F489163

General Info

Members Datasets Scaffolds Average Seq Length
1055 501 1016 256

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0445213|Ga0496102_0445213_79_909
Length 276
Sequence VKILEAERLSIAFGGVRAVDDVSLAVEAGEVFSIIGPNGAGKTTLFNMISGLYTPAAGRVRLTGEDVTGLAPDRLAHRGLSRTFQNLQIFVRMTALENVMVGCHRHEATGIFAELLHLPSVARQNRTTRDAAAAALGRVGLSSHAARFAAGLPYGALKRLEMARALASAPKVLLLDEPAAGCNPVETAEIAAIIRQFARDGITVVLVEHDMRLVMDISDRIHVLANGRTLAEGTAAVVRANPAVIEAYLGVGACSGERSDSPRKGGGAQEIAGAAG

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
5 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
6 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
7 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
8 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
9 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
10 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
11 2643221658 Variovorax sp. Root411 Isolate Unclassified
12 2643221736 Bosea sp. Root483D1 Isolate Unclassified
13 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
14 2738541277 Variovorax sp. GV051 Isolate Unclassified
15 2738541307 Variovorax sp. GV008 Isolate Unclassified
16 2738543019 Variovorax sp. GV040 Isolate Unclassified
17 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
18 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
19 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
20 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
26 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
27 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
28 2841760612 Bosea sp. Tri-49 Isolate Nodule
29 2844104063 Bosea sp. Tri-39 Isolate Nodule
30 2851182111 Bosea sp. Tri-44 Isolate Nodule
31 2851246043 Bosea sp. Tri-54 Isolate Nodule
32 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
33 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
34 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
35 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
36 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
37 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
38 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
39 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
40 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
41 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
42 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
43 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
44 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
45 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
46 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
50 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
51 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
52 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
53 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
54 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
55 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
56 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
57 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
58 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
59 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
64 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
65 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
66 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
67 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
68 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
69 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
73 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
74 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
75 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
86 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
87 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
88 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
89 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
90 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
91 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
98 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
99 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
100 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
101 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
102 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
103 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
104 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
105 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
106 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
107 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
108 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
109 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
110 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
111 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
112 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
113 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
117 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
118 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
119 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
120 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
121 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
122 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
123 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
124 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
125 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
126 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
127 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
128 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
129 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
130 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
131 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
132 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
133 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
134 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
135 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
139 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
140 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
142 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
143 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
144 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
145 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
146 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
147 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
148 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
149 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
150 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
151 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
152 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
153 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
154 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
156 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
157 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
158 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
159 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
160 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
161 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
162 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
163 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
164 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
165 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
166 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
167 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
168 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
169 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
170 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
171 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
172 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
173 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
174 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
175 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
176 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
177 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
178 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
179 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
180 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
181 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
182 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
184 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
185 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
186 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
189 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
259 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
263 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
264 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
265 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
266 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
267 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
268 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
269 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
270 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
271 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
272 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
273 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
274 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
275 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
276 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
277 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
278 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
279 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
280 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
281 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
282 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
283 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
284 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
285 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
286 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
287 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
288 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
289 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
290 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
291 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
292 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
293 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
294 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
295 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
296 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
297 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
298 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
299 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
300 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
301 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
302 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
303 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
304 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
305 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
306 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
307 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
308 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
309 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
310 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
311 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
312 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
313 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
314 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
315 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
316 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
317 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
318 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
319 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
320 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
321 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
322 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
323 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
324 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
325 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
326 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
327 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
328 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
329 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
330 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
331 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
332 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
333 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
334 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
335 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
336 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
337 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
338 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
339 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
340 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
341 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
342 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
343 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
344 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
345 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
346 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
347 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
348 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
349 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
350 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
351 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
352 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
353 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
354 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
355 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
356 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
357 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
358 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
359 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
360 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
361 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
362 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
363 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
364 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
365 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
366 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
367 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
368 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
369 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
370 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
371 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
372 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
373 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
374 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
375 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
376 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
377 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
381 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
382 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
383 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
384 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
385 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
386 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
387 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
388 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
389 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
390 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
391 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
392 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
393 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
394 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
395 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
396 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
397 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
398 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
399 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
400 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
401 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
402 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
403 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
404 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
405 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
406 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
407 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
408 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
409 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
410 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
411 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
412 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
413 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
414 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
415 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
416 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
417 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
418 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
419 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
420 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
421 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
422 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
423 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
439 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
440 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
441 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
442 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
443 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
444 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
445 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
446 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
447 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
448 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
452 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
453 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
456 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
457 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
458 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
459 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
460 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
461 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
462 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
463 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
464 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
465 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
466 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
467 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
468 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
469 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
470 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
471 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
472 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
473 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
474 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
475 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
476 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
477 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
478 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
479 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
480 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
481 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
482 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
483 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
484 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
485 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
486 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
487 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
488 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
489 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
490 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
491 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
492 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
493 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
494 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
495 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
496 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
497 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
498 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
499 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
500 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
501 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.21
Metatranscriptomes 0.09
Isolates 3.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.01
Nodule 1.14
Rhizoplane 10.14
Rhizosphere 77.82
Stem 0
Stem Tuber 0
Unclassified 3.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_6977220 2162886011 Bacteria 3369
2 2214544908 2209111006 Bacteria 36473
3 ARcpr5oldR_c000009 3300000041 Bacteria 39838
4 ARSoilYngRDRAFT_c00030 3300000042 Bacteria 22085
5 ARcpr5yngRDRAFT_c000008 3300000043 Bacteria 39878
6 ARSoilOldRDRAFT_c000009 3300000044 Bacteria 45329
7 ARCol0oldRDRAFT_c00009 3300000045 Bacteria 15916
8 ARCol0yngRDRAFT_1000008 3300000652 Bacteria 45358
9 JGI24743J22301_10004507 3300001991 Bacteria 2276
10 JGI25152J39213_1020028 3300002773 Bacteria 1205
11 JGI25151J46595_10000697 3300003187 Bacteria 28184
12 JGI25151J46595_10020173 3300003187 Bacteria 2815
13 JGI25153J46596_10003791 3300003215 Bacteria 8346
14 Ga0055524_1000064 3300003775 Bacteria 133574
15 Ga0055536_1004556 3300003781 Bacteria 7040
16 Ga0055528_1007814 3300003790 Bacteria 4673
17 Ga0055530_10007828 3300003791 Bacteria 4410
18 Ga0055540_1000045 3300003792 Bacteria 152083
19 Ga0055531_10000149 3300003794 Bacteria 80949
20 Ga0065716_1001541 3300005277 Bacteria 7642
21 Ga0065704_10070953 3300005289 Bacteria 14294
22 Ga0065712_10074587 3300005290 Bacteria 4056
23 Ga0065712_10079461 3300005290 Bacteria 3215
24 Ga0065715_10119572 3300005293 Bacteria 2283
25 Ga0065707_10095129 3300005295 Bacteria 3414
26 Ga0070658_10012053 3300005327 Bacteria 6943
27 Ga0070658_10222047 3300005327 Bacteria 1598
28 Ga0070676_10042146 3300005328 Bacteria 2649
29 Ga0070676_10229184 3300005328 Bacteria 1231
30 Ga0070683_100067856 3300005329 Bacteria 3322
31 Ga0070683_100343710 3300005329 Bacteria 1421
32 Ga0070690_100031226 3300005330 Bacteria 3317
33 Ga0070690_100040872 3300005330 Bacteria 2934
34 Ga0070670_100034285 3300005331 Bacteria 4368
35 Ga0070670_100045033 3300005331 Bacteria 3792
36 Ga0070670_100054860 3300005331 Bacteria 3422
37 Ga0070670_100489277 3300005331 Bacteria 1093
38 Ga0070677_10021417 3300005333 Bacteria 2371
39 Ga0070677_10051133 3300005333 Bacteria 1672
40 Ga0068869_100076568 3300005334 Bacteria 2487
