429_10000146915 | 244 |
| 237 | 3300007076 | Ga0075435_100009949 | Ga0075435_1000099497 | 244 |
| 238 | 3300009094 | Ga0111539_10001763 | Ga0111539_1000176322 | 244 |
| 239 | 3300009147 | Ga0114129_10001978 | Ga0114129_1000197823 | 244 |
| 240 | 3300027907 | Ga0207428_10000417 | Ga0207428_1000041741 | 244 |
| 241 | 3300049571 | Ga0501034_0363252 | Ga0501034_0363252_416_1216 | 244 |
| 242 | 3300050507 | nmdc:mga05p37_531_c1 | nmdc:mga05p37_531_c1_18828_19616 | 244 |
| 243 | 3300050508 | nmdc:mga09592_8311_c1 | nmdc:mga09592_8311_c1_2800_3588 | 244 |
| 244 | 3300050509 | nmdc:mga0qj67_413_c1 | nmdc:mga0qj67_413_c1_14097_14885 | 244 |
| 245 | 3300050510 | nmdc:mga06r32_1915_c1 | nmdc:mga06r32_1915_c1_9282_10070 | 244 |
| 246 | 3300050511 | nmdc:mga08y16_23328_c1 | nmdc:mga08y16_23328_c1_2727_3515 | 244 |
| 247 | 3300050512 | nmdc:mga0n895_209_c1 | nmdc:mga0n895_209_c1_22784_23572 | 244 |
| 248 | 3300050513 | nmdc:mga0rr50_591_c1 | nmdc:mga0rr50_591_c1_4983_5771 | 244 |
| 249 | 3300050515 | nmdc:mga0a205_1233_c1 | nmdc:mga0a205_1233_c1_18170_18958 | 244 |
| 250 | iso_pu_bacteria | 2738541277 | 2738722971 | 244 |
| 251 | iso_pu_bacteria | 2738543019 | 2739283542 | 244 |
| 252 | 3300005983 | Ga0081540_1001455 | Ga0081540_10014554 | 245 |
| 253 | 3300028794 | Ga0307515_10258369 | Ga0307515_102583692 | 245 |
| 254 | 3300031456 | Ga0307513_10002157 | Ga0307513_1000215715 | 245 |
| 255 | 3300048907 | Ga0496104_0715172 | Ga0496104_0715172_84_839 | 245 |
| 256 | 3300003781 | Ga0055536_1004556 | Ga0055536_10045566 | 246 |
| 257 | 3300003791 | Ga0055530_10007828 | Ga0055530_100078284 | 246 |
| 258 | 3300003792 | Ga0055540_1000045 | Ga0055540_100004525 | 246 |
| 259 | 3300003794 | Ga0055531_10000149 | Ga0055531_1000014925 | 246 |
| 260 | 3300009094 | Ga0111539_10028162 | Ga0111539_100281624 | 246 |
| 261 | 3300025292 | Ga0209676_1000135 | Ga0209676_1000135134 | 246 |
| 262 | 3300025298 | Ga0209050_1000100 | Ga0209050_100010050 | 246 |
| 263 | 3300025303 | Ga0209051_1000067 | Ga0209051_1000067177 | 246 |
| 264 | 3300025304 | Ga0209257_1000095 | Ga0209257_100009564 | 246 |
| 265 | 3300031731 | Ga0307405_10015237 | Ga0307405_100152375 | 246 |
| 266 | 3300035398 | Ga0316574_0024694 | Ga0316574_0024694_15_773 | 246 |
| 267 | 3300037471 | Ga0395905_0004682 | Ga0395905_0004682_8676_9434 | 246 |
| 268 | 3300047321 | Ga0495676_0010663 | Ga0495676_0010663_3330_4088 | 246 |
| 269 | 3300047673 | Ga0495593_0012124 | Ga0495593_0012124_3036_3794 | 246 |
| 270 | 3300048089 | Ga0495614_0002092 | Ga0495614_0002092_419_1177 | 246 |
| 271 | 3300048925 | Ga0496122_0119563 | Ga0496122_0119563_74_832 | 246 |
| 272 | 3300048927 | Ga0496124_0118073 | Ga0496124_0118073_1339_2097 | 246 |
| 273 | 3300050512 | nmdc:mga0n895_260850_c1 | nmdc:mga0n895_260850_c1_651_1409 | 246 |
| 274 | 3300053087 | Ga0500643_021588 | Ga0500643_021588_825_1583 | 246 |
| 275 | 3300053133 | Ga0500655_013080 | Ga0500655_013080_100_858 | 246 |
| 276 | 3300053141 | Ga0500574_038835 | Ga0500574_038835_395_1153 | 246 |
| 277 | 3300053161 | Ga0500634_0000656 | Ga0500634_0000656_10505_11263 | 246 |
| 278 | 3300053162 | Ga0500638_015637 | Ga0500638_015637_312_1070 | 246 |
| 279 | 3300005331 | Ga0070670_100054860 | Ga0070670_1000548603 | 247 |
| 280 | 3300005347 | Ga0070668_100353053 | Ga0070668_1003530532 | 247 |
| 281 | 3300005367 | Ga0070667_100184817 | Ga0070667_1001848171 | 247 |
| 282 | 3300005547 | Ga0070693_100052891 | Ga0070693_1000528912 | 247 |
| 283 | 3300005841 | Ga0068863_100129676 | Ga0068863_1001296763 | 247 |
| 284 | 3300006048 | Ga0075363_100026897 | Ga0075363_1000268973 | 247 |
| 285 | 3300006051 | Ga0075364_10010874 | Ga0075364_100108742 | 247 |
| 286 | 3300006178 | Ga0075367_10199806 | Ga0075367_101998062 | 247 |
| 287 | 3300006237 | Ga0097621_100167011 | Ga0097621_1001670112 | 247 |
| 288 | 3300006358 | Ga0068871_100388319 | Ga0068871_1003883192 | 247 |
| 289 | 3300006844 | Ga0075428_100153128 | Ga0075428_1001531283 | 247 |
| 290 | 3300009098 | Ga0105245_10360456 | Ga0105245_103604562 | 247 |
| 291 | 3300009553 | Ga0105249_10505332 | Ga0105249_105053322 | 247 |
| 292 | 3300011119 | Ga0105246_10136766 | Ga0105246_101367662 | 247 |
| 293 | 3300014326 | Ga0157380_10149702 | Ga0157380_101497022 | 247 |
| 294 | 3300025907 | Ga0207645_10021819 | Ga0207645_100218193 | 247 |
| 295 | 3300025918 | Ga0207662_10023421 | Ga0207662_100234214 | 247 |
| 296 | 3300025925 | Ga0207650_10265663 | Ga0207650_102656632 | 247 |
| 297 | 3300025927 | Ga0207687_10109109 | Ga0207687_101091093 | 247 |
| 298 | 3300025972 | Ga0207668_10436034 | Ga0207668_104360342 | 247 |
| 299 | 3300026035 | Ga0207703_10134630 | Ga0207703_101346302 | 247 |
| 300 | 3300026041 | Ga0207639_10196363 | Ga0207639_101963632 | 247 |
| 301 | 3300026088 | Ga0207641_10080191 | Ga0207641_100801913 | 247 |
| 302 | 3300028381 | Ga0268264_10005764 | Ga0268264_100057647 | 247 |
| 303 | 3300031344 | Ga0265316_10104946 | Ga0265316_101049462 | 247 |
| 304 | 3300031456 | Ga0307513_10182335 | Ga0307513_101823352 | 247 |
| 305 | 3300032004 | Ga0307414_10016739 | Ga0307414_100167394 | 247 |
| 306 | 3300044712 | Ga0453684_0042476 | Ga0453684_0042476_4356_5117 | 247 |
| 307 | 3300045051 | Ga0451576_0000057 | Ga0451576_0000057_292047_292808 | 247 |
| 308 | 3300045051 | Ga0451576_0034096 | Ga0451576_0034096_2365_3126 | 247 |
| 309 | 3300046460 | Ga0495638_0019991 | Ga0495638_0019991_1721_2482 | 247 |
| 310 | 3300046474 | Ga0495605_0027074 | Ga0495605_0027074_2004_2765 | 247 |
| 311 | 3300049571 | Ga0501034_0005912 | Ga0501034_0005912_2883_3644 | 247 |
| 312 | 3300050489 | nmdc:mga03683_72291_c1 | nmdc:mga03683_72291_c1_513_1274 | 247 |
| 313 | 3300050491 | nmdc:mga00v17_178915_c1 | nmdc:mga00v17_178915_c1_86_847 | 247 |
| 314 | 3300050492 | nmdc:mga0yw44_58881_c1 | nmdc:mga0yw44_58881_c1_1424_2185 | 247 |
| 315 | 3300050494 | nmdc:mga06z11_159847_c1 | nmdc:mga06z11_159847_c1_310_1071 | 247 |
| 316 | 3300053079 | Ga0500610_0086566 | Ga0500610_0086566_671_1453 | 247 |
| 317 | 3300053151 | Ga0500604_0026027 | Ga0500604_0026027_429_1190 | 247 |
| 318 | 3300001991 | JGI24743J22301_10004507 | JGI24743J22301_100045073 | 248 |
| 319 | 3300005290 | Ga0065712_10079461 | Ga0065712_100794612 | 248 |
| 320 | 3300005293 | Ga0065715_10119572 | Ga0065715_101195722 | 248 |
| 321 | 3300005328 | Ga0070676_10229184 | Ga0070676_102291842 | 248 |
| 322 | 3300005329 | Ga0070683_100067856 | Ga0070683_1000678563 | 248 |
| 323 | 3300005330 | Ga0070690_100040872 | Ga0070690_1000408723 | 248 |
| 324 | 3300005331 | Ga0070670_100045033 | Ga0070670_1000450335 | 248 |
| 325 | 3300005333 | Ga0070677_10021417 | Ga0070677_100214173 | 248 |
| 326 | 3300005334 | Ga0068869_100219157 | Ga0068869_1002191572 | 248 |
| 327 | 3300005335 | Ga0070666_10082392 | Ga0070666_100823922 | 248 |
| 328 | 3300005338 | Ga0068868_100065959 | Ga0068868_1000659592 | 248 |
| 329 | 3300005340 | Ga0070689_100116047 | Ga0070689_1001160472 | 248 |
| 330 | 3300005343 | Ga0070687_100007937 | Ga0070687_1000079374 | 248 |
| 331 | 3300005353 | Ga0070669_100129903 | Ga0070669_1001299032 | 248 |
| 332 | 3300005354 | Ga0070675_100055984 | Ga0070675_1000559841 | 248 |
| 333 | 3300005355 | Ga0070671_100139366 | Ga0070671_1001393662 | 248 |
| 334 | 3300005356 | Ga0070674_100097805 | Ga0070674_1000978052 | 248 |
| 335 | 3300005364 | Ga0070673_100271202 | Ga0070673_1002712022 | 248 |
| 336 | 3300005365 | Ga0070688_100003872 | Ga0070688_1000038723 | 248 |
| 337 | 3300005366 | Ga0070659_100113504 | Ga0070659_1001135042 | 248 |
| 338 | 3300005367 | Ga0070667_100141341 | Ga0070667_1001413412 | 248 |
| 339 | 3300005441 | Ga0070700_100053456 | Ga0070700_1000534562 | 248 |
| 340 | 3300005455 | Ga0070663_100026594 | Ga0070663_1000265943 | 248 |
| 341 | 3300005456 | Ga0070678_100079685 | Ga0070678_1000796853 | 248 |
| 342 | 3300005457 | Ga0070662_100117596 | Ga0070662_1001175962 | 248 |
| 343 | 3300005459 | Ga0068867_100039092 | Ga0068867_1000390923 | 248 |
| 344 | 3300005466 | Ga0070685_10030373 | Ga0070685_100303733 | 248 |
| 345 | 3300005535 | Ga0070684_100486754 | Ga0070684_1004867542 | 248 |
| 346 | 3300005548 | Ga0070665_100051051 | Ga0070665_1000510512 | 248 |
| 347 | 3300005577 | Ga0068857_100141940 | Ga0068857_1001419402 | 248 |
| 348 | 3300005578 | Ga0068854_100056426 | Ga0068854_1000564263 | 248 |
| 349 | 3300005616 | Ga0068852_100236339 | Ga0068852_1002363392 | 248 |
| 350 | 3300005617 | Ga0068859_100052613 | Ga0068859_1000526136 | 248 |
| 351 | 3300005618 | Ga0068864_100015632 | Ga0068864_1000156324 | 248 |
| 352 | 3300005718 | Ga0068866_10012834 | Ga0068866_100128343 | 248 |
| 353 | 3300005834 | Ga0068851_10003774 | Ga0068851_100037744 | 248 |
| 354 | 3300005840 | Ga0068870_10021342 | Ga0068870_100213422 | 248 |
| 355 | 3300005841 | Ga0068863_100907465 | Ga0068863_1009074651 | 248 |
| 356 | 3300005842 | Ga0068858_100177287 | Ga0068858_1001772872 | 248 |
| 357 | 3300005843 | Ga0068860_100540591 | Ga0068860_1005405912 | 248 |
| 358 | 3300005844 | Ga0068862_100182861 | Ga0068862_1001828612 | 248 |
| 359 | 3300006237 | Ga0097621_100295049 | Ga0097621_1002950492 | 248 |
| 360 | 3300006358 | Ga0068871_100287677 | Ga0068871_1002876772 | 248 |
| 361 | 3300006881 | Ga0068865_100030560 | Ga0068865_1000305602 | 248 |
| 362 | 3300006931 | Ga0097620_100052611 | Ga0097620_1000526116 | 248 |
| 363 | 3300009094 | Ga0111539_10196051 | Ga0111539_101960512 | 248 |
| 364 | 3300009098 | Ga0105245_10289217 | Ga0105245_102892172 | 248 |
| 365 | 3300009148 | Ga0105243_10088495 | Ga0105243_100884952 | 248 |
| 366 | 3300009176 | Ga0105242_10457040 | Ga0105242_104570401 | 248 |
| 367 | 3300009553 | Ga0105249_10139027 | Ga0105249_101390273 | 248 |
| 368 | 3300010375 | Ga0105239_10374928 | Ga0105239_103749282 | 248 |
| 369 | 3300013296 | Ga0157374_10015100 | Ga0157374_100151008 | 248 |
| 370 | 3300013297 | Ga0157378_10860880 | Ga0157378_108608802 | 248 |
| 371 | 3300013306 | Ga0163162_10433708 | Ga0163162_104337082 | 248 |
| 372 | 3300013307 | Ga0157372_10613420 | Ga0157372_106134202 | 248 |
| 373 | 3300014325 | Ga0163163_10213655 | Ga0163163_102136552 | 248 |
| 374 | 3300014326 | Ga0157380_10024561 | Ga0157380_100245614 | 248 |
| 375 | 3300014968 | Ga0157379_10169853 | Ga0157379_101698532 | 248 |
| 376 | 3300014969 | Ga0157376_10138812 | Ga0157376_101388121 | 248 |
| 377 | 3300017792 | Ga0163161_10328026 | Ga0163161_103280262 | 248 |
| 378 | 3300025271 | Ga0207666_1007060 | Ga0207666_10070602 | 248 |
| 379 | 3300025290 | Ga0207673_1000176 | Ga0207673_10001763 | 248 |
| 380 | 3300025315 | Ga0207697_10000294 | Ga0207697_1000029418 | 248 |
| 381 | 3300025321 | Ga0207656_10009247 | Ga0207656_100092473 | 248 |
| 382 | 3300025893 | Ga0207682_10001810 | Ga0207682_100018109 | 248 |
| 383 | 3300025899 | Ga0207642_10017847 | Ga0207642_100178473 | 248 |
| 384 | 3300025903 | Ga0207680_10086423 | Ga0207680_100864232 | 248 |
| 385 | 3300025907 | Ga0207645_10000860 | Ga0207645_1000086027 | 248 |
| 386 | 3300025908 | Ga0207643_10000205 | Ga0207643_1000020533 | 248 |
| 387 | 3300025918 | Ga0207662_10005870 | Ga0207662_100058706 | 248 |
| 388 | 3300025920 | Ga0207649_10473140 | Ga0207649_104731401 | 248 |
| 389 | 3300025923 | Ga0207681_10138311 | Ga0207681_101383112 | 248 |
| 390 | 3300025925 | Ga0207650_10171378 | Ga0207650_101713782 | 248 |
| 391 | 3300025926 | Ga0207659_10008424 | Ga0207659_100084244 | 248 |
| 392 | 3300025927 | Ga0207687_10399636 | Ga0207687_103996362 | 248 |
| 393 | 3300025931 | Ga0207644_10124042 | Ga0207644_101240422 | 248 |
| 394 | 3300025932 | Ga0207690_10079256 | Ga0207690_100792562 | 248 |
| 395 | 3300025933 | Ga0207706_10002261 | Ga0207706_100022613 | 248 |
| 396 | 3300025934 | Ga0207686_10310368 | Ga0207686_103103681 | 248 |
| 397 | 3300025936 | Ga0207670_10007748 | Ga0207670_100077482 | 248 |
| 398 | 3300025937 | Ga0207669_10132289 | Ga0207669_101322892 | 248 |
| 399 | 3300025940 | Ga0207691_10213830 | Ga0207691_102138302 | 248 |
| 400 | 3300025942 | Ga0207689_10000451 | Ga0207689_1000045139 | 248 |
| 401 | 3300025944 | Ga0207661_10083982 | Ga0207661_100839822 | 248 |
| 402 | 3300025945 | Ga0207679_10134627 | Ga0207679_101346272 | 248 |
| 403 | 3300025949 | Ga0207667_10390455 | Ga0207667_103904552 | 248 |
| 404 | 3300025960 | Ga0207651_10583334 | Ga0207651_105833342 | 248 |
| 405 | 3300025961 | Ga0207712_10150472 | Ga0207712_101504722 | 248 |
| 406 | 3300025972 | Ga0207668_10410868 | Ga0207668_104108682 | 248 |
| 407 | 3300025981 | Ga0207640_10171174 | Ga0207640_101711742 | 248 |
| 408 | 3300025986 | Ga0207658_10418137 | Ga0207658_104181372 | 248 |
| 409 | 3300026023 | Ga0207677_10065980 | Ga0207677_100659802 | 248 |
| 410 | 3300026035 | Ga0207703_10023848 | Ga0207703_100238482 | 248 |
| 411 | 3300026041 | Ga0207639_10534069 | Ga0207639_105340692 | 248 |
| 412 | 3300026067 | Ga0207678_10058032 | Ga0207678_100580323 | 248 |
| 413 | 3300026075 | Ga0207708_10001624 | Ga0207708_1000162410 | 248 |
| 414 | 3300026078 | Ga0207702_10507337 | Ga0207702_105073372 | 248 |
| 415 | 3300026089 | Ga0207648_10000390 | Ga0207648_100003903 | 248 |
| 416 | 3300026095 | Ga0207676_10016105 | Ga0207676_100161053 | 248 |
| 417 | 3300026116 | Ga0207674_10094836 | Ga0207674_100948362 | 248 |
| 418 | 3300026118 | Ga0207675_100001090 | Ga0207675_1000010903 | 248 |
| 419 | 3300026121 | Ga0207683_10003939 | Ga0207683_100039393 | 248 |
| 420 | 3300027907 | Ga0207428_10066465 | Ga0207428_100664653 | 248 |
| 421 | 3300028379 | Ga0268266_10038124 | Ga0268266_100381245 | 248 |
| 422 | 3300028380 | Ga0268265_10594543 | Ga0268265_105945432 | 248 |
| 423 | 3300028381 | Ga0268264_10031479 | Ga0268264_100314796 | 248 |
| 424 | 3300028794 | Ga0307515_10000636 | Ga0307515_100006367 | 248 |
| 425 | 3300035170 | Ga0373943_0238225 | Ga0373943_0238225_181_954 | 248 |
| 426 | 3300037068 | Ga0373925_0158233 | Ga0373925_0158233_469_1242 | 248 |
| 427 | 3300046615 | Ga0495656_0070161 | Ga0495656_0070161_434_1243 | 248 |
| 428 | 3300048090 | Ga0495615_0013716 | Ga0495615_0013716_700_1509 | 248 |
| 429 | 3300048903 | Ga0496100_0026719 | Ga0496100_0026719_1675_2448 | 248 |
| 430 | 3300048904 | Ga0496101_0011376 | Ga0496101_0011376_3288_4061 | 248 |
| 431 | 3300048905 | Ga0496102_0130122 | Ga0496102_0130122_1281_2054 | 248 |
| 432 | 3300048907 | Ga0496104_0008355 | Ga0496104_0008355_3318_4091 | 248 |
| 433 | 3300048910 | Ga0496107_0020418 | Ga0496107_0020418_2988_3761 | 248 |
| 434 | 3300048911 | Ga0496108_0182308 | Ga0496108_0182308_392_1165 | 248 |
| 435 | 3300048912 | Ga0496109_0020842 | Ga0496109_0020842_1561_2334 | 248 |
| 436 | 3300048913 | Ga0496110_0042347 | Ga0496110_0042347_2862_3635 | 248 |
| 437 | 3300048914 | Ga0496111_0148208 | Ga0496111_0148208_196_969 | 248 |
| 438 | 3300048917 | Ga0496114_0189620 | Ga0496114_0189620_14_787 | 248 |
| 439 | 3300050511 | nmdc:mga08y16_67091_c1 | nmdc:mga08y16_67091_c1_834_1607 | 248 |
| 440 | 3300053125 | Ga0500618_001056 | Ga0500618_001056_6804_7589 | 248 |
| 441 | 3300046558 | Ga0495633_0000063 | Ga0495633_0000063_81589_82356 | 249 |
| 442 | iso_pu_bacteria | 2582581306 | 2585268675 | 249 |
| 443 | iso_pu_bacteria | 2834578030 | 2834581435 | 249 |
| 444 | 3300005354 | Ga0070675_100126767 | Ga0070675_1001267672 | 250 |
| 445 | 3300005356 | Ga0070674_100035925 | Ga0070674_1000359252 | 250 |
| 446 | 3300005456 | Ga0070678_100124312 | Ga0070678_1001243123 | 250 |
| 447 | 3300005456 | Ga0070678_100166376 | Ga0070678_1001663762 | 250 |
| 448 | 3300005459 | Ga0068867_100287337 | Ga0068867_1002873372 | 250 |