41 Ga0068869_100219157 3300005334 Bacteria 1507
42 Ga0070666_10082392 3300005335 Bacteria 2200
43 Ga0070666_10200436 3300005335 Bacteria 1404
44 Ga0070680_100001410 3300005336 Bacteria 17375
45 Ga0070680_100007553 3300005336 Bacteria 8289
46 Ga0070680_100061649 3300005336 Bacteria 3070
47 Ga0070680_100197201 3300005336 Bacteria 1697
48 Ga0070680_100441619 3300005336 Bacteria 1111
49 Ga0070682_100085926 3300005337 Bacteria 2047
50 Ga0070682_100317335 3300005337 Bacteria 1149
51 Ga0070682_100360308 3300005337 Bacteria 1087
52 Ga0068868_100065959 3300005338 Bacteria 2877
53 Ga0068868_100197794 3300005338 Bacteria 1674
54 Ga0070660_100001593 3300005339 Bacteria 15589
55 Ga0070660_100007654 3300005339 Bacteria 7527
56 Ga0070660_100234431 3300005339 Bacteria 1494
57 Ga0070660_100376427 3300005339 Bacteria 1172
58 Ga0070689_100031795 3300005340 Bacteria 4011
59 Ga0070689_100116047 3300005340 Bacteria 2135
60 Ga0070689_100641144 3300005340 Bacteria 923
61 Ga0070687_100007937 3300005343 Bacteria 4466
62 Ga0070687_100070207 3300005343 Bacteria 1878
63 Ga0070661_100066713 3300005344 Bacteria 2644
64 Ga0070692_10020011 3300005345 Bacteria 3238
65 Ga0070668_100038614 3300005347 Bacteria 3650
66 Ga0070668_100267347 3300005347 Bacteria 1424
67 Ga0070668_100353053 3300005347 Bacteria 1245
68 Ga0070669_100007294 3300005353 Bacteria 7929
69 Ga0070669_100129903 3300005353 Bacteria 1931
70 Ga0070669_100332861 3300005353 Bacteria 1228
71 Ga0070675_100055984 3300005354 Bacteria 3248
72 Ga0070675_100126767 3300005354 Bacteria 2172
73 Ga0070671_100010470 3300005355 Bacteria 7440
74 Ga0070671_100139366 3300005355 Bacteria 2046
75 Ga0070674_100030100 3300005356 Bacteria 3584
76 Ga0070674_100035925 3300005356 Bacteria 3322
77 Ga0070674_100092683 3300005356 Bacteria 2184
78 Ga0070674_100097805 3300005356 Bacteria 2132
79 Ga0070673_100271202 3300005364 Bacteria 1485
80 Ga0070688_100003872 3300005365 Bacteria 7754
81 Ga0070688_100023242 3300005365 Bacteria 3644
82 Ga0070659_100075313 3300005366 Bacteria 2690
83 Ga0070659_100113504 3300005366 Bacteria 2189
84 Ga0070659_100225823 3300005366 Bacteria 1547
85 Ga0070659_100276957 3300005366 Bacteria 1395
86 Ga0070659_100283983 3300005366 Bacteria 1377
87 Ga0070659_100291966 3300005366 Bacteria 1358
88 Ga0070667_100009854 3300005367 Bacteria 7921
89 Ga0070667_100141341 3300005367 Bacteria 2108
90 Ga0070667_100184817 3300005367 Bacteria 1844
91 Ga0070709_10005422 3300005434 Bacteria 6909
92 Ga0070709_10481325 3300005434 Bacteria 940
93 Ga0070714_100033057 3300005435 Bacteria 4322
94 Ga0070714_100046287 3300005435 Bacteria 3690
95 Ga0070714_100073796 3300005435 Bacteria 2956
96 Ga0070714_100108474 3300005435 Bacteria 2455
97 Ga0070713_100099724 3300005436 Bacteria 2513
98 Ga0070710_10078595 3300005437 Bacteria 1920
99 Ga0070710_10088122 3300005437 Bacteria 1825
100 Ga0070710_10205431 3300005437 Bacteria 1246
101 Ga0070701_10039584 3300005438 Bacteria 2392
102 Ga0070701_10145612 3300005438 Bacteria 1359
103 Ga0070700_100053456 3300005441 Bacteria 2520
104 Ga0070700_100243382 3300005441 Bacteria 1286
105 Ga0070694_100030678 3300005444 Bacteria 3519
106 Ga0070694_100127084 3300005444 Bacteria 1836
107 Ga0070663_100001521 3300005455 Bacteria 12761
108 Ga0070663_100026594 3300005455 Bacteria 3921
109 Ga0070663_100251573 3300005455 Bacteria 1399
110 Ga0070678_100073746 3300005456 Bacteria 2562
111 Ga0070678_100079685 3300005456 Bacteria 2478
112 Ga0070678_100124312 3300005456 Bacteria 2039
113 Ga0070678_100166376 3300005456 Bacteria 1792
114 Ga0070678_100230441 3300005456 Bacteria 1544
115 Ga0070662_100117596 3300005457 Bacteria 2033
116 Ga0070681_10047543 3300005458 Bacteria 4289
117 Ga0070681_10063813 3300005458 Bacteria 3656
118 Ga0068867_100039092 3300005459 Bacteria 3457
119 Ga0068867_100287337 3300005459 Bacteria 1351
120 Ga0070685_10011463 3300005466 Bacteria 4640
121 Ga0070685_10030373 3300005466 Bacteria 3010
122 Ga0070706_100197283 3300005467 Bacteria 1880
123 Ga0070707_100332348 3300005468 Bacteria 1476
124 Ga0070698_100130523 3300005471 Bacteria 2468
125 Ga0070679_100028477 3300005530 Bacteria 5508
126 Ga0070679_100074303 3300005530 Bacteria 3390
127 Ga0070679_100182765 3300005530 Bacteria 2069
128 Ga0070679_100305833 3300005530 Bacteria 1540
129 Ga0070684_100072514 3300005535 Bacteria 3032
130 Ga0070684_100486754 3300005535 Bacteria 1142
131 Ga0070697_100620514 3300005536 Bacteria 951
132 Ga0070672_100206191 3300005543 Bacteria 1645
133 Ga0070695_100003825 3300005545 Bacteria 8781
134 Ga0070695_100120908 3300005545 Bacteria 1791
135 Ga0070693_100017405 3300005547 Bacteria 3736
136 Ga0070693_100052891 3300005547 Bacteria 2330
137 Ga0070665_100002816 3300005548 Bacteria 18830
138 Ga0070665_100051051 3300005548 Bacteria 4149
139 Ga0070665_100409078 3300005548 Bacteria 1365
140 Ga0070665_100478057 3300005548 Bacteria 1256
141 Ga0070704_100127835 3300005549 Bacteria 1964
142 Ga0068855_100017227 3300005563 Bacteria 8694
143 Ga0068855_100567348 3300005563 Bacteria 1227
144 Ga0070664_100198645 3300005564 Bacteria 1789
145 Ga0068857_100141940 3300005577 Bacteria 2171
146 Ga0068854_100056426 3300005578 Bacteria 2830
147 Ga0068854_100360164 3300005578 Bacteria 1193
148 Ga0068856_100280568 3300005614 Bacteria 1683
149 Ga0068852_100166905 3300005616 Bacteria 2060
150 Ga0068852_100193731 3300005616 Bacteria 1919
151 Ga0068852_100236339 3300005616 Bacteria 1744
152 Ga0068852_100463515 3300005616 Bacteria 1256
153 Ga0068859_100036474 3300005617 Bacteria 4936
154 Ga0068859_100052613 3300005617 Bacteria 4094
155 Ga0068859_100252855 3300005617 Bacteria 1853
156 Ga0068859_100680199 3300005617 Bacteria 1120
157 Ga0068864_100008308 3300005618 Bacteria 8564
158 Ga0068864_100015632 3300005618 Bacteria 6314
159 Ga0068864_100029633 3300005618 Bacteria 4637
160 Ga0068864_100157159 3300005618 Bacteria 2064
161 Ga0068866_10012834 3300005718 Bacteria 3659
162 Ga0068866_10031153 3300005718 Bacteria 2566
163 Ga0068861_100050735 3300005719 Bacteria 3147
164 Ga0068861_100303616 3300005719 Bacteria 1384
165 Ga0068851_10003774 3300005834 Bacteria 6776
166 Ga0068851_10261404 3300005834 Bacteria 985
167 Ga0068870_10021342 3300005840 Bacteria 3166
168 Ga0068870_10057880 3300005840 Bacteria 2073
169 Ga0068863_100087926 3300005841 Bacteria 2945
170 Ga0068863_100129676 3300005841 Bacteria 2407
171 Ga0068863_100612742 3300005841 Bacteria 1078
172 Ga0068863_100907465 3300005841 Bacteria 881
173 Ga0068858_100001279 3300005842 Bacteria 26017
174 Ga0068858_100036464 3300005842 Bacteria 4560
175 Ga0068858_100177287 3300005842 Bacteria 2011
176 Ga0068860_100103357 3300005843 Bacteria 2719
177 Ga0068860_100186511 3300005843 Bacteria 2006
178 Ga0068860_100540591 3300005843 Bacteria 1166
179 Ga0068862_100112390 3300005844 Bacteria 2392
180 Ga0068862_100182861 3300005844 Bacteria 1882
181 Ga0081455_10000858 3300005937 Bacteria 39172
182 Ga0081455_10003340 3300005937 Bacteria 18499
183 Ga0081455_10009294 3300005937 Bacteria 10123
184 Ga0081455_10143757 3300005937 Bacteria 1849
185 Ga0081538_10001857 3300005981 Bacteria 21297
186 Ga0081538_10034940 3300005981 Bacteria 3313
187 Ga0081540_1001455 3300005983 Bacteria 20460
188 Ga0081540_1003099 3300005983 Bacteria 13317
189 Ga0081540_1039591 3300005983 Bacteria 2469
190 Ga0070717_10081002 3300006028 Bacteria 2725
191 Ga0070717_10450305 3300006028 Bacteria 1160
192 Ga0075365_10008924 3300006038 Bacteria 5726
193 Ga0075365_10010677 3300006038 Bacteria 5364
194 Ga0075365_10043532 3300006038 Bacteria 2939
195 Ga0075365_10096405 3300006038 Bacteria 2021
196 Ga0075363_100007861 3300006048 Bacteria 4933
197 Ga0075363_100026897 3300006048 Bacteria 2946
198 Ga0075364_10010874 3300006051 Bacteria 5514
199 Ga0075432_10004288 3300006058 Bacteria 4853
200 Ga0075432_10050644 3300006058 Bacteria 1465
201 Ga0070715_10000623 3300006163 Bacteria 9367
202 Ga0070715_10054022 3300006163 Bacteria 1738
203 Ga0070715_10155350 3300006163 Bacteria 1125
204 Ga0070716_100314000 3300006173 Bacteria 1095
205 Ga0070712_100028977 3300006175 Bacteria 3709
206 Ga0070712_100271120 3300006175 Bacteria 1363
207 Ga0075362_10030106 3300006177 Bacteria 2343
208 Ga0075367_10109898 3300006178 Bacteria 1691
209 Ga0075367_10199806 3300006178 Bacteria 1249
210 Ga0075369_10085027 3300006186 Bacteria 1407
211 Ga0075427_10001837 3300006194 Bacteria 2776
212 Ga0097621_100034889 3300006237 Bacteria 4015
213 Ga0097621_100112776 3300006237 Bacteria 2299
214 Ga0097621_100167011 3300006237 Bacteria 1895
215 Ga0097621_100295049 3300006237 Bacteria 1430
216 Ga0075370_10017813 3300006353 Bacteria 3842
217 Ga0068871_100059967 3300006358 Bacteria 3102
218 Ga0068871_100287677 3300006358 Bacteria 1439
219 Ga0068871_100388319 3300006358 Bacteria 1241
220 Ga0075428_100001371 3300006844 Bacteria 25896
221 Ga0075428_100002667 3300006844 Bacteria 19383
222 Ga0075428_100045387 3300006844 Bacteria 4828
223 Ga0075428_100056055 3300006844 Bacteria 4317
224 Ga0075428_100153128 3300006844 Bacteria 2505
225 Ga0075428_100199973 3300006844 Bacteria 2161
226 Ga0075428_100471572 3300006844 Bacteria 1344
227 Ga0075428_100648358 3300006844 Bacteria 1126
228 Ga0075430_100000770 3300006846 Bacteria 24728
229 Ga0075430_100017979 3300006846 Bacteria 6018
230 Ga0075430_100098009 3300006846 Bacteria 2449
231 Ga0075431_100000399 3300006847 Bacteria 35027
232 Ga0075431_100001861 3300006847 Bacteria 19979
233 Ga0075431_100058238 3300006847 Bacteria 3986
234 Ga0075431_100138863 3300006847 Bacteria 2505
235 Ga0075433_10000374 3300006852 Bacteria 28158
236 Ga0075433_10145154 3300006852 Bacteria 2110
237 Ga0075434_100001253 3300006871 Bacteria 21152
238 Ga0075434_100189166 3300006871 Bacteria 2079
239 Ga0075434_100257538 3300006871 Bacteria 1764
240 Ga0075434_100314024 3300006871 Bacteria 1588
241 Ga0075434_100355241 3300006871 Bacteria 1486
242 Ga0075429_100001469 3300006880 Bacteria 19383
243 Ga0075429_100001959 3300006880 Bacteria 17088
244 Ga0075429_100043337 3300006880 Bacteria 3916
245 Ga0075429_100054135 3300006880 Bacteria 3491
246 Ga0075429_100299777 3300006880 Bacteria 1407
247 Ga0068865_100030560 3300006881 Bacteria 3584
248 Ga0075436_100414980 3300006914 Bacteria 977
249 Ga0097620_100036473 3300006931 Bacteria 4936
250 Ga0097620_100052611 3300006931 Bacteria 4094
251 Ga0097620_100252838 3300006931 Bacteria 1853
252 Ga0097620_100680191 3300006931 Bacteria 1120
253 Ga0075435_100009949 3300007076 Bacteria 6927
254 Ga0075435_100136866 3300007076 Bacteria 2052
255 Ga0105240_10032220 3300009093 Bacteria 6788
256 Ga0105240_10038568 3300009093 Bacteria 6126
257 Ga0105240_10513008 3300009093 Bacteria 1331
258 Ga0111539_10000242 3300009094 Bacteria 65417
259 Ga0111539_10001763 3300009094 Bacteria 28733
260 Ga0111539_10003310 3300009094 Bacteria 21272
261 Ga0111539_10003651 3300009094 Bacteria 20267
262 Ga0111539_10028162 3300009094 Bacteria 6859
263 Ga0111539_10196051 3300009094 Bacteria 2355
264 Ga0111539_10232174 3300009094 Bacteria 2148
265 Ga0111539_10410115 3300009094 Bacteria 1578
266 Ga0111539_10634047 3300009094 Bacteria 1244
267 Ga0111539_11142077 3300009094 Bacteria 905
268 Ga0105245_10000556 3300009098 Bacteria 33858
269 Ga0105245_10003235 3300009098 Bacteria 14596
270 Ga0105245_10289217 3300009098 Bacteria 1605
271 Ga0105245_10360456 3300009098 Bacteria 1443
272 Ga0105247_10000474 3300009101 Bacteria 33690
273 Ga0105247_10039961 3300009101 Bacteria 2866
274 Ga0105247_10316669 3300009101 Bacteria 1087
275 Ga0114129_10000199 3300009147 Bacteria 66704
276 Ga0114129_10001978 3300009147 Bacteria 28018
277 Ga0114129_10007210 3300009147 Bacteria 15822
278 Ga0114129_10020933 3300009147 Bacteria 9290
279 Ga0114129_10033314 3300009147 Bacteria 7280
280 Ga0114129_10085361 3300009147 Bacteria 4380
281 Ga0114129_10088583 3300009147 Bacteria 4290
282 Ga0114129_10120940 3300009147 Bacteria 3604
283 Ga0114129_10436698 3300009147 Bacteria 1719
284 Ga0114129_10466703 3300009147 Bacteria 1654
285 Ga0114129_11222167 3300009147 Bacteria 935
286 Ga0105243_10088495 3300009148 Bacteria 2544
287 Ga0105243_10092321 3300009148 Bacteria 2496
288 Ga0105241_10392172 3300009174 Bacteria 1216
289 Ga0105242_10011728 3300009176 Bacteria 6744
290 Ga0105242_10457040 3300009176 Bacteria 1205
291 Ga0105248_10000873 3300009177 Bacteria 33799
292 Ga0105248_10084018 3300009177 Bacteria 3581
293 Ga0105248_10104607 3300009177 Bacteria 3192
294 Ga0105248_10193366 3300009177 Bacteria 2292
295 Ga0105237_10026808 3300009545 Bacteria 5889
296 Ga0105238_10395151 3300009551 Bacteria 1375
297 Ga0105249_10139027 3300009553 Bacteria 2327
298 Ga0105249_10239323 3300009553 Bacteria 1794
299 Ga0105249_10429619 3300009553 Bacteria 1356
300 Ga0105249_10479340 3300009553 Bacteria 1287
301 Ga0105249_10505332 3300009553 Bacteria 1254
302 Ga0105239_10002642 3300010375 Bacteria 22634
303 Ga0105239_10028385 3300010375 Bacteria 6156
304 Ga0105239_10111018 3300010375 Bacteria 3039
305 Ga0105239_10374928 3300010375 Bacteria 1608
306 Ga0105246_10000220 3300011119 Bacteria 29009
307 Ga0105246_10136766 3300011119 Bacteria 1837
308 Ga0105246_10361447 3300011119 Bacteria 1193
309 Ga0157337_1000858 3300012483 Bacteria 1457
310 Ga0157371_10081856 3300013102 Bacteria 2286
311 Ga0157374_10000524 3300013296 Bacteria 34473
312 Ga0157374_10015100 3300013296 Bacteria 6771
313 Ga0157374_10325716 3300013296 Bacteria 1523
314 Ga0157378_10000591 3300013297 Bacteria 34042
315 Ga0157378_10860880 3300013297 Bacteria 935
316 Ga0163162_10003457 3300013306 Bacteria 15087
317 Ga0163162_10012895 3300013306 Bacteria 8162
318 Ga0163162_10433708 3300013306 Bacteria 1446
319 Ga0163162_10542747 3300013306 Bacteria 1291
320 Ga0157372_10017920 3300013307 Bacteria 7610
321 Ga0157372_10613420 3300013307 Bacteria 1268
322 Ga0157375_10001668 3300013308 Bacteria 19088
323 Ga0157375_10049059 3300013308 Bacteria 4135
324 Ga0163163_10015811 3300014325 Bacteria 6991
325 Ga0163163_10026975 3300014325 Bacteria 5496
326 Ga0163163_10050183 3300014325 Bacteria 4109
327 Ga0163163_10147751 3300014325 Bacteria 2395
328 Ga0163163_10213655 3300014325 Bacteria 1978
329 Ga0157380_10024561 3300014326 Bacteria 4562
330 Ga0157380_10138079 3300014326 Bacteria 2090
331 Ga0157380_10149702 3300014326 Bacteria 2016
332 Ga0157380_10611902 3300014326 Bacteria 1080
333 Ga0182008_10003543 3300014497 Bacteria 9382
334 Ga0182008_10193696 3300014497 Bacteria 1032
335 Ga0157377_10012661 3300014745 Bacteria 4247
336 Ga0157377_10098137 3300014745 Bacteria 1741
337 Ga0157379_10000422 3300014968 Bacteria 34158
338 Ga0157379_10034165 3300014968 Bacteria 4532
339 Ga0157379_10095356 3300014968 Bacteria 2669
340 Ga0157379_10169853 3300014968 Bacteria 1969
341 Ga0157379_10711286 3300014968 Bacteria 943
342 Ga0157376_10000285 3300014969 Bacteria 34194
343 Ga0157376_10138812 3300014969 Bacteria 2178
344 Ga0157376_10225942 3300014969 Bacteria 1736
345 Ga0182007_10001188 3300015262 Bacteria 14143
346 Ga0163161_10066341 3300017792 Bacteria 2635
347 Ga0163161_10328026 3300017792 Bacteria 1211
348 Ga0206353_10740853 3300020082 Bacteria 3108
349 Ga0214542_1000092 3300021321 Bacteria 117288
350 Ga0214543_1000045 3300021327 Bacteria 152699
351 Ga0209129_1000788 3300025258 Bacteria 19977
352 Ga0207666_1007060 3300025271 Bacteria 1470
353 Ga0209673_1001311 3300025273 Bacteria 25169
354 Ga0207673_1000176 3300025290 Bacteria 6351
355 Ga0209675_1000448 3300025291 Bacteria 31951
356 Ga0209676_1000135 3300025292 Bacteria 182756
357 Ga0209025_1000325 3300025294 Bacteria 106131
358 Ga0209025_1001354 3300025294 Bacteria 32918
359 Ga0209025_1027868 3300025294 Bacteria 2786
360 Ga0209564_1000048 3300025295 Bacteria 364806
361 Ga0209564_1017756 3300025295 Bacteria 2752
362 Ga0209758_1000217 3300025297 Bacteria 124619
363 Ga0209050_1000100 3300025298 Bacteria 231385
364 Ga0209050_1021841 3300025298 Bacteria 2315
365 Ga0209256_1000041 3300025299 Bacteria 364827
366 Ga0209256_1028313 3300025299 Bacteria 1582
367 Ga0209051_1000067 3300025303 Bacteria 227181
368 Ga0209257_1000095 3300025304 Bacteria 259437
369 Ga0207697_10000294 3300025315 Bacteria 27868
370 Ga0207656_10009247 3300025321 Bacteria 3655
371 Ga0207682_10001810 3300025893 Bacteria 9782
372 Ga0207682_10011631 3300025893 Bacteria 3438
373 Ga0207682_10089411 3300025893 Bacteria 1333
374 Ga0207642_10017847 3300025899 Bacteria 2709
375 Ga0207642_10046978 3300025899 Bacteria 1927
376 Ga0207710_10000423 3300025900 Bacteria 27748
377 Ga0207688_10004774 3300025901 Bacteria 7385
378 Ga0207688_10189841 3300025901 Bacteria 1228
379 Ga0207680_10086423 3300025903 Bacteria 1983
380 Ga0207685_10077434 3300025905 Bacteria 1366
381 Ga0207699_10145029 3300025906 Bacteria 1564
382 Ga0207645_10000860 3300025907 Bacteria 25221
383 Ga0207645_10021819 3300025907 Bacteria 4171
384 Ga0207645_10100904 3300025907 Bacteria 1862
385 Ga0207643_10000205 3300025908 Bacteria 41221
386 Ga0207643_10006425 3300025908 Bacteria 6295
387 Ga0207705_10187659 3300025909 Bacteria 1562
388 Ga0207705_10341375 3300025909 Bacteria 1153
389 Ga0207684_10006570 3300025910 Bacteria 10586
390 Ga0207684_10009005 3300025910 Bacteria 8850
391 Ga0207684_10025930 3300025910 Bacteria 4996
392 Ga0207707_10077105 3300025912 Bacteria 2909
393 Ga0207707_10168888 3300025912 Bacteria 1912
394 Ga0207707_10335447 3300025912 Bacteria 1304
395 Ga0207695_10251855 3300025913 Bacteria 1665
396 Ga0207693_10009517 3300025915 Bacteria 7915
397 Ga0207693_10042367 3300025915 Bacteria 3584
398 Ga0207693_10234584 3300025915 Bacteria 1441
399 Ga0207663_10132781 3300025916 Bacteria 1723
400 Ga0207660_10040473 3300025917 Bacteria 3263
401 Ga0207660_10080698 3300025917 Bacteria 2389
402 Ga0207660_10273863 3300025917 Bacteria 1338
403 Ga0207662_10005870 3300025918 Bacteria 6585
404 Ga0207662_10023421 3300025918 Bacteria 3548
405 Ga0207662_10183060 3300025918 Bacteria 1349
406 Ga0207657_10006225 3300025919 Bacteria 12403
407 Ga0207657_10043698 3300025919 Bacteria 3944
408 Ga0207649_10133613 3300025920 Bacteria 1689
409 Ga0207649_10473140 3300025920 Bacteria 949
410 Ga0207652_10028460 3300025921 Bacteria 4662
411 Ga0207652_10364747 3300025921 Bacteria 1304
412 Ga0207681_10138311 3300025923 Bacteria 1810
413 Ga0207681_10175867 3300025923 Bacteria 1626
414 Ga0207681_10192537 3300025923 Bacteria 1561
415 Ga0207650_10162264 3300025925 Bacteria 1771
416 Ga0207650_10171378 3300025925 Bacteria 1725
417 Ga0207650_10254780 3300025925 Bacteria 1422
418 Ga0207650_10265663 3300025925 Bacteria 1393
419 Ga0207659_10008424 3300025926 Bacteria 6399
420 Ga0207659_10173163 3300025926 Bacteria 1704
421 Ga0207659_10245756 3300025926 Bacteria 1450
422 Ga0207687_10001492 3300025927 Bacteria 16025
423 Ga0207687_10004767 3300025927 Bacteria 9019
424 Ga0207687_10109109 3300025927 Bacteria 2050
425 Ga0207687_10399636 3300025927 Bacteria 1130
426 Ga0207700_10146696 3300025928 Bacteria 1945
427 Ga0207664_10164862 3300025929 Bacteria 1892
428 Ga0207664_10168031 3300025929 Bacteria 1875
429 Ga0207644_10124042 3300025931 Bacteria 1969
430 Ga0207644_10125641 3300025931 Bacteria 1958
431 Ga0207690_10079256 3300025932 Bacteria 2288
432 Ga0207690_10211940 3300025932 Bacteria 1477
433 Ga0207706_10002261 3300025933 Bacteria 18804
434 Ga0207706_10037037 3300025933 Bacteria 4332
435 Ga0207706_10110449 3300025933 Bacteria 2419
436 Ga0207686_10043990 3300025934 Bacteria 2739
437 Ga0207686_10127351 3300025934 Bacteria 1742
438 Ga0207686_10310368 3300025934 Bacteria 1175
439 Ga0207709_10004733 3300025935 Bacteria 7813
440 Ga0207670_10007748 3300025936 Bacteria 6023
441 Ga0207670_10034893 3300025936 Bacteria 3257
442 Ga0207669_10132289 3300025937 Bacteria 1716
443 Ga0207669_10230427 3300025937 Bacteria 1366
444 Ga0207669_10266642 3300025937 Bacteria 1284
445 Ga0207665_10051482 3300025939 Bacteria 2772
446 Ga0207665_10069347 3300025939 Bacteria 2404
447 Ga0207691_10041637 3300025940 Bacteria 4239
448 Ga0207691_10056674 3300025940 Bacteria 3569
449 Ga0207691_10106643 3300025940 Bacteria 2495
450 Ga0207691_10213830 3300025940 Bacteria 1674
451 Ga0207711_10005965 3300025941 Bacteria 10298
452 Ga0207711_10154119 3300025941 Bacteria 2075
453 Ga0207689_10000451 3300025942 Bacteria 38688
454 Ga0207689_10164184 3300025942 Bacteria 1830
455 Ga0207661_10083982 3300025944 Bacteria 2636
456 Ga0207679_10134627 3300025945 Bacteria 1988
457 Ga0207667_10088505 3300025949 Bacteria 3202
458 Ga0207667_10229732 3300025949 Bacteria 1900
459 Ga0207667_10258639 3300025949 Bacteria 1780
460 Ga0207667_10390455 3300025949 Bacteria 1417
461 Ga0207667_10582082 3300025949 Bacteria 1130
462 Ga0207651_10159515 3300025960 Bacteria 1766
463 Ga0207651_10583334 3300025960 Bacteria 975
464 Ga0207712_10022771 3300025961 Bacteria 4130
465 Ga0207712_10150472 3300025961 Bacteria 1797
466 Ga0207668_10410868 3300025972 Bacteria 1146
467 Ga0207668_10436034 3300025972 Bacteria 1115
468 Ga0207640_10171174 3300025981 Bacteria 1618
469 Ga0207640_10222185 3300025981 Bacteria 1447
470 Ga0207658_10418137 3300025986 Bacteria 1181
471 Ga0207677_10065980 3300026023 Bacteria 2528
472 Ga0207677_10174422 3300026023 Bacteria 1685
473 Ga0207703_10023848 3300026035 Bacteria 4811
474 Ga0207703_10070592 3300026035 Bacteria 2883
475 Ga0207703_10134630 3300026035 Bacteria 2138
476 Ga0207639_10178370 3300026041 Bacteria 1805
477 Ga0207639_10196363 3300026041 Bacteria 1727
478 Ga0207639_10203555 3300026041 Bacteria 1699
479 Ga0207639_10534069 3300026041 Bacteria 1075
480 Ga0207678_10058032 3300026067 Bacteria 3331
481 Ga0207678_10539024 3300026067 Bacteria 1020
482 Ga0207708_10001624 3300026075 Bacteria 16729
483 Ga0207702_10507337 3300026078 Bacteria 1176
484 Ga0207641_10080191 3300026088 Bacteria 2831
485 Ga0207648_10000390 3300026089 Bacteria 48543
486 Ga0207648_10047851 3300026089 Bacteria 3747
487 Ga0207676_10009516 3300026095 Bacteria 6917
488 Ga0207676_10016105 3300026095 Bacteria 5407
489 Ga0207676_10016716 3300026095 Bacteria 5312
490 Ga0207676_10567161 3300026095 Bacteria 1086
491 Ga0207674_10094836 3300026116 Bacteria 2970
492 Ga0207674_10211351 3300026116 Bacteria 1889
493 Ga0207675_100001090 3300026118 Bacteria 26881
494 Ga0207675_100015233 3300026118 Bacteria 7173
495 Ga0207675_100206992 3300026118 Bacteria 1885
496 Ga0207675_100219881 3300026118 Bacteria 1830
497 Ga0207683_10002061 3300026121 Bacteria 17777
498 Ga0207683_10003939 3300026121 Bacteria 12881
499 Ga0207683_10024494 3300026121 Bacteria 5199
500 Ga0207683_10041267 3300026121 Bacteria 4028
501 Ga0207683_10264680 3300026121 Bacteria 1570
502 Ga0207698_10042937 3300026142 Bacteria 3383
503 Ga0207428_10000417 3300027907 Bacteria 52860
504 Ga0207428_10000666 3300027907 Bacteria 40250
505 Ga0207428_10001271 3300027907 Bacteria 26982
506 Ga0207428_10003318 3300027907 Bacteria 15655
507 Ga0207428_10066465 3300027907 Bacteria 2841
508 Ga0268266_10001063 3300028379 Bacteria 34421
509 Ga0268266_10038124 3300028379 Bacteria 4092
510 Ga0268266_10258047 3300028379 Bacteria 1614
511 Ga0268265_10030511 3300028380 Bacteria 3884
512 Ga0268265_10594543 3300028380 Bacteria 1056
513 Ga0268264_10005764 3300028381 Bacteria 10502
514 Ga0268264_10031479 3300028381 Bacteria 4348
515 Ga0268264_10501491 3300028381 Bacteria 1184
516 Ga0265337_1003658 3300028556 Bacteria 6592
517 Ga0307515_10000636 3300028794 Bacteria 81268
518 Ga0307515_10050958 3300028794 Bacteria 6185
519 Ga0307515_10258369 3300028794 Bacteria 1482
520 Ga0265340_10033735 3300031247 Bacteria 2547
521 Ga0265339_10050492 3300031249 Bacteria 2274
522 Ga0265327_10007017 3300031251 Bacteria 8830
523 Ga0265316_10104946 3300031344 Bacteria 2144
524 Ga0265316_10127589 3300031344 Bacteria 1918
525 Ga0307513_10002157 3300031456 Bacteria 27520
526 Ga0307513_10049621 3300031456 Bacteria 4544
527 Ga0307513_10182335 3300031456 Bacteria 1961
528 Ga0265313_10012769 3300031595 Bacteria 5099
529 Ga0307514_10002611 3300031649 Bacteria 18435
530 Ga0316575_10029884 3300031665 Bacteria 2129
531 Ga0316575_10084681 3300031665 Bacteria 1280
532 Ga0265314_10003227 3300031711 Bacteria 15941
533 Ga0265342_10000319 3300031712 Bacteria 54575
534 Ga0316576_10143503 3300031727 Bacteria 1798
535 Ga0307405_10015237 3300031731 Bacteria 4158
536 Ga0307413_10003248 3300031824 Bacteria 6808
537 Ga0307413_10041893 3300031824 Bacteria 2686
538 Ga0307412_10191080 3300031911 Bacteria 1548
539 Ga0307409_100021337 3300031995 Bacteria 4438
540 Ga0307416_100026408 3300032002 Bacteria 4278
541 Ga0307414_10016739 3300032004 Bacteria 4467
542 Ga0307414_10083086 3300032004 Bacteria 2351
543 Ga0316583_10002868 3300032133 Bacteria 6050
544 Ga0373930_0002705 3300034816 Bacteria 2763
545 Ga0373948_0006564 3300034817 Bacteria 1928
546 Ga0373950_0005593 3300034818 Bacteria 1883
547 Ga0373938_0000049 3300034957 Bacteria 15338
548 Ga0373926_0059501 3300035083 Bacteria 1391
549 Ga0373928_0000021 3300035084 Bacteria 27737
550 Ga0373928_0033520 3300035084 Bacteria 1149
551 Ga0373929_0000048 3300035085 Bacteria 25670
552 Ga0373940_0000013 3300035088 Bacteria 23710
553 Ga0373944_0003921 3300035089 Bacteria 3853
554 Ga0373944_0006052 3300035089 Bacteria 3205
555 Ga0373949_0000214 3300035090 Bacteria 21912
556 Ga0373951_0000646 3300035091 Bacteria 9590
557 Ga0373952_0000011 3300035092 Bacteria 25689
558 Ga0373932_0000018 3300035112 Bacteria 53356
559 Ga0373939_0000116 3300035114 Bacteria 23908
560 Ga0373939_0005135 3300035114 Bacteria 3111
561 Ga0373941_0001307 3300035115 Bacteria 5241
562 Ga0373945_0008345 3300035116 Bacteria 3371
563 Ga0373953_0053110 3300035117 Bacteria 1642
564 Ga0373954_0016716 3300035118 Bacteria 3288
565 Ga0373956_0020258 3300035119 Bacteria 2828
566 Ga0373960_0002914 3300035121 Bacteria 3869
567 Ga0373943_0003784 3300035170 Bacteria 6873
568 Ga0373943_0238225 3300035170 Bacteria 1019
569 Ga0373946_0006096 3300035171 Bacteria 4365
570 Ga0373946_0064684 3300035171 Bacteria 1565
571 Ga0373955_0001168 3300035172 Bacteria 11151
572 Ga0373942_0000606 3300035207 Bacteria 10070
573 Ga0373961_0001104 3300035241 Bacteria 8550
574 Ga0316574_0024694 3300035398 Bacteria 3600
575 Ga0373931_0007116 3300035691 Bacteria 5260
576 Ga0373931_0199774 3300035691 Bacteria 1194
577 Ga0373935_0000678 3300035692 Bacteria 17989
578 Ga0373935_0393421 3300035692 Bacteria 994
579 Ga0373927_0001937 3300035695 Bacteria 15284
580 Ga0373927_0013273 3300035695 Bacteria 5476
581 Ga0373927_0022549 3300035695 Bacteria 4124
582 Ga0373927_0026546 3300035695 Bacteria 3785
583 Ga0373933_0009768 3300035724 Bacteria 5251
584 Ga0373947_0000512 3300035725 Bacteria 22553
585 Ga0373947_0019543 3300035725 Bacteria 3907
586 Ga0373947_0030272 3300035725 Bacteria 3180
587 Ga0373947_0053289 3300035725 Bacteria 2439
588 Ga0373937_0015895 3300036401 Bacteria 6674
589 Ga0373937_0034948 3300036401 Bacteria 4572
590 Ga0373937_0247000 3300036401 Bacteria 1682
591 Ga0373937_0734664 3300036401 Bacteria 934
592 Ga0316582_0107213 3300036647 Bacteria 1856
593 Ga0316584_0042274 3300036712 Bacteria 3399
594 Ga0373925_0009707 3300037068 Bacteria 7000
595 Ga0373925_0158233 3300037068 Bacteria 1783
596 Ga0373925_0159201 3300037068 Bacteria 1777
597 Ga0373925_0183545 3300037068 Bacteria 1657
598 Ga0395900_0102690 3300037418 Bacteria 2937
599 Ga0395898_0114153 3300037466 Bacteria 2588
600 Ga0395905_0004682 3300037471 Bacteria 14144
601 Ga0395905_0069654 3300037471 Bacteria 3295
602 Ga0395905_0208565 3300037471 Bacteria 1831
603 Ga0436365_1865970 3300039437 Bacteria 1261
604 Ga0436362_1291563 3300039453 Bacteria 1084
605 Ga0451577_0127016 3300042876 Bacteria 2285
606 Ga0466966_0038191 3300044684 Bacteria 3094
607 Ga0466961_0030412 3300044693 Bacteria 3470
608 Ga0466963_0000333 3300044694 Bacteria 21482
609 Ga0466963_0011090 3300044694 Bacteria 5480
610 Ga0466963_0032397 3300044694 Bacteria 3384
611 Ga0466963_0039521 3300044694 Bacteria 3089
612 Ga0466963_0039590 3300044694 Bacteria 3087
613 Ga0466963_0065666 3300044694 Bacteria 2433
614 Ga0453684_0042476 3300044712 Bacteria 6128
615 Ga0453684_0044084 3300044712 Bacteria 5979
616 Ga0466971_0010404 3300044719 Bacteria 4065
617 Ga0466971_0011623 3300044719 Bacteria 3854
618 Ga0466968_0006794 3300044735 Bacteria 4327
619 Ga0466968_0026467 3300044735 Bacteria 2381
620 Ga0466968_0110608 3300044735 Bacteria 1235
621 Ga0466968_0120622 3300044735 Bacteria 1186
622 Ga0466957_0002407 3300044842 Bacteria 10043
623 Ga0466957_0005553 3300044842 Bacteria 7085
624 Ga0466957_0011232 3300044842 Bacteria 5158
625 Ga0466957_0051591 3300044842 Bacteria 2504
626 Ga0466960_0075909 3300044901 Bacteria 1682
627 Ga0466959_0019196 3300045049 Bacteria 5026
628 Ga0451576_0000057 3300045051 Bacteria 300798
629 Ga0451576_0011125 3300045051 Bacteria 10266
630 Ga0451576_0034096 3300045051 Bacteria 5408
631 Ga0466958_0001168 3300045836 Bacteria 12216
632 Ga0466958_0004245 3300045836 Bacteria 7538
633 Ga0466958_0004419 3300045836 Bacteria 7423
634 Ga0466958_0013380 3300045836 Bacteria 4670
635 Ga0466958_0013508 3300045836 Bacteria 4650
636 Ga0466958_0091685 3300045836 Bacteria 1881
637 Ga0466967_0000297 3300045976 Bacteria 22234
638 Ga0466967_0020232 3300045976 Bacteria 5373
639 Ga0466967_0026963 3300045976 Bacteria 4770
640 Ga0466967_0058365 3300045976 Bacteria 3411
641 Ga0466967_0109721 3300045976 Bacteria 2533
642 Ga0466967_0234549 3300045976 Bacteria 1748
643 Ga0466967_0312618 3300045976 Bacteria 1514
644 Ga0466967_0379427 3300045976 Bacteria 1372
645 Ga0495592_0057799 3300046454 Bacteria 2863
646 Ga0495603_0000910 3300046455 Bacteria 16994
647 Ga0495603_0051213 3300046455 Bacteria 2454
648 Ga0495603_0282256 3300046455 Bacteria 954
649 Ga0495590_0017090 3300046457 Bacteria 2616
650 Ga0495629_0002174 3300046459 Bacteria 15143
651 Ga0495629_0095721 3300046459 Bacteria 2071
652 Ga0495638_0001151 3300046460 Bacteria 25469
653 Ga0495638_0019991 3300046460 Bacteria 4426
654 Ga0495641_0035838 3300046461 Bacteria 2335
655 Ga0495641_0189111 3300046461 Bacteria 922
656 Ga0495580_0038182 3300046472 Bacteria 3441
657 Ga0495582_0019547 3300046473 Bacteria 3704
658 Ga0495605_0027074 3300046474 Bacteria 2974
659 Ga0495605_0058646 3300046474 Bacteria 1850
660 Ga0495639_0003104 3300046475 Bacteria 7224
661 Ga0495662_0031267 3300046476 Bacteria 2571
662 Ga0495664_0114080 3300046477 Bacteria 1632
663 Ga0495594_0068750 3300046499 Bacteria 1967
664 Ga0495607_0098141 3300046501 Bacteria 1574
665 Ga0495583_0011669 3300046506 Bacteria 5033
666 Ga0495616_0060673 3300046513 Bacteria 1857
667 Ga0495618_0003910 3300046514 Bacteria 9205
668 Ga0495618_0017334 3300046514 Bacteria 4414
669 Ga0495620_0029039 3300046515 Bacteria 2564
670 Ga0495620_0072615 3300046515 Bacteria 1405
671 Ga0495630_0226645 3300046517 Bacteria 1427
672 Ga0495643_0012275 3300046522 Bacteria 5174
673 Ga0495643_0014725 3300046522 Bacteria 4646
674 Ga0495644_0046658 3300046523 Bacteria 1628
675 Ga0495644_0130921 3300046523 Bacteria 956
676 Ga0495648_0160294 3300046524 Bacteria 1164
677 Ga0495663_0106013 3300046525 Bacteria 930
678 Ga0495666_0030560 3300046526 Bacteria 2643
679 Ga0495642_0008919 3300046528 Bacteria 3838
680 Ga0495652_0018938 3300046529 Bacteria 6135
681 Ga0495665_0003399 3300046531 Bacteria 8641
682 Ga0495665_0147992 3300046531 Bacteria 1226
683 Ga0495640_0001822 3300046533 Bacteria 16907
684 Ga0495640_0039926 3300046533 Bacteria 3290
685 Ga0495586_0231095 3300046535 Bacteria 1052
686 Ga0495597_0056755 3300046542 Bacteria 1714
687 Ga0495633_0000063 3300046558 Bacteria 141657
688 Ga0495667_0072958 3300046559 Bacteria 2236
689 Ga0495656_0070161 3300046615 Bacteria 1554
690 Ga0495634_0000688 3300046642 Bacteria 32901
691 Ga0495634_0017644 3300046642 Bacteria 5091
692 Ga0495611_0138792 3300046648 Bacteria 1135
693 Ga0495625_0011610 3300046660 Bacteria 7166
694 Ga0495625_0061370 3300046660 Bacteria 2660
695 Ga0495635_0105941 3300046663 Bacteria 1921
696 Ga0495635_0245286 3300046663 Bacteria 1208
697 Ga0495661_0038474 3300046665 Bacteria 2979
698 Ga0495661_0105433 3300046665 Bacteria 1579
699 Ga0495657_0110364 3300046675 Bacteria 1743
700 Ga0495646_0048055 3300046680 Bacteria 2595
701 Ga0495647_0000251 3300046681 Bacteria 14648
702 Ga0495658_0009547 3300046683 Bacteria 4838
703 Ga0495658_0038260 3300046683 Bacteria 2656
704 Ga0495658_0038764 3300046683 Bacteria 2640
705 Ga0495658_0114976 3300046683 Bacteria 1622
706 Ga0495669_0184129 3300046684 Bacteria 996
707 Ga0495613_0053053 3300046689 Bacteria 2985
708 Ga0495613_0071912 3300046689 Bacteria 2521
709 Ga0495613_0153073 3300046689 Bacteria 1644
710 Ga0495624_0019040 3300046690 Bacteria 4586
711 Ga0495670_0184558 3300046691 Bacteria 1102
712 Ga0495671_0086299 3300046692 Bacteria 1538
713 Ga0495649_0014372 3300046694 Bacteria 4540
714 Ga0495660_0015386 3300046810 Bacteria 4421
715 Ga0495581_0005554 3300047315 Bacteria 7306
716 Ga0495581_0042923 3300047315 Bacteria 2616
717 Ga0495604_0037852 3300047317 Bacteria 3797
718 Ga0495604_0063525 3300047317 Bacteria 2816
719 Ga0495674_0001606 3300047319 Bacteria 22176
720 Ga0495674_0205282 3300047319 Bacteria 1634
721 Ga0495674_0361115 3300047319 Bacteria 1178
722 Ga0495674_0446745 3300047319 Bacteria 1039
723 Ga0495676_0001862 3300047321 Bacteria 18513
724 Ga0495676_0010663 3300047321 Bacteria 8324
725 Ga0495680_0004830 3300047322 Bacteria 12791
726 Ga0495683_0037293 3300047323 Bacteria 2465
727 Ga0495687_031905 3300047443 Bacteria 2410
728 Ga0495684_0001239 3300047471 Bacteria 20563
729 Ga0495686_0143651 3300047472 Bacteria 1406
730 Ga0495593_0012124 3300047673 Bacteria 4932
731 Ga0495602_0077707 3300048088 Bacteria 2807
732 Ga0495614_0002092 3300048089 Bacteria 8813
733 Ga0495615_0013716 3300048090 Bacteria 1698
734 Ga0496100_0000310 3300048903 Bacteria 24113
735 Ga0496100_0019395 3300048903 Bacteria 4056
736 Ga0496100_0026719 3300048903 Bacteria 3542
737 Ga0496100_0256854 3300048903 Bacteria 1294
738 Ga0496100_0280340 3300048903 Bacteria 1242
739 Ga0496101_0000500 3300048904 Bacteria 24613
740 Ga0496101_0006351 3300048904 Bacteria 7608
741 Ga0496101_0011376 3300048904 Bacteria 5903
742 Ga0496101_0011880 3300048904 Bacteria 5797
743 Ga0496101_0482904 3300048904 Bacteria 978
744 Ga0496102_0000679 3300048905 Bacteria 34025
745 Ga0496102_0016989 3300048905 Bacteria 6367
746 Ga0496102_0036207 3300048905 Bacteria 4445
747 Ga0496102_0050469 3300048905 Bacteria 3788
748 Ga0496102_0088989 3300048905 Bacteria 2855
749 Ga0496102_0130122 3300048905 Bacteria 2355
750 Ga0496102_0278265 3300048905 Bacteria 1577
751 Ga0496102_0304938 3300048905 Bacteria 1501
752 Ga0496102_0445213 3300048905 Bacteria 1215
753 Ga0496103_0000777 3300048906 Bacteria 23523
754 Ga0496103_0012623 3300048906 Bacteria 5011
755 Ga0496103_0026169 3300048906 Bacteria 3531
756 Ga0496103_0052199 3300048906 Bacteria 2532
757 Ga0496104_0000500 3300048907 Bacteria 33808
758 Ga0496104_0003660 3300048907 Bacteria 13270
759 Ga0496104_0007218 3300048907 Bacteria 9800
760 Ga0496104_0008355 3300048907 Bacteria 9200
761 Ga0496104_0043116 3300048907 Bacteria 4237
762 Ga0496104_0046659 3300048907 Bacteria 4080
763 Ga0496104_0083212 3300048907 Bacteria 3052
764 Ga0496104_0086082 3300048907 Bacteria 3000
765 Ga0496104_0616958 3300048907 Bacteria 994
766 Ga0496104_0715172 3300048907 Bacteria 909
767 Ga0496105_0000525 3300048908 Bacteria 25344
768 Ga0496105_0009717 3300048908 Bacteria 7535
769 Ga0496105_0027920 3300048908 Bacteria 4615
770 Ga0496105_0028263 3300048908 Bacteria 4587
771 Ga0496105_0140192 3300048908 Bacteria 1990
772 Ga0496106_0000323 3300048909 Bacteria 33743
773 Ga0496106_0023005 3300048909 Bacteria 4629
774 Ga0496106_0058250 3300048909 Bacteria 2924
775 Ga0496106_0080140 3300048909 Bacteria 2507
776 Ga0496106_0160185 3300048909 Bacteria 1779
777 Ga0496106_0203361 3300048909 Bacteria 1576
778 Ga0496106_0576156 3300048909 Bacteria 902
779 Ga0496107_0003179 3300048910 Bacteria 10921
780 Ga0496107_0020418 3300048910 Bacteria 4679
781 Ga0496107_0088609 3300048910 Bacteria 2259
782 Ga0496107_0113779 3300048910 Bacteria 1990
783 Ga0496107_0165338 3300048910 Bacteria 1640
784 Ga0496107_0388727 3300048910 Bacteria 1038
785 Ga0496108_0001888 3300048911 Bacteria 16784
786 Ga0496108_0003718 3300048911 Bacteria 12234
787 Ga0496108_0032005 3300048911 Bacteria 4365
788 Ga0496108_0056998 3300048911 Bacteria 3283
789 Ga0496108_0107602 3300048911 Bacteria 2381
790 Ga0496108_0162035 3300048911 Bacteria 1933
791 Ga0496108_0182308 3300048911 Bacteria 1818
792 Ga0496109_0000493 3300048912 Bacteria 33784
793 Ga0496109_0010883 3300048912 Bacteria 7789
794 Ga0496109_0020842 3300048912 Bacteria 5792
795 Ga0496109_0026456 3300048912 Bacteria 5174
796 Ga0496109_0032798 3300048912 Bacteria 4671
797 Ga0496109_0073582 3300048912 Bacteria 3140
798 Ga0496109_0098334 3300048912 Bacteria 2713
799 Ga0496109_0213456 3300048912 Bacteria 1815
800 Ga0496109_0351492 3300048912 Bacteria 1392
801 Ga0496110_0003830 3300048913 Bacteria 11584
802 Ga0496110_0011097 3300048913 Bacteria 7360
803 Ga0496110_0011459 3300048913 Bacteria 7257
804 Ga0496110_0013354 3300048913 Bacteria 6786
805 Ga0496110_0042347 3300048913 Bacteria 3974
806 Ga0496110_0112651 3300048913 Bacteria 2446
807 Ga0496111_0001343 3300048914 Bacteria 13890
808 Ga0496111_0005703 3300048914 Bacteria 8023
809 Ga0496111_0016571 3300048914 Bacteria 5080
810 Ga0496111_0041058 3300048914 Bacteria 3319
811 Ga0496111_0148208 3300048914 Bacteria 1740
812 Ga0496111_0156803 3300048914 Bacteria 1689
813 Ga0496111_0319292 3300048914 Bacteria 1150
814 Ga0496112_0001321 3300048915 Bacteria 18847
815 Ga0496112_0011501 3300048915 Bacteria 8084
816 Ga0496112_0018168 3300048915 Bacteria 6617
817 Ga0496112_0053484 3300048915 Bacteria 3966
818 Ga0496112_0075196 3300048915 Bacteria 3341
819 Ga0496113_0000869 3300048916 Bacteria 15820
820 Ga0496113_0001628 3300048916 Bacteria 12652
821 Ga0496113_0009474 3300048916 Bacteria 6388
822 Ga0496113_0036308 3300048916 Bacteria 3610
823 Ga0496113_0037654 3300048916 Bacteria 3552
824 Ga0496113_0153801 3300048916 Bacteria 1816
825 Ga0496113_0219364 3300048916 Bacteria 1515
826 Ga0496113_0354671 3300048916 Bacteria 1177
827 Ga0496113_0580105 3300048916 Bacteria 898
828 Ga0496114_0005594 3300048917 Bacteria 9851
829 Ga0496114_0073191 3300048917 Bacteria 2883
830 Ga0496114_0147392 3300048917 Bacteria 2041
831 Ga0496114_0157425 3300048917 Bacteria 1973
832 Ga0496114_0181580 3300048917 Bacteria 1838
833 Ga0496114_0184021 3300048917 Bacteria 1825
834 Ga0496114_0189620 3300048917 Bacteria 1798
835 Ga0496115_0001322 3300048918 Bacteria 17672
836 Ga0496115_0044026 3300048918 Bacteria 3559
837 Ga0496115_0065754 3300048918 Bacteria 2929
838 Ga0496115_0172643 3300048918 Bacteria 1788
839 Ga0496115_0477898 3300048918 Bacteria 1004
840 Ga0496115_0523387 3300048918 Bacteria 951
841 Ga0496116_0041215 3300048919 Bacteria 3170
842 Ga0496117_0008368 3300048920 Bacteria 9837
843 Ga0496117_0176720 3300048920 Bacteria 1232
844 Ga0496118_0008003 3300048921 Bacteria 11047
845 Ga0496121_0000643 3300048924 Bacteria 65217
846 Ga0496121_0059299 3300048924 Bacteria 3157
847 Ga0496121_0064933 3300048924 Bacteria 2973
848 Ga0496122_0119563 3300048925 Bacteria 1703
849 Ga0496122_0170271 3300048925 Bacteria 1314
850 Ga0496123_0029826 3300048926 Bacteria 4005
851 Ga0496124_0118073 3300048927 Bacteria 2124
852 Ga0496124_0498302 3300048927 Bacteria 817
853 Ga0496125_0047289 3300048928 Bacteria 3600
854 Ga0496125_0112820 3300048928 Bacteria 1963
855 Ga0496126_0365379 3300048929 Bacteria 1178
856 Ga0495678_041849 3300049459 Bacteria 1830
857 Ga0501031_0005436 3300049568 Bacteria 8293
858 Ga0501031_0190025 3300049568 Bacteria 1341
859 Ga0501032_0017369 3300049569 Bacteria 5052
860 Ga0501033_0003024 3300049570 Bacteria 14013
861 Ga0501033_0086874 3300049570 Bacteria 2289
862 Ga0501034_0004465 3300049571 Bacteria 15554
863 Ga0501034_0005912 3300049571 Bacteria 13279
864 Ga0501034_0008051 3300049571 Bacteria 11187
865 Ga0501034_0363252 3300049571 Bacteria 1375
866 Ga0501036_0073195 3300049572 Bacteria 2897
867 Ga0501037_0010019 3300049573 Bacteria 6951
868 Ga0501038_0003860 3300049574 Bacteria 13931
869 Ga0501039_0006970 3300049575 Bacteria 8606
870 Ga0501039_0015604 3300049575 Bacteria 5813
871 Ga0501039_0648091 3300049575 Bacteria 827
872 Ga0501040_0335103 3300049576 Bacteria 1083
873 Ga0501041_0002801 3300049577 Bacteria 9960
874 Ga0501041_0422764 3300049577 Bacteria 845
875 Ga0501042_0004936 3300049578 Bacteria 8541
876 Ga0501042_0066842 3300049578 Bacteria 2570
877 Ga0501043_0008009 3300049579 Bacteria 8341
878 Ga0501046_0061889 3300049580 Bacteria 2925
879 Ga0501047_0005106 3300049581 Bacteria 12316
880 Ga0501047_0119207 3300049581 Bacteria 2521
881 Ga0501047_0195397 3300049581 Bacteria 1885
882 Ga0501048_0006714 3300049582 Bacteria 8742
883 Ga0501048_0426245 3300049582 Bacteria 949
884 Ga0501067_0051323 3300049583 Bacteria 2286
885 Ga0501068_0001358 3300049584 Bacteria 12976
886 Ga0501068_0017296 3300049584 Bacteria 4169
887 Ga0501069_0002413 3300049585 Bacteria 9501
888 Ga0501069_0109390 3300049585 Bacteria 1573
889 Ga0501070_0023475 3300049586 Bacteria 5166
890 Ga0501070_0023781 3300049586 Bacteria 5135
891 Ga0501071_0006163 3300049587 Bacteria 7774
892 Ga0501071_0195123 3300049587 Bacteria 1519
893 Ga0501072_0004774 3300049588 Bacteria 10318
894 Ga0501072_0015146 3300049588 Bacteria 5913
895 Ga0501073_0004766 3300049589 Bacteria 10179
896 Ga0501074_0020411 3300049590 Bacteria 4815
897 Ga0501075_0015205 3300049591 Bacteria 5520
898 Ga0501075_0028467 3300049591 Bacteria 4124
899 Ga0501075_0040374 3300049591 Bacteria 3494
900 Ga0501075_0364602 3300049591 Bacteria 1101
901 Ga0501076_0004393 3300049592 Bacteria 10022
902 Ga0501076_0015056 3300049592 Bacteria 5840
903 Ga0501076_0022336 3300049592 Bacteria 4863
904 Ga0501077_0005390 3300049593 Bacteria 7774
905 Ga0501077_0049664 3300049593 Bacteria 2665
906 Ga0501079_0003856 3300049741 Bacteria 11063
907 Ga0501079_0070516 3300049741 Bacteria 2699
908 Ga0501079_0088355 3300049741 Bacteria 2400
909 Ga0501080_0003042 3300049742 Bacteria 14800
910 Ga0501080_0556852 3300049742 Bacteria 1021
911 Ga0501080_0984115 3300049742 Bacteria 732
912 Ga0501081_0085219 3300049743 Bacteria 2217
913 Ga0501083_0002239 3300049744 Bacteria 13224
914 Ga0501083_0053884 3300049744 Bacteria 2700
915 Ga0501035_0004259 3300049822 Bacteria 13581
916 Ga0501044_0023054 3300049823 Bacteria 6626
917 Ga0501044_0034557 3300049823 Bacteria 5300
918 Ga0501044_0079274 3300049823 Bacteria 3328
919 Ga0501045_0005270 3300049824 Bacteria 8950
920 Ga0501045_0005895 3300049824 Bacteria 8477
921 Ga0501045_0156553 3300049824 Bacteria 1695
922 nmdc:mga03683_28853_c1 3300050489 Bacteria 2209
923 nmdc:mga03683_72291_c1 3300050489 Bacteria 1477
924 nmdc:mga00v17_130434_c1 3300050491 Bacteria 1606
925 nmdc:mga00v17_178915_c1 3300050491 Bacteria 1368
926 nmdc:mga00v17_31_c1 3300050491 Bacteria 87312
927 nmdc:mga0yw44_104652_c1 3300050492 Bacteria 1807
928 nmdc:mga0yw44_18397_c1 3300050492 Bacteria 3826
929 nmdc:mga0yw44_186330_c1 3300050492 Bacteria 1367
930 nmdc:mga0yw44_2715_c1 3300050492 Bacteria 7645
931 nmdc:mga0yw44_58881_c1 3300050492 Bacteria 2348
932 nmdc:mga0k408_3653_c1 3300050493 Bacteria 8142
933 nmdc:mga06z11_159847_c1 3300050494 Bacteria 1287
934 nmdc:mga07m45_279627_c1 3300050496 Bacteria 971
935 nmdc:mga07m45_39299_c1 3300050496 Bacteria 2643
936 nmdc:mga05p37_120842_c1 3300050507 Bacteria 3218
937 nmdc:mga05p37_24147_c1 3300050507 Bacteria 7385
938 nmdc:mga05p37_276593_c1 3300050507 Bacteria 2004
939 nmdc:mga05p37_383_c1 3300050507 Bacteria 47792
940 nmdc:mga05p37_44079_c1 3300050507 Bacteria 5489
941 nmdc:mga05p37_531_c1 3300050507 Bacteria 42040
942 nmdc:mga09592_247433_c1 3300050508 Bacteria 1545
943 nmdc:mga09592_274481_c1 3300050508 Bacteria 1462
944 nmdc:mga09592_4666_c1 3300050508 Bacteria 11094
945 nmdc:mga09592_78098_c1 3300050508 Bacteria 2817
946 nmdc:mga09592_8311_c1 3300050508 Bacteria 8442
947 nmdc:mga09592_84470_c1 3300050508 Bacteria 2707
948 nmdc:mga0qj67_14148_c1 3300050509 Bacteria 6027
949 nmdc:mga0qj67_413_c1 3300050509 Bacteria 29228
950 nmdc:mga0qj67_61543_c1 3300050509 Bacteria 2981
951 nmdc:mga0qj67_72216_c1 3300050509 Bacteria 2755
952 nmdc:mga0qj67_92854_c1 3300050509 Bacteria 2426
953 nmdc:mga06r32_173575_c1 3300050510 Bacteria 2140
954 nmdc:mga06r32_1915_c1 3300050510 Bacteria 18535
955 nmdc:mga06r32_711_c2 3300050510 Bacteria 27826
956 nmdc:mga08y16_114652_c1 3300050511 Bacteria 2806
957 nmdc:mga08y16_23328_c1 3300050511 Bacteria 6536
958 nmdc:mga08y16_369_c1 3300050511 Bacteria 40785
959 nmdc:mga08y16_417932_c1 3300050511 Bacteria 1371
960 nmdc:mga08y16_67091_c1 3300050511 Bacteria 3743
961 nmdc:mga08y16_73920_c1 3300050511 Bacteria 3552
962 nmdc:mga0n895_137616_c1 3300050512 Bacteria 2469
963 nmdc:mga0n895_209_c1 3300050512 Bacteria 36635
964 nmdc:mga0n895_260850_c1 3300050512 Bacteria 1758
965 nmdc:mga0n895_313143_c1 3300050512 Bacteria 1591
966 nmdc:mga0n895_36911_c1 3300050512 Bacteria 4722
967 nmdc:mga0n895_515963_c1 3300050512 Bacteria 1203
968 nmdc:mga0rr50_591_c1 3300050513 Bacteria 19417
969 nmdc:mga0rr50_91735_c1 3300050513 Bacteria 2367
970 nmdc:mga0a205_1233_c1 3300050515 Bacteria 21462
971 nmdc:mga0a205_135810_c1 3300050515 Bacteria 2360
972 nmdc:mga0a205_318146_c1 3300050515 Bacteria 1427
973 nmdc:mga0a205_83824_c1 3300050515 Bacteria 3079
974 nmdc:mga0sz30_22184_c1 3300050516 Bacteria 2575
975 Ga0495601_0000647 3300053077 Bacteria 18571
976 Ga0495601_0002386 3300053077 Bacteria 10655
977 Ga0495601_0063468 3300053077 Bacteria 2348
978 Ga0495612_0006165 3300053078 Bacteria 4934
979 Ga0500610_0086566 3300053079 Bacteria 1630
980 Ga0495655_0024574 3300053083 Bacteria 1401
981 Ga0495595_0000537 3300053084 Bacteria 14481
982 Ga0495595_0097936 3300053084 Bacteria 1413
983 Ga0495595_0165472 3300053084 Bacteria 1093
984 Ga0495619_0022151 3300053085 Bacteria 4062
985 Ga0495619_0029197 3300053085 Bacteria 3562
986 Ga0495619_0041968 3300053085 Bacteria 2994
987 Ga0500643_021588 3300053087 Bacteria 2084
988 Ga0500566_0011276 3300053094 Bacteria 5265
989 Ga0500650_0000958 3300053098 Bacteria 8142
990 Ga0500562_005421 3300053108 Bacteria 3204
991 Ga0500608_018675 3300053122 Bacteria 3168
992 Ga0500618_001056 3300053125 Bacteria 13684
993 Ga0500618_024229 3300053125 Bacteria 1463
994 Ga0500655_013080 3300053133 Bacteria 1512
995 Ga0500559_0000932 3300053136 Bacteria 18458
996 Ga0500568_0002600 3300053139 Bacteria 10494
997 Ga0500574_038835 3300053141 Bacteria 1319
998 Ga0500590_049704 3300053148 Bacteria 2134
999 Ga0500604_0026027 3300053151 Bacteria 1685
1000 Ga0500616_0000033 3300053153 Bacteria 398830
1001 Ga0500622_0000073 3300053156 Bacteria 111045
1002 Ga0500634_0000656 3300053161 Bacteria 11746
1003 Ga0500638_015637 3300053162 Bacteria 3485
1004 Ga0500636_0000712 3300053177 Bacteria 17867
1005 Ga0500636_0069941 3300053177 Bacteria 2037
1006 Ga0500645_044128 3300053730 Bacteria 1312
1007 Ga0501084_0011336 3300054114 Bacteria 7383
1008 Ga0501084_0014881 3300054114 Bacteria 6452
1009 Ga0501084_0404894 3300054114 Bacteria 1153
1010 Ga0501082_0005629 3300060353 Bacteria 10874
1011 Ga0501082_0535132 3300060353 Bacteria 1024
1012 Ga0466962_0017570 3300061719 Bacteria 3443
1013 Ga0466962_0038099 3300061719 Bacteria 2303
1014 Ga0466962_0144013 3300061719 Bacteria 1155
1015 Ga0530510_0015211 3300061734 Bacteria 5433
1016 Ga0530510_0140646 3300061734 Bacteria 1778