| 449 | 3300005548 | Ga0070665_100409078 | Ga0070665_1004090782 | 250 |
| 450 | 3300014497 | Ga0182008_10003543 | Ga0182008_100035435 | 250 |
| 451 | 3300015262 | Ga0182007_10001188 | Ga0182007_100011887 | 250 |
| 452 | 3300025893 | Ga0207682_10011631 | Ga0207682_100116313 | 250 |
| 453 | 3300025926 | Ga0207659_10173163 | Ga0207659_101731632 | 250 |
| 454 | 3300025931 | Ga0207644_10125641 | Ga0207644_101256412 | 250 |
| 455 | 3300025940 | Ga0207691_10056674 | Ga0207691_100566742 | 250 |
| 456 | 3300025960 | Ga0207651_10159515 | Ga0207651_101595152 | 250 |
| 457 | 3300026089 | Ga0207648_10047851 | Ga0207648_100478514 | 250 |
| 458 | 3300026121 | Ga0207683_10002061 | Ga0207683_100020613 | 250 |
| 459 | 3300026121 | Ga0207683_10041267 | Ga0207683_100412671 | 250 |
| 460 | 3300031251 | Ga0265327_10007017 | Ga0265327_100070176 | 250 |
| 461 | 3300048916 | Ga0496113_0354671 | Ga0496113_0354671_330_1100 | 250 |
| 462 | iso_pu_bacteria | 2721755755 | 2723846699 | 250 |
| 463 | iso_pu_bacteria | 2857524615 | 2857525209 | 250 |
| 464 | iso_pu_bacteria | 2884298095 | 2884299123 | 250 |
| 465 | iso_pu_bacteria | 2893066018 | 2893069597 | 250 |
| 466 | iso_pu_bacteria | 2899275550 | 2899277389 | 250 |
| 467 | 3300046522 | Ga0495643_0014725 | Ga0495643_0014725_606_1379 | 251 |
| 468 | 3300046528 | Ga0495642_0008919 | Ga0495642_0008919_2526_3299 | 251 |
| 469 | 3300046665 | Ga0495661_0038474 | Ga0495661_0038474_236_1009 | 251 |
| 470 | iso_pu_bacteria | 2508501122 | 2509110329 | 251 |
| 471 | iso_pu_bacteria | 2510917028 | 2511185925 | 251 |
| 472 | iso_pu_bacteria | 2582581294 | 2585204755 | 251 |
| 473 | iso_pu_bacteria | 2582581316 | 2585334916 | 251 |
| 474 | iso_pu_bacteria | 2582581867 | 2585401313 | 251 |
| 475 | iso_pu_bacteria | 2585427590 | 2585821539 | 251 |
| 476 | iso_pu_bacteria | 2643221736 | 2644744117 | 251 |
| 477 | iso_pu_bacteria | 2775506902 | 2776267829 | 251 |
| 478 | iso_pu_bacteria | 2775506904 | 2776281800 | 251 |
| 479 | iso_pu_bacteria | 2791355082 | 2792583566 | 251 |
| 480 | iso_pu_bacteria | 2808606387 | 2808990081 | 251 |
| 481 | iso_pu_bacteria | 2824617872 | 2824618573 | 251 |
| 482 | iso_pu_bacteria | 2824626560 | 2824627212 | 251 |
| 483 | iso_pu_bacteria | 2824635225 | 2824635572 | 251 |
| 484 | iso_pu_bacteria | 2824644064 | 2824644408 | 251 |
| 485 | iso_pu_bacteria | 2824714736 | 2824719069 | 251 |
| 486 | iso_pu_bacteria | 2824723954 | 2824725537 | 251 |
| 487 | iso_pu_bacteria | 2841760612 | 2841766020 | 251 |
| 488 | iso_pu_bacteria | 2844104063 | 2844105786 | 251 |
| 489 | iso_pu_bacteria | 2851182111 | 2851187650 | 251 |
| 490 | iso_pu_bacteria | 2851246043 | 2851246142 | 251 |
| 491 | iso_pu_bacteria | 8049293176 | 8049297946 | 251 |
| 492 | iso_pu_bacteria | 8057529695 | 8057531807 | 251 |
| 493 | 3300002773 | JGI25152J39213_1020028 | JGI25152J39213_10200281 | 252 |
| 494 | 3300003187 | JGI25151J46595_10000697 | JGI25151J46595_1000069713 | 252 |
| 495 | 3300025258 | Ga0209129_1000788 | Ga0209129_100078819 | 252 |
| 496 | 3300025294 | Ga0209025_1001354 | Ga0209025_100135419 | 252 |
| 497 | 3300031649 | Ga0307514_10002611 | Ga0307514_100026116 | 252 |
| 498 | 3300050489 | nmdc:mga03683_28853_c1 | nmdc:mga03683_28853_c1_1417_2199 | 252 |
| 499 | 3300050496 | nmdc:mga07m45_39299_c1 | nmdc:mga07m45_39299_c1_1658_2440 | 252 |
| 500 | iso_pu_bacteria | 2513237087 | 2513593396 | 252 |
| 501 | 3300005434 | Ga0070709_10481325 | Ga0070709_104813252 | 253 |
| 502 | 3300006871 | Ga0075434_100189166 | Ga0075434_1001891661 | 253 |
| 503 | 3300009147 | Ga0114129_11222167 | Ga0114129_112221672 | 253 |
| 504 | 3300050491 | nmdc:mga00v17_31_c1 | nmdc:mga00v17_31_c1_68247_69035 | 253 |
| 505 | 3300005327 | Ga0070658_10012053 | Ga0070658_100120534 | 254 |
| 506 | 3300005327 | Ga0070658_10222047 | Ga0070658_102220472 | 254 |
| 507 | 3300005336 | Ga0070680_100001410 | Ga0070680_10000141014 | 254 |
| 508 | 3300005336 | Ga0070680_100061649 | Ga0070680_1000616492 | 254 |
| 509 | 3300005339 | Ga0070660_100007654 | Ga0070660_1000076545 | 254 |
| 510 | 3300005344 | Ga0070661_100066713 | Ga0070661_1000667133 | 254 |
| 511 | 3300005366 | Ga0070659_100276957 | Ga0070659_1002769572 | 254 |
| 512 | 3300005458 | Ga0070681_10047543 | Ga0070681_100475433 | 254 |
| 513 | 3300005530 | Ga0070679_100028477 | Ga0070679_1000284774 | 254 |
| 514 | 3300005530 | Ga0070679_100305833 | Ga0070679_1003058332 | 254 |
| 515 | 3300005614 | Ga0068856_100280568 | Ga0068856_1002805682 | 254 |
| 516 | 3300005616 | Ga0068852_100193731 | Ga0068852_1001937313 | 254 |
| 517 | 3300005937 | Ga0081455_10009294 | Ga0081455_100092942 | 254 |
| 518 | 3300006038 | Ga0075365_10008924 | Ga0075365_100089246 | 254 |
| 519 | 3300006175 | Ga0070712_100028977 | Ga0070712_1000289772 | 254 |
| 520 | 3300006844 | Ga0075428_100648358 | Ga0075428_1006483581 | 254 |
| 521 | 3300006847 | Ga0075431_100138863 | Ga0075431_1001388632 | 254 |
| 522 | 3300009093 | Ga0105240_10038568 | Ga0105240_100385684 | 254 |
| 523 | 3300009093 | Ga0105240_10513008 | Ga0105240_105130082 | 254 |
| 524 | 3300009147 | Ga0114129_10436698 | Ga0114129_104366982 | 254 |
| 525 | 3300013102 | Ga0157371_10081856 | Ga0157371_100818562 | 254 |
| 526 | 3300020082 | Ga0206353_10740853 | Ga0206353_107408534 | 254 |
| 527 | 3300025909 | Ga0207705_10187659 | Ga0207705_101876592 | 254 |
| 528 | 3300025909 | Ga0207705_10341375 | Ga0207705_103413752 | 254 |
| 529 | 3300025912 | Ga0207707_10335447 | Ga0207707_103354471 | 254 |
| 530 | 3300025915 | Ga0207693_10042367 | Ga0207693_100423672 | 254 |
| 531 | 3300025917 | Ga0207660_10040473 | Ga0207660_100404733 | 254 |
| 532 | 3300025917 | Ga0207660_10080698 | Ga0207660_100806982 | 254 |
| 533 | 3300025920 | Ga0207649_10133613 | Ga0207649_101336132 | 254 |
| 534 | 3300025921 | Ga0207652_10028460 | Ga0207652_100284605 | 254 |
| 535 | 3300025949 | Ga0207667_10229732 | Ga0207667_102297322 | 254 |
| 536 | 3300025949 | Ga0207667_10258639 | Ga0207667_102586392 | 254 |
| 537 | 3300026142 | Ga0207698_10042937 | Ga0207698_100429374 | 254 |
| 538 | 3300031595 | Ga0265313_10012769 | Ga0265313_100127694 | 254 |
| 539 | 3300031665 | Ga0316575_10084681 | Ga0316575_100846812 | 254 |
| 540 | 3300031712 | Ga0265342_10000319 | Ga0265342_1000031927 | 254 |
| 541 | 3300032133 | Ga0316583_10002868 | Ga0316583_100028684 | 254 |
| 542 | 3300037471 | Ga0395905_0069654 | Ga0395905_0069654_1331_2122 | 254 |
| 543 | 3300046460 | Ga0495638_0001151 | Ga0495638_0001151_23043_23825 | 254 |
| 544 | 3300046501 | Ga0495607_0098141 | Ga0495607_0098141_69_851 | 254 |
| 545 | 3300046524 | Ga0495648_0160294 | Ga0495648_0160294_310_1092 | 254 |
| 546 | 3300046660 | Ga0495625_0011610 | Ga0495625_0011610_2286_3068 | 254 |
| 547 | 3300048903 | Ga0496100_0256854 | Ga0496100_0256854_168_950 | 254 |
| 548 | 3300048910 | Ga0496107_0088609 | Ga0496107_0088609_10_792 | 254 |
| 549 | 3300048920 | Ga0496117_0008368 | Ga0496117_0008368_1996_2778 | 254 |
| 550 | 3300048921 | Ga0496118_0008003 | Ga0496118_0008003_1823_2605 | 254 |
| 551 | 3300048924 | Ga0496121_0000643 | Ga0496121_0000643_3577_4359 | 254 |
| 552 | 3300048924 | Ga0496121_0059299 | Ga0496121_0059299_811_1593 | 254 |
| 553 | 3300048929 | Ga0496126_0365379 | Ga0496126_0365379_116_898 | 254 |
| 554 | 3300049581 | Ga0501047_0005106 | Ga0501047_0005106_3621_4403 | 254 |
| 555 | 3300049581 | Ga0501047_0119207 | Ga0501047_0119207_974_1756 | 254 |
| 556 | 3300049742 | Ga0501080_0556852 | Ga0501080_0556852_107_889 | 254 |
| 557 | 3300049823 | Ga0501044_0079274 | Ga0501044_0079274_19_801 | 254 |
| 558 | 3300050492 | nmdc:mga0yw44_186330_c1 | nmdc:mga0yw44_186330_c1_270_1052 | 254 |
| 559 | 3300050509 | nmdc:mga0qj67_92854_c1 | nmdc:mga0qj67_92854_c1_1362_2144 | 254 |
| 560 | 3300050510 | nmdc:mga06r32_173575_c1 | nmdc:mga06r32_173575_c1_1324_2106 | 254 |
| 561 | 3300053094 | Ga0500566_0011276 | Ga0500566_0011276_1682_2464 | 254 |
| 562 | 3300053098 | Ga0500650_0000958 | Ga0500650_0000958_1999_2781 | 254 |
| 563 | 3300053108 | Ga0500562_005421 | Ga0500562_005421_1848_2630 | 254 |
| 564 | 3300053122 | Ga0500608_018675 | Ga0500608_018675_1033_1815 | 254 |
| 565 | 3300053125 | Ga0500618_024229 | Ga0500618_024229_559_1341 | 254 |
| 566 | 3300053136 | Ga0500559_0000932 | Ga0500559_0000932_16739_17521 | 254 |
| 567 | 3300053139 | Ga0500568_0002600 | Ga0500568_0002600_7146_7928 | 254 |
| 568 | 3300053148 | Ga0500590_049704 | Ga0500590_049704_53_835 | 254 |
| 569 | 3300053153 | Ga0500616_0000033 | Ga0500616_0000033_237162_237944 | 254 |
| 570 | 3300053156 | Ga0500622_0000073 | Ga0500622_0000073_91900_92682 | 254 |
| 571 | 3300053177 | Ga0500636_0000712 | Ga0500636_0000712_8370_9152 | 254 |
| 572 | 3300053730 | Ga0500645_044128 | Ga0500645_044128_434_1216 | 254 |
| 573 | 3300003775 | Ga0055524_1000064 | Ga0055524_100006431 | 255 |
| 574 | 3300003790 | Ga0055528_1007814 | Ga0055528_10078143 | 255 |
| 575 | 3300005347 | Ga0070668_100267347 | Ga0070668_1002673472 | 255 |
| 576 | 3300005434 | Ga0070709_10005422 | Ga0070709_100054222 | 255 |
| 577 | 3300005435 | Ga0070714_100033057 | Ga0070714_1000330572 | 255 |
| 578 | 3300005435 | Ga0070714_100108474 | Ga0070714_1001084742 | 255 |
| 579 | 3300005437 | Ga0070710_10088122 | Ga0070710_100881222 | 255 |
| 580 | 3300005437 | Ga0070710_10205431 | Ga0070710_102054312 | 255 |
| 581 | 3300005455 | Ga0070663_100251573 | Ga0070663_1002515731 | 255 |
| 582 | 3300005467 | Ga0070706_100197283 | Ga0070706_1001972832 | 255 |
| 583 | 3300005468 | Ga0070707_100332348 | Ga0070707_1003323482 | 255 |
| 584 | 3300005471 | Ga0070698_100130523 | Ga0070698_1001305232 | 255 |
| 585 | 3300005536 | Ga0070697_100620514 | Ga0070697_1006205141 | 255 |
| 586 | 3300005937 | Ga0081455_10000858 | Ga0081455_1000085812 | 255 |
| 587 | 3300005983 | Ga0081540_1003099 | Ga0081540_10030994 | 255 |
| 588 | 3300006028 | Ga0070717_10081002 | Ga0070717_100810022 | 255 |
| 589 | 3300006048 | Ga0075363_100007861 | Ga0075363_1000078614 | 255 |
| 590 | 3300006163 | Ga0070715_10000623 | Ga0070715_100006237 | 255 |
| 591 | 3300006163 | Ga0070715_10054022 | Ga0070715_100540223 | 255 |
| 592 | 3300006173 | Ga0070716_100314000 | Ga0070716_1003140002 | 255 |
| 593 | 3300006844 | Ga0075428_100056055 | Ga0075428_1000560553 | 255 |
| 594 | 3300006844 | Ga0075428_100199973 | Ga0075428_1001999732 | 255 |
| 595 | 3300006852 | Ga0075433_10145154 | Ga0075433_101451542 | 255 |
| 596 | 3300006871 | Ga0075434_100257538 | Ga0075434_1002575382 | 255 |
| 597 | 3300006871 | Ga0075434_100314024 | Ga0075434_1003140242 | 255 |
| 598 | 3300007076 | Ga0075435_100136866 | Ga0075435_1001368662 | 255 |
| 599 | 3300009147 | Ga0114129_10088583 | Ga0114129_100885833 | 255 |
| 600 | 3300009147 | Ga0114129_10120940 | Ga0114129_101209403 | 255 |
| 601 | 3300009177 | Ga0105248_10104607 | Ga0105248_101046072 | 255 |
| 602 | 3300011119 | Ga0105246_10361447 | Ga0105246_103614472 | 255 |
| 603 | 3300021321 | Ga0214542_1000092 | Ga0214542_1000092102 | 255 |
| 604 | 3300021327 | Ga0214543_1000045 | Ga0214543_1000045134 | 255 |
| 605 | 3300025273 | Ga0209673_1001311 | Ga0209673_10013113 | 255 |
| 606 | 3300025291 | Ga0209675_1000448 | Ga0209675_100044817 | 255 |
| 607 | 3300025295 | Ga0209564_1000048 | Ga0209564_100004899 | 255 |
| 608 | 3300025295 | Ga0209564_1017756 | Ga0209564_10177562 | 255 |
| 609 | 3300025299 | Ga0209256_1000041 | Ga0209256_100004199 | 255 |
| 610 | 3300025299 | Ga0209256_1028313 | Ga0209256_10283132 | 255 |
| 611 | 3300025906 | Ga0207699_10145029 | Ga0207699_101450292 | 255 |
| 612 | 3300025910 | Ga0207684_10006570 | Ga0207684_100065707 | 255 |
| 613 | 3300025910 | Ga0207684_10009005 | Ga0207684_100090052 | 255 |
| 614 | 3300025910 | Ga0207684_10025930 | Ga0207684_100259305 | 255 |
| 615 | 3300025928 | Ga0207700_10146696 | Ga0207700_101466962 | 255 |
| 616 | 3300025929 | Ga0207664_10168031 | Ga0207664_101680312 | 255 |
| 617 | 3300025939 | Ga0207665_10051482 | Ga0207665_100514822 | 255 |
| 618 | 3300025939 | Ga0207665_10069347 | Ga0207665_100693472 | 255 |
| 619 | 3300028794 | Ga0307515_10050958 | Ga0307515_100509584 | 255 |
| 620 | 3300031456 | Ga0307513_10049621 | Ga0307513_100496214 | 255 |
| 621 | 3300037466 | Ga0395898_0114153 | Ga0395898_0114153_765_1550 | 255 |
| 622 | 3300037471 | Ga0395905_0208565 | Ga0395905_0208565_295_1080 | 255 |
| 623 | 3300046515 | Ga0495620_0029039 | Ga0495620_0029039_539_1324 | 255 |
| 624 | 3300048903 | Ga0496100_0280340 | Ga0496100_0280340_307_1092 | 255 |
| 625 | 3300048904 | Ga0496101_0482904 | Ga0496101_0482904_150_935 | 255 |
| 626 | 3300048905 | Ga0496102_0278265 | Ga0496102_0278265_668_1453 | 255 |
| 627 | 3300048905 | Ga0496102_0304938 | Ga0496102_0304938_271_1056 | 255 |
| 628 | 3300048907 | Ga0496104_0083212 | Ga0496104_0083212_573_1358 | 255 |
| 629 | 3300048907 | Ga0496104_0086082 | Ga0496104_0086082_1970_2755 | 255 |
| 630 | 3300048908 | Ga0496105_0027920 | Ga0496105_0027920_3669_4454 | 255 |
| 631 | 3300048909 | Ga0496106_0080140 | Ga0496106_0080140_811_1596 | 255 |
| 632 | 3300048909 | Ga0496106_0203361 | Ga0496106_0203361_605_1390 | 255 |
| 633 | 3300048910 | Ga0496107_0165338 | Ga0496107_0165338_229_1014 | 255 |
| 634 | 3300048910 | Ga0496107_0388727 | Ga0496107_0388727_65_850 | 255 |
| 635 | 3300048911 | Ga0496108_0162035 | Ga0496108_0162035_933_1718 | 255 |
| 636 | 3300048912 | Ga0496109_0213456 | Ga0496109_0213456_601_1401 | 255 |
| 637 | 3300048913 | Ga0496110_0011459 | Ga0496110_0011459_5380_6165 | 255 |
| 638 | 3300048913 | Ga0496110_0112651 | Ga0496110_0112651_1374_2159 | 255 |
| 639 | 3300048914 | Ga0496111_0041058 | Ga0496111_0041058_2121_2906 | 255 |
| 640 | 3300048914 | Ga0496111_0156803 | Ga0496111_0156803_121_906 | 255 |
| 641 | 3300048915 | Ga0496112_0053484 | Ga0496112_0053484_2309_3094 | 255 |
| 642 | 3300048915 | Ga0496112_0075196 | Ga0496112_0075196_70_855 | 255 |
| 643 | 3300048916 | Ga0496113_0036308 | Ga0496113_0036308_831_1616 | 255 |
| 644 | 3300048916 | Ga0496113_0153801 | Ga0496113_0153801_479_1264 | 255 |
| 645 | 3300048916 | Ga0496113_0580105 | Ga0496113_0580105_79_864 | 255 |
| 646 | 3300048918 | Ga0496115_0172643 | Ga0496115_0172643_304_1089 | 255 |
| 647 | 3300048918 | Ga0496115_0477898 | Ga0496115_0477898_52_837 | 255 |
| 648 | 3300048925 | Ga0496122_0170271 | Ga0496122_0170271_180_965 | 255 |
| 649 | 3300048927 | Ga0496124_0498302 | Ga0496124_0498302_20_805 | 255 |
| 650 | 3300048928 | Ga0496125_0047289 | Ga0496125_0047289_2696_3481 | 255 |
| 651 | 3300049582 | Ga0501048_0426245 | Ga0501048_0426245_143_928 | 255 |
| 652 | 3300050492 | nmdc:mga0yw44_18397_c1 | nmdc:mga0yw44_18397_c1_601_1386 | 255 |
| 653 | 3300050507 | nmdc:mga05p37_276593_c1 | nmdc:mga05p37_276593_c1_346_1131 | 255 |
| 654 | 3300050512 | nmdc:mga0n895_137616_c1 | nmdc:mga0n895_137616_c1_859_1644 | 255 |
| 655 | 3300050513 | nmdc:mga0rr50_91735_c1 | nmdc:mga0rr50_91735_c1_1090_1875 | 255 |
| 656 | 3300050515 | nmdc:mga0a205_318146_c1 | nmdc:mga0a205_318146_c1_199_984 | 255 |
| 657 | 3300050516 | nmdc:mga0sz30_22184_c1 | nmdc:mga0sz30_22184_c1_1038_1823 | 255 |
| 658 | 3300053177 | Ga0500636_0069941 | Ga0500636_0069941_337_1122 | 255 |
| 659 | 2209111006 | 2214544908 | 2213593100 | 256 |
| 660 | 3300000041 | ARcpr5oldR_c000009 | ARcpr5oldR_00000923 | 256 |
| 661 | 3300000042 | ARSoilYngRDRAFT_c00030 | ARSoilYngRDRAFT_0003018 | 256 |
| 662 | 3300000043 | ARcpr5yngRDRAFT_c000008 | ARcpr5yngRDRAFT_00000818 | 256 |
| 663 | 3300000044 | ARSoilOldRDRAFT_c000009 | ARSoilOldRDRAFT_00000919 | 256 |
| 664 | 3300000045 | ARCol0oldRDRAFT_c00009 | ARCol0oldRDRAFT_000097 | 256 |