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10466703 Ga0114129_104667032 207
2 3300044693 Ga0466961_0030412 Ga0466961_0030412_2620_3264 207
3 3300044694 Ga0466963_0032397 Ga0466963_0032397_1616_2260 207
4 3300044735 Ga0466968_0006794 Ga0466968_0006794_2041_2685 207
5 3300044842 Ga0466957_0005553 Ga0466957_0005553_208_852 207
6 3300045049 Ga0466959_0019196 Ga0466959_0019196_3131_3775 207
7 3300045836 Ga0466958_0013508 Ga0466958_0013508_62_706 207
8 3300061719 Ga0466962_0017570 Ga0466962_0017570_208_852 207
9 3300037418 Ga0395900_0102690 Ga0395900_0102690_2236_2901 214
10 3300046454 Ga0495592_0057799 Ga0495592_0057799_443_1108 214
11 3300045976 Ga0466967_0058365 Ga0466967_0058365_2237_2905 215
12 3300045976 Ga0466967_0234549 Ga0466967_0234549_857_1525 215
13 3300044694 Ga0466963_0011090 Ga0466963_0011090_497_1168 216
14 3300044735 Ga0466968_0026467 Ga0466968_0026467_235_906 216
15 3300045836 Ga0466958_0004245 Ga0466958_0004245_4185_4856 216
16 3300045976 Ga0466967_0379427 Ga0466967_0379427_211_882 216
17 3300048917 Ga0496114_0157425 Ga0496114_0157425_1185_1862 218
18 3300005435 Ga0070714_100046287 Ga0070714_1000462873 219
19 3300045976 Ga0466967_0026963 Ga0466967_0026963_3206_3892 221
20 3300035171 Ga0373946_0064684 Ga0373946_0064684_176_964 222
21 3300005937 Ga0081455_10143757 Ga0081455_101437571 225
22 3300046684 Ga0495669_0184129 Ga0495669_0184129_11_709 226
23 3300048909 Ga0496106_0576156 Ga0496106_0576156_13_720 226
24 3300049742 Ga0501080_0984115 Ga0501080_0984115_21_719 226
25 3300005618 Ga0068864_100157159 Ga0068864_1001571591 227
26 3300014325 Ga0163163_10147751 Ga0163163_101477513 227
27 3300014497 Ga0182008_10193696 Ga0182008_101936962 227
28 3300026095 Ga0207676_10567161 Ga0207676_105671612 227
29 3300026118 Ga0207675_100206992 Ga0207675_1002069922 227
30 3300005328 Ga0070676_10042146 Ga0070676_100421463 228
31 3300005329 Ga0070683_100343710 Ga0070683_1003437102 228
32 3300005334 Ga0068869_100076568 Ga0068869_1000765682 228
33 3300005336 Ga0070680_100007553 Ga0070680_1000075538 228
34 3300005337 Ga0070682_100360308 Ga0070682_1003603082 228
35 3300005339 Ga0070660_100376427 Ga0070660_1003764272 228
36 3300005366 Ga0070659_100075313 Ga0070659_1000753132 228
37 3300005444 Ga0070694_100030678 Ga0070694_1000306784 228
38 3300005530 Ga0070679_100074303 Ga0070679_1000743033 228
39 3300005535 Ga0070684_100072514 Ga0070684_1000725143 228
40 3300005547 Ga0070693_100017405 Ga0070693_1000174051 228
41 3300005578 Ga0068854_100360164 Ga0068854_1003601642 228
42 3300005719 Ga0068861_100303616 Ga0068861_1003036162 228
43 3300006058 Ga0075432_10004288 Ga0075432_100042884 228
44 3300006844 Ga0075428_100001371 Ga0075428_1000013719 228
45 3300006880 Ga0075429_100043337 Ga0075429_1000433373 228
46 3300009094 Ga0111539_10003651 Ga0111539_100036517 228
47 3300009098 Ga0105245_10003235 Ga0105245_100032354 228
48 3300009147 Ga0114129_10007210 Ga0114129_1000721012 228
49 3300009148 Ga0105243_10092321 Ga0105243_100923212 228
50 3300009551 Ga0105238_10395151 Ga0105238_103951512 228
51 3300010375 Ga0105239_10028385 Ga0105239_100283854 228
52 3300014745 Ga0157377_10012661 Ga0157377_100126613 228
53 3300025901 Ga0207688_10004774 Ga0207688_100047746 228
54 3300025907 Ga0207645_10100904 Ga0207645_101009042 228
55 3300025912 Ga0207707_10168888 Ga0207707_101688882 228
56 3300025926 Ga0207659_10245756 Ga0207659_102457562 228
57 3300025927 Ga0207687_10004767 Ga0207687_100047676 228
58 3300025933 Ga0207706_10110449 Ga0207706_101104491 228
59 3300025935 Ga0207709_10004733 Ga0207709_100047332 228
60 3300025949 Ga0207667_10582082 Ga0207667_105820822 228
61 3300026041 Ga0207639_10203555 Ga0207639_102035552 228
62 3300027907 Ga0207428_10001271 Ga0207428_100012719 228
63 3300044901 Ga0466960_0075909 Ga0466960_0075909_425_1132 228
64 3300049572 Ga0501036_0073195 Ga0501036_0073195_464_1243 228
65 3300049575 Ga0501039_0015604 Ga0501039_0015604_1686_2465 228
66 3300049578 Ga0501042_0066842 Ga0501042_0066842_551_1330 228
67 3300049580 Ga0501046_0061889 Ga0501046_0061889_1460_2239 228
68 3300049584 Ga0501068_0017296 Ga0501068_0017296_2209_2988 228
69 3300049585 Ga0501069_0109390 Ga0501069_0109390_655_1434 228
70 3300049586 Ga0501070_0023475 Ga0501070_0023475_1754_2533 228
71 3300049587 Ga0501071_0195123 Ga0501071_0195123_262_1041 228
72 3300049588 Ga0501072_0004774 Ga0501072_0004774_8933_9712 228
73 3300049591 Ga0501075_0028467 Ga0501075_0028467_2657_3436 228
74 3300049592 Ga0501076_0015056 Ga0501076_0015056_3376_4155 228
75 3300049593 Ga0501077_0049664 Ga0501077_0049664_99_878 228
76 3300049742 Ga0501080_0003042 Ga0501080_0003042_6588_7367 228
77 3300049744 Ga0501083_0053884 Ga0501083_0053884_1385_2164 228
78 3300049824 Ga0501045_0005895 Ga0501045_0005895_6792_7571 228
79 3300050507 nmdc:mga05p37_44079_c1 nmdc:mga05p37_44079_c1_3424_4203 228
80 3300050508 nmdc:mga09592_84470_c1 nmdc:mga09592_84470_c1_1653_2432 228
81 3300050511 nmdc:mga08y16_114652_c1 nmdc:mga08y16_114652_c1_830_1609 228
82 3300054114 Ga0501084_0011336 Ga0501084_0011336_5882_6661 228
83 3300061734 Ga0530510_0015211 Ga0530510_0015211_2035_2814 228
84 3300045976 Ga0466967_0312618 Ga0466967_0312618_116_826 229
85 3300048911 Ga0496108_0056998 Ga0496108_0056998_1685_2395 229
86 3300048912 Ga0496109_0032798 Ga0496109_0032798_3716_4426 229
87 3300048916 Ga0496113_0037654 Ga0496113_0037654_1004_1714 229
88 3300048917 Ga0496114_0147392 Ga0496114_0147392_945_1655 229
89 3300049568 Ga0501031_0005436 Ga0501031_0005436_2761_3471 229
90 3300049569 Ga0501032_0017369 Ga0501032_0017369_4326_5036 229
91 3300049570 Ga0501033_0003024 Ga0501033_0003024_5318_6028 229
92 3300049571 Ga0501034_0004465 Ga0501034_0004465_10875_11585 229
93 3300049573 Ga0501037_0010019 Ga0501037_0010019_3486_4196 229
94 3300049574 Ga0501038_0003860 Ga0501038_0003860_8235_8945 229
95 3300049575 Ga0501039_0006970 Ga0501039_0006970_6525_7235 229
96 3300049577 Ga0501041_0002801 Ga0501041_0002801_4080_4790 229
97 3300049578 Ga0501042_0004936 Ga0501042_0004936_3486_4196 229
98 3300049579 Ga0501043_0008009 Ga0501043_0008009_4181_4891 229
99 3300049581 Ga0501047_0195397 Ga0501047_0195397_673_1383 229
100 3300049582 Ga0501048_0006714 Ga0501048_0006714_3687_4397 229
101 3300049584 Ga0501068_0001358 Ga0501068_0001358_3911_4621 229
102 3300049585 Ga0501069_0002413 Ga0501069_0002413_2927_3637 229
103 3300049586 Ga0501070_0023781 Ga0501070_0023781_1500_2210 229
104 3300049587 Ga0501071_0006163 Ga0501071_0006163_3486_4196 229
105 3300049588 Ga0501072_0015146 Ga0501072_0015146_2276_2986 229
106 3300049589 Ga0501073_0004766 Ga0501073_0004766_4289_4999 229
107 3300049590 Ga0501074_0020411 Ga0501074_0020411_1372_2082 229
108 3300049591 Ga0501075_0040374 Ga0501075_0040374_1500_2210 229
109 3300049592 Ga0501076_0004393 Ga0501076_0004393_3830_4540 229
110 3300049593 Ga0501077_0005390 Ga0501077_0005390_3579_4289 229
111 3300049744 Ga0501083_0002239 Ga0501083_0002239_5224_5934 229
112 3300049822 Ga0501035_0004259 Ga0501035_0004259_7672_8382 229
113 3300049823 Ga0501044_0023054 Ga0501044_0023054_2304_3014 229
114 3300049824 Ga0501045_0005270 Ga0501045_0005270_5313_6023 229
115 3300060353 Ga0501082_0005629 Ga0501082_0005629_5178_5888 229
116 3300049741 Ga0501079_0070516 Ga0501079_0070516_27_740 230
117 3300049575 Ga0501039_0648091 Ga0501039_0648091_38_787 232
118 3300005331 Ga0070670_100034285 Ga0070670_1000342852 235
119 3300005435 Ga0070714_100073796 Ga0070714_1000737963 235
120 3300005563 Ga0068855_100017227 Ga0068855_1000172277 235
121 3300006871 Ga0075434_100355241 Ga0075434_1003552412 235
122 3300009094 Ga0111539_10410115 Ga0111539_104101152 235
123 3300009101 Ga0105247_10316669 Ga0105247_103166691 235
124 3300009147 Ga0114129_10033314 Ga0114129_100333148 235
125 3300013306 Ga0163162_10542747 Ga0163162_105427471 235
126 3300014325 Ga0163163_10026975 Ga0163163_100269752 235
127 3300014968 Ga0157379_10711286 Ga0157379_107112862 235
128 3300025919 Ga0207657_10006225 Ga0207657_100062259 235
129 3300025925 Ga0207650_10254780 Ga0207650_102547801 235
130 3300025929 Ga0207664_10164862 Ga0207664_101648622 235
131 3300025949 Ga0207667_10088505 Ga0207667_100885053 235
132 3300026041 Ga0207639_10178370 Ga0207639_101783702 235
133 3300035084 Ga0373928_0033520 Ga0373928_0033520_221_1009 235
134 3300046457 Ga0495590_0017090 Ga0495590_0017090_1611_2396 235
135 3300046513 Ga0495616_0060673 Ga0495616_0060673_190_975 235
136 3300046522 Ga0495643_0012275 Ga0495643_0012275_3414_4199 235
137 3300046542 Ga0495597_0056755 Ga0495597_0056755_590_1375 235
138 3300046648 Ga0495611_0138792 Ga0495611_0138792_303_1088 235
139 3300046660 Ga0495625_0061370 Ga0495625_0061370_680_1465 235
140 3300047323 Ga0495683_0037293 Ga0495683_0037293_1034_1819 235
141 3300048905 Ga0496102_0088989 Ga0496102_0088989_1793_2581 235
142 3300048906 Ga0496103_0052199 Ga0496103_0052199_427_1215 235
143 3300048907 Ga0496104_0046659 Ga0496104_0046659_3048_3836 235
144 3300048908 Ga0496105_0009717 Ga0496105_0009717_6504_7292 235
145 3300048909 Ga0496106_0160185 Ga0496106_0160185_357_1145 235
146 3300048910 Ga0496107_0113779 Ga0496107_0113779_531_1319 235
147 3300048911 Ga0496108_0003718 Ga0496108_0003718_7853_8641 235
148 3300048912 Ga0496109_0010883 Ga0496109_0010883_6820_7608 235
149 3300048914 Ga0496111_0005703 Ga0496111_0005703_6492_7280 235
150 3300048915 Ga0496112_0018168 Ga0496112_0018168_29_817 235
151 3300048916 Ga0496113_0001628 Ga0496113_0001628_7477_8265 235
152 3300048917 Ga0496114_0184021 Ga0496114_0184021_847_1635 235
153 3300049459 Ga0495678_041849 Ga0495678_041849_857_1642 235
154 3300050507 nmdc:mga05p37_24147_c1 nmdc:mga05p37_24147_c1_3173_3961 235
155 3300050511 nmdc:mga08y16_417932_c1 nmdc:mga08y16_417932_c1_339_1127 235
156 3300050512 nmdc:mga0n895_313143_c1 nmdc:mga0n895_313143_c1_373_1161 235
157 3300005563 Ga0068855_100567348 Ga0068855_1005673482 236
158 3300039453 Ga0436362_1291563 Ga0436362_1291563_305_1072 236
159 3300044694 Ga0466963_0039521 Ga0466963_0039521_1116_1883 236
160 3300044694 Ga0466963_0065666 Ga0466963_0065666_304_1071 236
161 3300044719 Ga0466971_0011623 Ga0466971_0011623_1989_2756 236
162 3300044735 Ga0466968_0120622 Ga0466968_0120622_183_950 236
163 3300044842 Ga0466957_0002407 Ga0466957_0002407_4761_5528 236
164 3300045836 Ga0466958_0001168 Ga0466958_0001168_4641_5408 236
165 3300046506 Ga0495583_0011669 Ga0495583_0011669_3186_3971 236
166 3300046694 Ga0495649_0014372 Ga0495649_0014372_685_1470 236
167 3300046810 Ga0495660_0015386 Ga0495660_0015386_3171_3956 236
168 3300047443 Ga0495687_031905 Ga0495687_031905_176_961 236
169 3300047472 Ga0495686_0143651 Ga0495686_0143651_196_981 236
170 3300061719 Ga0466962_0038099 Ga0466962_0038099_1039_1806 236
171 3300061719 Ga0466962_0144013 Ga0466962_0144013_10_777 236
172 3300005337 Ga0070682_100317335 Ga0070682_1003173352 237
173 3300005456 Ga0070678_100230441 Ga0070678_1002304412 237
174 3300005458 Ga0070681_10063813 Ga0070681_100638133 237
175 3300005530 Ga0070679_100182765 Ga0070679_1001827652 237
176 3300005545 Ga0070695_100003825 Ga0070695_1000038256 237
177 3300005841 Ga0068863_100612742 Ga0068863_1006127421 237
178 3300009093 Ga0105240_10032220 Ga0105240_100322204 237
179 3300009545 Ga0105237_10026808 Ga0105237_100268083 237
180 3300013307 Ga0157372_10017920 Ga0157372_100179205 237
181 3300025912 Ga0207707_10077105 Ga0207707_100771052 237
182 3300025913 Ga0207695_10251855 Ga0207695_102518552 237
183 3300025915 Ga0207693_10234584 Ga0207693_102345842 237
184 3300025916 Ga0207663_10132781 Ga0207663_101327812 237
185 3300025921 Ga0207652_10364747 Ga0207652_103647472 237
186 3300026121 Ga0207683_10264680 Ga0207683_102646802 237
187 3300031824 Ga0307413_10041893 Ga0307413_100418932 237
188 3300039437 Ga0436365_1865970 Ga0436365_1865970_472_1236 237
189 3300044694 Ga0466963_0000333 Ga0466963_0000333_13523_14296 237
190 3300044694 Ga0466963_0039590 Ga0466963_0039590_1976_2740 237
191 3300044735 Ga0466968_0110608 Ga0466968_0110608_290_1063 237
192 3300044842 Ga0466957_0011232 Ga0466957_0011232_86_859 237
193 3300044842 Ga0466957_0051591 Ga0466957_0051591_1206_1979 237
194 3300045836 Ga0466958_0004419 Ga0466958_0004419_3771_4544 237
195 3300045836 Ga0466958_0091685 Ga0466958_0091685_152_916 237
196 3300045976 Ga0466967_0000297 Ga0466967_0000297_18768_19541 237
197 3300045976 Ga0466967_0020232 Ga0466967_0020232_1378_2142 237
198 3300048905 Ga0496102_0036207 Ga0496102_0036207_2952_3725 237
199 3300048906 Ga0496103_0012623 Ga0496103_0012623_94_867 237
200 3300031824 Ga0307413_10003248 Ga0307413_100032486 238
201 3300031911 Ga0307412_10191080 Ga0307412_101910801 238
202 3300031995 Ga0307409_100021337 Ga0307409_1000213372 238
203 3300032002 Ga0307416_100026408 Ga0307416_1000264084 238
204 3300032004 Ga0307414_10083086 Ga0307414_100830862 238
205 3300045976 Ga0466967_0109721 Ga0466967_0109721_330_1100 238
206 3300006175 Ga0070712_100271120 Ga0070712_1002711202 239
207 3300025915 Ga0207693_10009517 Ga0207693_100095176 239
208 iso_pu_bacteria 2939631187 2939634463 239
209 3300048904 Ga0496101_0006351 Ga0496101_0006351_4836_5600 240
210 3300025294 Ga0209025_1027868 Ga0209025_10278683 241
211 3300025298 Ga0209050_1021841 Ga0209050_10218412 241
212 3300035114 Ga0373939_0005135 Ga0373939_0005135_1940_2728 241
213 3300048919 Ga0496116_0041215 Ga0496116_0041215_2224_2982 241
214 3300048920 Ga0496117_0176720 Ga0496117_0176720_88_846 241
215 3300048924 Ga0496121_0064933 Ga0496121_0064933_2128_2886 241
216 3300048926 Ga0496123_0029826 Ga0496123_0029826_1331_2089 241
217 3300048928 Ga0496125_0112820 Ga0496125_0112820_219_977 241
218 3300050512 nmdc:mga0n895_515963_c1 nmdc:mga0n895_515963_c1_443_1186 241
219 3300003187 JGI25151J46595_10020173 JGI25151J46595_100201733 242
220 3300025294 Ga0209025_1000325 Ga0209025_100032530 242
221 iso_pu_bacteria 2643221658 2644325202 242
222 iso_pu_bacteria 2738541307 2738883099 242
223 3300009094 Ga0111539_11142077 Ga0111539_111420771 243
224 3300025937 Ga0207669_10266642 Ga0207669_102666422 243
225 3300026067 Ga0207678_10539024 Ga0207678_105390242 243
226 3300048918 Ga0496115_0523387 Ga0496115_0523387_86_880 243
227 iso_pu_bacteria 2904541872 2904548939 243
228 iso_pu_bacteria 2929160207 2929160942 243
229 iso_pu_bacteria 8054563764 8054568490 243
230 3300006194 Ga0075427_10001837 Ga0075427_100018373 244
231 3300006844 Ga0075428_100002667 Ga0075428_1000026679 244
232 3300006846 Ga0075430_100000770 Ga0075430_1000007704 244
233 3300006847 Ga0075431_100000399 Ga0075431_10000039923 244
234 3300006852 Ga0075433_10000374 Ga0075433_100003747 244
235 3300006871 Ga0075434_100001253 Ga0075434_10000125316 244
236 3300006880 Ga0075429_100001469 Ga0075429_10000146915 244
237 3300007076 Ga0075435_100009949 Ga0075435_1000099497 244
238 3300009094 Ga0111539_10001763 Ga0111539_1000176322 244
239 3300009147 Ga0114129_10001978 Ga0114129_1000197823 244
240 3300027907 Ga0207428_10000417 Ga0207428_1000041741 244
241 3300049571 Ga0501034_0363252 Ga0501034_0363252_416_1216 244
242 3300050507 nmdc:mga05p37_531_c1 nmdc:mga05p37_531_c1_18828_19616 244
243 3300050508 nmdc:mga09592_8311_c1 nmdc:mga09592_8311_c1_2800_3588 244
244 3300050509 nmdc:mga0qj67_413_c1 nmdc:mga0qj67_413_c1_14097_14885 244
245 3300050510 nmdc:mga06r32_1915_c1 nmdc:mga06r32_1915_c1_9282_10070 244
246 3300050511 nmdc:mga08y16_23328_c1 nmdc:mga08y16_23328_c1_2727_3515 244
247 3300050512 nmdc:mga0n895_209_c1 nmdc:mga0n895_209_c1_22784_23572 244
248 3300050513 nmdc:mga0rr50_591_c1 nmdc:mga0rr50_591_c1_4983_5771 244
249 3300050515 nmdc:mga0a205_1233_c1 nmdc:mga0a205_1233_c1_18170_18958 244
250 iso_pu_bacteria 2738541277 2738722971 244
251 iso_pu_bacteria 2738543019 2739283542 244
252 3300005983 Ga0081540_1001455 Ga0081540_10014554 245
253 3300028794 Ga0307515_10258369 Ga0307515_102583692 245
254 3300031456 Ga0307513_10002157 Ga0307513_1000215715 245
255 3300048907 Ga0496104_0715172 Ga0496104_0715172_84_839 245
256 3300003781 Ga0055536_1004556 Ga0055536_10045566 246
257 3300003791 Ga0055530_10007828 Ga0055530_100078284 246
258 3300003792 Ga0055540_1000045 Ga0055540_100004525 246
259 3300003794 Ga0055531_10000149 Ga0055531_1000014925 246
260 3300009094 Ga0111539_10028162 Ga0111539_100281624 246
261 3300025292 Ga0209676_1000135 Ga0209676_1000135134 246
262 3300025298 Ga0209050_1000100 Ga0209050_100010050 246