| 665 | 3300000652 | ARCol0yngRDRAFT_1000008 | ARCol0yngRDRAFT_100000829 | 256 |
| 666 | 3300003215 | JGI25153J46596_10003791 | JGI25153J46596_100037916 | 256 |
| 667 | 3300005277 | Ga0065716_1001541 | Ga0065716_10015414 | 256 |
| 668 | 3300005289 | Ga0065704_10070953 | Ga0065704_100709536 | 256 |
| 669 | 3300005290 | Ga0065712_10074587 | Ga0065712_100745873 | 256 |
| 670 | 3300005295 | Ga0065707_10095129 | Ga0065707_100951293 | 256 |
| 671 | 3300005330 | Ga0070690_100031226 | Ga0070690_1000312264 | 256 |
| 672 | 3300005331 | Ga0070670_100489277 | Ga0070670_1004892771 | 256 |
| 673 | 3300005333 | Ga0070677_10051133 | Ga0070677_100511332 | 256 |
| 674 | 3300005335 | Ga0070666_10200436 | Ga0070666_102004362 | 256 |
| 675 | 3300005336 | Ga0070680_100197201 | Ga0070680_1001972012 | 256 |
| 676 | 3300005336 | Ga0070680_100441619 | Ga0070680_1004416192 | 256 |
| 677 | 3300005337 | Ga0070682_100085926 | Ga0070682_1000859262 | 256 |
| 678 | 3300005338 | Ga0068868_100197794 | Ga0068868_1001977942 | 256 |
| 679 | 3300005339 | Ga0070660_100001593 | Ga0070660_1000015935 | 256 |
| 680 | 3300005340 | Ga0070689_100031795 | Ga0070689_1000317952 | 256 |
| 681 | 3300005340 | Ga0070689_100641144 | Ga0070689_1006411441 | 256 |
| 682 | 3300005343 | Ga0070687_100070207 | Ga0070687_1000702072 | 256 |
| 683 | 3300005345 | Ga0070692_10020011 | Ga0070692_100200114 | 256 |
| 684 | 3300005347 | Ga0070668_100038614 | Ga0070668_1000386144 | 256 |
| 685 | 3300005353 | Ga0070669_100007294 | Ga0070669_1000072945 | 256 |
| 686 | 3300005353 | Ga0070669_100332861 | Ga0070669_1003328612 | 256 |
| 687 | 3300005355 | Ga0070671_100010470 | Ga0070671_1000104708 | 256 |
| 688 | 3300005356 | Ga0070674_100030100 | Ga0070674_1000301002 | 256 |
| 689 | 3300005356 | Ga0070674_100092683 | Ga0070674_1000926832 | 256 |
| 690 | 3300005365 | Ga0070688_100023242 | Ga0070688_1000232424 | 256 |
| 691 | 3300005366 | Ga0070659_100225823 | Ga0070659_1002258232 | 256 |
| 692 | 3300005366 | Ga0070659_100283983 | Ga0070659_1002839832 | 256 |
| 693 | 3300005367 | Ga0070667_100009854 | Ga0070667_1000098545 | 256 |
| 694 | 3300005436 | Ga0070713_100099724 | Ga0070713_1000997243 | 256 |
| 695 | 3300005437 | Ga0070710_10078595 | Ga0070710_100785952 | 256 |
| 696 | 3300005438 | Ga0070701_10039584 | Ga0070701_100395842 | 256 |
| 697 | 3300005438 | Ga0070701_10145612 | Ga0070701_101456122 | 256 |
| 698 | 3300005441 | Ga0070700_100243382 | Ga0070700_1002433822 | 256 |
| 699 | 3300005444 | Ga0070694_100127084 | Ga0070694_1001270841 | 256 |
| 700 | 3300005455 | Ga0070663_100001521 | Ga0070663_1000015215 | 256 |
| 701 | 3300005456 | Ga0070678_100073746 | Ga0070678_1000737463 | 256 |
| 702 | 3300005466 | Ga0070685_10011463 | Ga0070685_100114634 | 256 |
| 703 | 3300005543 | Ga0070672_100206191 | Ga0070672_1002061912 | 256 |
| 704 | 3300005545 | Ga0070695_100120908 | Ga0070695_1001209082 | 256 |
| 705 | 3300005548 | Ga0070665_100002816 | Ga0070665_10000281611 | 256 |
| 706 | 3300005548 | Ga0070665_100478057 | Ga0070665_1004780572 | 256 |
| 707 | 3300005549 | Ga0070704_100127835 | Ga0070704_1001278352 | 256 |
| 708 | 3300005564 | Ga0070664_100198645 | Ga0070664_1001986452 | 256 |
| 709 | 3300005616 | Ga0068852_100166905 | Ga0068852_1001669052 | 256 |
| 710 | 3300005616 | Ga0068852_100463515 | Ga0068852_1004635152 | 256 |
| 711 | 3300005617 | Ga0068859_100036474 | Ga0068859_1000364744 | 256 |
| 712 | 3300005617 | Ga0068859_100252855 | Ga0068859_1002528552 | 256 |
| 713 | 3300005617 | Ga0068859_100680199 | Ga0068859_1006801992 | 256 |
| 714 | 3300005618 | Ga0068864_100008308 | Ga0068864_1000083086 | 256 |
| 715 | 3300005618 | Ga0068864_100029633 | Ga0068864_1000296332 | 256 |
| 716 | 3300005718 | Ga0068866_10031153 | Ga0068866_100311533 | 256 |
| 717 | 3300005719 | Ga0068861_100050735 | Ga0068861_1000507353 | 256 |
| 718 | 3300005834 | Ga0068851_10261404 | Ga0068851_102614042 | 256 |
| 719 | 3300005840 | Ga0068870_10057880 | Ga0068870_100578802 | 256 |
| 720 | 3300005841 | Ga0068863_100087926 | Ga0068863_1000879263 | 256 |
| 721 | 3300005842 | Ga0068858_100001279 | Ga0068858_10000127912 | 256 |
| 722 | 3300005842 | Ga0068858_100036464 | Ga0068858_1000364644 | 256 |
| 723 | 3300005843 | Ga0068860_100103357 | Ga0068860_1001033573 | 256 |
| 724 | 3300005843 | Ga0068860_100186511 | Ga0068860_1001865113 | 256 |
| 725 | 3300005844 | Ga0068862_100112390 | Ga0068862_1001123903 | 256 |
| 726 | 3300005937 | Ga0081455_10003340 | Ga0081455_1000334014 | 256 |
| 727 | 3300005981 | Ga0081538_10001857 | Ga0081538_100018575 | 256 |
| 728 | 3300005981 | Ga0081538_10034940 | Ga0081538_100349403 | 256 |
| 729 | 3300005983 | Ga0081540_1039591 | Ga0081540_10395912 | 256 |
| 730 | 3300006028 | Ga0070717_10450305 | Ga0070717_104503052 | 256 |
| 731 | 3300006038 | Ga0075365_10010677 | Ga0075365_100106772 | 256 |
| 732 | 3300006038 | Ga0075365_10043532 | Ga0075365_100435322 | 256 |
| 733 | 3300006038 | Ga0075365_10096405 | Ga0075365_100964053 | 256 |
| 734 | 3300006058 | Ga0075432_10050644 | Ga0075432_100506442 | 256 |
| 735 | 3300006163 | Ga0070715_10155350 | Ga0070715_101553502 | 256 |
| 736 | 3300006177 | Ga0075362_10030106 | Ga0075362_100301062 | 256 |
| 737 | 3300006178 | Ga0075367_10109898 | Ga0075367_101098982 | 256 |
| 738 | 3300006186 | Ga0075369_10085027 | Ga0075369_100850272 | 256 |
| 739 | 3300006237 | Ga0097621_100034889 | Ga0097621_1000348894 | 256 |
| 740 | 3300006237 | Ga0097621_100112776 | Ga0097621_1001127763 | 256 |
| 741 | 3300006353 | Ga0075370_10017813 | Ga0075370_100178133 | 256 |
| 742 | 3300006358 | Ga0068871_100059967 | Ga0068871_1000599672 | 256 |
| 743 | 3300006844 | Ga0075428_100045387 | Ga0075428_1000453873 | 256 |
| 744 | 3300006844 | Ga0075428_100471572 | Ga0075428_1004715722 | 256 |
| 745 | 3300006846 | Ga0075430_100017979 | Ga0075430_1000179795 | 256 |
| 746 | 3300006846 | Ga0075430_100098009 | Ga0075430_1000980093 | 256 |
| 747 | 3300006847 | Ga0075431_100001861 | Ga0075431_1000018617 | 256 |
| 748 | 3300006847 | Ga0075431_100058238 | Ga0075431_1000582383 | 256 |
| 749 | 3300006880 | Ga0075429_100001959 | Ga0075429_1000019597 | 256 |
| 750 | 3300006880 | Ga0075429_100054135 | Ga0075429_1000541354 | 256 |
| 751 | 3300006914 | Ga0075436_100414980 | Ga0075436_1004149801 | 256 |
| 752 | 3300006931 | Ga0097620_100036473 | Ga0097620_1000364734 | 256 |
| 753 | 3300006931 | Ga0097620_100252838 | Ga0097620_1002528382 | 256 |
| 754 | 3300006931 | Ga0097620_100680191 | Ga0097620_1006801912 | 256 |
| 755 | 3300009094 | Ga0111539_10003310 | Ga0111539_1000331013 | 256 |
| 756 | 3300009094 | Ga0111539_10232174 | Ga0111539_102321741 | 256 |
| 757 | 3300009094 | Ga0111539_10634047 | Ga0111539_106340472 | 256 |
| 758 | 3300009098 | Ga0105245_10000556 | Ga0105245_1000055625 | 256 |
| 759 | 3300009101 | Ga0105247_10000474 | Ga0105247_100004749 | 256 |
| 760 | 3300009101 | Ga0105247_10039961 | Ga0105247_100399612 | 256 |
| 761 | 3300009147 | Ga0114129_10000199 | Ga0114129_1000019913 | 256 |
| 762 | 3300009147 | Ga0114129_10085361 | Ga0114129_100853613 | 256 |
| 763 | 3300009174 | Ga0105241_10392172 | Ga0105241_103921722 | 256 |
| 764 | 3300009176 | Ga0105242_10011728 | Ga0105242_100117286 | 256 |
| 765 | 3300009177 | Ga0105248_10000873 | Ga0105248_1000087325 | 256 |
| 766 | 3300009177 | Ga0105248_10193366 | Ga0105248_101933663 | 256 |
| 767 | 3300009553 | Ga0105249_10429619 | Ga0105249_104296192 | 256 |
| 768 | 3300009553 | Ga0105249_10479340 | Ga0105249_104793402 | 256 |
| 769 | 3300011119 | Ga0105246_10000220 | Ga0105246_1000022011 | 256 |
| 770 | 3300013296 | Ga0157374_10000524 | Ga0157374_1000052426 | 256 |
| 771 | 3300013296 | Ga0157374_10325716 | Ga0157374_103257162 | 256 |
| 772 | 3300013297 | Ga0157378_10000591 | Ga0157378_1000059110 | 256 |
| 773 | 3300013306 | Ga0163162_10003457 | Ga0163162_100034573 | 256 |
| 774 | 3300013308 | Ga0157375_10001668 | Ga0157375_1000166810 | 256 |
| 775 | 3300014325 | Ga0163163_10015811 | Ga0163163_100158115 | 256 |
| 776 | 3300014325 | Ga0163163_10050183 | Ga0163163_100501834 | 256 |
| 777 | 3300014326 | Ga0157380_10138079 | Ga0157380_101380792 | 256 |
| 778 | 3300014745 | Ga0157377_10098137 | Ga0157377_100981372 | 256 |
| 779 | 3300014968 | Ga0157379_10000422 | Ga0157379_1000042211 | 256 |
| 780 | 3300014968 | Ga0157379_10034165 | Ga0157379_100341654 | 256 |
| 781 | 3300014968 | Ga0157379_10095356 | Ga0157379_100953562 | 256 |
| 782 | 3300014969 | Ga0157376_10000285 | Ga0157376_1000028511 | 256 |
| 783 | 3300014969 | Ga0157376_10225942 | Ga0157376_102259422 | 256 |
| 784 | 3300017792 | Ga0163161_10066341 | Ga0163161_100663413 | 256 |
| 785 | 3300025297 | Ga0209758_1000217 | Ga0209758_1000217115 | 256 |
| 786 | 3300025893 | Ga0207682_10089411 | Ga0207682_100894112 | 256 |
| 787 | 3300025899 | Ga0207642_10046978 | Ga0207642_100469782 | 256 |
| 788 | 3300025900 | Ga0207710_10000423 | Ga0207710_100004233 | 256 |
| 789 | 3300025901 | Ga0207688_10189841 | Ga0207688_101898412 | 256 |
| 790 | 3300025905 | Ga0207685_10077434 | Ga0207685_100774342 | 256 |
| 791 | 3300025908 | Ga0207643_10006425 | Ga0207643_100064254 | 256 |
| 792 | 3300025917 | Ga0207660_10273863 | Ga0207660_102738632 | 256 |
| 793 | 3300025918 | Ga0207662_10183060 | Ga0207662_101830602 | 256 |
| 794 | 3300025919 | Ga0207657_10043698 | Ga0207657_100436983 | 256 |
| 795 | 3300025923 | Ga0207681_10175867 | Ga0207681_101758672 | 256 |
| 796 | 3300025923 | Ga0207681_10192537 | Ga0207681_101925372 | 256 |
| 797 | 3300025925 | Ga0207650_10162264 | Ga0207650_101622642 | 256 |
| 798 | 3300025927 | Ga0207687_10001492 | Ga0207687_100014928 | 256 |
| 799 | 3300025932 | Ga0207690_10211940 | Ga0207690_102119402 | 256 |
| 800 | 3300025933 | Ga0207706_10037037 | Ga0207706_100370375 | 256 |
| 801 | 3300025934 | Ga0207686_10043990 | Ga0207686_100439903 | 256 |
| 802 | 3300025934 | Ga0207686_10127351 | Ga0207686_101273512 | 256 |
| 803 | 3300025936 | Ga0207670_10034893 | Ga0207670_100348934 | 256 |
| 804 | 3300025937 | Ga0207669_10230427 | Ga0207669_102304272 | 256 |
| 805 | 3300025940 | Ga0207691_10041637 | Ga0207691_100416373 | 256 |
| 806 | 3300025940 | Ga0207691_10106643 | Ga0207691_101066433 | 256 |
| 807 | 3300025941 | Ga0207711_10005965 | Ga0207711_100059652 | 256 |
| 808 | 3300025941 | Ga0207711_10154119 | Ga0207711_101541192 | 256 |
| 809 | 3300025942 | Ga0207689_10164184 | Ga0207689_101641842 | 256 |
| 810 | 3300025961 | Ga0207712_10022771 | Ga0207712_100227714 | 256 |
| 811 | 3300026023 | Ga0207677_10174422 | Ga0207677_101744222 | 256 |
| 812 | 3300026035 | Ga0207703_10070592 | Ga0207703_100705923 | 256 |
| 813 | 3300026095 | Ga0207676_10009516 | Ga0207676_100095164 | 256 |
| 814 | 3300026095 | Ga0207676_10016716 | Ga0207676_100167162 | 256 |
| 815 | 3300026116 | Ga0207674_10211351 | Ga0207674_102113512 | 256 |
| 816 | 3300026118 | Ga0207675_100015233 | Ga0207675_1000152335 | 256 |
| 817 | 3300026118 | Ga0207675_100219881 | Ga0207675_1002198813 | 256 |
| 818 | 3300026121 | Ga0207683_10024494 | Ga0207683_100244944 | 256 |
| 819 | 3300027907 | Ga0207428_10000666 | Ga0207428_1000066637 | 256 |
| 820 | 3300027907 | Ga0207428_10003318 | Ga0207428_100033186 | 256 |
| 821 | 3300028379 | Ga0268266_10001063 | Ga0268266_1000106325 | 256 |
| 822 | 3300028379 | Ga0268266_10258047 | Ga0268266_102580472 | 256 |
| 823 | 3300028380 | Ga0268265_10030511 | Ga0268265_100305113 | 256 |
| 824 | 3300028381 | Ga0268264_10501491 | Ga0268264_105014912 | 256 |
| 825 | 3300028556 | Ga0265337_1003658 | Ga0265337_10036587 | 256 |
| 826 | 3300031247 | Ga0265340_10033735 | Ga0265340_100337353 | 256 |
| 827 | 3300031249 | Ga0265339_10050492 | Ga0265339_100504922 | 256 |
| 828 | 3300031344 | Ga0265316_10127589 | Ga0265316_101275892 | 256 |
| 829 | 3300031665 | Ga0316575_10029884 | Ga0316575_100298843 | 256 |
| 830 | 3300031711 | Ga0265314_10003227 | Ga0265314_100032277 | 256 |
| 831 | 3300031727 | Ga0316576_10143503 | Ga0316576_101435032 | 256 |
| 832 | 3300034818 | Ga0373950_0005593 | Ga0373950_0005593_951_1745 | 256 |
| 833 | 3300035083 | Ga0373926_0059501 | Ga0373926_0059501_458_1246 | 256 |
| 834 | 3300035089 | Ga0373944_0003921 | Ga0373944_0003921_1335_2123 | 256 |
| 835 | 3300035089 | Ga0373944_0006052 | Ga0373944_0006052_127_918 | 256 |
| 836 | 3300035116 | Ga0373945_0008345 | Ga0373945_0008345_2369_3160 | 256 |
| 837 | 3300035117 | Ga0373953_0053110 | Ga0373953_0053110_75_863 | 256 |
| 838 | 3300035118 | Ga0373954_0016716 | Ga0373954_0016716_749_1537 | 256 |
| 839 | 3300035119 | Ga0373956_0020258 | Ga0373956_0020258_101_889 | 256 |
| 840 | 3300035170 | Ga0373943_0003784 | Ga0373943_0003784_4431_5222 | 256 |
| 841 | 3300035171 | Ga0373946_0006096 | Ga0373946_0006096_626_1417 | 256 |
| 842 | 3300035172 | Ga0373955_0001168 | Ga0373955_0001168_1376_2164 | 256 |
| 843 | 3300035691 | Ga0373931_0199774 | Ga0373931_0199774_375_1163 | 256 |
| 844 | 3300035692 | Ga0373935_0000678 | Ga0373935_0000678_33_824 | 256 |
| 845 | 3300035692 | Ga0373935_0393421 | Ga0373935_0393421_118_906 | 256 |
| 846 | 3300035695 | Ga0373927_0001937 | Ga0373927_0001937_16_804 | 256 |
| 847 | 3300035695 | Ga0373927_0013273 | Ga0373927_0013273_4266_5054 | 256 |
| 848 | 3300035695 | Ga0373927_0022549 | Ga0373927_0022549_1542_2330 | 256 |
| 849 | 3300035695 | Ga0373927_0026546 | Ga0373927_0026546_1167_1958 | 256 |
| 850 | 3300035724 | Ga0373933_0009768 | Ga0373933_0009768_3833_4621 | 256 |
| 851 | 3300035725 | Ga0373947_0000512 | Ga0373947_0000512_14500_15291 | 256 |
| 852 | 3300035725 | Ga0373947_0019543 | Ga0373947_0019543_1151_1939 | 256 |
| 853 | 3300035725 | Ga0373947_0030272 | Ga0373947_0030272_523_1311 | 256 |
| 854 | 3300035725 | Ga0373947_0053289 | Ga0373947_0053289_924_1712 | 256 |
| 855 | 3300036401 | Ga0373937_0015895 | Ga0373937_0015895_3340_4128 | 256 |
| 856 | 3300036401 | Ga0373937_0034948 | Ga0373937_0034948_850_1638 | 256 |
| 857 | 3300036401 | Ga0373937_0247000 | Ga0373937_0247000_87_884 | 256 |
| 858 | 3300036401 | Ga0373937_0734664 | Ga0373937_0734664_63_851 | 256 |
| 859 | 3300036647 | Ga0316582_0107213 | Ga0316582_0107213_579_1367 | 256 |
| 860 | 3300036712 | Ga0316584_0042274 | Ga0316584_0042274_2193_2981 | 256 |
| 861 | 3300037068 | Ga0373925_0009707 | Ga0373925_0009707_3713_4501 | 256 |
| 862 | 3300037068 | Ga0373925_0159201 | Ga0373925_0159201_174_962 | 256 |
| 863 | 3300037068 | Ga0373925_0183545 | Ga0373925_0183545_427_1215 | 256 |
| 864 | 3300044684 | Ga0466966_0038191 | Ga0466966_0038191_1965_2753 | 256 |
| 865 | 3300044719 | Ga0466971_0010404 | Ga0466971_0010404_3176_3964 | 256 |
| 866 | 3300045836 | Ga0466958_0013380 | Ga0466958_0013380_3226_4014 | 256 |
| 867 | 3300046455 | Ga0495603_0000910 | Ga0495603_0000910_2397_3188 | 256 |
| 868 | 3300046455 | Ga0495603_0051213 | Ga0495603_0051213_420_1208 | 256 |
| 869 | 3300046455 | Ga0495603_0282256 | Ga0495603_0282256_83_871 | 256 |
| 870 | 3300046459 | Ga0495629_0002174 | Ga0495629_0002174_1804_2595 | 256 |
| 871 | 3300046459 | Ga0495629_0095721 | Ga0495629_0095721_1016_1804 | 256 |
| 872 | 3300046461 | Ga0495641_0035838 | Ga0495641_0035838_697_1488 | 256 |
| 873 | 3300046461 | Ga0495641_0189111 | Ga0495641_0189111_24_812 | 256 |
| 874 | 3300046472 | Ga0495580_0038182 | Ga0495580_0038182_1141_1932 | 256 |
| 875 | 3300046473 | Ga0495582_0019547 | Ga0495582_0019547_942_1733 | 256 |
| 876 | 3300046474 | Ga0495605_0058646 | Ga0495605_0058646_530_1318 | 256 |
| 877 | 3300046475 | Ga0495639_0003104 | Ga0495639_0003104_6369_7157 | 256 |
| 878 | 3300046476 | Ga0495662_0031267 | Ga0495662_0031267_476_1267 | 256 |