263 3300025303 Ga0209051_1000067 Ga0209051_1000067177 246
264 3300025304 Ga0209257_1000095 Ga0209257_100009564 246
265 3300031731 Ga0307405_10015237 Ga0307405_100152375 246
266 3300035398 Ga0316574_0024694 Ga0316574_0024694_15_773 246
267 3300037471 Ga0395905_0004682 Ga0395905_0004682_8676_9434 246
268 3300047321 Ga0495676_0010663 Ga0495676_0010663_3330_4088 246
269 3300047673 Ga0495593_0012124 Ga0495593_0012124_3036_3794 246
270 3300048089 Ga0495614_0002092 Ga0495614_0002092_419_1177 246
271 3300048925 Ga0496122_0119563 Ga0496122_0119563_74_832 246
272 3300048927 Ga0496124_0118073 Ga0496124_0118073_1339_2097 246
273 3300050512 nmdc:mga0n895_260850_c1 nmdc:mga0n895_260850_c1_651_1409 246
274 3300053087 Ga0500643_021588 Ga0500643_021588_825_1583 246
275 3300053133 Ga0500655_013080 Ga0500655_013080_100_858 246
276 3300053141 Ga0500574_038835 Ga0500574_038835_395_1153 246
277 3300053161 Ga0500634_0000656 Ga0500634_0000656_10505_11263 246
278 3300053162 Ga0500638_015637 Ga0500638_015637_312_1070 246
279 3300005331 Ga0070670_100054860 Ga0070670_1000548603 247
280 3300005347 Ga0070668_100353053 Ga0070668_1003530532 247
281 3300005367 Ga0070667_100184817 Ga0070667_1001848171 247
282 3300005547 Ga0070693_100052891 Ga0070693_1000528912 247
283 3300005841 Ga0068863_100129676 Ga0068863_1001296763 247
284 3300006048 Ga0075363_100026897 Ga0075363_1000268973 247
285 3300006051 Ga0075364_10010874 Ga0075364_100108742 247
286 3300006178 Ga0075367_10199806 Ga0075367_101998062 247
287 3300006237 Ga0097621_100167011 Ga0097621_1001670112 247
288 3300006358 Ga0068871_100388319 Ga0068871_1003883192 247
289 3300006844 Ga0075428_100153128 Ga0075428_1001531283 247
290 3300009098 Ga0105245_10360456 Ga0105245_103604562 247
291 3300009553 Ga0105249_10505332 Ga0105249_105053322 247
292 3300011119 Ga0105246_10136766 Ga0105246_101367662 247
293 3300014326 Ga0157380_10149702 Ga0157380_101497022 247
294 3300025907 Ga0207645_10021819 Ga0207645_100218193 247
295 3300025918 Ga0207662_10023421 Ga0207662_100234214 247
296 3300025925 Ga0207650_10265663 Ga0207650_102656632 247
297 3300025927 Ga0207687_10109109 Ga0207687_101091093 247
298 3300025972 Ga0207668_10436034 Ga0207668_104360342 247
299 3300026035 Ga0207703_10134630 Ga0207703_101346302 247
300 3300026041 Ga0207639_10196363 Ga0207639_101963632 247
301 3300026088 Ga0207641_10080191 Ga0207641_100801913 247
302 3300028381 Ga0268264_10005764 Ga0268264_100057647 247
303 3300031344 Ga0265316_10104946 Ga0265316_101049462 247
304 3300031456 Ga0307513_10182335 Ga0307513_101823352 247
305 3300032004 Ga0307414_10016739 Ga0307414_100167394 247
306 3300044712 Ga0453684_0042476 Ga0453684_0042476_4356_5117 247
307 3300045051 Ga0451576_0000057 Ga0451576_0000057_292047_292808 247
308 3300045051 Ga0451576_0034096 Ga0451576_0034096_2365_3126 247
309 3300046460 Ga0495638_0019991 Ga0495638_0019991_1721_2482 247
310 3300046474 Ga0495605_0027074 Ga0495605_0027074_2004_2765 247
311 3300049571 Ga0501034_0005912 Ga0501034_0005912_2883_3644 247
312 3300050489 nmdc:mga03683_72291_c1 nmdc:mga03683_72291_c1_513_1274 247
313 3300050491 nmdc:mga00v17_178915_c1 nmdc:mga00v17_178915_c1_86_847 247
314 3300050492 nmdc:mga0yw44_58881_c1 nmdc:mga0yw44_58881_c1_1424_2185 247
315 3300050494 nmdc:mga06z11_159847_c1 nmdc:mga06z11_159847_c1_310_1071 247
316 3300053079 Ga0500610_0086566 Ga0500610_0086566_671_1453 247
317 3300053151 Ga0500604_0026027 Ga0500604_0026027_429_1190 247
318 3300001991 JGI24743J22301_10004507 JGI24743J22301_100045073 248
319 3300005290 Ga0065712_10079461 Ga0065712_100794612 248
320 3300005293 Ga0065715_10119572 Ga0065715_101195722 248
321 3300005328 Ga0070676_10229184 Ga0070676_102291842 248
322 3300005329 Ga0070683_100067856 Ga0070683_1000678563 248
323 3300005330 Ga0070690_100040872 Ga0070690_1000408723 248
324 3300005331 Ga0070670_100045033 Ga0070670_1000450335 248
325 3300005333 Ga0070677_10021417 Ga0070677_100214173 248
326 3300005334 Ga0068869_100219157 Ga0068869_1002191572 248
327 3300005335 Ga0070666_10082392 Ga0070666_100823922 248
328 3300005338 Ga0068868_100065959 Ga0068868_1000659592 248
329 3300005340 Ga0070689_100116047 Ga0070689_1001160472 248
330 3300005343 Ga0070687_100007937 Ga0070687_1000079374 248
331 3300005353 Ga0070669_100129903 Ga0070669_1001299032 248
332 3300005354 Ga0070675_100055984 Ga0070675_1000559841 248
333 3300005355 Ga0070671_100139366 Ga0070671_1001393662 248
334 3300005356 Ga0070674_100097805 Ga0070674_1000978052 248
335 3300005364 Ga0070673_100271202 Ga0070673_1002712022 248
336 3300005365 Ga0070688_100003872 Ga0070688_1000038723 248
337 3300005366 Ga0070659_100113504 Ga0070659_1001135042 248
338 3300005367 Ga0070667_100141341 Ga0070667_1001413412 248
339 3300005441 Ga0070700_100053456 Ga0070700_1000534562 248
340 3300005455 Ga0070663_100026594 Ga0070663_1000265943 248
341 3300005456 Ga0070678_100079685 Ga0070678_1000796853 248
342 3300005457 Ga0070662_100117596 Ga0070662_1001175962 248
343 3300005459 Ga0068867_100039092 Ga0068867_1000390923 248
344 3300005466 Ga0070685_10030373 Ga0070685_100303733 248
345 3300005535 Ga0070684_100486754 Ga0070684_1004867542 248
346 3300005548 Ga0070665_100051051 Ga0070665_1000510512 248
347 3300005577 Ga0068857_100141940 Ga0068857_1001419402 248
348 3300005578 Ga0068854_100056426 Ga0068854_1000564263 248
349 3300005616 Ga0068852_100236339 Ga0068852_1002363392 248
350 3300005617 Ga0068859_100052613 Ga0068859_1000526136 248
351 3300005618 Ga0068864_100015632 Ga0068864_1000156324 248
352 3300005718 Ga0068866_10012834 Ga0068866_100128343 248
353 3300005834 Ga0068851_10003774 Ga0068851_100037744 248
354 3300005840 Ga0068870_10021342 Ga0068870_100213422 248
355 3300005841 Ga0068863_100907465 Ga0068863_1009074651 248
356 3300005842 Ga0068858_100177287 Ga0068858_1001772872 248
357 3300005843 Ga0068860_100540591 Ga0068860_1005405912 248
358 3300005844 Ga0068862_100182861 Ga0068862_1001828612 248
359 3300006237 Ga0097621_100295049 Ga0097621_1002950492 248
360 3300006358 Ga0068871_100287677 Ga0068871_1002876772 248
361 3300006881 Ga0068865_100030560 Ga0068865_1000305602 248
362 3300006931 Ga0097620_100052611 Ga0097620_1000526116 248
363 3300009094 Ga0111539_10196051 Ga0111539_101960512 248
364 3300009098 Ga0105245_10289217 Ga0105245_102892172 248
365 3300009148 Ga0105243_10088495 Ga0105243_100884952 248
366 3300009176 Ga0105242_10457040 Ga0105242_104570401 248
367 3300009553 Ga0105249_10139027 Ga0105249_101390273 248
368 3300010375 Ga0105239_10374928 Ga0105239_103749282 248
369 3300013296 Ga0157374_10015100 Ga0157374_100151008 248
370 3300013297 Ga0157378_10860880 Ga0157378_108608802 248
371 3300013306 Ga0163162_10433708 Ga0163162_104337082 248
372 3300013307 Ga0157372_10613420 Ga0157372_106134202 248
373 3300014325 Ga0163163_10213655 Ga0163163_102136552 248
374 3300014326 Ga0157380_10024561 Ga0157380_100245614 248
375 3300014968 Ga0157379_10169853 Ga0157379_101698532 248
376 3300014969 Ga0157376_10138812 Ga0157376_101388121 248
377 3300017792 Ga0163161_10328026 Ga0163161_103280262 248
378 3300025271 Ga0207666_1007060 Ga0207666_10070602 248
379 3300025290 Ga0207673_1000176 Ga0207673_10001763 248
380 3300025315 Ga0207697_10000294 Ga0207697_1000029418 248
381 3300025321 Ga0207656_10009247 Ga0207656_100092473 248
382 3300025893 Ga0207682_10001810 Ga0207682_100018109 248
383 3300025899 Ga0207642_10017847 Ga0207642_100178473 248
384 3300025903 Ga0207680_10086423 Ga0207680_100864232 248
385 3300025907 Ga0207645_10000860 Ga0207645_1000086027 248
386 3300025908 Ga0207643_10000205 Ga0207643_1000020533 248
387 3300025918 Ga0207662_10005870 Ga0207662_100058706 248
388 3300025920 Ga0207649_10473140 Ga0207649_104731401 248
389 3300025923 Ga0207681_10138311 Ga0207681_101383112 248
390 3300025925 Ga0207650_10171378 Ga0207650_101713782 248
391 3300025926 Ga0207659_10008424 Ga0207659_100084244 248
392 3300025927 Ga0207687_10399636 Ga0207687_103996362 248
393 3300025931 Ga0207644_10124042 Ga0207644_101240422 248
394 3300025932 Ga0207690_10079256 Ga0207690_100792562 248
395 3300025933 Ga0207706_10002261 Ga0207706_100022613 248
396 3300025934 Ga0207686_10310368 Ga0207686_103103681 248
397 3300025936 Ga0207670_10007748 Ga0207670_100077482 248
398 3300025937 Ga0207669_10132289 Ga0207669_101322892 248
399 3300025940 Ga0207691_10213830 Ga0207691_102138302 248
400 3300025942 Ga0207689_10000451 Ga0207689_1000045139 248
401 3300025944 Ga0207661_10083982 Ga0207661_100839822 248
402 3300025945 Ga0207679_10134627 Ga0207679_101346272 248
403 3300025949 Ga0207667_10390455 Ga0207667_103904552 248
404 3300025960 Ga0207651_10583334 Ga0207651_105833342 248
405 3300025961 Ga0207712_10150472 Ga0207712_101504722 248
406 3300025972 Ga0207668_10410868 Ga0207668_104108682 248
407 3300025981 Ga0207640_10171174 Ga0207640_101711742 248
408 3300025986 Ga0207658_10418137 Ga0207658_104181372 248
409 3300026023 Ga0207677_10065980 Ga0207677_100659802 248
410 3300026035 Ga0207703_10023848 Ga0207703_100238482 248
411 3300026041 Ga0207639_10534069 Ga0207639_105340692 248
412 3300026067 Ga0207678_10058032 Ga0207678_100580323 248
413 3300026075 Ga0207708_10001624 Ga0207708_1000162410 248
414 3300026078 Ga0207702_10507337 Ga0207702_105073372 248
415 3300026089 Ga0207648_10000390 Ga0207648_100003903 248
416 3300026095 Ga0207676_10016105 Ga0207676_100161053 248
417 3300026116 Ga0207674_10094836 Ga0207674_100948362 248
418 3300026118 Ga0207675_100001090 Ga0207675_1000010903 248
419 3300026121 Ga0207683_10003939 Ga0207683_100039393 248
420 3300027907 Ga0207428_10066465 Ga0207428_100664653 248
421 3300028379 Ga0268266_10038124 Ga0268266_100381245 248
422 3300028380 Ga0268265_10594543 Ga0268265_105945432 248
423 3300028381 Ga0268264_10031479 Ga0268264_100314796 248
424 3300028794 Ga0307515_10000636 Ga0307515_100006367 248
425 3300035170 Ga0373943_0238225 Ga0373943_0238225_181_954 248
426 3300037068 Ga0373925_0158233 Ga0373925_0158233_469_1242 248
427 3300046615 Ga0495656_0070161 Ga0495656_0070161_434_1243 248
428 3300048090 Ga0495615_0013716 Ga0495615_0013716_700_1509 248
429 3300048903 Ga0496100_0026719 Ga0496100_0026719_1675_2448 248
430 3300048904 Ga0496101_0011376 Ga0496101_0011376_3288_4061 248
431 3300048905 Ga0496102_0130122 Ga0496102_0130122_1281_2054 248
432 3300048907 Ga0496104_0008355 Ga0496104_0008355_3318_4091 248
433 3300048910 Ga0496107_0020418 Ga0496107_0020418_2988_3761 248
434 3300048911 Ga0496108_0182308 Ga0496108_0182308_392_1165 248
435 3300048912 Ga0496109_0020842 Ga0496109_0020842_1561_2334 248
436 3300048913 Ga0496110_0042347 Ga0496110_0042347_2862_3635 248
437 3300048914 Ga0496111_0148208 Ga0496111_0148208_196_969 248
438 3300048917 Ga0496114_0189620 Ga0496114_0189620_14_787 248
439 3300050511 nmdc:mga08y16_67091_c1 nmdc:mga08y16_67091_c1_834_1607 248
440 3300053125 Ga0500618_001056 Ga0500618_001056_6804_7589 248
441 3300046558 Ga0495633_0000063 Ga0495633_0000063_81589_82356 249
442 iso_pu_bacteria 2582581306 2585268675 249
443 iso_pu_bacteria 2834578030 2834581435 249
444 3300005354 Ga0070675_100126767 Ga0070675_1001267672 250
445 3300005356 Ga0070674_100035925 Ga0070674_1000359252 250
446 3300005456 Ga0070678_100124312 Ga0070678_1001243123 250
447 3300005456 Ga0070678_100166376 Ga0070678_1001663762 250
448 3300005459 Ga0068867_100287337 Ga0068867_1002873372 250
449 3300005548 Ga0070665_100409078 Ga0070665_1004090782 250
450 3300014497 Ga0182008_10003543 Ga0182008_100035435 250
451 3300015262 Ga0182007_10001188 Ga0182007_100011887 250
452 3300025893 Ga0207682_10011631 Ga0207682_100116313 250
453 3300025926 Ga0207659_10173163 Ga0207659_101731632 250
454 3300025931 Ga0207644_10125641 Ga0207644_101256412 250
455 3300025940 Ga0207691_10056674 Ga0207691_100566742 250
456 3300025960 Ga0207651_10159515 Ga0207651_101595152 250
457 3300026089 Ga0207648_10047851 Ga0207648_100478514 250
458 3300026121 Ga0207683_10002061 Ga0207683_100020613 250
459 3300026121 Ga0207683_10041267 Ga0207683_100412671 250
460 3300031251 Ga0265327_10007017 Ga0265327_100070176 250
461 3300048916 Ga0496113_0354671 Ga0496113_0354671_330_1100 250
462 iso_pu_bacteria 2721755755 2723846699 250
463 iso_pu_bacteria 2857524615 2857525209 250
464 iso_pu_bacteria 2884298095 2884299123 250
465 iso_pu_bacteria 2893066018 2893069597 250
466 iso_pu_bacteria 2899275550 2899277389 250
467 3300046522 Ga0495643_0014725 Ga0495643_0014725_606_1379 251
468 3300046528 Ga0495642_0008919 Ga0495642_0008919_2526_3299 251
469 3300046665 Ga0495661_0038474 Ga0495661_0038474_236_1009 251
470 iso_pu_bacteria 2508501122 2509110329 251
471 iso_pu_bacteria 2510917028 2511185925 251
472 iso_pu_bacteria 2582581294 2585204755 251
473 iso_pu_bacteria 2582581316 2585334916 251
474 iso_pu_bacteria 2582581867 2585401313 251
475 iso_pu_bacteria 2585427590 2585821539 251
476 iso_pu_bacteria 2643221736 2644744117 251
477 iso_pu_bacteria 2775506902 2776267829 251
478 iso_pu_bacteria 2775506904 2776281800 251
479 iso_pu_bacteria 2791355082 2792583566 251
480 iso_pu_bacteria 2808606387 2808990081 251
481 iso_pu_bacteria 2824617872 2824618573 251
482 iso_pu_bacteria 2824626560 2824627212 251
483 iso_pu_bacteria 2824635225 2824635572 251
484 iso_pu_bacteria 2824644064 2824644408 251
485 iso_pu_bacteria 2824714736 2824719069 251
486 iso_pu_bacteria 2824723954 2824725537 251
487 iso_pu_bacteria 2841760612 2841766020 251
488 iso_pu_bacteria 2844104063 2844105786 251
489 iso_pu_bacteria 2851182111 2851187650 251
490 iso_pu_bacteria 2851246043 2851246142 251
491 iso_pu_bacteria 8049293176 8049297946 251
492 iso_pu_bacteria 8057529695 8057531807 251
493 3300002773 JGI25152J39213_1020028 JGI25152J39213_10200281 252
494 3300003187 JGI25151J46595_10000697 JGI25151J46595_1000069713 252
495 3300025258 Ga0209129_1000788 Ga0209129_100078819 252
496 3300025294 Ga0209025_1001354 Ga0209025_100135419 252
497 3300031649 Ga0307514_10002611 Ga0307514_100026116 252
498 3300050489 nmdc:mga03683_28853_c1 nmdc:mga03683_28853_c1_1417_2199 252
499 3300050496 nmdc:mga07m45_39299_c1 nmdc:mga07m45_39299_c1_1658_2440 252
500 iso_pu_bacteria 2513237087 2513593396 252
501 3300005434 Ga0070709_10481325 Ga0070709_104813252 253
502 3300006871 Ga0075434_100189166 Ga0075434_1001891661 253
503 3300009147 Ga0114129_11222167 Ga0114129_112221672 253
504 3300050491 nmdc:mga00v17_31_c1 nmdc:mga00v17_31_c1_68247_69035 253
505 3300005327 Ga0070658_10012053 Ga0070658_100120534 254
506 3300005327 Ga0070658_10222047 Ga0070658_102220472 254
507 3300005336 Ga0070680_100001410 Ga0070680_10000141014 254
508 3300005336 Ga0070680_100061649 Ga0070680_1000616492 254
509 3300005339 Ga0070660_100007654 Ga0070660_1000076545 254
510 3300005344 Ga0070661_100066713 Ga0070661_1000667133 254
511 3300005366 Ga0070659_100276957 Ga0070659_1002769572 254
512 3300005458 Ga0070681_10047543 Ga0070681_100475433 254
513 3300005530 Ga0070679_100028477 Ga0070679_1000284774 254
514 3300005530 Ga0070679_100305833 Ga0070679_1003058332 254
515 3300005614 Ga0068856_100280568 Ga0068856_1002805682 254
516 3300005616 Ga0068852_100193731 Ga0068852_1001937313 254
517 3300005937 Ga0081455_10009294 Ga0081455_100092942 254
518 3300006038 Ga0075365_10008924 Ga0075365_100089246 254
519 3300006175 Ga0070712_100028977 Ga0070712_1000289772 254
520 3300006844 Ga0075428_100648358 Ga0075428_1006483581 254
521 3300006847 Ga0075431_100138863 Ga0075431_1001388632 254
522 3300009093 Ga0105240_10038568 Ga0105240_100385684 254
523 3300009093 Ga0105240_10513008 Ga0105240_105130082 254
524 3300009147 Ga0114129_10436698 Ga0114129_104366982 254
525 3300013102 Ga0157371_10081856 Ga0157371_100818562 254
526 3300020082 Ga0206353_10740853 Ga0206353_107408534 254
527 3300025909 Ga0207705_10187659 Ga0207705_101876592 254
528 3300025909 Ga0207705_10341375 Ga0207705_103413752 254
529 3300025912 Ga0207707_10335447 Ga0207707_103354471 254
530 3300025915 Ga0207693_10042367 Ga0207693_100423672 254
531 3300025917 Ga0207660_10040473 Ga0207660_100404733 254
532 3300025917 Ga0207660_10080698 Ga0207660_100806982 254
533 3300025920 Ga0207649_10133613 Ga0207649_101336132 254
534 3300025921 Ga0207652_10028460 Ga0207652_100284605 254
535 3300025949 Ga0207667_10229732 Ga0207667_102297322 254
536 3300025949 Ga0207667_10258639 Ga0207667_102586392 254
537 3300026142 Ga0207698_10042937 Ga0207698_100429374 254
538 3300031595 Ga0265313_10012769 Ga0265313_100127694 254
539 3300031665 Ga0316575_10084681 Ga0316575_100846812 254
540 3300031712 Ga0265342_10000319 Ga0265342_1000031927 254
541 3300032133 Ga0316583_10002868 Ga0316583_100028684 254
542 3300037471 Ga0395905_0069654 Ga0395905_0069654_1331_2122 254
543 3300046460 Ga0495638_0001151 Ga0495638_0001151_23043_23825 254
544 3300046501 Ga0495607_0098141 Ga0495607_0098141_69_851 254
545 3300046524 Ga0495648_0160294 Ga0495648_0160294_310_1092 254
546 3300046660 Ga0495625_0011610 Ga0495625_0011610_2286_3068 254
547 3300048903 Ga0496100_0256854 Ga0496100_0256854_168_950 254
548 3300048910 Ga0496107_0088609 Ga0496107_0088609_10_792 254
549 3300048920 Ga0496117_0008368 Ga0496117_0008368_1996_2778 254
550 3300048921 Ga0496118_0008003 Ga0496118_0008003_1823_2605 254
551 3300048924 Ga0496121_0000643 Ga0496121_0000643_3577_4359 254
552 3300048924 Ga0496121_0059299 Ga0496121_0059299_811_1593 254
553 3300048929 Ga0496126_0365379 Ga0496126_0365379_116_898 254
554 3300049581 Ga0501047_0005106 Ga0501047_0005106_3621_4403 254
555 3300049581 Ga0501047_0119207 Ga0501047_0119207_974_1756 254
556 3300049742 Ga0501080_0556852 Ga0501080_0556852_107_889 254
557 3300049823 Ga0501044_0079274 Ga0501044_0079274_19_801 254
558 3300050492 nmdc:mga0yw44_186330_c1 nmdc:mga0yw44_186330_c1_270_1052 254
559 3300050509 nmdc:mga0qj67_92854_c1 nmdc:mga0qj67_92854_c1_1362_2144 254
560 3300050510 nmdc:mga06r32_173575_c1 nmdc:mga06r32_173575_c1_1324_2106 254
561 3300053094 Ga0500566_0011276 Ga0500566_0011276_1682_2464 254
562 3300053098 Ga0500650_0000958 Ga0500650_0000958_1999_2781 254
563 3300053108 Ga0500562_005421 Ga0500562_005421_1848_2630 254
564 3300053122 Ga0500608_018675 Ga0500608_018675_1033_1815 254
565 3300053125 Ga0500618_024229 Ga0500618_024229_559_1341 254
566 3300053136 Ga0500559_0000932 Ga0500559_0000932_16739_17521 254
567 3300053139 Ga0500568_0002600 Ga0500568_0002600_7146_7928 254
568 3300053148 Ga0500590_049704 Ga0500590_049704_53_835 254
569 3300053153 Ga0500616_0000033 Ga0500616_0000033_237162_237944 254
570 3300053156 Ga0500622_0000073 Ga0500622_0000073_91900_92682 254
571 3300053177 Ga0500636_0000712 Ga0500636_0000712_8370_9152 254
572 3300053730 Ga0500645_044128 Ga0500645_044128_434_1216 254
573 3300003775 Ga0055524_1000064 Ga0055524_100006431 255
574 3300003790 Ga0055528_1007814 Ga0055528_10078143 255
575 3300005347 Ga0070668_100267347 Ga0070668_1002673472 255
576 3300005434 Ga0070709_10005422 Ga0070709_100054222 255
577 3300005435 Ga0070714_100033057 Ga0070714_1000330572 255
578 3300005435 Ga0070714_100108474 Ga0070714_1001084742 255
579 3300005437 Ga0070710_10088122 Ga0070710_100881222 255
580 3300005437 Ga0070710_10205431 Ga0070710_102054312 255
581 3300005455 Ga0070663_100251573 Ga0070663_1002515731 255
582 3300005467 Ga0070706_100197283 Ga0070706_1001972832 255
583 3300005468 Ga0070707_100332348 Ga0070707_1003323482 255
584 3300005471 Ga0070698_100130523 Ga0070698_1001305232 255
585 3300005536 Ga0070697_100620514 Ga0070697_1006205141 255
586 3300005937 Ga0081455_10000858 Ga0081455_1000085812 255
587 3300005983 Ga0081540_1003099 Ga0081540_10030994 255
588 3300006028 Ga0070717_10081002 Ga0070717_100810022 255
589 3300006048 Ga0075363_100007861 Ga0075363_1000078614 255
590 3300006163 Ga0070715_10000623 Ga0070715_100006237 255
591 3300006163 Ga0070715_10054022 Ga0070715_100540223 255
592 3300006173 Ga0070716_100314000 Ga0070716_1003140002 255
593 3300006844 Ga0075428_100056055 Ga0075428_1000560553 255
594 3300006844 Ga0075428_100199973 Ga0075428_1001999732 255
595 3300006852 Ga0075433_10145154 Ga0075433_101451542 255
596 3300006871 Ga0075434_100257538 Ga0075434_1002575382 255
597 3300006871 Ga0075434_100314024 Ga0075434_1003140242 255
598 3300007076 Ga0075435_100136866 Ga0075435_1001368662 255
599 3300009147 Ga0114129_10088583 Ga0114129_100885833 255
600 3300009147 Ga0114129_10120940 Ga0114129_101209403 255
601 3300009177 Ga0105248_10104607 Ga0105248_101046072 255
602 3300011119 Ga0105246_10361447 Ga0105246_103614472 255
603 3300021321 Ga0214542_1000092 Ga0214542_1000092102 255
604 3300021327 Ga0214543_1000045 Ga0214543_1000045134 255
605 3300025273 Ga0209673_1001311 Ga0209673_10013113 255
606 3300025291 Ga0209675_1000448 Ga0209675_100044817 255
607 3300025295 Ga0209564_1000048 Ga0209564_100004899 255
608 3300025295 Ga0209564_1017756 Ga0209564_10177562 255
609 3300025299 Ga0209256_1000041 Ga0209256_100004199 255
610 3300025299 Ga0209256_1028313 Ga0209256_10283132 255
611 3300025906 Ga0207699_10145029 Ga0207699_101450292 255
612 3300025910 Ga0207684_10006570 Ga0207684_100065707 255
613 3300025910 Ga0207684_10009005 Ga0207684_100090052 255
614 3300025910 Ga0207684_10025930 Ga0207684_100259305 255
615 3300025928 Ga0207700_10146696 Ga0207700_101466962 255
616 3300025929 Ga0207664_10168031 Ga0207664_101680312 255
617 3300025939 Ga0207665_10051482 Ga0207665_100514822 255
618 3300025939 Ga0207665_10069347 Ga0207665_100693472 255
619 3300028794 Ga0307515_10050958 Ga0307515_100509584 255
620 3300031456 Ga0307513_10049621 Ga0307513_100496214 255
621 3300037466 Ga0395898_0114153 Ga0395898_0114153_765_1550 255
622 3300037471 Ga0395905_0208565 Ga0395905_0208565_295_1080 255
623 3300046515 Ga0495620_0029039 Ga0495620_0029039_539_1324 255
624 3300048903 Ga0496100_0280340 Ga0496100_0280340_307_1092 255
625 3300048904 Ga0496101_0482904 Ga0496101_0482904_150_935 255
626 3300048905 Ga0496102_0278265 Ga0496102_0278265_668_1453 255
627 3300048905 Ga0496102_0304938 Ga0496102_0304938_271_1056 255
628 3300048907 Ga0496104_0083212 Ga0496104_0083212_573_1358 255
629 3300048907 Ga0496104_0086082 Ga0496104_0086082_1970_2755 255
630 3300048908 Ga0496105_0027920 Ga0496105_0027920_3669_4454 255
631 3300048909 Ga0496106_0080140 Ga0496106_0080140_811_1596 255
632 3300048909 Ga0496106_0203361 Ga0496106_0203361_605_1390 255
633 3300048910 Ga0496107_0165338 Ga0496107_0165338_229_1014 255
634 3300048910 Ga0496107_0388727 Ga0496107_0388727_65_850 255
635 3300048911 Ga0496108_0162035 Ga0496108_0162035_933_1718 255
636 3300048912 Ga0496109_0213456 Ga0496109_0213456_601_1401 255
637 3300048913 Ga0496110_0011459 Ga0496110_0011459_5380_6165 255
638 3300048913 Ga0496110_0112651 Ga0496110_0112651_1374_2159 255
639 3300048914 Ga0496111_0041058 Ga0496111_0041058_2121_2906 255
640 3300048914 Ga0496111_0156803 Ga0496111_0156803_121_906 255
641 3300048915 Ga0496112_0053484 Ga0496112_0053484_2309_3094 255
642 3300048915 Ga0496112_0075196 Ga0496112_0075196_70_855 255
643 3300048916 Ga0496113_0036308 Ga0496113_0036308_831_1616 255
644 3300048916 Ga0496113_0153801 Ga0496113_0153801_479_1264 255
645 3300048916 Ga0496113_0580105 Ga0496113_0580105_79_864 255
646 3300048918 Ga0496115_0172643 Ga0496115_0172643_304_1089 255
647 3300048918 Ga0496115_0477898 Ga0496115_0477898_52_837 255
648 3300048925 Ga0496122_0170271 Ga0496122_0170271_180_965 255
649 3300048927 Ga0496124_0498302 Ga0496124_0498302_20_805 255
650 3300048928 Ga0496125_0047289 Ga0496125_0047289_2696_3481 255
651 3300049582 Ga0501048_0426245 Ga0501048_0426245_143_928 255
652 3300050492 nmdc:mga0yw44_18397_c1 nmdc:mga0yw44_18397_c1_601_1386 255
653 3300050507 nmdc:mga05p37_276593_c1 nmdc:mga05p37_276593_c1_346_1131 255
654 3300050512 nmdc:mga0n895_137616_c1 nmdc:mga0n895_137616_c1_859_1644 255
655 3300050513 nmdc:mga0rr50_91735_c1 nmdc:mga0rr50_91735_c1_1090_1875 255
656 3300050515 nmdc:mga0a205_318146_c1 nmdc:mga0a205_318146_c1_199_984 255
657 3300050516 nmdc:mga0sz30_22184_c1 nmdc:mga0sz30_22184_c1_1038_1823 255
658 3300053177 Ga0500636_0069941 Ga0500636_0069941_337_1122 255
659 2209111006 2214544908 2213593100 256
660 3300000041 ARcpr5oldR_c000009 ARcpr5oldR_00000923 256
661 3300000042 ARSoilYngRDRAFT_c00030 ARSoilYngRDRAFT_0003018 256
662 3300000043 ARcpr5yngRDRAFT_c000008 ARcpr5yngRDRAFT_00000818 256
663 3300000044 ARSoilOldRDRAFT_c000009 ARSoilOldRDRAFT_00000919 256
664 3300000045 ARCol0oldRDRAFT_c00009 ARCol0oldRDRAFT_000097 256
665 3300000652 ARCol0yngRDRAFT_1000008 ARCol0yngRDRAFT_100000829 256
666 3300003215 JGI25153J46596_10003791 JGI25153J46596_100037916 256
667 3300005277 Ga0065716_1001541 Ga0065716_10015414 256
668 3300005289 Ga0065704_10070953 Ga0065704_100709536 256
669 3300005290 Ga0065712_10074587 Ga0065712_100745873 256
670 3300005295 Ga0065707_10095129 Ga0065707_100951293 256
671 3300005330 Ga0070690_100031226 Ga0070690_1000312264 256
672 3300005331 Ga0070670_100489277 Ga0070670_1004892771 256
673 3300005333 Ga0070677_10051133 Ga0070677_100511332 256
674 3300005335 Ga0070666_10200436 Ga0070666_102004362 256
675 3300005336 Ga0070680_100197201 Ga0070680_1001972012 256
676 3300005336 Ga0070680_100441619 Ga0070680_1004416192 256
677 3300005337 Ga0070682_100085926 Ga0070682_1000859262 256
678 3300005338 Ga0068868_100197794 Ga0068868_1001977942 256
679 3300005339 Ga0070660_100001593 Ga0070660_1000015935 256
680 3300005340 Ga0070689_100031795 Ga0070689_1000317952 256
681 3300005340 Ga0070689_100641144 Ga0070689_1006411441 256
682 3300005343 Ga0070687_100070207 Ga0070687_1000702072 256
683 3300005345 Ga0070692_10020011 Ga0070692_100200114 256
684 3300005347 Ga0070668_100038614 Ga0070668_1000386144 256
685 3300005353 Ga0070669_100007294 Ga0070669_1000072945 256
686 3300005353 Ga0070669_100332861 Ga0070669_1003328612 256
687 3300005355 Ga0070671_100010470 Ga0070671_1000104708 256
688 3300005356 Ga0070674_100030100 Ga0070674_1000301002 256
689 3300005356 Ga0070674_100092683 Ga0070674_1000926832 256
690 3300005365 Ga0070688_100023242 Ga0070688_1000232424 256
691 3300005366 Ga0070659_100225823 Ga0070659_1002258232 256
692 3300005366 Ga0070659_100283983 Ga0070659_1002839832 256
693 3300005367 Ga0070667_100009854 Ga0070667_1000098545 256
694 3300005436 Ga0070713_100099724 Ga0070713_1000997243 256
695 3300005437 Ga0070710_10078595 Ga0070710_100785952 256
696 3300005438 Ga0070701_10039584 Ga0070701_100395842 256
697 3300005438 Ga0070701_10145612 Ga0070701_101456122 256
698 3300005441 Ga0070700_100243382 Ga0070700_1002433822 256
699 3300005444 Ga0070694_100127084 Ga0070694_1001270841 256
700 3300005455 Ga0070663_100001521 Ga0070663_1000015215 256
701 3300005456 Ga0070678_100073746 Ga0070678_1000737463 256
702 3300005466 Ga0070685_10011463 Ga0070685_100114634 256
703 3300005543 Ga0070672_100206191 Ga0070672_1002061912 256
704 3300005545 Ga0070695_100120908 Ga0070695_1001209082 256
705 3300005548 Ga0070665_100002816 Ga0070665_10000281611 256
706 3300005548 Ga0070665_100478057 Ga0070665_1004780572 256
707 3300005549 Ga0070704_100127835 Ga0070704_1001278352 256
708 3300005564 Ga0070664_100198645 Ga0070664_1001986452 256
709 3300005616 Ga0068852_100166905 Ga0068852_1001669052 256
710 3300005616 Ga0068852_100463515 Ga0068852_1004635152 256
711 3300005617 Ga0068859_100036474 Ga0068859_1000364744 256
712 3300005617 Ga0068859_100252855 Ga0068859_1002528552 256
713 3300005617 Ga0068859_100680199 Ga0068859_1006801992 256
714 3300005618 Ga0068864_100008308 Ga0068864_1000083086 256
715 3300005618 Ga0068864_100029633 Ga0068864_1000296332 256
716 3300005718 Ga0068866_10031153 Ga0068866_100311533 256
717 3300005719 Ga0068861_100050735 Ga0068861_1000507353 256
718 3300005834 Ga0068851_10261404 Ga0068851_102614042 256
719 3300005840 Ga0068870_10057880 Ga0068870_100578802 256
720 3300005841 Ga0068863_100087926 Ga0068863_1000879263 256
721 3300005842 Ga0068858_100001279 Ga0068858_10000127912 256
722 3300005842 Ga0068858_100036464 Ga0068858_1000364644 256
723 3300005843 Ga0068860_100103357 Ga0068860_1001033573 256
724 3300005843 Ga0068860_100186511 Ga0068860_1001865113 256
725 3300005844 Ga0068862_100112390 Ga0068862_1001123903 256
726 3300005937 Ga0081455_10003340 Ga0081455_1000334014 256
727 3300005981 Ga0081538_10001857 Ga0081538_100018575 256
728 3300005981 Ga0081538_10034940 Ga0081538_100349403 256
729 3300005983 Ga0081540_1039591 Ga0081540_10395912 256
730 3300006028 Ga0070717_10450305 Ga0070717_104503052 256
731 3300006038 Ga0075365_10010677 Ga0075365_100106772 256
732 3300006038 Ga0075365_10043532 Ga0075365_100435322 256
733 3300006038 Ga0075365_10096405 Ga0075365_100964053 256
734 3300006058 Ga0075432_10050644 Ga0075432_100506442 256
735 3300006163 Ga0070715_10155350 Ga0070715_101553502 256
736 3300006177 Ga0075362_10030106 Ga0075362_100301062 256
737 3300006178 Ga0075367_10109898 Ga0075367_101098982 256
738 3300006186 Ga0075369_10085027 Ga0075369_100850272 256
739 3300006237 Ga0097621_100034889 Ga0097621_1000348894 256
740 3300006237 Ga0097621_100112776 Ga0097621_1001127763 256
741 3300006353 Ga0075370_10017813 Ga0075370_100178133 256
742 3300006358 Ga0068871_100059967 Ga0068871_1000599672 256
743 3300006844 Ga0075428_100045387 Ga0075428_1000453873 256
744 3300006844 Ga0075428_100471572 Ga0075428_1004715722 256
745 3300006846 Ga0075430_100017979 Ga0075430_1000179795 256
746 3300006846 Ga0075430_100098009 Ga0075430_1000980093 256
747 3300006847 Ga0075431_100001861 Ga0075431_1000018617 256
748 3300006847 Ga0075431_100058238 Ga0075431_1000582383 256
749 3300006880 Ga0075429_100001959 Ga0075429_1000019597 256
750 3300006880 Ga0075429_100054135 Ga0075429_1000541354 256
751 3300006914 Ga0075436_100414980 Ga0075436_1004149801 256
752 3300006931 Ga0097620_100036473 Ga0097620_1000364734 256
753 3300006931 Ga0097620_100252838 Ga0097620_1002528382 256
754 3300006931 Ga0097620_100680191 Ga0097620_1006801912 256
755 3300009094 Ga0111539_10003310 Ga0111539_1000331013 256
756 3300009094 Ga0111539_10232174 Ga0111539_102321741 256
757 3300009094 Ga0111539_10634047 Ga0111539_106340472 256
758 3300009098 Ga0105245_10000556 Ga0105245_1000055625 256
759 3300009101 Ga0105247_10000474 Ga0105247_100004749 256
760 3300009101 Ga0105247_10039961 Ga0105247_100399612 256
761 3300009147 Ga0114129_10000199 Ga0114129_1000019913 256
762 3300009147 Ga0114129_10085361 Ga0114129_100853613 256
763 3300009174 Ga0105241_10392172 Ga0105241_103921722 256
764 3300009176 Ga0105242_10011728 Ga0105242_100117286 256
765 3300009177 Ga0105248_10000873 Ga0105248_1000087325 256
766 3300009177 Ga0105248_10193366 Ga0105248_101933663 256
767 3300009553 Ga0105249_10429619 Ga0105249_104296192 256
768 3300009553 Ga0105249_10479340 Ga0105249_104793402 256
769 3300011119 Ga0105246_10000220 Ga0105246_1000022011 256
770 3300013296 Ga0157374_10000524 Ga0157374_1000052426 256
771 3300013296 Ga0157374_10325716 Ga0157374_103257162 256
772 3300013297 Ga0157378_10000591 Ga0157378_1000059110 256
773 3300013306 Ga0163162_10003457 Ga0163162_100034573 256
774 3300013308 Ga0157375_10001668 Ga0157375_1000166810 256
775 3300014325 Ga0163163_10015811 Ga0163163_100158115 256
776 3300014325 Ga0163163_10050183 Ga0163163_100501834 256
777 3300014326 Ga0157380_10138079 Ga0157380_101380792 256
778 3300014745 Ga0157377_10098137 Ga0157377_100981372 256
779 3300014968 Ga0157379_10000422 Ga0157379_1000042211 256
780 3300014968 Ga0157379_10034165 Ga0157379_100341654 256
781 3300014968 Ga0157379_10095356 Ga0157379_100953562 256
782 3300014969 Ga0157376_10000285 Ga0157376_1000028511 256
783 3300014969 Ga0157376_10225942 Ga0157376_102259422 256
784 3300017792 Ga0163161_10066341 Ga0163161_100663413 256
785 3300025297 Ga0209758_1000217 Ga0209758_1000217115 256
786 3300025893 Ga0207682_10089411 Ga0207682_100894112 256
787 3300025899 Ga0207642_10046978 Ga0207642_100469782 256
788 3300025900 Ga0207710_10000423 Ga0207710_100004233 256
789 3300025901 Ga0207688_10189841 Ga0207688_101898412 256
790 3300025905 Ga0207685_10077434 Ga0207685_100774342 256
791 3300025908 Ga0207643_10006425 Ga0207643_100064254 256
792 3300025917 Ga0207660_10273863 Ga0207660_102738632 256
793 3300025918 Ga0207662_10183060 Ga0207662_101830602 256
794 3300025919 Ga0207657_10043698 Ga0207657_100436983 256
795 3300025923 Ga0207681_10175867 Ga0207681_101758672 256
796 3300025923 Ga0207681_10192537 Ga0207681_101925372 256
797 3300025925 Ga0207650_10162264 Ga0207650_101622642 256
798 3300025927 Ga0207687_10001492 Ga0207687_100014928 256
799 3300025932 Ga0207690_10211940 Ga0207690_102119402 256
800 3300025933 Ga0207706_10037037 Ga0207706_100370375 256
801 3300025934 Ga0207686_10043990 Ga0207686_100439903 256
802 3300025934 Ga0207686_10127351 Ga0207686_101273512 256
803 3300025936 Ga0207670_10034893 Ga0207670_100348934 256
804 3300025937 Ga0207669_10230427 Ga0207669_102304272 256
805 3300025940 Ga0207691_10041637 Ga0207691_100416373 256
806 3300025940 Ga0207691_10106643 Ga0207691_101066433 256
807 3300025941 Ga0207711_10005965 Ga0207711_100059652 256
808 3300025941 Ga0207711_10154119 Ga0207711_101541192 256
809 3300025942 Ga0207689_10164184 Ga0207689_101641842 256
810 3300025961 Ga0207712_10022771 Ga0207712_100227714 256
811 3300026023 Ga0207677_10174422 Ga0207677_101744222 256
812 3300026035 Ga0207703_10070592 Ga0207703_100705923 256
813 3300026095 Ga0207676_10009516 Ga0207676_100095164 256
814 3300026095 Ga0207676_10016716 Ga0207676_100167162 256
815 3300026116 Ga0207674_10211351 Ga0207674_102113512 256
816 3300026118 Ga0207675_100015233 Ga0207675_1000152335 256
817 3300026118 Ga0207675_100219881 Ga0207675_1002198813 256
818 3300026121 Ga0207683_10024494 Ga0207683_100244944 256
819 3300027907 Ga0207428_10000666 Ga0207428_1000066637 256
820 3300027907 Ga0207428_10003318 Ga0207428_100033186 256
821 3300028379 Ga0268266_10001063 Ga0268266_1000106325 256
822 3300028379 Ga0268266_10258047 Ga0268266_102580472 256
823 3300028380 Ga0268265_10030511 Ga0268265_100305113 256
824 3300028381 Ga0268264_10501491 Ga0268264_105014912 256
825 3300028556 Ga0265337_1003658 Ga0265337_10036587 256
826 3300031247 Ga0265340_10033735 Ga0265340_100337353 256
827 3300031249 Ga0265339_10050492 Ga0265339_100504922 256
828 3300031344 Ga0265316_10127589 Ga0265316_101275892 256
829 3300031665 Ga0316575_10029884 Ga0316575_100298843 256
830 3300031711 Ga0265314_10003227 Ga0265314_100032277 256
831 3300031727 Ga0316576_10143503 Ga0316576_101435032 256
832 3300034818 Ga0373950_0005593 Ga0373950_0005593_951_1745 256
833 3300035083 Ga0373926_0059501 Ga0373926_0059501_458_1246 256
834 3300035089 Ga0373944_0003921 Ga0373944_0003921_1335_2123 256
835 3300035089 Ga0373944_0006052 Ga0373944_0006052_127_918 256
836 3300035116 Ga0373945_0008345 Ga0373945_0008345_2369_3160 256
837 3300035117 Ga0373953_0053110 Ga0373953_0053110_75_863 256
838 3300035118 Ga0373954_0016716 Ga0373954_0016716_749_1537 256
839 3300035119 Ga0373956_0020258 Ga0373956_0020258_101_889 256
840 3300035170 Ga0373943_0003784 Ga0373943_0003784_4431_5222 256
841 3300035171 Ga0373946_0006096 Ga0373946_0006096_626_1417 256
842 3300035172 Ga0373955_0001168 Ga0373955_0001168_1376_2164 256
843 3300035691 Ga0373931_0199774 Ga0373931_0199774_375_1163 256
844 3300035692 Ga0373935_0000678 Ga0373935_0000678_33_824 256
845 3300035692 Ga0373935_0393421 Ga0373935_0393421_118_906 256
846 3300035695 Ga0373927_0001937 Ga0373927_0001937_16_804 256
847 3300035695 Ga0373927_0013273 Ga0373927_0013273_4266_5054 256
848 3300035695 Ga0373927_0022549 Ga0373927_0022549_1542_2330 256
849 3300035695 Ga0373927_0026546 Ga0373927_0026546_1167_1958 256
850 3300035724 Ga0373933_0009768 Ga0373933_0009768_3833_4621 256
851 3300035725 Ga0373947_0000512 Ga0373947_0000512_14500_15291 256
852 3300035725 Ga0373947_0019543 Ga0373947_0019543_1151_1939 256
853 3300035725 Ga0373947_0030272 Ga0373947_0030272_523_1311 256
854 3300035725 Ga0373947_0053289 Ga0373947_0053289_924_1712 256
855 3300036401 Ga0373937_0015895 Ga0373937_0015895_3340_4128 256
856 3300036401 Ga0373937_0034948 Ga0373937_0034948_850_1638 256
857 3300036401 Ga0373937_0247000 Ga0373937_0247000_87_884 256
858 3300036401 Ga0373937_0734664 Ga0373937_0734664_63_851 256
859 3300036647 Ga0316582_0107213 Ga0316582_0107213_579_1367 256
860 3300036712 Ga0316584_0042274 Ga0316584_0042274_2193_2981 256
861 3300037068 Ga0373925_0009707 Ga0373925_0009707_3713_4501 256
862 3300037068 Ga0373925_0159201 Ga0373925_0159201_174_962 256
863 3300037068 Ga0373925_0183545 Ga0373925_0183545_427_1215 256
864 3300044684 Ga0466966_0038191 Ga0466966_0038191_1965_2753 256
865 3300044719 Ga0466971_0010404 Ga0466971_0010404_3176_3964 256
866 3300045836 Ga0466958_0013380 Ga0466958_0013380_3226_4014 256
867 3300046455 Ga0495603_0000910 Ga0495603_0000910_2397_3188 256
868 3300046455 Ga0495603_0051213 Ga0495603_0051213_420_1208 256
869 3300046455 Ga0495603_0282256 Ga0495603_0282256_83_871 256
870 3300046459 Ga0495629_0002174 Ga0495629_0002174_1804_2595 256
871 3300046459 Ga0495629_0095721 Ga0495629_0095721_1016_1804 256
872 3300046461 Ga0495641_0035838 Ga0495641_0035838_697_1488 256
873 3300046461 Ga0495641_0189111 Ga0495641_0189111_24_812 256
874 3300046472 Ga0495580_0038182 Ga0495580_0038182_1141_1932 256
875 3300046473 Ga0495582_0019547 Ga0495582_0019547_942_1733 256
876 3300046474 Ga0495605_0058646 Ga0495605_0058646_530_1318 256
877 3300046475 Ga0495639_0003104 Ga0495639_0003104_6369_7157 256
878 3300046476 Ga0495662_0031267 Ga0495662_0031267_476_1267 256
879 3300046477 Ga0495664_0114080 Ga0495664_0114080_626_1417 256
880 3300046499 Ga0495594_0068750 Ga0495594_0068750_909_1697 256
881 3300046514 Ga0495618_0003910 Ga0495618_0003910_4684_5472 256
882 3300046514 Ga0495618_0017334 Ga0495618_0017334_560_1351 256
883 3300046515 Ga0495620_0072615 Ga0495620_0072615_586_1374 256
884 3300046517 Ga0495630_0226645 Ga0495630_0226645_117_908 256
885 3300046523 Ga0495644_0046658 Ga0495644_0046658_299_1087 256
886 3300046523 Ga0495644_0130921 Ga0495644_0130921_105_893 256
887 3300046525 Ga0495663_0106013 Ga0495663_0106013_33_821 256
888 3300046526 Ga0495666_0030560 Ga0495666_0030560_87_878 256
889 3300046529 Ga0495652_0018938 Ga0495652_0018938_2191_2982 256
890 3300046531 Ga0495665_0003399 Ga0495665_0003399_2455_3243 256
891 3300046531 Ga0495665_0147992 Ga0495665_0147992_110_901 256
892 3300046533 Ga0495640_0001822 Ga0495640_0001822_8783_9574 256
893 3300046533 Ga0495640_0039926 Ga0495640_0039926_929_1717 256
894 3300046535 Ga0495586_0231095 Ga0495586_0231095_159_950 256
895 3300046559 Ga0495667_0072958 Ga0495667_0072958_1110_1898 256
896 3300046642 Ga0495634_0000688 Ga0495634_0000688_9188_9979 256
897 3300046642 Ga0495634_0017644 Ga0495634_0017644_387_1175 256
898 3300046663 Ga0495635_0105941 Ga0495635_0105941_56_844 256
899 3300046663 Ga0495635_0245286 Ga0495635_0245286_58_849 256
900 3300046665 Ga0495661_0105433 Ga0495661_0105433_316_1104 256
901 3300046675 Ga0495657_0110364 Ga0495657_0110364_434_1222 256
902 3300046680 Ga0495646_0048055 Ga0495646_0048055_1345_2136 256
903 3300046681 Ga0495647_0000251 Ga0495647_0000251_1690_2481 256
904 3300046683 Ga0495658_0009547 Ga0495658_0009547_3511_4302 256
905 3300046683 Ga0495658_0038260 Ga0495658_0038260_300_1088 256
906 3300046683 Ga0495658_0038764 Ga0495658_0038764_572_1360 256
907 3300046683 Ga0495658_0114976 Ga0495658_0114976_765_1553 256
908 3300046689 Ga0495613_0053053 Ga0495613_0053053_896_1684 256
909 3300046689 Ga0495613_0071912 Ga0495613_0071912_625_1416 256
910 3300046689 Ga0495613_0153073 Ga0495613_0153073_240_1028 256
911 3300046690 Ga0495624_0019040 Ga0495624_0019040_205_993 256
912 3300046691 Ga0495670_0184558 Ga0495670_0184558_40_828 256
913 3300046692 Ga0495671_0086299 Ga0495671_0086299_656_1444 256
914 3300047315 Ga0495581_0005554 Ga0495581_0005554_124_912 256
915 3300047315 Ga0495581_0042923 Ga0495581_0042923_1296_2087 256
916 3300047317 Ga0495604_0037852 Ga0495604_0037852_1705_2493 256
917 3300047317 Ga0495604_0063525 Ga0495604_0063525_588_1379 256
918 3300047319 Ga0495674_0001606 Ga0495674_0001606_6894_7685 256
919 3300047319 Ga0495674_0205282 Ga0495674_0205282_528_1316 256
920 3300047319 Ga0495674_0361115 Ga0495674_0361115_313_1101 256
921 3300047319 Ga0495674_0446745 Ga0495674_0446745_111_899 256
922 3300047321 Ga0495676_0001862 Ga0495676_0001862_8971_9762 256
923 3300047322 Ga0495680_0004830 Ga0495680_0004830_11261_12049 256
924 3300047471 Ga0495684_0001239 Ga0495684_0001239_11023_11811 256
925 3300048088 Ga0495602_0077707 Ga0495602_0077707_1743_2531 256
926 3300048903 Ga0496100_0000310 Ga0496100_0000310_14075_14863 256
927 3300048903 Ga0496100_0019395 Ga0496100_0019395_2808_3596 256
928 3300048904 Ga0496101_0000500 Ga0496101_0000500_15758_16546 256
929 3300048904 Ga0496101_0011880 Ga0496101_0011880_2325_3113 256
930 3300048905 Ga0496102_0000679 Ga0496102_0000679_23769_24557 256
931 3300048905 Ga0496102_0016989 Ga0496102_0016989_2934_3722 256
932 3300048905 Ga0496102_0050469 Ga0496102_0050469_129_917 256
933 3300048905 Ga0496102_0445213 Ga0496102_0445213_79_909 256
934 3300048906 Ga0496103_0000777 Ga0496103_0000777_13506_14294 256
935 3300048906 Ga0496103_0026169 Ga0496103_0026169_1451_2239 256
936 3300048907 Ga0496104_0000500 Ga0496104_0000500_9252_10040 256
937 3300048907 Ga0496104_0003660 Ga0496104_0003660_5788_6618 256
938 3300048907 Ga0496104_0007218 Ga0496104_0007218_2365_3153 256
939 3300048907 Ga0496104_0043116 Ga0496104_0043116_480_1268 256
940 3300048907 Ga0496104_0616958 Ga0496104_0616958_87_875 256
941 3300048908 Ga0496105_0000525 Ga0496105_0000525_59_847 256
942 3300048908 Ga0496105_0028263 Ga0496105_0028263_2397_3185 256
943 3300048908 Ga0496105_0140192 Ga0496105_0140192_1031_1861 256
944 3300048909 Ga0496106_0000323 Ga0496106_0000323_9215_10003 256
945 3300048909 Ga0496106_0023005 Ga0496106_0023005_881_1669 256
946 3300048910 Ga0496107_0003179 Ga0496107_0003179_1578_2366 256
947 3300048911 Ga0496108_0001888 Ga0496108_0001888_6762_7550 256
948 3300048911 Ga0496108_0032005 Ga0496108_0032005_974_1762 256
949 3300048911 Ga0496108_0107602 Ga0496108_0107602_1530_2318 256
950 3300048912 Ga0496109_0000493 Ga0496109_0000493_9252_10040 256
951 3300048912 Ga0496109_0026456 Ga0496109_0026456_845_1633 256
952 3300048912 Ga0496109_0073582 Ga0496109_0073582_2272_3102 256
953 3300048912 Ga0496109_0351492 Ga0496109_0351492_70_858 256
954 3300048913 Ga0496110_0003830 Ga0496110_0003830_1600_2388 256
955 3300048913 Ga0496110_0013354 Ga0496110_0013354_761_1549 256
956 3300048914 Ga0496111_0001343 Ga0496111_0001343_9252_10040 256
957 3300048914 Ga0496111_0016571 Ga0496111_0016571_2824_3612 256
958 3300048915 Ga0496112_0001321 Ga0496112_0001321_1326_2114 256
959 3300048915 Ga0496112_0011501 Ga0496112_0011501_2449_3237 256
960 3300048916 Ga0496113_0000869 Ga0496113_0000869_9240_10028 256
961 3300048916 Ga0496113_0009474 Ga0496113_0009474_3981_4769 256
962 3300048916 Ga0496113_0219364 Ga0496113_0219364_682_1470 256
963 3300048917 Ga0496114_0005594 Ga0496114_0005594_7162_7950 256
964 3300048917 Ga0496114_0073191 Ga0496114_0073191_850_1638 256
965 3300048917 Ga0496114_0181580 Ga0496114_0181580_509_1339 256
966 3300048918 Ga0496115_0001322 Ga0496115_0001322_9606_10394 256
967 3300048918 Ga0496115_0044026 Ga0496115_0044026_769_1557 256
968 3300048918 Ga0496115_0065754 Ga0496115_0065754_793_1581 256
969 3300049568 Ga0501031_0190025 Ga0501031_0190025_77_865 256
970 3300049570 Ga0501033_0086874 Ga0501033_0086874_1425_2213 256
971 3300049571 Ga0501034_0008051 Ga0501034_0008051_4644_5432 256
972 3300049576 Ga0501040_0335103 Ga0501040_0335103_57_845 256
973 3300049583 Ga0501067_0051323 Ga0501067_0051323_1155_1943 256
974 3300049591 Ga0501075_0364602 Ga0501075_0364602_28_816 256
975 3300049741 Ga0501079_0088355 Ga0501079_0088355_625_1413 256
976 3300049823 Ga0501044_0034557 Ga0501044_0034557_3290_4078 256
977 3300049824 Ga0501045_0156553 Ga0501045_0156553_42_830 256
978 3300050491 nmdc:mga00v17_130434_c1 nmdc:mga00v17_130434_c1_381_1169 256
979 3300050492 nmdc:mga0yw44_104652_c1 nmdc:mga0yw44_104652_c1_967_1755 256
980 3300050492 nmdc:mga0yw44_2715_c1 nmdc:mga0yw44_2715_c1_413_1201 256
981 3300050496 nmdc:mga07m45_279627_c1 nmdc:mga07m45_279627_c1_68_856 256
982 3300050507 nmdc:mga05p37_120842_c1 nmdc:mga05p37_120842_c1_2229_3017 256
983 3300050507 nmdc:mga05p37_383_c1 nmdc:mga05p37_383_c1_33535_34323 256
984 3300050508 nmdc:mga09592_274481_c1 nmdc:mga09592_274481_c1_512_1300 256
985 3300050508 nmdc:mga09592_4666_c1 nmdc:mga09592_4666_c1_3791_4579 256
986 3300050508 nmdc:mga09592_78098_c1 nmdc:mga09592_78098_c1_380_1168 256
987 3300050509 nmdc:mga0qj67_14148_c1 nmdc:mga0qj67_14148_c1_1519_2307 256
988 3300050509 nmdc:mga0qj67_61543_c1 nmdc:mga0qj67_61543_c1_717_1505 256
989 3300050509 nmdc:mga0qj67_72216_c1 nmdc:mga0qj67_72216_c1_1783_2571 256
990 3300050510 nmdc:mga06r32_711_c2 nmdc:mga06r32_711_c2_9752_10540 256
991 3300050511 nmdc:mga08y16_369_c1 nmdc:mga08y16_369_c1_29622_30410 256
992 3300050512 nmdc:mga0n895_36911_c1 nmdc:mga0n895_36911_c1_689_1477 256
993 3300050515 nmdc:mga0a205_135810_c1 nmdc:mga0a205_135810_c1_1091_1879 256
994 3300053077 Ga0495601_0000647 Ga0495601_0000647_4889_5680 256
995 3300053077 Ga0495601_0002386 Ga0495601_0002386_5256_6044 256
996 3300053077 Ga0495601_0063468 Ga0495601_0063468_50_838 256
997 3300053078 Ga0495612_0006165 Ga0495612_0006165_1821_2609 256
998 3300053083 Ga0495655_0024574 Ga0495655_0024574_502_1290 256
999 3300053084 Ga0495595_0000537 Ga0495595_0000537_8456_9244 256
1000 3300053084 Ga0495595_0097936 Ga0495595_0097936_327_1115 256
1001 3300053084 Ga0495595_0165472 Ga0495595_0165472_196_987 256
1002 3300053085 Ga0495619_0022151 Ga0495619_0022151_728_1516 256
1003 3300053085 Ga0495619_0029197 Ga0495619_0029197_2146_2937 256
1004 3300053085 Ga0495619_0041968 Ga0495619_0041968_1428_2216 256
1005 3300054114 Ga0501084_0404894 Ga0501084_0404894_146_934 256
1006 3300061734 Ga0530510_0140646 Ga0530510_0140646_96_884 256
1007 3300005339 Ga0070660_100234431 Ga0070660_1002344312 257
1008 3300005366 Ga0070659_100291966 Ga0070659_1002919662 257
1009 3300006880 Ga0075429_100299777 Ga0075429_1002997771 257
1010 3300009147 Ga0114129_10020933 Ga0114129_100209332 257
1011 3300009177 Ga0105248_10084018 Ga0105248_100840183 257
1012 3300010375 Ga0105239_10111018 Ga0105239_101110183 257
1013 3300025981 Ga0207640_10222185 Ga0207640_102221852 257
1014 3300050508 nmdc:mga09592_247433_c1 nmdc:mga09592_247433_c1_672_1463 257
1015 3300050493 nmdc:mga0k408_3653_c1 nmdc:mga0k408_3653_c1_5425_6228 258
1016 2162886011 MRS1b_contig_6977220 MRS1b_0725.00002480 259
1017 3300009094 Ga0111539_10000242 Ga0111539_1000024226 259
1018 3300009553 Ga0105249_10239323 Ga0105249_102393232 259
1019 3300010375 Ga0105239_10002642 Ga0105239_100026426 259
1020 3300012483 Ga0157337_1000858 Ga0157337_10008581 259
1021 3300013306 Ga0163162_10012895 Ga0163162_100128954 259
1022 3300013308 Ga0157375_10049059 Ga0157375_100490594 259
1023 3300014326 Ga0157380_10611902 Ga0157380_106119022 259
1024 3300034816 Ga0373930_0002705 Ga0373930_0002705_1103_1900 259
1025 3300034817 Ga0373948_0006564 Ga0373948_0006564_85_882 259
1026 3300034957 Ga0373938_0000049 Ga0373938_0000049_2654_3451 259
1027 3300035084 Ga0373928_0000021 Ga0373928_0000021_850_1647 259
1028 3300035085 Ga0373929_0000048 Ga0373929_0000048_1735_2532 259
1029 3300035088 Ga0373940_0000013 Ga0373940_0000013_6872_7669 259
1030 3300035090 Ga0373949_0000214 Ga0373949_0000214_14324_15121 259
1031 3300035091 Ga0373951_0000646 Ga0373951_0000646_1474_2271 259
1032 3300035092 Ga0373952_0000011 Ga0373952_0000011_1536_2333 259
1033 3300035112 Ga0373932_0000018 Ga0373932_0000018_29406_30203 259
1034 3300035114 Ga0373939_0000116 Ga0373939_0000116_643_1440 259
1035 3300035115 Ga0373941_0001307 Ga0373941_0001307_3022_3819 259
1036 3300035121 Ga0373960_0002914 Ga0373960_0002914_1284_2081 259
1037 3300035207 Ga0373942_0000606 Ga0373942_0000606_1116_1913 259
1038 3300035241 Ga0373961_0001104 Ga0373961_0001104_6659_7456 259
1039 3300035691 Ga0373931_0007116 Ga0373931_0007116_1207_2004 259
1040 3300042876 Ga0451577_0127016 Ga0451577_0127016_183_980 259
1041 3300044712 Ga0453684_0044084 Ga0453684_0044084_3807_4604 259
1042 3300045051 Ga0451576_0011125 Ga0451576_0011125_1143_1940 259
1043 3300048909 Ga0496106_0058250 Ga0496106_0058250_22_819 259
1044 3300048912 Ga0496109_0098334 Ga0496109_0098334_1335_2132 259
1045 3300048913 Ga0496110_0011097 Ga0496110_0011097_3984_4781 259
1046 3300048914 Ga0496111_0319292 Ga0496111_0319292_327_1124 259
1047 3300049577 Ga0501041_0422764 Ga0501041_0422764_32_829 259
1048 3300049591 Ga0501075_0015205 Ga0501075_0015205_3667_4464 259
1049 3300049592 Ga0501076_0022336 Ga0501076_0022336_3909_4706 259
1050 3300049741 Ga0501079_0003856 Ga0501079_0003856_1169_1966 259
1051 3300049743 Ga0501081_0085219 Ga0501081_0085219_1205_2002 259
1052 3300050511 nmdc:mga08y16_73920_c1 nmdc:mga08y16_73920_c1_1549_2346 259
1053 3300050515 nmdc:mga0a205_83824_c1 nmdc:mga0a205_83824_c1_1114_1911 259
1054 3300054114 Ga0501084_0014881 Ga0501084_0014881_58_855 259
1055 3300060353 Ga0501082_0535132 Ga0501082_0535132_104_901 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

228

254

0.95

PF00005

ABC_tran

ABC transporter

19

180

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9301 7 235
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9137 6 235
7efo-assembly1.cif.gz_A lptb2fg-lps from klebsiella pneumoniae in nanodiscs 0.892 7 247
1g9x-assembly3.cif.gz_C characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter 0.8854 4 245
6mjp-assembly1.cif.gz_B lptb(e163q)fgc from vibrio cholerae 0.8848 6 248
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9463 6 247 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9291 7 230 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9222 4 70 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9105 7 230 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9099 6 247 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3D1IYM8-F1-model_v4 ABC transporter 0.9856 162 247 GO:0005524
GO:0005886
AF-A0A2C9ELC4-F1-model_v4 High-affinity branched-chain amino acid transport ATP-binding protein BraF 0.9699 5 248 GO:0005524
GO:0005886
GO:0016887
AF-A0A7J9XS80-F1-model_v4 ATP-binding cassette domain-containing protein 0.9586 4 248 GO:0005524
GO:0005886
GO:0016887
AF-A0A7C3YY79-F1-model_v4 ABC transporter ATP-binding protein 0.9565 5 247 GO:0005524
GO:0005886
GO:0016887
AF-A0A3G1KQ69-F1-model_v4 ABC transporter domain-containing protein 0.9504 4 249 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Feature Viewer

pLDDT pTM Quality
88.16 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map