| 879 | 3300046477 | Ga0495664_0114080 | Ga0495664_0114080_626_1417 | 256 |
| 880 | 3300046499 | Ga0495594_0068750 | Ga0495594_0068750_909_1697 | 256 |
| 881 | 3300046514 | Ga0495618_0003910 | Ga0495618_0003910_4684_5472 | 256 |
| 882 | 3300046514 | Ga0495618_0017334 | Ga0495618_0017334_560_1351 | 256 |
| 883 | 3300046515 | Ga0495620_0072615 | Ga0495620_0072615_586_1374 | 256 |
| 884 | 3300046517 | Ga0495630_0226645 | Ga0495630_0226645_117_908 | 256 |
| 885 | 3300046523 | Ga0495644_0046658 | Ga0495644_0046658_299_1087 | 256 |
| 886 | 3300046523 | Ga0495644_0130921 | Ga0495644_0130921_105_893 | 256 |
| 887 | 3300046525 | Ga0495663_0106013 | Ga0495663_0106013_33_821 | 256 |
| 888 | 3300046526 | Ga0495666_0030560 | Ga0495666_0030560_87_878 | 256 |
| 889 | 3300046529 | Ga0495652_0018938 | Ga0495652_0018938_2191_2982 | 256 |
| 890 | 3300046531 | Ga0495665_0003399 | Ga0495665_0003399_2455_3243 | 256 |
| 891 | 3300046531 | Ga0495665_0147992 | Ga0495665_0147992_110_901 | 256 |
| 892 | 3300046533 | Ga0495640_0001822 | Ga0495640_0001822_8783_9574 | 256 |
| 893 | 3300046533 | Ga0495640_0039926 | Ga0495640_0039926_929_1717 | 256 |
| 894 | 3300046535 | Ga0495586_0231095 | Ga0495586_0231095_159_950 | 256 |
| 895 | 3300046559 | Ga0495667_0072958 | Ga0495667_0072958_1110_1898 | 256 |
| 896 | 3300046642 | Ga0495634_0000688 | Ga0495634_0000688_9188_9979 | 256 |
| 897 | 3300046642 | Ga0495634_0017644 | Ga0495634_0017644_387_1175 | 256 |
| 898 | 3300046663 | Ga0495635_0105941 | Ga0495635_0105941_56_844 | 256 |
| 899 | 3300046663 | Ga0495635_0245286 | Ga0495635_0245286_58_849 | 256 |
| 900 | 3300046665 | Ga0495661_0105433 | Ga0495661_0105433_316_1104 | 256 |
| 901 | 3300046675 | Ga0495657_0110364 | Ga0495657_0110364_434_1222 | 256 |
| 902 | 3300046680 | Ga0495646_0048055 | Ga0495646_0048055_1345_2136 | 256 |
| 903 | 3300046681 | Ga0495647_0000251 | Ga0495647_0000251_1690_2481 | 256 |
| 904 | 3300046683 | Ga0495658_0009547 | Ga0495658_0009547_3511_4302 | 256 |
| 905 | 3300046683 | Ga0495658_0038260 | Ga0495658_0038260_300_1088 | 256 |
| 906 | 3300046683 | Ga0495658_0038764 | Ga0495658_0038764_572_1360 | 256 |
| 907 | 3300046683 | Ga0495658_0114976 | Ga0495658_0114976_765_1553 | 256 |
| 908 | 3300046689 | Ga0495613_0053053 | Ga0495613_0053053_896_1684 | 256 |
| 909 | 3300046689 | Ga0495613_0071912 | Ga0495613_0071912_625_1416 | 256 |
| 910 | 3300046689 | Ga0495613_0153073 | Ga0495613_0153073_240_1028 | 256 |
| 911 | 3300046690 | Ga0495624_0019040 | Ga0495624_0019040_205_993 | 256 |
| 912 | 3300046691 | Ga0495670_0184558 | Ga0495670_0184558_40_828 | 256 |
| 913 | 3300046692 | Ga0495671_0086299 | Ga0495671_0086299_656_1444 | 256 |
| 914 | 3300047315 | Ga0495581_0005554 | Ga0495581_0005554_124_912 | 256 |
| 915 | 3300047315 | Ga0495581_0042923 | Ga0495581_0042923_1296_2087 | 256 |
| 916 | 3300047317 | Ga0495604_0037852 | Ga0495604_0037852_1705_2493 | 256 |
| 917 | 3300047317 | Ga0495604_0063525 | Ga0495604_0063525_588_1379 | 256 |
| 918 | 3300047319 | Ga0495674_0001606 | Ga0495674_0001606_6894_7685 | 256 |
| 919 | 3300047319 | Ga0495674_0205282 | Ga0495674_0205282_528_1316 | 256 |
| 920 | 3300047319 | Ga0495674_0361115 | Ga0495674_0361115_313_1101 | 256 |
| 921 | 3300047319 | Ga0495674_0446745 | Ga0495674_0446745_111_899 | 256 |
| 922 | 3300047321 | Ga0495676_0001862 | Ga0495676_0001862_8971_9762 | 256 |
| 923 | 3300047322 | Ga0495680_0004830 | Ga0495680_0004830_11261_12049 | 256 |
| 924 | 3300047471 | Ga0495684_0001239 | Ga0495684_0001239_11023_11811 | 256 |
| 925 | 3300048088 | Ga0495602_0077707 | Ga0495602_0077707_1743_2531 | 256 |
| 926 | 3300048903 | Ga0496100_0000310 | Ga0496100_0000310_14075_14863 | 256 |
| 927 | 3300048903 | Ga0496100_0019395 | Ga0496100_0019395_2808_3596 | 256 |
| 928 | 3300048904 | Ga0496101_0000500 | Ga0496101_0000500_15758_16546 | 256 |
| 929 | 3300048904 | Ga0496101_0011880 | Ga0496101_0011880_2325_3113 | 256 |
| 930 | 3300048905 | Ga0496102_0000679 | Ga0496102_0000679_23769_24557 | 256 |
| 931 | 3300048905 | Ga0496102_0016989 | Ga0496102_0016989_2934_3722 | 256 |
| 932 | 3300048905 | Ga0496102_0050469 | Ga0496102_0050469_129_917 | 256 |
| 933 | 3300048905 | Ga0496102_0445213 | Ga0496102_0445213_79_909 | 256 |
| 934 | 3300048906 | Ga0496103_0000777 | Ga0496103_0000777_13506_14294 | 256 |
| 935 | 3300048906 | Ga0496103_0026169 | Ga0496103_0026169_1451_2239 | 256 |
| 936 | 3300048907 | Ga0496104_0000500 | Ga0496104_0000500_9252_10040 | 256 |
| 937 | 3300048907 | Ga0496104_0003660 | Ga0496104_0003660_5788_6618 | 256 |
| 938 | 3300048907 | Ga0496104_0007218 | Ga0496104_0007218_2365_3153 | 256 |
| 939 | 3300048907 | Ga0496104_0043116 | Ga0496104_0043116_480_1268 | 256 |
| 940 | 3300048907 | Ga0496104_0616958 | Ga0496104_0616958_87_875 | 256 |
| 941 | 3300048908 | Ga0496105_0000525 | Ga0496105_0000525_59_847 | 256 |
| 942 | 3300048908 | Ga0496105_0028263 | Ga0496105_0028263_2397_3185 | 256 |
| 943 | 3300048908 | Ga0496105_0140192 | Ga0496105_0140192_1031_1861 | 256 |
| 944 | 3300048909 | Ga0496106_0000323 | Ga0496106_0000323_9215_10003 | 256 |
| 945 | 3300048909 | Ga0496106_0023005 | Ga0496106_0023005_881_1669 | 256 |
| 946 | 3300048910 | Ga0496107_0003179 | Ga0496107_0003179_1578_2366 | 256 |
| 947 | 3300048911 | Ga0496108_0001888 | Ga0496108_0001888_6762_7550 | 256 |
| 948 | 3300048911 | Ga0496108_0032005 | Ga0496108_0032005_974_1762 | 256 |
| 949 | 3300048911 | Ga0496108_0107602 | Ga0496108_0107602_1530_2318 | 256 |
| 950 | 3300048912 | Ga0496109_0000493 | Ga0496109_0000493_9252_10040 | 256 |
| 951 | 3300048912 | Ga0496109_0026456 | Ga0496109_0026456_845_1633 | 256 |
| 952 | 3300048912 | Ga0496109_0073582 | Ga0496109_0073582_2272_3102 | 256 |
| 953 | 3300048912 | Ga0496109_0351492 | Ga0496109_0351492_70_858 | 256 |
| 954 | 3300048913 | Ga0496110_0003830 | Ga0496110_0003830_1600_2388 | 256 |
| 955 | 3300048913 | Ga0496110_0013354 | Ga0496110_0013354_761_1549 | 256 |
| 956 | 3300048914 | Ga0496111_0001343 | Ga0496111_0001343_9252_10040 | 256 |
| 957 | 3300048914 | Ga0496111_0016571 | Ga0496111_0016571_2824_3612 | 256 |
| 958 | 3300048915 | Ga0496112_0001321 | Ga0496112_0001321_1326_2114 | 256 |
| 959 | 3300048915 | Ga0496112_0011501 | Ga0496112_0011501_2449_3237 | 256 |
| 960 | 3300048916 | Ga0496113_0000869 | Ga0496113_0000869_9240_10028 | 256 |
| 961 | 3300048916 | Ga0496113_0009474 | Ga0496113_0009474_3981_4769 | 256 |
| 962 | 3300048916 | Ga0496113_0219364 | Ga0496113_0219364_682_1470 | 256 |
| 963 | 3300048917 | Ga0496114_0005594 | Ga0496114_0005594_7162_7950 | 256 |
| 964 | 3300048917 | Ga0496114_0073191 | Ga0496114_0073191_850_1638 | 256 |
| 965 | 3300048917 | Ga0496114_0181580 | Ga0496114_0181580_509_1339 | 256 |
| 966 | 3300048918 | Ga0496115_0001322 | Ga0496115_0001322_9606_10394 | 256 |
| 967 | 3300048918 | Ga0496115_0044026 | Ga0496115_0044026_769_1557 | 256 |
| 968 | 3300048918 | Ga0496115_0065754 | Ga0496115_0065754_793_1581 | 256 |
| 969 | 3300049568 | Ga0501031_0190025 | Ga0501031_0190025_77_865 | 256 |
| 970 | 3300049570 | Ga0501033_0086874 | Ga0501033_0086874_1425_2213 | 256 |
| 971 | 3300049571 | Ga0501034_0008051 | Ga0501034_0008051_4644_5432 | 256 |
| 972 | 3300049576 | Ga0501040_0335103 | Ga0501040_0335103_57_845 | 256 |
| 973 | 3300049583 | Ga0501067_0051323 | Ga0501067_0051323_1155_1943 | 256 |
| 974 | 3300049591 | Ga0501075_0364602 | Ga0501075_0364602_28_816 | 256 |
| 975 | 3300049741 | Ga0501079_0088355 | Ga0501079_0088355_625_1413 | 256 |
| 976 | 3300049823 | Ga0501044_0034557 | Ga0501044_0034557_3290_4078 | 256 |
| 977 | 3300049824 | Ga0501045_0156553 | Ga0501045_0156553_42_830 | 256 |
| 978 | 3300050491 | nmdc:mga00v17_130434_c1 | nmdc:mga00v17_130434_c1_381_1169 | 256 |
| 979 | 3300050492 | nmdc:mga0yw44_104652_c1 | nmdc:mga0yw44_104652_c1_967_1755 | 256 |
| 980 | 3300050492 | nmdc:mga0yw44_2715_c1 | nmdc:mga0yw44_2715_c1_413_1201 | 256 |
| 981 | 3300050496 | nmdc:mga07m45_279627_c1 | nmdc:mga07m45_279627_c1_68_856 | 256 |
| 982 | 3300050507 | nmdc:mga05p37_120842_c1 | nmdc:mga05p37_120842_c1_2229_3017 | 256 |
| 983 | 3300050507 | nmdc:mga05p37_383_c1 | nmdc:mga05p37_383_c1_33535_34323 | 256 |
| 984 | 3300050508 | nmdc:mga09592_274481_c1 | nmdc:mga09592_274481_c1_512_1300 | 256 |
| 985 | 3300050508 | nmdc:mga09592_4666_c1 | nmdc:mga09592_4666_c1_3791_4579 | 256 |
| 986 | 3300050508 | nmdc:mga09592_78098_c1 | nmdc:mga09592_78098_c1_380_1168 | 256 |
| 987 | 3300050509 | nmdc:mga0qj67_14148_c1 | nmdc:mga0qj67_14148_c1_1519_2307 | 256 |
| 988 | 3300050509 | nmdc:mga0qj67_61543_c1 | nmdc:mga0qj67_61543_c1_717_1505 | 256 |
| 989 | 3300050509 | nmdc:mga0qj67_72216_c1 | nmdc:mga0qj67_72216_c1_1783_2571 | 256 |
| 990 | 3300050510 | nmdc:mga06r32_711_c2 | nmdc:mga06r32_711_c2_9752_10540 | 256 |
| 991 | 3300050511 | nmdc:mga08y16_369_c1 | nmdc:mga08y16_369_c1_29622_30410 | 256 |
| 992 | 3300050512 | nmdc:mga0n895_36911_c1 | nmdc:mga0n895_36911_c1_689_1477 | 256 |
| 993 | 3300050515 | nmdc:mga0a205_135810_c1 | nmdc:mga0a205_135810_c1_1091_1879 | 256 |
| 994 | 3300053077 | Ga0495601_0000647 | Ga0495601_0000647_4889_5680 | 256 |
| 995 | 3300053077 | Ga0495601_0002386 | Ga0495601_0002386_5256_6044 | 256 |
| 996 | 3300053077 | Ga0495601_0063468 | Ga0495601_0063468_50_838 | 256 |
| 997 | 3300053078 | Ga0495612_0006165 | Ga0495612_0006165_1821_2609 | 256 |
| 998 | 3300053083 | Ga0495655_0024574 | Ga0495655_0024574_502_1290 | 256 |
| 999 | 3300053084 | Ga0495595_0000537 | Ga0495595_0000537_8456_9244 | 256 |
| 1000 | 3300053084 | Ga0495595_0097936 | Ga0495595_0097936_327_1115 | 256 |
| 1001 | 3300053084 | Ga0495595_0165472 | Ga0495595_0165472_196_987 | 256 |
| 1002 | 3300053085 | Ga0495619_0022151 | Ga0495619_0022151_728_1516 | 256 |
| 1003 | 3300053085 | Ga0495619_0029197 | Ga0495619_0029197_2146_2937 | 256 |
| 1004 | 3300053085 | Ga0495619_0041968 | Ga0495619_0041968_1428_2216 | 256 |
| 1005 | 3300054114 | Ga0501084_0404894 | Ga0501084_0404894_146_934 | 256 |
| 1006 | 3300061734 | Ga0530510_0140646 | Ga0530510_0140646_96_884 | 256 |
| 1007 | 3300005339 | Ga0070660_100234431 | Ga0070660_1002344312 | 257 |
| 1008 | 3300005366 | Ga0070659_100291966 | Ga0070659_1002919662 | 257 |
| 1009 | 3300006880 | Ga0075429_100299777 | Ga0075429_1002997771 | 257 |
| 1010 | 3300009147 | Ga0114129_10020933 | Ga0114129_100209332 | 257 |
| 1011 | 3300009177 | Ga0105248_10084018 | Ga0105248_100840183 | 257 |
| 1012 | 3300010375 | Ga0105239_10111018 | Ga0105239_101110183 | 257 |
| 1013 | 3300025981 | Ga0207640_10222185 | Ga0207640_102221852 | 257 |
| 1014 | 3300050508 | nmdc:mga09592_247433_c1 | nmdc:mga09592_247433_c1_672_1463 | 257 |
| 1015 | 3300050493 | nmdc:mga0k408_3653_c1 | nmdc:mga0k408_3653_c1_5425_6228 | 258 |
| 1016 | 2162886011 | MRS1b_contig_6977220 | MRS1b_0725.00002480 | 259 |
| 1017 | 3300009094 | Ga0111539_10000242 | Ga0111539_1000024226 | 259 |
| 1018 | 3300009553 | Ga0105249_10239323 | Ga0105249_102393232 | 259 |
| 1019 | 3300010375 | Ga0105239_10002642 | Ga0105239_100026426 | 259 |
| 1020 | 3300012483 | Ga0157337_1000858 | Ga0157337_10008581 | 259 |
| 1021 | 3300013306 | Ga0163162_10012895 | Ga0163162_100128954 | 259 |
| 1022 | 3300013308 | Ga0157375_10049059 | Ga0157375_100490594 | 259 |
| 1023 | 3300014326 | Ga0157380_10611902 | Ga0157380_106119022 | 259 |
| 1024 | 3300034816 | Ga0373930_0002705 | Ga0373930_0002705_1103_1900 | 259 |
| 1025 | 3300034817 | Ga0373948_0006564 | Ga0373948_0006564_85_882 | 259 |
| 1026 | 3300034957 | Ga0373938_0000049 | Ga0373938_0000049_2654_3451 | 259 |
| 1027 | 3300035084 | Ga0373928_0000021 | Ga0373928_0000021_850_1647 | 259 |
| 1028 | 3300035085 | Ga0373929_0000048 | Ga0373929_0000048_1735_2532 | 259 |
| 1029 | 3300035088 | Ga0373940_0000013 | Ga0373940_0000013_6872_7669 | 259 |
| 1030 | 3300035090 | Ga0373949_0000214 | Ga0373949_0000214_14324_15121 | 259 |
| 1031 | 3300035091 | Ga0373951_0000646 | Ga0373951_0000646_1474_2271 | 259 |
| 1032 | 3300035092 | Ga0373952_0000011 | Ga0373952_0000011_1536_2333 | 259 |
| 1033 | 3300035112 | Ga0373932_0000018 | Ga0373932_0000018_29406_30203 | 259 |
| 1034 | 3300035114 | Ga0373939_0000116 | Ga0373939_0000116_643_1440 | 259 |
| 1035 | 3300035115 | Ga0373941_0001307 | Ga0373941_0001307_3022_3819 | 259 |
| 1036 | 3300035121 | Ga0373960_0002914 | Ga0373960_0002914_1284_2081 | 259 |
| 1037 | 3300035207 | Ga0373942_0000606 | Ga0373942_0000606_1116_1913 | 259 |
| 1038 | 3300035241 | Ga0373961_0001104 | Ga0373961_0001104_6659_7456 | 259 |
| 1039 | 3300035691 | Ga0373931_0007116 | Ga0373931_0007116_1207_2004 | 259 |
| 1040 | 3300042876 | Ga0451577_0127016 | Ga0451577_0127016_183_980 | 259 |
| 1041 | 3300044712 | Ga0453684_0044084 | Ga0453684_0044084_3807_4604 | 259 |
| 1042 | 3300045051 | Ga0451576_0011125 | Ga0451576_0011125_1143_1940 | 259 |
| 1043 | 3300048909 | Ga0496106_0058250 | Ga0496106_0058250_22_819 | 259 |
| 1044 | 3300048912 | Ga0496109_0098334 | Ga0496109_0098334_1335_2132 | 259 |
| 1045 | 3300048913 | Ga0496110_0011097 | Ga0496110_0011097_3984_4781 | 259 |
| 1046 | 3300048914 | Ga0496111_0319292 | Ga0496111_0319292_327_1124 | 259 |
| 1047 | 3300049577 | Ga0501041_0422764 | Ga0501041_0422764_32_829 | 259 |
| 1048 | 3300049591 | Ga0501075_0015205 | Ga0501075_0015205_3667_4464 | 259 |
| 1049 | 3300049592 | Ga0501076_0022336 | Ga0501076_0022336_3909_4706 | 259 |
| 1050 | 3300049741 | Ga0501079_0003856 | Ga0501079_0003856_1169_1966 | 259 |
| 1051 | 3300049743 | Ga0501081_0085219 | Ga0501081_0085219_1205_2002 | 259 |
| 1052 | 3300050511 | nmdc:mga08y16_73920_c1 | nmdc:mga08y16_73920_c1_1549_2346 | 259 |
| 1053 | 3300050515 | nmdc:mga0a205_83824_c1 | nmdc:mga0a205_83824_c1_1114_1911 | 259 |
| 1054 | 3300054114 | Ga0501084_0014881 | Ga0501084_0014881_58_855 | 259 |
| 1055 | 3300060353 | Ga0501082_0535132 | Ga0501082_0535132_104_901 | 259 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9301 | 7 | 235 |
| 2awn-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) | 0.9137 | 6 | 235 |
| 7efo-assembly1.cif.gz_A | lptb2fg-lps from klebsiella pneumoniae in nanodiscs | 0.892 | 7 | 247 |
| 1g9x-assembly3.cif.gz_C | characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter | 0.8854 | 4 | 245 |
| 6mjp-assembly1.cif.gz_B | lptb(e163q)fgc from vibrio cholerae | 0.8848 | 6 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9S7_4_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9463 | 6 | 247 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9291 | 7 | 230 | 3.40.50.300 |
| af_A0A1D6Q2V7_231_304_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9222 | 4 | 70 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9105 | 7 | 230 | 3.40.50.300 |
| af_P0A9S7_4_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9099 | 6 | 247 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D1IYM8-F1-model_v4 | ABC transporter | 0.9856 | 162 | 247 |
GO:0005524
GO:0005886 |
| AF-A0A2C9ELC4-F1-model_v4 | High-affinity branched-chain amino acid transport ATP-binding protein BraF | 0.9699 | 5 | 248 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A7J9XS80-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9586 | 4 | 248 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A7C3YY79-F1-model_v4 | ABC transporter ATP-binding protein | 0.9565 | 5 | 247 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A3G1KQ69-F1-model_v4 | ABC transporter domain-containing protein | 0.9504 | 4 | 249 |
GO:0005304
GO:0005524 GO:0005886 GO:0015188 GO:0015192 GO:0015808 GO:0016887 GO:0042941 GO:1903805 GO:1903806 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar