F489152

General Info

Members Datasets Scaffolds Average Seq Length
1055 427 1055 239

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10050193|Ga0157377_100501932
Length 263
Sequence LDRRGFFPGDSRFGDEKVPHQSESPDRGLLRRHGDNKNGAKRAFFGRRKGHSLKPRQAALFDTLLPRLALDLSNAAPADPRALFAVPVDALRLEIGFGGAEHLIAQAQANPRIGFIATDAFVNAVAKALVAIDERTLTNIRLHFGDASELLDWLPNASISQLDLLYPDPWPKRRHWKRRFIQDDNLRRLARILKTEGELRFATDIADYAAYALARVFRSADFVWTAECADDWRKPWTDFGGTRYEAKAKREGRRPAYFVFRRV

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
9 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
135 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
157 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
235 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
236 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
237 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
238 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
239 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
240 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
241 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
242 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
243 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
246 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
247 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
248 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
249 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
250 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
251 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
252 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
253 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
254 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
255 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
256 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
257 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
258 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
259 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
260 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
262 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
264 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
265 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
266 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
267 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
268 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
269 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
270 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
273 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
274 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
275 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
276 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
277 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
279 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
280 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
281 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
282 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
283 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
286 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
287 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
288 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
289 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
290 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
291 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
292 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
293 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
294 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
295 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
296 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
297 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
298 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
299 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
300 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
301 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
302 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
303 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
304 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
305 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
306 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
311 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
312 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
313 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
314 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
315 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
316 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
317 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
318 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
319 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
320 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
321 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
322 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
323 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
324 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
325 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
326 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
327 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
328 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
329 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
330 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
331 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
332 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
333 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
334 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
335 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
338 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
339 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
340 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
341 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
342 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
343 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
344 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
345 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
346 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
347 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
348 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
349 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
350 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
351 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
352 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
353 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
354 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
355 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
356 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
357 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
361 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
362 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
363 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
366 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
367 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
368 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
369 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
370 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
371 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
378 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
379 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
393 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
394 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
395 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
396 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
397 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
398 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
399 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
400 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
401 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
402 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
403 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
404 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
407 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
408 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
409 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
410 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
411 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
412 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
413 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
414 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
415 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
416 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
417 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
418 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
419 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
420 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
421 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
422 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
423 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
424 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
425 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
426 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
427 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 8.25
Rhizosphere 90.52
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745198 2209111006 Bacteria 16611
2 ARcpr5oldR_c000001 3300000041 Bacteria 84000
3 ARSoilYngRDRAFT_c00002 3300000042 Bacteria 45421
4 ARcpr5yngRDRAFT_c000052 3300000043 Bacteria 18395
5 ARSoilOldRDRAFT_c000001 3300000044 Bacteria 104759
6 ARCol0oldRDRAFT_c00118 3300000045 Bacteria 6952
7 ARCol0yngRDRAFT_1000001 3300000652 Bacteria 73871
8 JGI24032J14994_100737 3300001430 Bacteria 1673
9 JGI24741J21665_1003866 3300001915 Bacteria 3458
10 JGI24752J21851_1006376 3300001976 Bacteria 1542
11 JGI24746J21847_1000659 3300001977 Bacteria 5287
12 JGI24739J22299_10000177 3300001989 Bacteria 21227
13 JGI24737J22298_10005064 3300001990 Bacteria 4565
14 JGI24737J22298_10005147 3300001990 Bacteria 4528
15 JGI24750J21931_1000821 3300002070 Bacteria 4287
16 JGI24750J21931_1000850 3300002070 Bacteria 4210
17 JGI24745J21846_1000205 3300002073 Bacteria 4792
18 JGI24748J21848_1000211 3300002074 Bacteria 7274
19 JGI24738J21930_10000256 3300002075 Bacteria 14438
20 JGI24749J21850_1006010 3300002076 Bacteria 1693
21 JGI24744J21845_10000112 3300002077 Bacteria 11058
22 JGI24033J26618_1000425 3300002155 Bacteria 4204
23 JGI24742J22300_10002461 3300002244 Bacteria 2962
24 JGI25404J52841_10002600 3300003659 Bacteria 3440
25 JGI25405J52794_10023352 3300003911 Bacteria 1258
26 Ga0065712_10001068 3300005290 Bacteria 8962
27 Ga0065712_10188505 3300005290 Bacteria 1159
28 Ga0065715_10003590 3300005293 Bacteria 4262
29 Ga0065715_10093721 3300005293 Bacteria 4582
30 Ga0070658_10008439 3300005327 Bacteria 8286
31 Ga0070676_10012964 3300005328 Bacteria 4566
32 Ga0070676_10044006 3300005328 Bacteria 2597
33 Ga0070683_100000098 3300005329 Bacteria 57301
34 Ga0070683_101029154 3300005329 Bacteria 791
35 Ga0070690_100015149 3300005330 Bacteria 4592
36 Ga0070690_100026107 3300005330 Bacteria 3600
37 Ga0070690_100104042 3300005330 Bacteria 1886
38 Ga0070670_100001544 3300005331 Bacteria 18563
39 Ga0070677_10000092 3300005333 Bacteria 29109
40 Ga0068869_100000054 3300005334 Bacteria 49952
41 Ga0070680_100027363 3300005336 Bacteria 4566
42 Ga0070680_100058485 3300005336 Bacteria 3152
43 Ga0070680_100396210 3300005336 Bacteria 1176
44 Ga0070682_100000181 3300005337 Bacteria 47168
45 Ga0068868_100003816 3300005338 Bacteria 10523
46 Ga0068868_100186885 3300005338 Bacteria 1722
47 Ga0070660_100027651 3300005339 Bacteria 4235
48 Ga0070660_100089794 3300005339 Bacteria 2421
49 Ga0070660_100297881 3300005339 Bacteria 1322
50 Ga0070660_100708931 3300005339 Bacteria 844
51 Ga0070689_100024070 3300005340 Bacteria 4566
52 Ga0070689_100039552 3300005340 Bacteria 3611
53 Ga0070689_100377502 3300005340 Bacteria 1194
54 Ga0070691_10009004 3300005341 Bacteria 4566
55 Ga0070691_10014475 3300005341 Bacteria 3620
56 Ga0070687_100007432 3300005343 Bacteria 4566
57 Ga0070687_100013713 3300005343 Bacteria 3620
58 Ga0070687_100393211 3300005343 Bacteria 907
59 Ga0070661_100000153 3300005344 Bacteria 56652
60 Ga0070661_100059218 3300005344 Bacteria 2807
61 Ga0070692_10000320 3300005345 Bacteria 13809
62 Ga0070668_100024606 3300005347 Bacteria 4562
63 Ga0070669_100027199 3300005353 Bacteria 4117
64 Ga0070669_100070208 3300005353 Bacteria 2589
65 Ga0070669_100367658 3300005353 Bacteria 1171
66 Ga0070675_100027317 3300005354 Bacteria 4584
67 Ga0070675_100378773 3300005354 Bacteria 1259
68 Ga0070675_100383468 3300005354 Bacteria 1251
69 Ga0070671_100011992 3300005355 Bacteria 6971
70 Ga0070671_100114916 3300005355 Bacteria 2262
71 Ga0070671_100512358 3300005355 Bacteria 1032
72 Ga0070674_100017007 3300005356 Bacteria 4566
73 Ga0070674_100083413 3300005356 Bacteria 2289
74 Ga0070674_100212083 3300005356 Bacteria 1501
75 Ga0070674_100385786 3300005356 Bacteria 1141
76 Ga0070673_100005417 3300005364 Bacteria 8166
77 Ga0070688_100023577 3300005365 Bacteria 3620
78 Ga0070659_100025193 3300005366 Bacteria 4566
79 Ga0070659_100054309 3300005366 Bacteria 3155
80 Ga0070659_100349765 3300005366 Bacteria 1240
81 Ga0070667_100029223 3300005367 Bacteria 4592
82 Ga0070667_100107011 3300005367 Bacteria 2421
83 Ga0070703_10004107 3300005406 Bacteria 4111
84 Ga0070703_10007172 3300005406 Bacteria 3129
85 Ga0070709_10246392 3300005434 Bacteria 1285
86 Ga0070709_10544292 3300005434 Unclassified 887
87 Ga0070714_100370257 3300005435 Bacteria 1349
88 Ga0070714_100603998 3300005435 Bacteria 1054
89 Ga0070713_100005576 3300005436 Bacteria 8624
90 Ga0070713_100016744 3300005436 Bacteria 5519
91 Ga0070713_100116115 3300005436 Bacteria 2340
92 Ga0070710_10004049 3300005437 Bacteria 6957
93 Ga0070710_10094569 3300005437 Bacteria 1769
94 Ga0070701_10014309 3300005438 Bacteria 3634
95 Ga0070711_100062903 3300005439 Bacteria 2588
96 Ga0070711_100355580 3300005439 Bacteria 1178
97 Ga0070711_100471932 3300005439 Unclassified 1030
98 Ga0070705_100000311 3300005440 Bacteria 28719
99 Ga0070705_100032626 3300005440 Bacteria 2895
100 Ga0070705_100109693 3300005440 Bacteria 1760
101 Ga0070700_100013652 3300005441 Bacteria 4566
102 Ga0070694_100122542 3300005444 Bacteria 1867
103 Ga0070708_100015291 3300005445 Bacteria 6333
104 Ga0070663_100002418 3300005455 Bacteria 10500
105 Ga0070663_100156092 3300005455 Bacteria 1753
106 Ga0070678_100000382 3300005456 Bacteria 20769
107 Ga0070678_100147029 3300005456 Bacteria 1893
108 Ga0070662_100019898 3300005457 Bacteria 4566
109 Ga0070662_100033993 3300005457 Bacteria 3593
110 Ga0070662_100072994 3300005457 Bacteria 2535
111 Ga0070681_10042293 3300005458 Bacteria 4566
112 Ga0070681_10173797 3300005458 Bacteria 2076
113 Ga0070681_10221004 3300005458 Bacteria 1809
114 Ga0070681_10523804 3300005458 Bacteria 1099
115 Ga0068867_100021877 3300005459 Bacteria 4566
116 Ga0070685_10004779 3300005466 Bacteria 6861
117 Ga0070685_10080613 3300005466 Bacteria 1950
118 Ga0070685_10169087 3300005466 Bacteria 1400
119 Ga0070707_100164538 3300005468 Bacteria 2162
120 Ga0070679_100022398 3300005530 Bacteria 6176
121 Ga0070679_100041737 3300005530 Bacteria 4566
122 Ga0070679_100051061 3300005530 Bacteria 4118
123 Ga0070679_100051422 3300005530 Bacteria 4104
124 Ga0070679_100077850 3300005530 Bacteria 3305
125 Ga0070679_100144573 3300005530 Bacteria 2356
126 Ga0070679_100241026 3300005530 Bacteria 1765
127 Ga0070684_100030755 3300005535 Bacteria 4566
128 Ga0070684_100050287 3300005535 Bacteria 3620
129 Ga0070684_100394562 3300005535 Bacteria 1275
130 Ga0070697_100074309 3300005536 Bacteria 2792
131 Ga0068853_100001615 3300005539 Bacteria 16456
132 Ga0068853_100054660 3300005539 Bacteria 3441
133 Ga0070672_100010353 3300005543 Bacteria 6467
134 Ga0070672_100173707 3300005543 Bacteria 1793
135 Ga0070672_100333385 3300005543 Bacteria 1291
136 Ga0070686_100014350 3300005544 Bacteria 4566
137 Ga0070695_100015681 3300005545 Bacteria 4578
138 Ga0070696_100004854 3300005546 Bacteria 8984
139 Ga0070696_100060128 3300005546 Bacteria 2657
140 Ga0070696_100309990 3300005546 Bacteria 1211
141 Ga0070696_100350674 3300005546 Bacteria 1143
142 Ga0070696_100456101 3300005546 Bacteria 1010
143 Ga0070693_100004759 3300005547 Bacteria 6462
144 Ga0070665_100047110 3300005548 Bacteria 4327
145 Ga0070665_100141229 3300005548 Bacteria 2411
146 Ga0070665_100692157 3300005548 Bacteria 1032
147 Ga0070704_100093974 3300005549 Bacteria 2242
148 Ga0070704_100096510 3300005549 Bacteria 2216
149 Ga0068855_100057337 3300005563 Bacteria 4566
150 Ga0068855_100143145 3300005563 Bacteria 2723
151 Ga0068855_100194016 3300005563 Bacteria 2289
152 Ga0070664_100014418 3300005564 Bacteria 6444
153 Ga0070664_100047954 3300005564 Bacteria 3610
154 Ga0070664_100082047 3300005564 Bacteria 2780
155 Ga0070664_100106768 3300005564 Bacteria 2440
156 Ga0070664_100322413 3300005564 Unclassified 1400
157 Ga0068857_100032777 3300005577 Bacteria 4592
158 Ga0068857_100093574 3300005577 Bacteria 2691
159 Ga0068857_100151308 3300005577 Bacteria 2102
160 Ga0068854_100000145 3300005578 Bacteria 49590
161 Ga0068854_100051437 3300005578 Bacteria 2952
162 Ga0068854_100298229 3300005578 Bacteria 1303
163 Ga0068856_100084816 3300005614 Bacteria 3147
164 Ga0068856_100086099 3300005614 Bacteria 3122
165 Ga0070702_100001703 3300005615 Bacteria 9128
166 Ga0070702_100555793 3300005615 Bacteria 853
167 Ga0068852_100028596 3300005616 Bacteria 4566
168 Ga0068852_100133271 3300005616 Bacteria 2290
169 Ga0068852_100926228 3300005616 Bacteria 889
170 Ga0068859_100062972 3300005617 Bacteria 3739
171 Ga0068859_100066075 3300005617 Bacteria 3651
172 Ga0068859_100075527 3300005617 Bacteria 3410
173 Ga0068864_100014958 3300005618 Bacteria 6449
174 Ga0068864_100135595 3300005618 Bacteria 2216
175 Ga0068866_10000209 3300005718 Bacteria 27638
176 Ga0068861_100021773 3300005719 Bacteria 4610
177 Ga0068861_100037215 3300005719 Bacteria 3617
178 Ga0068861_100265060 3300005719 Bacteria 1473
179 Ga0068851_10021107 3300005834 Bacteria 3160
180 Ga0068870_10000029 3300005840 Bacteria 45103
181 Ga0068863_100019798 3300005841 Bacteria 6436
182 Ga0068863_100113155 3300005841 Unclassified 2585
183 Ga0068858_100035970 3300005842 Bacteria 4592
184 Ga0068858_100117267 3300005842 Bacteria 2488
185 Ga0068858_100170651 3300005842 Bacteria 2051
186 Ga0068860_100044535 3300005843 Bacteria 4229
187 Ga0068860_100059856 3300005843 Bacteria 3620
188 Ga0068860_100395141 3300005843 Bacteria 1367
189 Ga0068862_100011280 3300005844 Bacteria 7379
190 Ga0068862_100036879 3300005844 Bacteria 4143
191 Ga0081455_10000002 3300005937 Bacteria 460472
192 Ga0081455_10007598 3300005937 Bacteria 11395
193 Ga0081540_1000150 3300005983 Bacteria 71934
194 Ga0081540_1014154 3300005983 Bacteria 5133
195 Ga0070717_10003573 3300006028 Bacteria 11149
196 Ga0070717_10134176 3300006028 Bacteria 2131
197 Ga0075365_10064057 3300006038 Bacteria 2462
198 Ga0075432_10000858 3300006058 Bacteria 9575
199 Ga0070715_10004174 3300006163 Bacteria 4701
200 Ga0070715_10009672 3300006163 Bacteria 3407
201 Ga0075367_10116176 3300006178 Bacteria 1646
202 Ga0075427_10006621 3300006194 Bacteria 1684
203 Ga0097621_100000328 3300006237 Bacteria 32181
204 Ga0097621_100009094 3300006237 Bacteria 7199
205 Ga0075370_10205919 3300006353 Bacteria 1161
206 Ga0068871_100007030 3300006358 Bacteria 8017
207 Ga0068871_100023940 3300006358 Bacteria 4731
208 Ga0068871_100085303 3300006358 Bacteria 2622
209 Ga0075428_100002065 3300006844 Bacteria 21658
210 Ga0075430_100000129 3300006846 Bacteria 47714
211 Ga0075431_100000234 3300006847 Bacteria 41571
212 Ga0075431_100449841 3300006847 Bacteria 1284
213 Ga0075433_10000060 3300006852 Bacteria 47870
214 Ga0075433_10005178 3300006852 Bacteria 10214
215 Ga0075433_10091829 3300006852 Bacteria 2684
216 Ga0075434_100000412 3300006871 Bacteria 31664
217 Ga0075434_100003277 3300006871 Bacteria 14477
218 Ga0075434_100049205 3300006871 Bacteria 4185
219 Ga0075434_100109607 3300006871 Bacteria 2771
220 Ga0075429_100000532 3300006880 Bacteria 28949
221 Ga0075429_100303077 3300006880 Bacteria 1399
222 Ga0068865_100011649 3300006881 Bacteria 5510
223 Ga0068865_100061544 3300006881 Bacteria 2632
224 Ga0068865_100395594 3300006881 Bacteria 1131
225 Ga0075436_100070902 3300006914 Bacteria 2409
226 Ga0075436_100203536 3300006914 Bacteria 1402
227 Ga0075436_100470404 3300006914 Bacteria 917
228 Ga0097620_100062974 3300006931 Bacteria 3739
229 Ga0097620_100066081 3300006931 Bacteria 3651
230 Ga0097620_100075530 3300006931 Bacteria 3410
231 Ga0075435_100008631 3300007076 Bacteria 7325
232 Ga0075435_100074494 3300007076 Bacteria 2777
233 Ga0075435_100128723 3300007076 Bacteria 2117
234 Ga0075435_100247441 3300007076 Bacteria 1517
235 Ga0105244_10020723 3300009036 Bacteria 3647
236 Ga0105250_10004829 3300009092 Bacteria 6133
237 Ga0105250_10126411 3300009092 Bacteria 1053
238 Ga0105240_10029089 3300009093 Bacteria 7205
239 Ga0105240_10071744 3300009093 Bacteria 4282
240 Ga0105240_10228923 3300009093 Bacteria 2162
241 Ga0111539_10004252 3300009094 Bacteria 18756
242 Ga0111539_10058244 3300009094 Bacteria 4584
243 Ga0111539_10058514 3300009094 Bacteria 4572
244 Ga0111539_10087470 3300009094 Bacteria 3660
245 Ga0105245_10000882 3300009098 Bacteria 27254
246 Ga0105245_10180158 3300009098 Bacteria 2018
247 Ga0105245_11045134 3300009098 Bacteria 862
248 Ga0105247_10001969 3300009101 Bacteria 14264
249 Ga0105247_10015650 3300009101 Bacteria 4540
250 Ga0105247_10088788 3300009101 Bacteria 1959
251 Ga0105247_10113517 3300009101 Bacteria 1746
252 Ga0105247_10145007 3300009101 Bacteria 1560
253 Ga0114129_10011272 3300009147 Bacteria 12741
254 Ga0114129_10011377 3300009147 Bacteria 12675
255 Ga0105243_10024684 3300009148 Bacteria 4587
256 Ga0105243_10039281 3300009148 Bacteria 3688
257 Ga0105243_10112355 3300009148 Bacteria 2282
258 Ga0105243_10137153 3300009148 Bacteria 2083
259 Ga0105243_10330732 3300009148 Bacteria 1392
260 Ga0105241_10004094 3300009174 Bacteria 10774
261 Ga0105241_10097873 3300009174 Bacteria 2327
262 Ga0105242_10021910 3300009176 Bacteria 5022
263 Ga0105242_10230762 3300009176 Bacteria 1659
264 Ga0105242_10422351 3300009176 Bacteria 1250
265 Ga0105248_10034980 3300009177 Bacteria 5621
266 Ga0105248_10049550 3300009177 Bacteria 4711
267 Ga0105248_10381652 3300009177 Bacteria 1587
268 Ga0105248_10658159 3300009177 Bacteria 1182
269 Ga0105237_10016131 3300009545 Bacteria 7769
270 Ga0105237_10110080 3300009545 Bacteria 2746
271 Ga0105237_10380585 3300009545 Bacteria 1416
272 Ga0105238_10288062 3300009551 Bacteria 1624
273 Ga0105238_10292464 3300009551 Bacteria 1611
274 Ga0105249_10008019 3300009553 Bacteria 9205
275 Ga0105249_10037532 3300009553 Bacteria 4397
276 Ga0105249_10194309 3300009553 Bacteria 1982
277 Ga0105249_10413790 3300009553 Bacteria 1381
278 Ga0105239_10049789 3300010375 Bacteria 4595
279 Ga0105239_10052026 3300010375 Bacteria 4490
280 Ga0105239_10349846 3300010375 Bacteria 1668
281 Ga0105246_10007744 3300011119 Bacteria 6591
282 Ga0157347_1004501 3300012502 Bacteria 1298
283 Ga0157338_1006414 3300012515 Bacteria 1087
284 Ga0157373_10006834 3300013100 Bacteria 8493
285 Ga0157371_10012862 3300013102 Bacteria 6372
286 Ga0157371_10052032 3300013102 Bacteria 2909
287 Ga0157371_10123108 3300013102 Bacteria 1844
288 Ga0157370_10038422 3300013104 Bacteria 4630
289 Ga0157369_10299185 3300013105 Bacteria 1674
290 Ga0157374_10000614 3300013296 Bacteria 31520
291 Ga0157374_10432005 3300013296 Bacteria 1317
292 Ga0157374_10790265 3300013296 Bacteria 965
293 Ga0157378_10000701 3300013297 Bacteria 31354
294 Ga0157378_10141244 3300013297 Bacteria 2236
295 Ga0157378_10154525 3300013297 Bacteria 2140
296 Ga0157378_10622402 3300013297 Bacteria 1093
297 Ga0163162_10042063 3300013306 Bacteria 4572
298 Ga0163162_10060042 3300013306 Bacteria 3836
299 Ga0163162_10467102 3300013306 Bacteria 1393
300 Ga0163162_10545355 3300013306 Bacteria 1288
301 Ga0157372_10028350 3300013307 Bacteria 6110
302 Ga0157372_10338765 3300013307 Bacteria 1752
303 Ga0157372_10699436 3300013307 Bacteria 1180
304 Ga0157375_10009978 3300013308 Bacteria 8349
305 Ga0157375_10038574 3300013308 Bacteria 4587
306 Ga0157375_10159258 3300013308 Bacteria 2399
307 Ga0157375_10414997 3300013308 Bacteria 1512
308 Ga0157375_11126533 3300013308 Bacteria 919
309 Ga0163163_10007899 3300014325 Bacteria 9406
310 Ga0163163_10033764 3300014325 Bacteria 4952
311 Ga0157380_10001646 3300014326 Bacteria 14707
312 Ga0157380_10107099 3300014326 Bacteria 2340
313 Ga0157380_10304208 3300014326 Bacteria 1470
314 Ga0157380_10616293 3300014326 Bacteria 1076
315 Ga0157377_10000514 3300014745 Bacteria 16439
316 Ga0157377_10050193 3300014745 Bacteria 2348
317 Ga0157379_10003823 3300014968 Bacteria 12837
318 Ga0157379_10125244 3300014968 Bacteria 2312
319 Ga0157379_10129603 3300014968 Bacteria 2270
320 Ga0157379_10137747 3300014968 Bacteria 2200
321 Ga0157379_10270049 3300014968 Bacteria 1546
322 Ga0157379_10305929 3300014968 Bacteria 1449
323 Ga0157376_10000860 3300014969 Bacteria 19922
324 Ga0157376_10048487 3300014969 Bacteria 3512
325 Ga0157376_10341078 3300014969 Bacteria 1431
326 Ga0157376_10748979 3300014969 Bacteria 986
327 Ga0163161_10000956 3300017792 Bacteria 22176
328 Ga0163161_10178929 3300017792 Bacteria 1625
329 Ga0163161_10222039 3300017792 Bacteria 1463
330 Ga0197907_11114363 3300020069 Bacteria 1585
331 Ga0206354_11430131 3300020081 Bacteria 1411
332 Ga0206353_11674680 3300020082 Bacteria 2049
333 Ga0213876_10062749 3300021384 Bacteria 1962
334 Ga0207666_1000043 3300025271 Bacteria 24939
335 Ga0207666_1000617 3300025271 Bacteria 4255
336 Ga0207673_1000017 3300025290 Bacteria 12689
337 Ga0207697_10001136 3300025315 Bacteria 14657
338 Ga0207697_10008878 3300025315 Bacteria 4371
339 Ga0207653_10007260 3300025885 Bacteria 3456
340 Ga0207653_10015009 3300025885 Bacteria 2431
341 Ga0207682_10000021 3300025893 Bacteria 63904
342 Ga0207692_10011004 3300025898 Bacteria 3830
343 Ga0207642_10000063 3300025899 Bacteria 29814
344 Ga0207710_10028544 3300025900 Bacteria 2422
345 Ga0207710_10116105 3300025900 Bacteria 1274
346 Ga0207688_10000949 3300025901 Bacteria 14704
347 Ga0207688_10094425 3300025901 Bacteria 1721
348 Ga0207680_10009142 3300025903 Bacteria 4899
349 Ga0207680_10285752 3300025903 Bacteria 1147
350 Ga0207647_10013700 3300025904 Bacteria 5614
351 Ga0207647_10021210 3300025904 Bacteria 4339
352 Ga0207685_10019435 3300025905 Bacteria 2239
353 Ga0207699_10001682 3300025906 Bacteria 10460
354 Ga0207699_10061636 3300025906 Bacteria 2257
355 Ga0207645_10011742 3300025907 Bacteria 5968
356 Ga0207645_10018617 3300025907 Bacteria 4563
357 Ga0207645_10123720 3300025907 Bacteria 1680
358 Ga0207645_10268287 3300025907 Bacteria 1131
359 Ga0207643_10000108 3300025908 Bacteria 56497
360 Ga0207705_10077997 3300025909 Bacteria 2410
361 Ga0207705_10632208 3300025909 Bacteria 832
362 Ga0207654_10001731 3300025911 Bacteria 11357
363 Ga0207654_10263515 3300025911 Bacteria 1160
364 Ga0207707_10013364 3300025912 Bacteria 7156
365 Ga0207707_10032373 3300025912 Bacteria 4576
366 Ga0207707_10052219 3300025912 Bacteria 3560
367 Ga0207707_10145745 3300025912 Bacteria 2070
368 Ga0207707_10377881 3300025912 Bacteria 1218
369 Ga0207707_10662366 3300025912 Bacteria 879
370 Ga0207695_10212559 3300025913 Bacteria 1844
371 Ga0207671_10012822 3300025914 Bacteria 6715
372 Ga0207671_10055174 3300025914 Bacteria 2944
373 Ga0207693_10006099 3300025915 Bacteria 9985
374 Ga0207693_10018314 3300025915 Bacteria 5580
375 Ga0207693_10059968 3300025915 Bacteria 2981
376 Ga0207663_10008774 3300025916 Bacteria 5310
377 Ga0207663_10200440 3300025916 Bacteria 1439
378 Ga0207663_10265191 3300025916 Bacteria 1270
379 Ga0207663_10453618 3300025916 Bacteria 989
380 Ga0207660_10000014 3300025917 Bacteria 79328
381 Ga0207660_10164360 3300025917 Bacteria 1715
382 Ga0207662_10005530 3300025918 Bacteria 6749
383 Ga0207662_10020149 3300025918 Bacteria 3804
384 Ga0207657_10007397 3300025919 Bacteria 11262
385 Ga0207657_10034796 3300025919 Bacteria 4524
386 Ga0207657_10054202 3300025919 Bacteria 3469
387 Ga0207657_10286673 3300025919 Bacteria 1306
388 Ga0207649_10000086 3300025920 Bacteria 79546
389 Ga0207649_10089487 3300025920 Bacteria 2012
390 Ga0207652_10000255 3300025921 Bacteria 55415
391 Ga0207652_10120280 3300025921 Bacteria 2336
392 Ga0207652_10322151 3300025921 Bacteria 1395
393 Ga0207681_10000024 3300025923 Bacteria 206607
394 Ga0207681_10405362 3300025923 Bacteria 1102
395 Ga0207694_10619387 3300025924 Bacteria 911
396 Ga0207650_10005453 3300025925 Bacteria 8683
397 Ga0207650_10481834 3300025925 Bacteria 1035
398 Ga0207659_10000034 3300025926 Bacteria 108227
399 Ga0207659_10089772 3300025926 Bacteria 2292
400 Ga0207659_10315215 3300025926 Bacteria 1289
401 Ga0207659_10408687 3300025926 Bacteria 1137
402 Ga0207687_10000110 3300025927 Bacteria 58672
403 Ga0207687_10076773 3300025927 Bacteria 2401
404 Ga0207687_10124760 3300025927 Bacteria 1931
405 Ga0207687_10744148 3300025927 Bacteria 834
406 Ga0207700_10001909 3300025928 Bacteria 11858
407 Ga0207700_10206762 3300025928 Bacteria 1657
408 Ga0207664_10066335 3300025929 Bacteria 2893
409 Ga0207644_10000868 3300025931 Bacteria 19086
410 Ga0207644_10025290 3300025931 Bacteria 4082
411 Ga0207644_10782751 3300025931 Bacteria 797
412 Ga0207690_10000270 3300025932 Bacteria 36976
413 Ga0207690_10087572 3300025932 Bacteria 2191
414 Ga0207690_10114094 3300025932 Bacteria 1951
415 Ga0207706_10033611 3300025933 Bacteria 4563
416 Ga0207706_10040100 3300025933 Bacteria 4150
417 Ga0207706_10189817 3300025933 Bacteria 1804
418 Ga0207706_10229486 3300025933 Bacteria 1625
419 Ga0207706_10313411 3300025933 Bacteria 1366
420 Ga0207706_10341766 3300025933 Bacteria 1302
421 Ga0207686_10000214 3300025934 Bacteria 44245
422 Ga0207686_10072351 3300025934 Bacteria 2221
423 Ga0207709_10000344 3300025935 Bacteria 48058
424 Ga0207709_10010118 3300025935 Bacteria 5195
425 Ga0207709_10244590 3300025935 Bacteria 1307
426 Ga0207709_10321624 3300025935 Bacteria 1158
427 Ga0207670_10010144 3300025936 Bacteria 5410
428 Ga0207670_10015325 3300025936 Bacteria 4578
429 Ga0207670_10122715 3300025936 Bacteria 1891
430 Ga0207669_10000295 3300025937 Bacteria 22936
431 Ga0207669_10025469 3300025937 Bacteria 3199
432 Ga0207669_10026480 3300025937 Bacteria 3155
433 Ga0207704_10000343 3300025938 Bacteria 21644
434 Ga0207704_10165665 3300025938 Bacteria 1578
435 Ga0207704_10404826 3300025938 Bacteria 1078
436 Ga0207665_10001068 3300025939 Bacteria 18420
437 Ga0207665_10782940 3300025939 Bacteria 753
438 Ga0207691_10003768 3300025940 Bacteria 14723
439 Ga0207691_10286420 3300025940 Bacteria 1417
440 Ga0207691_10315884 3300025940 Bacteria 1340
441 Ga0207711_10001706 3300025941 Bacteria 20209
442 Ga0207711_10007798 3300025941 Bacteria 8948
443 Ga0207711_10342736 3300025941 Bacteria 1383
444 Ga0207689_10002655 3300025942 Bacteria 16537
445 Ga0207689_10209544 3300025942 Bacteria 1610
446 Ga0207661_10000094 3300025944 Bacteria 56621
447 Ga0207661_10691251 3300025944 Bacteria 938
448 Ga0207679_10000025 3300025945 Bacteria 203699
449 Ga0207679_10020011 3300025945 Bacteria 4509
450 Ga0207679_10132305 3300025945 Bacteria 2003
451 Ga0207679_10238500 3300025945 Bacteria 1539
452 Ga0207679_10248196 3300025945 Bacteria 1512
453 Ga0207667_10006649 3300025949 Bacteria 13973
454 Ga0207667_10046648 3300025949 Bacteria 4588
455 Ga0207667_10054806 3300025949 Bacteria 4193
456 Ga0207651_10000028 3300025960 Bacteria 68962
457 Ga0207712_10000558 3300025961 Bacteria 30161
458 Ga0207668_10000098 3300025972 Bacteria 62195
459 Ga0207668_10045417 3300025972 Bacteria 2996
460 Ga0207668_10092117 3300025972 Bacteria 2230
461 Ga0207640_10000104 3300025981 Bacteria 65093
462 Ga0207640_10015182 3300025981 Bacteria 4453
463 Ga0207658_10276159 3300025986 Bacteria 1438
464 Ga0207658_10291315 3300025986 Bacteria 1403
465 Ga0207677_10005087 3300026023 Bacteria 7109
466 Ga0207677_10012453 3300026023 Bacteria 4890
467 Ga0207703_10000594 3300026035 Bacteria 36837
468 Ga0207703_10006566 3300026035 Bacteria 9280
469 Ga0207703_10764680 3300026035 Bacteria 921
470 Ga0207639_10000265 3300026041 Bacteria 37412
471 Ga0207678_10003256 3300026067 Bacteria 14657
472 Ga0207678_10035004 3300026067 Bacteria 4372
473 Ga0207678_10085762 3300026067 Bacteria 2691
474 Ga0207708_10024812 3300026075 Bacteria 4536
475 Ga0207708_10024934 3300026075 Bacteria 4524
476 Ga0207708_10625825 3300026075 Bacteria 914
477 Ga0207702_10001351 3300026078 Bacteria 24451
478 Ga0207702_10085087 3300026078 Bacteria 2755
479 Ga0207702_10132731 3300026078 Bacteria 2242
480 Ga0207702_10897314 3300026078 Bacteria 878
481 Ga0207641_10005095 3300026088 Bacteria 11256
482 Ga0207648_10004307 3300026089 Bacteria 14659
483 Ga0207648_10160756 3300026089 Bacteria 1984
484 Ga0207676_10000640 3300026095 Bacteria 28116
485 Ga0207674_10005795 3300026116 Bacteria 14657
486 Ga0207674_10094456 3300026116 Bacteria 2977
487 Ga0207675_100003849 3300026118 Bacteria 14589
488 Ga0207675_100041595 3300026118 Bacteria 4292
489 Ga0207675_100041946 3300026118 Bacteria 4272
490 Ga0207683_10000001 3300026121 Bacteria 352047
491 Ga0207683_10007134 3300026121 Bacteria 9578
492 Ga0207683_10067720 3300026121 Bacteria 3150
493 Ga0207698_10001784 3300026142 Bacteria 12572
494 Ga0207698_10559774 3300026142 Bacteria 1122
495 Ga0209973_1000485 3300027252 Bacteria 3029
496 Ga0209995_1006935 3300027471 Bacteria 1827
497 Ga0210002_1001067 3300027617 Bacteria 3795
498 Ga0209983_1016594 3300027665 Bacteria 1521
499 Ga0209971_1011706 3300027682 Bacteria 2079
500 Ga0209966_1001536 3300027695 Bacteria 4012
501 Ga0209998_10002199 3300027717 Bacteria 4524
502 Ga0209998_10003000 3300027717 Bacteria 3755
503 Ga0209998_10012661 3300027717 Bacteria 1752
504 Ga0209974_10004169 3300027876 Bacteria 5171
505 Ga0209974_10014697 3300027876 Bacteria 2602
506 Ga0207428_10000146 3300027907 Bacteria 95417
507 Ga0207428_10000221 3300027907 Bacteria 79234
508 Ga0207428_10000590 3300027907 Bacteria 42889
509 Ga0268266_10012422 3300028379 Bacteria 7362
510 Ga0268266_10022724 3300028379 Bacteria 5339
511 Ga0268266_10108502 3300028379 Bacteria 2456
512 Ga0268266_10602734 3300028379 Bacteria 1055
513 Ga0268265_10005507 3300028380 Bacteria 8641
514 Ga0268265_10228447 3300028380 Bacteria 1634
515 Ga0268264_10000456 3300028381 Bacteria 55761
516 Ga0268264_10178976 3300028381 Bacteria 1924
517 Ga0268264_10390491 3300028381 Bacteria 1335
518 Ga0268264_10575414 3300028381 Bacteria 1107
519 Ga0265338_10131874 3300028800 Bacteria 1971
520 Ga0265330_10017783 3300031235 Bacteria 3271
521 Ga0265325_10000056 3300031241 Bacteria 77353
522 Ga0265325_10009447 3300031241 Bacteria 5691
523 Ga0265325_10011003 3300031241 Bacteria 5210
524 Ga0265325_10134796 3300031241 Bacteria 1179
525 Ga0265340_10021356 3300031247 Bacteria 3321
526 Ga0265339_10001467 3300031249 Bacteria 17421
527 Ga0265339_10069942 3300031249 Bacteria 1873
528 Ga0265339_10191220 3300031249 Bacteria 1014
529 Ga0265316_10022096 3300031344 Bacteria 5374
530 Ga0265316_10046316 3300031344 Bacteria 3447
531 Ga0265316_10108046 3300031344 Bacteria 2109
532 Ga0265313_10002478 3300031595 Bacteria 15910
533 Ga0265313_10019854 3300031595 Bacteria 3725
534 Ga0265313_10034043 3300031595 Bacteria 2581
535 Ga0265313_10047272 3300031595 Bacteria 2084
536 Ga0265313_10136068 3300031595 Bacteria 1060
537 Ga0316575_10082457 3300031665 Bacteria 1298
538 Ga0265314_10000391 3300031711 Bacteria 59630
539 Ga0265314_10015471 3300031711 Bacteria 6053
540 Ga0265314_10111305 3300031711 Bacteria 1740
541 Ga0265342_10000983 3300031712 Bacteria 28114
542 Ga0307409_100689398 3300031995 Bacteria 1020
543 Ga0373930_0000005 3300034816 Bacteria 25122
544 Ga0373948_0000203 3300034817 Bacteria 6831
545 Ga0373948_0006852 3300034817 Bacteria 1898
546 Ga0373948_0021977 3300034817 Bacteria 1226
547 Ga0373950_0000614 3300034818 Bacteria 4412
548 Ga0373958_0000033 3300034819 Bacteria 13945
549 Ga0373958_0000839 3300034819 Bacteria 3934
550 Ga0373959_0000714 3300034820 Bacteria 5679
551 Ga0373938_0000517 3300034957 Bacteria 6246
552 Ga0373938_0002463 3300034957 Bacteria 2988
553 Ga0373926_0028249 3300035083 Bacteria 1968
554 Ga0373928_0000058 3300035084 Bacteria 19168
555 Ga0373928_0002188 3300035084 Bacteria 3810
556 Ga0373928_0003549 3300035084 Bacteria 2975
557 Ga0373929_0000552 3300035085 Bacteria 7202
558 Ga0373929_0008568 3300035085 Bacteria 1887
559 Ga0373934_0057166 3300035086 Bacteria 1552
560 Ga0373934_0072943 3300035086 Bacteria 1374
561 Ga0373940_0001756 3300035088 Bacteria 4028
562 Ga0373940_0007632 3300035088 Bacteria 2447
563 Ga0373940_0013713 3300035088 Bacteria 1967
564 Ga0373944_0006589 3300035089 Bacteria 3084
565 Ga0373944_0053039 3300035089 Bacteria 1282
566 Ga0373949_0002457 3300035090 Bacteria 4755
567 Ga0373949_0015490 3300035090 Bacteria 1704
568 Ga0373949_0027929 3300035090 Bacteria 1329
569 Ga0373949_0032644 3300035090 Bacteria 1247
570 Ga0373951_0002590 3300035091 Bacteria 4541
571 Ga0373951_0049579 3300035091 Bacteria 1030
572 Ga0373952_0002862 3300035092 Bacteria 3119
573 Ga0373952_0003011 3300035092 Bacteria 3042
574 Ga0373952_0004967 3300035092 Bacteria 2420
575 Ga0373923_0019083 3300035111 Bacteria 2649
576 Ga0373932_0000987 3300035112 Bacteria 8250
577 Ga0373932_0003158 3300035112 Bacteria 4011
578 Ga0373932_0003436 3300035112 Bacteria 3810
579 Ga0373936_0010987 3300035113 Bacteria 3421
580 Ga0373939_0000783 3300035114 Bacteria 7833
581 Ga0373939_0001082 3300035114 Bacteria 6698
582 Ga0373939_0002024 3300035114 Bacteria 4839
583 Ga0373939_0008014 3300035114 Bacteria 2580
584 Ga0373939_0010179 3300035114 Bacteria 2346
585 Ga0373941_0000140 3300035115 Bacteria 12827
586 Ga0373941_0003396 3300035115 Bacteria 3605
587 Ga0373945_0077083 3300035116 Bacteria 1271
588 Ga0373953_0022523 3300035117 Bacteria 2376
589 Ga0373953_0139634 3300035117 Bacteria 1036
590 Ga0373953_0195319 3300035117 Bacteria 875
591 Ga0373954_0004912 3300035118 Bacteria 5772
592 Ga0373954_0007317 3300035118 Bacteria 4828
593 Ga0373956_0014602 3300035119 Bacteria 3283
594 Ga0373956_0023059 3300035119 Bacteria 2668
595 Ga0373956_0148111 3300035119 Bacteria 1104
596 Ga0373957_0014554 3300035120 Bacteria 2691
597 Ga0373957_0083530 3300035120 Bacteria 1263
598 Ga0373957_0102114 3300035120 Bacteria 1149
599 Ga0373960_0002027 3300035121 Bacteria 4553
600 Ga0373960_0003110 3300035121 Bacteria 3747
601 Ga0373960_0038885 3300035121 Bacteria 1366
602 Ga0373943_0016382 3300035170 Bacteria 3379
603 Ga0373943_0017942 3300035170 Bacteria 3245
604 Ga0373946_0012607 3300035171 Bacteria 3167
605 Ga0373946_0014256 3300035171 Bacteria 2996
606 Ga0373955_0024171 3300035172 Bacteria 3104
607 Ga0373955_0024957 3300035172 Bacteria 3063
608 Ga0373955_0047108 3300035172 Bacteria 2333
609 Ga0373955_0225138 3300035172 Bacteria 1121
610 Ga0373942_0004650 3300035207 Bacteria 3180
611 Ga0373942_0005098 3300035207 Bacteria 3046
612 Ga0373942_0027485 3300035207 Bacteria 1480
613 Ga0373961_0000385 3300035241 Bacteria 18617
614 Ga0373961_0018927 3300035241 Bacteria 1803
615 Ga0373961_0023941 3300035241 Bacteria 1647
616 Ga0373962_0009009 3300035242 Bacteria 2464
617 Ga0373962_0011063 3300035242 Bacteria 2256
618 Ga0373962_0013150 3300035242 Bacteria 2092
619 Ga0373924_0003869 3300035410 Bacteria 5186
620 Ga0373924_0014049 3300035410 Bacteria 3020
621 Ga0373931_0000130 3300035691 Bacteria 34420
622 Ga0373931_0003847 3300035691 Bacteria 6785
623 Ga0373931_0011865 3300035691 Bacteria 4213
624 Ga0373931_0242563 3300035691 Bacteria 1093
625 Ga0373935_0003155 3300035692 Bacteria 9507
626 Ga0373935_0030530 3300035692 Bacteria 3341
627 Ga0373935_0284115 3300035692 Bacteria 1165
628 Ga0373935_0311701 3300035692 Bacteria 1114
629 Ga0373935_0556600 3300035692 Bacteria 836
630 Ga0373927_0004274 3300035695 Bacteria 10029
631 Ga0373933_0005885 3300035724 Bacteria 6669
632 Ga0373933_0013244 3300035724 Bacteria 4568
633 Ga0373933_0087116 3300035724 Bacteria 1923
634 Ga0373933_0127897 3300035724 Bacteria 1595
635 Ga0373947_0004749 3300035725 Bacteria 7968
636 Ga0373947_0111730 3300035725 Bacteria 1727
637 Ga0373937_0010450 3300036401 Bacteria 8105
638 Ga0373937_0016552 3300036401 Bacteria 6548
639 Ga0373937_0029083 3300036401 Bacteria 5003
640 Ga0373937_0125919 3300036401 Bacteria 2390
641 Ga0373937_0205189 3300036401 Bacteria 1853
642 Ga0373937_0264040 3300036401 Bacteria 1624
643 Ga0373937_0288143 3300036401 Bacteria 1551
644 Ga0373925_0001412 3300037068 Bacteria 20860
645 Ga0373925_0400974 3300037068 Bacteria 1119
646 Ga0242420_008710 3300038996 Bacteria 1652
647 Ga0436365_1153613 3300039437 Bacteria 1226
648 Ga0436365_1291451 3300039437 Bacteria 2194
649 Ga0439453_0000724 3300041408 Bacteria 3817
650 Ga0439441_028274 3300042001 Bacteria 1074
651 Ga0439463_007316 3300042016 Bacteria 2728
652 Ga0439446_0070335 3300042156 Bacteria 1070
653 Ga0439434_0049585 3300042435 Bacteria 1300
654 Ga0439435_0020743 3300042436 Bacteria 1698
655 Ga0439459_0009621 3300042438 Bacteria 1673
656 Ga0439464_0025431 3300042439 Bacteria 1639
657 Ga0439460_0021792 3300042461 Bacteria 1754
658 Ga0439460_0032851 3300042461 Bacteria 1489
659 Ga0451577_0076456 3300042876 Bacteria 2985
660 Ga0453684_0045660 3300044712 Bacteria 5839
661 Ga0451576_0005933 3300045051 Bacteria 15133
662 Ga0495617_009209 3300046452 Bacteria 3393
663 Ga0495592_0007579 3300046454 Bacteria 8126
664 Ga0495592_0016926 3300046454 Bacteria 5535
665 Ga0495592_0079259 3300046454 Bacteria 2377
666 Ga0495603_0010367 3300046455 Bacteria 5641
667 Ga0495603_0021414 3300046455 Bacteria 3915
668 Ga0495603_0116140 3300046455 Bacteria 1560
669 Ga0495629_0000909 3300046459 Bacteria 23761
670 Ga0495629_0056541 3300046459 Bacteria 2743
671 Ga0495629_0095300 3300046459 Bacteria 2076
672 Ga0495641_0015089 3300046461 Bacteria 4148
673 Ga0495641_0036557 3300046461 Bacteria 2307
674 Ga0495651_0002035 3300046462 Bacteria 15618
675 Ga0495651_0008748 3300046462 Bacteria 7766
676 Ga0495651_0011644 3300046462 Bacteria 6762
677 Ga0495651_0065926 3300046462 Bacteria 2765
678 Ga0495651_0076302 3300046462 Bacteria 2539
679 Ga0495651_0495623 3300046462 Bacteria 783
680 Ga0495653_0027062 3300046463 Bacteria 4592
681 Ga0495653_0029649 3300046463 Bacteria 4365
682 Ga0495653_0054179 3300046463 Bacteria 3066
683 Ga0495653_0057670 3300046463 Bacteria 2954
684 Ga0495653_0207867 3300046463 Bacteria 1324
685 Ga0495580_0088609 3300046472 Bacteria 2155
686 Ga0495580_0145924 3300046472 Bacteria 1640
687 Ga0495582_0002021 3300046473 Bacteria 11367
688 Ga0495582_0002597 3300046473 Bacteria 10047
689 Ga0495605_0032808 3300046474 Bacteria 2641
690 Ga0495639_0006208 3300046475 Bacteria 5131
691 Ga0495662_0043060 3300046476 Bacteria 2179
692 Ga0495662_0154713 3300046476 Bacteria 1129
693 Ga0495664_0007311 3300046477 Bacteria 6128
694 Ga0495664_0023714 3300046477 Bacteria 3561
695 Ga0495664_0032029 3300046477 Bacteria 3083
696 Ga0495664_0057905 3300046477 Bacteria 2305
697 Ga0495584_0004152 3300046491 Bacteria 7819
698 Ga0495585_0000856 3300046492 Bacteria 26041
699 Ga0495594_0161848 3300046499 Bacteria 1272
700 Ga0495594_0253507 3300046499 Bacteria 1002
701 Ga0495607_0001563 3300046501 Bacteria 20034
702 Ga0495608_0000915 3300046511 Bacteria 20676
703 Ga0495608_0025614 3300046511 Bacteria 4027
704 Ga0495608_0029844 3300046511 Bacteria 3696
705 Ga0495618_0024462 3300046514 Bacteria 3740
706 Ga0495618_0056529 3300046514 Bacteria 2484
707 Ga0495618_0178095 3300046514 Bacteria 1351
708 Ga0495618_0223002 3300046514 Bacteria 1189
709 Ga0495628_0010424 3300046516 Bacteria 7895
710 Ga0495628_0020944 3300046516 Bacteria 5385
711 Ga0495628_0049175 3300046516 Bacteria 3339
712 Ga0495628_0076288 3300046516 Bacteria 2609
713 Ga0495630_0083103 3300046517 Bacteria 2417
714 Ga0495630_0193891 3300046517 Bacteria 1550
715 Ga0495630_0286970 3300046517 Bacteria 1257
716 Ga0495637_0008444 3300046520 Bacteria 5058
717 Ga0495637_0022486 3300046520 Bacteria 2875
718 Ga0495644_0000392 3300046523 Bacteria 19644
719 Ga0495663_0016049 3300046525 Bacteria 2115
720 Ga0495666_0105934 3300046526 Bacteria 1323
721 Ga0495652_0009116 3300046529 Bacteria 9030
722 Ga0495652_0020953 3300046529 Bacteria 5810
723 Ga0495652_0197711 3300046529 Bacteria 1528
724 Ga0495665_0003663 3300046531 Bacteria 8332
725 Ga0495665_0027096 3300046531 Bacteria 3076
726 Ga0495640_0029737 3300046533 Bacteria 3918
727 Ga0495640_0037750 3300046533 Bacteria 3403
728 Ga0495640_0172767 3300046533 Bacteria 1380
729 Ga0495586_0032773 3300046535 Bacteria 2787
730 Ga0495587_0001734 3300046536 Bacteria 14559
731 Ga0495587_0011728 3300046536 Bacteria 5546
732 Ga0495587_0029163 3300046536 Bacteria 3351
733 Ga0495598_0001967 3300046537 Bacteria 4173
734 Ga0495645_0004078 3300046543 Bacteria 9978
735 Ga0495645_0004983 3300046543 Bacteria 9095
736 Ga0495633_0000645 3300046558 Bacteria 32436
737 Ga0495667_0000259 3300046559 Bacteria 34280
738 Ga0495667_0015414 3300046559 Bacteria 5163
739 Ga0495656_0000157 3300046615 Bacteria 24846
740 Ga0495634_0068575 3300046642 Bacteria 2342
741 Ga0495634_0083127 3300046642 Bacteria 2090
742 Ga0495634_0201345 3300046642 Bacteria 1237
743 Ga0495611_0001997 3300046648 Bacteria 9664
744 Ga0495635_0004119 3300046663 Bacteria 10079
745 Ga0495635_0026839 3300046663 Bacteria 4006
746 Ga0495635_0113751 3300046663 Bacteria 1847
747 Ga0495635_0161557 3300046663 Bacteria 1525
748 Ga0495659_0000900 3300046664 Bacteria 10589
749 Ga0495588_0010993 3300046674 Bacteria 4235
750 Ga0495657_0003179 3300046675 Bacteria 13534
751 Ga0495657_0071813 3300046675 Bacteria 2259
752 Ga0495599_0008671 3300046678 Bacteria 6189
753 Ga0495599_0153235 3300046678 Bacteria 1426
754 Ga0495599_0192724 3300046678 Bacteria 1253
755 Ga0495599_0409653 3300046678 Bacteria 806
756 Ga0495623_0000981 3300046679 Bacteria 19240
757 Ga0495623_0089382 3300046679 Bacteria 1893
758 Ga0495623_0191642 3300046679 Bacteria 1181
759 Ga0495646_0001919 3300046680 Bacteria 12501
760 Ga0495646_0035551 3300046680 Bacteria 3090
761 Ga0495646_0050547 3300046680 Bacteria 2519
762 Ga0495647_0005796 3300046681 Bacteria 4064
763 Ga0495647_0039154 3300046681 Bacteria 1795
764 Ga0495647_0078828 3300046681 Bacteria 1332
765 Ga0495658_0000360 3300046683 Bacteria 25675
766 Ga0495658_0024624 3300046683 Bacteria 3207
767 Ga0495669_0076118 3300046684 Bacteria 1536
768 Ga0495613_0018760 3300046689 Bacteria 5156
769 Ga0495613_0052318 3300046689 Bacteria 3008
770 Ga0495613_0167337 3300046689 Bacteria 1561
771 Ga0495624_0007588 3300046690 Bacteria 7613
772 Ga0495624_0058845 3300046690 Bacteria 2412
773 Ga0495624_0064121 3300046690 Bacteria 2296
774 Ga0495670_0000213 3300046691 Bacteria 26531
775 Ga0495600_0014240 3300046809 Bacteria 5011
776 Ga0495600_0022131 3300046809 Bacteria 4079
777 Ga0495600_0023157 3300046809 Bacteria 3994
778 Ga0495581_0012254 3300047315 Bacteria 4966
779 Ga0495581_0086801 3300047315 Bacteria 1814
780 Ga0495581_0087282 3300047315 Bacteria 1808
781 Ga0495604_0001954 3300047317 Bacteria 16634
782 Ga0495604_0008955 3300047317 Bacteria 7912
783 Ga0495604_0034057 3300047317 Bacteria 4030
784 Ga0495674_0010262 3300047319 Bacteria 8870
785 Ga0495674_0022491 3300047319 Bacteria 5815
786 Ga0495674_0099970 3300047319 Bacteria 2469
787 Ga0495676_0035234 3300047321 Bacteria 4188
788 Ga0495676_0197971 3300047321 Bacteria 1397
789 Ga0495680_0002446 3300047322 Bacteria 19009
790 Ga0495680_0009264 3300047322 Bacteria 8869
791 Ga0495680_0043847 3300047322 Bacteria 3539
792 Ga0495680_0051002 3300047322 Bacteria 3233
793 Ga0495680_0064647 3300047322 Bacteria 2805
794 Ga0495680_0136516 3300047322 Bacteria 1798
795 Ga0495675_0000147 3300047444 Bacteria 49274
796 Ga0495675_0006699 3300047444 Bacteria 7061
797 Ga0495679_040117 3300047446 Bacteria 1457
798 Ga0495684_0005638 3300047471 Bacteria 9754
799 Ga0495684_0063016 3300047471 Bacteria 2819
800 Ga0495593_0004620 3300047673 Bacteria 8183
801 Ga0495593_0020466 3300047673 Bacteria 3705
802 Ga0495593_0071695 3300047673 Bacteria 1799
803 Ga0495593_0080949 3300047673 Bacteria 1679
804 Ga0495602_0002613 3300048088 Bacteria 18403
805 Ga0495602_0005981 3300048088 Bacteria 12776
806 Ga0495602_0071405 3300048088 Bacteria 2965
807 Ga0495614_0006737 3300048089 Bacteria 5142
808 Ga0495614_0201846 3300048089 Bacteria 900
809 Ga0495615_0037975 3300048090 Bacteria 1189
810 Ga0496100_0001667 3300048903 Bacteria 11014
811 Ga0496100_0012737 3300048903 Bacteria 4833
812 Ga0496100_0062922 3300048903 Bacteria 2450
813 Ga0496100_0153159 3300048903 Bacteria 1646
814 Ga0496100_0200409 3300048903 Bacteria 1454
815 Ga0496100_0295865 3300048903 Bacteria 1210
816 Ga0496100_0297824 3300048903 Bacteria 1206
817 Ga0496101_0000079 3300048904 Bacteria 107673
818 Ga0496101_0016662 3300048904 Bacteria 4971
819 Ga0496101_0070024 3300048904 Bacteria 2567
820 Ga0496101_0135932 3300048904 Bacteria 1870
821 Ga0496101_0161750 3300048904 Bacteria 1717
822 Ga0496101_0207427 3300048904 Bacteria 1517
823 Ga0496101_0351400 3300048904 Bacteria 1158
824 Ga0496102_0004410 3300048905 Bacteria 11888
825 Ga0496102_0104825 3300048905 Bacteria 2630
826 Ga0496102_0108844 3300048905 Bacteria 2581
827 Ga0496102_0203216 3300048905 Bacteria 1867
828 Ga0496102_0279436 3300048905 Bacteria 1574
829 Ga0496102_0453830 3300048905 Bacteria 1202
830 Ga0496103_0003888 3300048906 Bacteria 9088
831 Ga0496103_0082312 3300048906 Bacteria 2025
832 Ga0496103_0083312 3300048906 Bacteria 2013
833 Ga0496103_0112186 3300048906 Bacteria 1732
834 Ga0496104_0000203 3300048907 Bacteria 53173
835 Ga0496104_0050199 3300048907 Bacteria 3936
836 Ga0496104_0135318 3300048907 Bacteria 2367
837 Ga0496104_0150281 3300048907 Bacteria 2236
838 Ga0496104_0197580 3300048907 Bacteria 1923
839 Ga0496104_0256749 3300048907 Bacteria 1660
840 Ga0496104_0262828 3300048907 Bacteria 1638
841 Ga0496104_0368696 3300048907 Bacteria 1348
842 Ga0496105_0000378 3300048908 Bacteria 29328
843 Ga0496105_0014937 3300048908 Bacteria 6181
844 Ga0496105_0060404 3300048908 Bacteria 3128
845 Ga0496105_0079013 3300048908 Bacteria 2716
846 Ga0496105_0111416 3300048908 Bacteria 2258
847 Ga0496105_0239347 3300048908 Bacteria 1473
848 Ga0496106_0030064 3300048909 Bacteria 4050
849 Ga0496106_0041579 3300048909 Bacteria 3444
850 Ga0496106_0120142 3300048909 Bacteria 2053
851 Ga0496106_0197745 3300048909 Bacteria 1599
852 Ga0496106_0335187 3300048909 Bacteria 1214
853 Ga0496107_0020541 3300048910 Bacteria 4666
854 Ga0496107_0023690 3300048910 Bacteria 4339
855 Ga0496107_0025593 3300048910 Bacteria 4178
856 Ga0496107_0056439 3300048910 Bacteria 2837
857 Ga0496107_0071064 3300048910 Bacteria 2528
858 Ga0496107_0443439 3300048910 Bacteria 964
859 Ga0496107_0464350 3300048910 Bacteria 940
860 Ga0496107_0512662 3300048910 Bacteria 889
861 Ga0496108_0005809 3300048911 Bacteria 10002
862 Ga0496108_0081425 3300048911 Bacteria 2743
863 Ga0496108_0087944 3300048911 Bacteria 2639
864 Ga0496108_0118736 3300048911 Unclassified 2267
865 Ga0496108_0138143 3300048911 Bacteria 2098
866 Ga0496108_0312417 3300048911 Bacteria 1369
867 Ga0496109_0000223 3300048912 Bacteria 56008
868 Ga0496109_0050643 3300048912 Bacteria 3782
869 Ga0496109_0062821 3300048912 Bacteria 3396
870 Ga0496110_0005653 3300048913 Bacteria 9810
871 Ga0496110_0133133 3300048913 Bacteria 2245
872 Ga0496110_0136904 3300048913 Bacteria 2213
873 Ga0496110_0210296 3300048913 Bacteria 1768
874 Ga0496111_0007705 3300048914 Bacteria 7081
875 Ga0496111_0042491 3300048914 Bacteria 3264
876 Ga0496111_0074829 3300048914 Bacteria 2467
877 Ga0496111_0120204 3300048914 Bacteria 1940
878 Ga0496112_0055975 3300048915 Bacteria 3881
879 Ga0496112_0088107 3300048915 Bacteria 3071
880 Ga0496112_0091895 3300048915 Bacteria 3004
881 Ga0496112_0167574 3300048915 Bacteria 2162
882 Ga0496112_0756676 3300048915 Bacteria 897
883 Ga0496113_0000624 3300048916 Bacteria 17779
884 Ga0496113_0066235 3300048916 Bacteria 2735
885 Ga0496113_0067511 3300048916 Bacteria 2711
886 Ga0496113_0233293 3300048916 Bacteria 1467
887 Ga0496113_0311774 3300048916 Bacteria 1260
888 Ga0496114_0010254 3300048917 Bacteria 7456
889 Ga0496114_0158527 3300048917 Bacteria 1966
890 Ga0496114_0198527 3300048917 Bacteria 1756
891 Ga0496115_0001792 3300048918 Bacteria 15386
892 Ga0496115_0048404 3300048918 Bacteria 3400
893 Ga0496115_0103501 3300048918 Bacteria 2335
894 Ga0496115_0105890 3300048918 Bacteria 2308
895 Ga0496115_0159920 3300048918 Bacteria 1861
896 Ga0496115_0216170 3300048918 Bacteria 1582
897 Ga0496126_0287700 3300048929 Bacteria 1360
898 Ga0501031_0007895 3300049568 Bacteria 6926
899 Ga0501031_0378836 3300049568 Bacteria 915
900 Ga0501032_0066398 3300049569 Bacteria 2410
901 Ga0501032_0099488 3300049569 Bacteria 1926
902 Ga0501032_0117291 3300049569 Bacteria 1760
903 Ga0501033_0016242 3300049570 Bacteria 5638
904 Ga0501033_0276620 3300049570 Bacteria 1186
905 Ga0501033_0322022 3300049570 Bacteria 1086
906 Ga0501034_0000089 3300049571 Bacteria 165644
907 Ga0501034_0006479 3300049571 Bacteria 12605
908 Ga0501034_0089671 3300049571 Bacteria 3073
909 Ga0501034_0118791 3300049571 Bacteria 2630
910 Ga0501034_0171836 3300049571 Bacteria 2134
911 Ga0501036_0004689 3300049572 Bacteria 11039
912 Ga0501036_0013953 3300049572 Bacteria 6680
913 Ga0501036_0030377 3300049572 Bacteria 4564
914 Ga0501036_0198071 3300049572 Bacteria 1689
915 Ga0501037_0013965 3300049573 Bacteria 5918
916 Ga0501037_0018777 3300049573 Bacteria 5094
917 Ga0501037_0049478 3300049573 Bacteria 3077
918 Ga0501037_0157760 3300049573 Bacteria 1618
919 Ga0501037_0227615 3300049573 Bacteria 1310
920 Ga0501038_0008360 3300049574 Bacteria 9518
921 Ga0501038_0222223 3300049574 Bacteria 1506
922 Ga0501039_0005535 3300049575 Bacteria 9560
923 Ga0501039_0148448 3300049575 Bacteria 1842
924 Ga0501042_0065144 3300049578 Bacteria 2604
925 Ga0501043_0001206 3300049579 Bacteria 22752
926 Ga0501043_0024663 3300049579 Bacteria 4716
927 Ga0501043_0030112 3300049579 Bacteria 4263
928 Ga0501043_0049829 3300049579 Bacteria 3292
929 Ga0501043_0065943 3300049579 Bacteria 2843
930 Ga0501046_0019306 3300049580 Bacteria 5655
931 Ga0501046_0076895 3300049580 Bacteria 2585
932 Ga0501046_0179586 3300049580 Bacteria 1583
933 Ga0501046_0223038 3300049580 Bacteria 1395
934 Ga0501046_0296148 3300049580 Bacteria 1182
935 Ga0501047_0000108 3300049581 Bacteria 101252
936 Ga0501047_0030345 3300049581 Bacteria 5212
937 Ga0501047_0059519 3300049581 Bacteria 3687
938 Ga0501047_0563196 3300049581 Bacteria 963
939 Ga0501048_0000493 3300049582 Bacteria 27551
940 Ga0501048_0112368 3300049582 Bacteria 1924
941 Ga0501048_0300827 3300049582 Bacteria 1141
942 Ga0501067_0002851 3300049583 Bacteria 9519
943 Ga0501067_0045338 3300049583 Bacteria 2442
944 Ga0501068_0007207 3300049584 Bacteria 6157
945 Ga0501068_0062789 3300049584 Bacteria 2259
946 Ga0501068_0232858 3300049584 Bacteria 1171
947 Ga0501069_0004416 3300049585 Bacteria 7261
948 Ga0501069_0051175 3300049585 Bacteria 2298
949 Ga0501069_0083524 3300049585 Bacteria 1800
950 Ga0501070_0030292 3300049586 Bacteria 4533
951 Ga0501070_0031929 3300049586 Bacteria 4410
952 Ga0501070_0056871 3300049586 Bacteria 3242
953 Ga0501070_0072072 3300049586 Bacteria 2860
954 Ga0501070_0155493 3300049586 Bacteria 1885
955 Ga0501070_0429390 3300049586 Bacteria 1066
956 Ga0501071_0080378 3300049587 Bacteria 2383
957 Ga0501072_0281738 3300049588 Bacteria 1322
958 Ga0501073_0010473 3300049589 Bacteria 6797
959 Ga0501073_0028323 3300049589 Bacteria 4003
960 Ga0501073_0035595 3300049589 Bacteria 3537
961 Ga0501073_0049083 3300049589 Bacteria 2961
962 Ga0501073_0051395 3300049589 Bacteria 2887
963 Ga0501073_0424498 3300049589 Bacteria 919
964 Ga0501074_0001683 3300049590 Bacteria 15063
965 Ga0501074_0035388 3300049590 Bacteria 3618
966 Ga0501074_0046011 3300049590 Bacteria 3155
967 Ga0501076_0448358 3300049592 Bacteria 1062
968 Ga0501079_0022593 3300049741 Bacteria 4824
969 Ga0501079_0072864 3300049741 Bacteria 2655
970 Ga0501079_0129243 3300049741 Bacteria 1966
971 Ga0501079_0165326 3300049741 Bacteria 1725
972 Ga0501079_0206364 3300049741 Bacteria 1535
973 Ga0501080_0003238 3300049742 Bacteria 14365
974 Ga0501080_0033446 3300049742 Bacteria 4798
975 Ga0501080_0120932 3300049742 Bacteria 2426
976 Ga0501080_0172727 3300049742 Bacteria 1992
977 Ga0501083_0002587 3300049744 Bacteria 12452
978 Ga0501083_0007793 3300049744 Bacteria 7587
979 Ga0501083_0041181 3300049744 Bacteria 3133
980 Ga0501083_0120675 3300049744 Bacteria 1719
981 Ga0501035_0002622 3300049822 Bacteria 17526
982 Ga0501035_0121335 3300049822 Bacteria 2284
983 Ga0501035_0222290 3300049822 Bacteria 1612
984 Ga0501035_0263789 3300049822 Bacteria 1459
985 Ga0501035_0760810 3300049822 Bacteria 777
986 Ga0501044_0000998 3300049823 Bacteria 34042
987 Ga0501044_0059613 3300049823 Bacteria 3910
988 Ga0501044_0101735 3300049823 Bacteria 2890
989 Ga0501044_0193784 3300049823 Bacteria 1993
990 Ga0501044_0221669 3300049823 Bacteria 1842
991 Ga0501044_0589927 3300049823 Bacteria 1005
992 Ga0501045_0037222 3300049824 Bacteria 3536
993 Ga0501045_0267485 3300049824 Bacteria 1273
994 nmdc:mga0yw44_158748_c1 3300050492 Bacteria 1479
995 nmdc:mga0k408_30249_c1 3300050493 Bacteria 1432
996 nmdc:mga06z11_93342_c1 3300050494 Bacteria 1638
997 nmdc:mga05p37_111_c1 3300050507 Bacteria 32778
998 nmdc:mga05p37_64417_c1 3300050507 Bacteria 4511
999 nmdc:mga09592_519_c1 3300050508 Bacteria 29199
1000 nmdc:mga0qj67_5814_c1 3300050509 Bacteria 9027
1001 nmdc:mga06r32_3010_c1 3300050510 Bacteria 15094
1002 nmdc:mga08y16_11075_c1 3300050511 Bacteria 9469
1003 nmdc:mga08y16_223100_c1 3300050511 Bacteria 1951
1004 nmdc:mga08y16_59876_c1 3300050511 Bacteria 3978
1005 nmdc:mga08y16_82929_c1 3300050511 Bacteria 3342
1006 nmdc:mga0n895_2911_c1 3300050512 Bacteria 13576
1007 nmdc:mga0n895_497_c1 3300050512 Bacteria 26681
1008 nmdc:mga0n895_52554_c1 3300050512 Bacteria 4000
1009 nmdc:mga0n895_6865_c1 3300050512 Bacteria 9722
1010 nmdc:mga0rr50_636_c1 3300050513 Bacteria 18874
1011 nmdc:mga0rr50_702502_c1 3300050513 Bacteria 863
1012 nmdc:mga08x19_183599_c1 3300050514 Bacteria 1429
1013 nmdc:mga08x19_197544_c1 3300050514 Bacteria 1378
1014 nmdc:mga08x19_436421_c1 3300050514 Unclassified 921
1015 nmdc:mga0a205_269192_c1 3300050515 Bacteria 1581
1016 nmdc:mga0a205_5029_c1 3300050515 Bacteria 11910
1017 nmdc:mga0a205_50_c1 3300050515 Bacteria 64126
1018 Ga0495601_0000259 3300053077 Bacteria 28526
1019 Ga0495601_0002525 3300053077 Bacteria 10410
1020 Ga0495601_0004827 3300053077 Bacteria 7817
1021 Ga0495601_0059824 3300053077 Bacteria 2416
1022 Ga0495601_0196120 3300053077 Bacteria 1320
1023 Ga0495612_0000173 3300053078 Bacteria 27147
1024 Ga0495612_0005298 3300053078 Bacteria 5327
1025 Ga0495612_0005917 3300053078 Bacteria 5042
1026 Ga0495612_0010418 3300053078 Bacteria 3758
1027 Ga0495612_0017601 3300053078 Bacteria 2860
1028 Ga0495612_0213992 3300053078 Bacteria 852
1029 Ga0495595_0002058 3300053084 Bacteria 7825
1030 Ga0495595_0005278 3300053084 Bacteria 5224
1031 Ga0495595_0009740 3300053084 Bacteria 3980
1032 Ga0495595_0011900 3300053084 Bacteria 3646
1033 Ga0495595_0117609 3300053084 Bacteria 1293
1034 Ga0495595_0131756 3300053084 Bacteria 1222
1035 Ga0495619_0000132 3300053085 Bacteria 55452
1036 Ga0495619_0000178 3300053085 Bacteria 46773
1037 Ga0495619_0001228 3300053085 Bacteria 16765
1038 Ga0495619_0004954 3300053085 Bacteria 8458
1039 Ga0495619_0023258 3300053085 Bacteria 3971
1040 Ga0495619_0032913 3300053085 Bacteria 3365
1041 Ga0495619_0261479 3300053085 Bacteria 1199
1042 Ga0500641_0000709 3300053096 Bacteria 12054
1043 Ga0500595_000001 3300053119 Bacteria 1088438
1044 Ga0500616_0093155 3300053153 Bacteria 1487
1045 Ga0501084_0025949 3300054114 Bacteria 4887
1046 Ga0501084_0047646 3300054114 Bacteria 3589
1047 Ga0501084_0199671 3300054114 Bacteria 1687
1048 Ga0501084_0239714 3300054114 Bacteria 1531
1049 Ga0501084_0689869 3300054114 Bacteria 861
1050 Ga0501082_0027930 3300060353 Bacteria 4859
1051 Ga0501082_0035092 3300060353 Bacteria 4323
1052 Ga0501082_0050587 3300060353 Bacteria 3583
1053 Ga0501082_0130231 3300060353 Bacteria 2183
1054 Ga0501082_0171884 3300060353 Bacteria 1884
1055 Ga0501082_0200682 3300060353 Bacteria 1735

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10064057 Ga0075365_100640573 223
2 3300046642 Ga0495634_0201345 Ga0495634_0201345_56_763 223
3 3300049568 Ga0501031_0378836 Ga0501031_0378836_177_872 224
4 3300049569 Ga0501032_0099488 Ga0501032_0099488_917_1612 224
5 3300049572 Ga0501036_0030377 Ga0501036_0030377_741_1436 224
6 3300049572 Ga0501036_0198071 Ga0501036_0198071_708_1403 224
7 3300049573 Ga0501037_0018777 Ga0501037_0018777_1296_1991 224
8 3300049573 Ga0501037_0157760 Ga0501037_0157760_592_1287 224
9 3300049574 Ga0501038_0008360 Ga0501038_0008360_1982_2668 224
10 3300049575 Ga0501039_0148448 Ga0501039_0148448_412_1107 224
11 3300049579 Ga0501043_0024663 Ga0501043_0024663_811_1506 224
12 3300049579 Ga0501043_0030112 Ga0501043_0030112_1462_2157 224
13 3300049580 Ga0501046_0296148 Ga0501046_0296148_130_825 224
14 3300049581 Ga0501047_0059519 Ga0501047_0059519_136_831 224
15 3300049582 Ga0501048_0112368 Ga0501048_0112368_291_986 224
16 3300049583 Ga0501067_0045338 Ga0501067_0045338_596_1291 224
17 3300049584 Ga0501068_0062789 Ga0501068_0062789_1283_1978 224
18 3300049584 Ga0501068_0232858 Ga0501068_0232858_68_763 224
19 3300049585 Ga0501069_0051175 Ga0501069_0051175_499_1194 224
20 3300049585 Ga0501069_0083524 Ga0501069_0083524_1021_1716 224
21 3300049586 Ga0501070_0031929 Ga0501070_0031929_140_835 224
22 3300049586 Ga0501070_0155493 Ga0501070_0155493_1111_1806 224
23 3300049587 Ga0501071_0080378 Ga0501071_0080378_51_746 224
24 3300049589 Ga0501073_0035595 Ga0501073_0035595_684_1379 224
25 3300049590 Ga0501074_0035388 Ga0501074_0035388_1638_2333 224
26 3300049741 Ga0501079_0022593 Ga0501079_0022593_2362_3057 224
27 3300049741 Ga0501079_0165326 Ga0501079_0165326_525_1220 224
28 3300049742 Ga0501080_0120932 Ga0501080_0120932_540_1235 224
29 3300049742 Ga0501080_0172727 Ga0501080_0172727_1020_1715 224
30 3300049744 Ga0501083_0120675 Ga0501083_0120675_249_944 224
31 3300049822 Ga0501035_0263789 Ga0501035_0263789_619_1314 224
32 3300049823 Ga0501044_0101735 Ga0501044_0101735_858_1553 224
33 3300049824 Ga0501045_0267485 Ga0501045_0267485_363_1058 224
34 3300054114 Ga0501084_0199671 Ga0501084_0199671_936_1631 224
35 3300054114 Ga0501084_0689869 Ga0501084_0689869_136_831 224
36 3300060353 Ga0501082_0171884 Ga0501082_0171884_1059_1745 224
37 3300060353 Ga0501082_0200682 Ga0501082_0200682_18_713 224
38 3300009147 Ga0114129_10011272 Ga0114129_100112724 225
39 3300031995 Ga0307409_100689398 Ga0307409_1006893982 225
40 3300035117 Ga0373953_0195319 Ga0373953_0195319_154_831 225
41 3300046462 Ga0495651_0065926 Ga0495651_0065926_979_1656 225
42 3300046679 Ga0495623_0191642 Ga0495623_0191642_260_937 225
43 3300049571 Ga0501034_0000089 Ga0501034_0000089_73897_74583 225
44 3300049571 Ga0501034_0006479 Ga0501034_0006479_3438_4127 225
45 3300049571 Ga0501034_0118791 Ga0501034_0118791_1143_1832 225
46 3300049572 Ga0501036_0004689 Ga0501036_0004689_5195_5884 225
47 3300049573 Ga0501037_0049478 Ga0501037_0049478_2281_2970 225
48 3300049574 Ga0501038_0222223 Ga0501038_0222223_536_1225 225
49 3300049579 Ga0501043_0001206 Ga0501043_0001206_8587_9276 225
50 3300049579 Ga0501043_0065943 Ga0501043_0065943_1028_1717 225
51 3300049580 Ga0501046_0179586 Ga0501046_0179586_425_1114 225
52 3300049581 Ga0501047_0000108 Ga0501047_0000108_73856_74545 225
53 3300049581 Ga0501047_0563196 Ga0501047_0563196_106_795 225
54 3300049582 Ga0501048_0000493 Ga0501048_0000493_5220_5909 225
55 3300049586 Ga0501070_0072072 Ga0501070_0072072_751_1440 225
56 3300049589 Ga0501073_0028323 Ga0501073_0028323_1305_1994 225
57 3300049590 Ga0501074_0001683 Ga0501074_0001683_3978_4667 225
58 3300049742 Ga0501080_0003238 Ga0501080_0003238_10205_10894 225
59 3300049744 Ga0501083_0002587 Ga0501083_0002587_6223_6912 225
60 3300049822 Ga0501035_0760810 Ga0501035_0760810_19_708 225
61 3300049823 Ga0501044_0000998 Ga0501044_0000998_32006_32695 225
62 3300053084 Ga0495595_0117609 Ga0495595_0117609_149_826 225
63 3300060353 Ga0501082_0130231 Ga0501082_0130231_1132_1821 225
64 3300005327 Ga0070658_10008439 Ga0070658_100084394 226
65 3300005366 Ga0070659_100349765 Ga0070659_1003497652 226
66 3300005530 Ga0070679_100144573 Ga0070679_1001445732 226
67 3300005530 Ga0070679_100241026 Ga0070679_1002410262 226
68 3300005563 Ga0068855_100143145 Ga0068855_1001431452 226
69 3300005577 Ga0068857_100093574 Ga0068857_1000935742 226
70 3300005614 Ga0068856_100086099 Ga0068856_1000860994 226
71 3300005616 Ga0068852_100133271 Ga0068852_1001332712 226
72 3300009551 Ga0105238_10288062 Ga0105238_102880622 226
73 3300013102 Ga0157371_10123108 Ga0157371_101231082 226
74 3300013307 Ga0157372_10699436 Ga0157372_106994361 226
75 3300025909 Ga0207705_10632208 Ga0207705_106322081 226
76 3300025912 Ga0207707_10377881 Ga0207707_103778812 226
77 3300025921 Ga0207652_10322151 Ga0207652_103221511 226
78 3300025932 Ga0207690_10114094 Ga0207690_101140942 226
79 3300025944 Ga0207661_10691251 Ga0207661_106912511 226
80 3300025949 Ga0207667_10046648 Ga0207667_100466484 226
81 3300026078 Ga0207702_10132731 Ga0207702_101327312 226
82 3300026142 Ga0207698_10559774 Ga0207698_105597742 226
83 3300031595 Ga0265313_10019854 Ga0265313_100198542 226
84 3300031711 Ga0265314_10111305 Ga0265314_101113051 226
85 3300031712 Ga0265342_10000983 Ga0265342_1000098310 226
86 3300049823 Ga0501044_0193784 Ga0501044_0193784_1266_1955 226
87 3300005458 Ga0070681_10523804 Ga0070681_105238042 227
88 3300021384 Ga0213876_10062749 Ga0213876_100627492 227
89 3300025912 Ga0207707_10662366 Ga0207707_106623661 227
90 3300031235 Ga0265330_10017783 Ga0265330_100177832 227
91 3300031241 Ga0265325_10009447 Ga0265325_100094475 227
92 3300031241 Ga0265325_10134796 Ga0265325_101347962 227
93 3300031249 Ga0265339_10001467 Ga0265339_100014675 227
94 3300031249 Ga0265339_10191220 Ga0265339_101912201 227
95 3300031344 Ga0265316_10108046 Ga0265316_101080462 227
96 3300031595 Ga0265313_10002478 Ga0265313_1000247813 227
97 3300031595 Ga0265313_10136068 Ga0265313_101360681 227
98 3300035692 Ga0373935_0556600 Ga0373935_0556600_128_820 227
99 3300039437 Ga0436365_1291451 Ga0436365_1291451_991_1674 227
100 3300049569 Ga0501032_0117291 Ga0501032_0117291_580_1284 227
101 3300049571 Ga0501034_0171836 Ga0501034_0171836_918_1622 227
102 3300049581 Ga0501047_0030345 Ga0501047_0030345_2375_3079 227
103 3300049589 Ga0501073_0051395 Ga0501073_0051395_521_1225 227
104 3300049741 Ga0501079_0129243 Ga0501079_0129243_1026_1730 227
105 3300049744 Ga0501083_0007793 Ga0501083_0007793_1663_2367 227
106 3300049823 Ga0501044_0589927 Ga0501044_0589927_235_939 227
107 3300053078 Ga0495612_0005298 Ga0495612_0005298_2947_3684 227
108 3300060353 Ga0501082_0035092 Ga0501082_0035092_1960_2664 227
109 3300005328 Ga0070676_10044006 Ga0070676_100440061 228
110 3300005339 Ga0070660_100708931 Ga0070660_1007089311 228
111 3300005343 Ga0070687_100393211 Ga0070687_1003932111 228
112 3300005356 Ga0070674_100385786 Ga0070674_1003857861 228
113 3300005434 Ga0070709_10246392 Ga0070709_102463921 228
114 3300005434 Ga0070709_10544292 Ga0070709_105442921 228
115 3300005435 Ga0070714_100370257 Ga0070714_1003702571 228
116 3300005436 Ga0070713_100116115 Ga0070713_1001161152 228
117 3300005439 Ga0070711_100355580 Ga0070711_1003555801 228
118 3300005439 Ga0070711_100471932 Ga0070711_1004719321 228
119 3300005440 Ga0070705_100032626 Ga0070705_1000326262 228
120 3300005456 Ga0070678_100147029 Ga0070678_1001470291 228
121 3300005468 Ga0070707_100164538 Ga0070707_1001645382 228
122 3300005530 Ga0070679_100077850 Ga0070679_1000778502 228
123 3300005543 Ga0070672_100333385 Ga0070672_1003333851 228
124 3300005546 Ga0070696_100309990 Ga0070696_1003099902 228
125 3300005563 Ga0068855_100194016 Ga0068855_1001940162 228
126 3300005578 Ga0068854_100298229 Ga0068854_1002982292 228
127 3300005615 Ga0070702_100555793 Ga0070702_1005557931 228
128 3300005616 Ga0068852_100926228 Ga0068852_1009262281 228
129 3300006163 Ga0070715_10009672 Ga0070715_100096722 228
130 3300006358 Ga0068871_100085303 Ga0068871_1000853032 228
131 3300006847 Ga0075431_100449841 Ga0075431_1004498412 228
132 3300006880 Ga0075429_100303077 Ga0075429_1003030771 228
133 3300009093 Ga0105240_10029089 Ga0105240_100290892 228
134 3300009093 Ga0105240_10228923 Ga0105240_102289232 228
135 3300009098 Ga0105245_11045134 Ga0105245_110451341 228
136 3300009101 Ga0105247_10088788 Ga0105247_100887882 228
137 3300009148 Ga0105243_10112355 Ga0105243_101123552 228
138 3300009148 Ga0105243_10330732 Ga0105243_103307322 228
139 3300009174 Ga0105241_10097873 Ga0105241_100978732 228
140 3300009176 Ga0105242_10230762 Ga0105242_102307622 228
141 3300009176 Ga0105242_10422351 Ga0105242_104223512 228
142 3300009177 Ga0105248_10034980 Ga0105248_100349805 228
143 3300009551 Ga0105238_10292464 Ga0105238_102924642 228
144 3300013102 Ga0157371_10052032 Ga0157371_100520323 228
145 3300013104 Ga0157370_10038422 Ga0157370_100384222 228
146 3300013105 Ga0157369_10299185 Ga0157369_102991852 228
147 3300013297 Ga0157378_10141244 Ga0157378_101412442 228
148 3300013297 Ga0157378_10154525 Ga0157378_101545252 228
149 3300013306 Ga0163162_10060042 Ga0163162_100600424 228
150 3300013308 Ga0157375_10009978 Ga0157375_100099786 228
151 3300014968 Ga0157379_10125244 Ga0157379_101252442 228
152 3300014969 Ga0157376_10048487 Ga0157376_100484873 228
153 3300014969 Ga0157376_10341078 Ga0157376_103410782 228
154 3300017792 Ga0163161_10222039 Ga0163161_102220392 228
155 3300020069 Ga0197907_11114363 Ga0197907_111143632 228
156 3300020081 Ga0206354_11430131 Ga0206354_114301311 228
157 3300020082 Ga0206353_11674680 Ga0206353_116746802 228
158 3300025903 Ga0207680_10285752 Ga0207680_102857521 228
159 3300025905 Ga0207685_10019435 Ga0207685_100194352 228
160 3300025906 Ga0207699_10061636 Ga0207699_100616362 228
161 3300025907 Ga0207645_10123720 Ga0207645_101237201 228
162 3300025909 Ga0207705_10077997 Ga0207705_100779972 228
163 3300025911 Ga0207654_10263515 Ga0207654_102635152 228
164 3300025912 Ga0207707_10013364 Ga0207707_100133642 228
165 3300025912 Ga0207707_10052219 Ga0207707_100522192 228
166 3300025915 Ga0207693_10006099 Ga0207693_100060995 228
167 3300025916 Ga0207663_10200440 Ga0207663_102004402 228
168 3300025916 Ga0207663_10453618 Ga0207663_104536181 228
169 3300025917 Ga0207660_10164360 Ga0207660_101643602 228
170 3300025919 Ga0207657_10007397 Ga0207657_100073976 228
171 3300025920 Ga0207649_10089487 Ga0207649_100894872 228
172 3300025921 Ga0207652_10120280 Ga0207652_101202802 228
173 3300025924 Ga0207694_10619387 Ga0207694_106193871 228
174 3300025927 Ga0207687_10124760 Ga0207687_101247601 228
175 3300025927 Ga0207687_10744148 Ga0207687_107441481 228
176 3300025928 Ga0207700_10206762 Ga0207700_102067622 228
177 3300025931 Ga0207644_10782751 Ga0207644_107827511 228
178 3300025933 Ga0207706_10313411 Ga0207706_103134112 228
179 3300025934 Ga0207686_10072351 Ga0207686_100723512 228
180 3300025935 Ga0207709_10244590 Ga0207709_102445902 228
181 3300025935 Ga0207709_10321624 Ga0207709_103216242 228
182 3300025939 Ga0207665_10782940 Ga0207665_107829401 228
183 3300025940 Ga0207691_10315884 Ga0207691_103158841 228
184 3300025941 Ga0207711_10342736 Ga0207711_103427362 228
185 3300025949 Ga0207667_10054806 Ga0207667_100548062 228
186 3300025972 Ga0207668_10092117 Ga0207668_100921172 228
187 3300025981 Ga0207640_10015182 Ga0207640_100151824 228
188 3300025986 Ga0207658_10276159 Ga0207658_102761591 228
189 3300026067 Ga0207678_10085762 Ga0207678_100857623 228
190 3300026078 Ga0207702_10085087 Ga0207702_100850872 228
191 3300026121 Ga0207683_10067720 Ga0207683_100677202 228
192 3300028800 Ga0265338_10131874 Ga0265338_101318742 228
193 3300031241 Ga0265325_10000056 Ga0265325_1000005667 228
194 3300031241 Ga0265325_10011003 Ga0265325_100110034 228
195 3300031344 Ga0265316_10022096 Ga0265316_100220962 228
196 3300031344 Ga0265316_10046316 Ga0265316_100463163 228
197 3300031595 Ga0265313_10034043 Ga0265313_100340432 228
198 3300031595 Ga0265313_10047272 Ga0265313_100472722 228
199 3300031665 Ga0316575_10082457 Ga0316575_100824571 228
200 3300031711 Ga0265314_10015471 Ga0265314_100154713 228
201 3300035086 Ga0373934_0072943 Ga0373934_0072943_363_1058 228
202 3300035089 Ga0373944_0053039 Ga0373944_0053039_334_1029 228
203 3300035090 Ga0373949_0015490 Ga0373949_0015490_507_1202 228
204 3300035091 Ga0373951_0049579 Ga0373951_0049579_36_731 228
205 3300035111 Ga0373923_0019083 Ga0373923_0019083_398_1093 228
206 3300035114 Ga0373939_0001082 Ga0373939_0001082_1050_1769 228
207 3300035116 Ga0373945_0077083 Ga0373945_0077083_300_995 228
208 3300035118 Ga0373954_0007317 Ga0373954_0007317_2593_3288 228
209 3300035119 Ga0373956_0023059 Ga0373956_0023059_1247_1942 228
210 3300035119 Ga0373956_0148111 Ga0373956_0148111_227_967 228
211 3300035120 Ga0373957_0014554 Ga0373957_0014554_1409_2104 228
212 3300035120 Ga0373957_0102114 Ga0373957_0102114_291_1031 228
213 3300035172 Ga0373955_0024171 Ga0373955_0024171_86_781 228
214 3300035172 Ga0373955_0047108 Ga0373955_0047108_135_830 228
215 3300035242 Ga0373962_0013150 Ga0373962_0013150_1031_1726 228
216 3300035410 Ga0373924_0003869 Ga0373924_0003869_1469_2164 228
217 3300035691 Ga0373931_0242563 Ga0373931_0242563_117_815 228
218 3300035692 Ga0373935_0311701 Ga0373935_0311701_248_943 228
219 3300035724 Ga0373933_0013244 Ga0373933_0013244_2235_2930 228
220 3300035724 Ga0373933_0087116 Ga0373933_0087116_316_1056 228
221 3300035725 Ga0373947_0111730 Ga0373947_0111730_447_1142 228
222 3300036401 Ga0373937_0010450 Ga0373937_0010450_2047_2787 228
223 3300036401 Ga0373937_0016552 Ga0373937_0016552_4173_4868 228
224 3300036401 Ga0373937_0125919 Ga0373937_0125919_591_1286 228
225 3300036401 Ga0373937_0264040 Ga0373937_0264040_249_989 228
226 3300046454 Ga0495592_0016926 Ga0495592_0016926_918_1613 228
227 3300046455 Ga0495603_0021414 Ga0495603_0021414_2968_3663 228
228 3300046459 Ga0495629_0056541 Ga0495629_0056541_301_996 228
229 3300046459 Ga0495629_0095300 Ga0495629_0095300_684_1379 228
230 3300046462 Ga0495651_0002035 Ga0495651_0002035_3703_4398 228
231 3300046462 Ga0495651_0076302 Ga0495651_0076302_1659_2354 228
232 3300046462 Ga0495651_0495623 Ga0495651_0495623_74_769 228
233 3300046463 Ga0495653_0029649 Ga0495653_0029649_295_990 228
234 3300046463 Ga0495653_0057670 Ga0495653_0057670_2027_2722 228
235 3300046463 Ga0495653_0207867 Ga0495653_0207867_514_1209 228
236 3300046472 Ga0495580_0145924 Ga0495580_0145924_629_1324 228
237 3300046476 Ga0495662_0154713 Ga0495662_0154713_229_924 228
238 3300046477 Ga0495664_0007311 Ga0495664_0007311_3661_4356 228
239 3300046477 Ga0495664_0057905 Ga0495664_0057905_768_1463 228
240 3300046499 Ga0495594_0253507 Ga0495594_0253507_277_972 228
241 3300046511 Ga0495608_0000915 Ga0495608_0000915_6881_7576 228
242 3300046514 Ga0495618_0024462 Ga0495618_0024462_1559_2254 228
243 3300046514 Ga0495618_0178095 Ga0495618_0178095_447_1142 228
244 3300046516 Ga0495628_0020944 Ga0495628_0020944_3571_4266 228
245 3300046516 Ga0495628_0076288 Ga0495628_0076288_1492_2187 228
246 3300046517 Ga0495630_0083103 Ga0495630_0083103_1118_1813 228
247 3300046526 Ga0495666_0105934 Ga0495666_0105934_91_786 228
248 3300046529 Ga0495652_0020953 Ga0495652_0020953_4835_5530 228
249 3300046529 Ga0495652_0197711 Ga0495652_0197711_567_1262 228
250 3300046531 Ga0495665_0027096 Ga0495665_0027096_2321_3016 228
251 3300046533 Ga0495640_0029737 Ga0495640_0029737_1243_1938 228
252 3300046536 Ga0495587_0001734 Ga0495587_0001734_10904_11599 228
253 3300046543 Ga0495645_0004983 Ga0495645_0004983_1357_2052 228
254 3300046559 Ga0495667_0000259 Ga0495667_0000259_6718_7413 228
255 3300046642 Ga0495634_0083127 Ga0495634_0083127_606_1301 228
256 3300046663 Ga0495635_0026839 Ga0495635_0026839_918_1613 228
257 3300046663 Ga0495635_0113751 Ga0495635_0113751_801_1496 228
258 3300046675 Ga0495657_0003179 Ga0495657_0003179_10446_11141 228
259 3300046678 Ga0495599_0153235 Ga0495599_0153235_287_982 228
260 3300046678 Ga0495599_0192724 Ga0495599_0192724_248_943 228
261 3300046679 Ga0495623_0000981 Ga0495623_0000981_9606_10301 228
262 3300046680 Ga0495646_0050547 Ga0495646_0050547_858_1553 228
263 3300046681 Ga0495647_0078828 Ga0495647_0078828_498_1193 228
264 3300046689 Ga0495613_0167337 Ga0495613_0167337_838_1536 228
265 3300046690 Ga0495624_0058845 Ga0495624_0058845_892_1587 228
266 3300046690 Ga0495624_0064121 Ga0495624_0064121_1441_2136 228
267 3300046809 Ga0495600_0023157 Ga0495600_0023157_2308_3003 228
268 3300047315 Ga0495581_0086801 Ga0495581_0086801_286_981 228
269 3300047317 Ga0495604_0008955 Ga0495604_0008955_5841_6536 228
270 3300047317 Ga0495604_0034057 Ga0495604_0034057_990_1685 228
271 3300047319 Ga0495674_0010262 Ga0495674_0010262_257_952 228
272 3300047319 Ga0495674_0022491 Ga0495674_0022491_4263_4958 228
273 3300047319 Ga0495674_0099970 Ga0495674_0099970_1028_1723 228
274 3300047321 Ga0495676_0197971 Ga0495676_0197971_50_745 228
275 3300047322 Ga0495680_0043847 Ga0495680_0043847_2471_3166 228
276 3300047322 Ga0495680_0051002 Ga0495680_0051002_858_1553 228
277 3300047322 Ga0495680_0136516 Ga0495680_0136516_596_1336 228
278 3300047444 Ga0495675_0000147 Ga0495675_0000147_14700_15395 228
279 3300047471 Ga0495684_0063016 Ga0495684_0063016_1385_2080 228
280 3300047673 Ga0495593_0071695 Ga0495593_0071695_173_868 228
281 3300047673 Ga0495593_0080949 Ga0495593_0080949_135_830 228
282 3300048088 Ga0495602_0005981 Ga0495602_0005981_7565_8260 228
283 3300048088 Ga0495602_0071405 Ga0495602_0071405_1800_2495 228
284 3300048089 Ga0495614_0201846 Ga0495614_0201846_100_795 228
285 3300048903 Ga0496100_0153159 Ga0496100_0153159_70_768 228
286 3300048903 Ga0496100_0200409 Ga0496100_0200409_382_1077 228
287 3300048904 Ga0496101_0070024 Ga0496101_0070024_1014_1712 228
288 3300048904 Ga0496101_0351400 Ga0496101_0351400_346_1041 228
289 3300048905 Ga0496102_0453830 Ga0496102_0453830_201_896 228
290 3300048906 Ga0496103_0083312 Ga0496103_0083312_561_1256 228
291 3300048907 Ga0496104_0262828 Ga0496104_0262828_448_1146 228
292 3300048908 Ga0496105_0014937 Ga0496105_0014937_1941_2639 228
293 3300048909 Ga0496106_0120142 Ga0496106_0120142_215_910 228
294 3300048909 Ga0496106_0335187 Ga0496106_0335187_481_1179 228
295 3300048910 Ga0496107_0056439 Ga0496107_0056439_271_966 228
296 3300048914 Ga0496111_0074829 Ga0496111_0074829_470_1168 228
297 3300048915 Ga0496112_0091895 Ga0496112_0091895_1064_1762 228
298 3300048917 Ga0496114_0158527 Ga0496114_0158527_986_1681 228
299 3300048918 Ga0496115_0048404 Ga0496115_0048404_1192_1887 228
300 3300048918 Ga0496115_0159920 Ga0496115_0159920_1105_1800 228
301 3300049570 Ga0501033_0322022 Ga0501033_0322022_126_827 228
302 3300049580 Ga0501046_0223038 Ga0501046_0223038_191_931 228
303 3300049586 Ga0501070_0030292 Ga0501070_0030292_1698_2414 228
304 3300049589 Ga0501073_0424498 Ga0501073_0424498_191_877 228
305 3300049822 Ga0501035_0002622 Ga0501035_0002622_10325_11041 228
306 3300049822 Ga0501035_0222290 Ga0501035_0222290_708_1448 228
307 3300049823 Ga0501044_0221669 Ga0501044_0221669_160_900 228
308 3300050492 nmdc:mga0yw44_158748_c1 nmdc:mga0yw44_158748_c1_164_877 228
309 3300053077 Ga0495601_0002525 Ga0495601_0002525_8876_9571 228
310 3300053077 Ga0495601_0004827 Ga0495601_0004827_5666_6361 228
311 3300053077 Ga0495601_0059824 Ga0495601_0059824_1180_1875 228
312 3300053078 Ga0495612_0010418 Ga0495612_0010418_877_1572 228
313 3300053078 Ga0495612_0017601 Ga0495612_0017601_1693_2388 228
314 3300053084 Ga0495595_0002058 Ga0495595_0002058_1175_1870 228
315 3300053084 Ga0495595_0009740 Ga0495595_0009740_918_1613 228
316 3300053085 Ga0495619_0000132 Ga0495619_0000132_31882_32577 228
317 3300053085 Ga0495619_0023258 Ga0495619_0023258_1675_2370 228
318 3300005353 Ga0070669_100367658 Ga0070669_1003676581 230
319 3300005354 Ga0070675_100383468 Ga0070675_1003834682 230
320 3300009553 Ga0105249_10194309 Ga0105249_101943093 230
321 3300025915 Ga0207693_10059968 Ga0207693_100599681 230
322 3300025923 Ga0207681_10405362 Ga0207681_104053622 230
323 3300025926 Ga0207659_10089772 Ga0207659_100897722 230
324 3300026075 Ga0207708_10625825 Ga0207708_106258252 230
325 3300035114 Ga0373939_0008014 Ga0373939_0008014_29_721 230
326 3300037068 Ga0373925_0400974 Ga0373925_0400974_79_810 230
327 3300041408 Ga0439453_0000724 Ga0439453_0000724_243_935 230
328 3300042156 Ga0439446_0070335 Ga0439446_0070335_244_936 230
329 3300042461 Ga0439460_0021792 Ga0439460_0021792_18_710 230
330 3300046472 Ga0495580_0088609 Ga0495580_0088609_435_1181 230
331 3300046514 Ga0495618_0223002 Ga0495618_0223002_121_867 230
332 3300046517 Ga0495630_0193891 Ga0495630_0193891_648_1394 230
333 3300048090 Ga0495615_0037975 Ga0495615_0037975_303_995 230
334 3300049568 Ga0501031_0007895 Ga0501031_0007895_1899_2591 230
335 3300049569 Ga0501032_0066398 Ga0501032_0066398_235_927 230
336 3300049570 Ga0501033_0016242 Ga0501033_0016242_2036_2728 230
337 3300049571 Ga0501034_0089671 Ga0501034_0089671_2320_3012 230
338 3300049572 Ga0501036_0013953 Ga0501036_0013953_2365_3057 230
339 3300049573 Ga0501037_0013965 Ga0501037_0013965_2365_3057 230
340 3300049575 Ga0501039_0005535 Ga0501039_0005535_2746_3438 230
341 3300049578 Ga0501042_0065144 Ga0501042_0065144_25_717 230
342 3300049579 Ga0501043_0049829 Ga0501043_0049829_2366_3058 230
343 3300049580 Ga0501046_0019306 Ga0501046_0019306_1314_2006 230
344 3300049583 Ga0501067_0002851 Ga0501067_0002851_2714_3406 230
345 3300049584 Ga0501068_0007207 Ga0501068_0007207_5246_5938 230
346 3300049585 Ga0501069_0004416 Ga0501069_0004416_3659_4351 230
347 3300049586 Ga0501070_0056871 Ga0501070_0056871_235_927 230
348 3300049588 Ga0501072_0281738 Ga0501072_0281738_15_707 230
349 3300049589 Ga0501073_0010473 Ga0501073_0010473_3265_3957 230
350 3300049589 Ga0501073_0049083 Ga0501073_0049083_584_1288 230
351 3300049590 Ga0501074_0046011 Ga0501074_0046011_276_968 230
352 3300049741 Ga0501079_0072864 Ga0501079_0072864_176_868 230
353 3300049741 Ga0501079_0206364 Ga0501079_0206364_109_813 230
354 3300049742 Ga0501080_0033446 Ga0501080_0033446_637_1329 230
355 3300049744 Ga0501083_0041181 Ga0501083_0041181_1055_1747 230
356 3300049822 Ga0501035_0121335 Ga0501035_0121335_1358_2050 230
357 3300049824 Ga0501045_0037222 Ga0501045_0037222_2620_3312 230
358 3300050493 nmdc:mga0k408_30249_c1 nmdc:mga0k408_30249_c1_445_1137 230
359 3300054114 Ga0501084_0047646 Ga0501084_0047646_1928_2620 230
360 3300054114 Ga0501084_0239714 Ga0501084_0239714_772_1464 230
361 3300060353 Ga0501082_0027930 Ga0501082_0027930_2267_2959 230
362 3300005339 Ga0070660_100297881 Ga0070660_1002978811 231
363 3300005457 Ga0070662_100072994 Ga0070662_1000729942 231
364 3300005466 Ga0070685_10169087 Ga0070685_101690872 231
365 3300005530 Ga0070679_100022398 Ga0070679_1000223984 231
366 3300005564 Ga0070664_100082047 Ga0070664_1000820472 231
367 3300006914 Ga0075436_100203536 Ga0075436_1002035361 231
368 3300009092 Ga0105250_10126411 Ga0105250_101264111 231
369 3300013297 Ga0157378_10622402 Ga0157378_106224021 231
370 3300013308 Ga0157375_11126533 Ga0157375_111265332 231
371 3300014326 Ga0157380_10304208 Ga0157380_103042082 231
372 3300014326 Ga0157380_10616293 Ga0157380_106162932 231
373 3300025907 Ga0207645_10268287 Ga0207645_102682872 231
374 3300025927 Ga0207687_10076773 Ga0207687_100767732 231
375 3300025933 Ga0207706_10229486 Ga0207706_102294862 231
376 3300025936 Ga0207670_10122715 Ga0207670_101227152 231
377 3300031247 Ga0265340_10021356 Ga0265340_100213562 231
378 3300031249 Ga0265339_10069942 Ga0265339_100699422 231
379 3300049570 Ga0501033_0276620 Ga0501033_0276620_449_1144 231
380 3300049573 Ga0501037_0227615 Ga0501037_0227615_436_1131 231
381 3300049580 Ga0501046_0076895 Ga0501046_0076895_1739_2434 231
382 3300049582 Ga0501048_0300827 Ga0501048_0300827_66_761 231
383 3300049586 Ga0501070_0429390 Ga0501070_0429390_208_903 231
384 3300049823 Ga0501044_0059613 Ga0501044_0059613_2320_3015 231
385 3300050514 nmdc:mga08x19_197544_c1 nmdc:mga08x19_197544_c1_505_1209 231
386 3300005338 Ga0068868_100186885 Ga0068868_1001868851 232
387 3300005436 Ga0070713_100005576 Ga0070713_1000055767 232
388 3300005437 Ga0070710_10094569 Ga0070710_100945691 232
389 3300005458 Ga0070681_10173797 Ga0070681_101737972 232
390 3300005530 Ga0070679_100051061 Ga0070679_1000510613 232
391 3300006028 Ga0070717_10134176 Ga0070717_101341762 232
392 3300009101 Ga0105247_10015650 Ga0105247_100156502 232
393 3300013296 Ga0157374_10432005 Ga0157374_104320052 232
394 3300025898 Ga0207692_10011004 Ga0207692_100110042 232
395 3300025912 Ga0207707_10145745 Ga0207707_101457452 232
396 3300025929 Ga0207664_10066335 Ga0207664_100663353 232
397 3300036401 Ga0373937_0288143 Ga0373937_0288143_228_926 232
398 3300039437 Ga0436365_1153613 Ga0436365_1153613_59_766 232
399 3300042435 Ga0439434_0049585 Ga0439434_0049585_72_779 232
400 3300042438 Ga0439459_0009621 Ga0439459_0009621_614_1321 232
401 3300048903 Ga0496100_0012737 Ga0496100_0012737_199_897 232
402 3300048904 Ga0496101_0207427 Ga0496101_0207427_592_1290 232
403 3300048905 Ga0496102_0279436 Ga0496102_0279436_681_1379 232
404 3300048907 Ga0496104_0000203 Ga0496104_0000203_19787_20491 232
405 3300048907 Ga0496104_0197580 Ga0496104_0197580_963_1661 232
406 3300048908 Ga0496105_0000378 Ga0496105_0000378_14232_14936 232
407 3300048910 Ga0496107_0464350 Ga0496107_0464350_140_838 232
408 3300048910 Ga0496107_0512662 Ga0496107_0512662_70_768 232
409 3300048917 Ga0496114_0010254 Ga0496114_0010254_4040_4738 232
410 3300053078 Ga0495612_0213992 Ga0495612_0213992_86_784 232
411 3300053084 Ga0495595_0131756 Ga0495595_0131756_291_995 232
412 3300053085 Ga0495619_0004954 Ga0495619_0004954_7594_8292 232
413 3300005330 Ga0070690_100104042 Ga0070690_1001040422 233
414 3300005355 Ga0070671_100512358 Ga0070671_1005123582 233
415 3300005548 Ga0070665_100692157 Ga0070665_1006921572 233
416 3300005564 Ga0070664_100322413 Ga0070664_1003224131 233
417 3300005719 Ga0068861_100265060 Ga0068861_1002650602 233
418 3300006237 Ga0097621_100009094 Ga0097621_1000090944 233
419 3300009098 Ga0105245_10180158 Ga0105245_101801582 233
420 3300009101 Ga0105247_10145007 Ga0105247_101450072 233
421 3300013306 Ga0163162_10545355 Ga0163162_105453552 233
422 3300025907 Ga0207645_10011742 Ga0207645_100117424 233
423 3300025931 Ga0207644_10025290 Ga0207644_100252902 233
424 3300025945 Ga0207679_10248196 Ga0207679_102481962 233
425 3300026035 Ga0207703_10006566 Ga0207703_100065664 233
426 3300026118 Ga0207675_100041595 Ga0207675_1000415954 233
427 3300028379 Ga0268266_10012422 Ga0268266_100124228 233
428 3300028381 Ga0268264_10178976 Ga0268264_101789762 233
429 3300031711 Ga0265314_10000391 Ga0265314_1000039125 233
430 3300048903 Ga0496100_0297824 Ga0496100_0297824_486_1187 233
431 3300048905 Ga0496102_0108844 Ga0496102_0108844_509_1210 233
432 3300048906 Ga0496103_0112186 Ga0496103_0112186_134_835 233
433 3300048907 Ga0496104_0368696 Ga0496104_0368696_628_1329 233
434 3300048911 Ga0496108_0312417 Ga0496108_0312417_20_721 233
435 3300048918 Ga0496115_0216170 Ga0496115_0216170_234_935 233
436 2209111006 2214745198 2213754572 234
437 3300000041 ARcpr5oldR_c000001 ARcpr5oldR_00000156 234
438 3300000042 ARSoilYngRDRAFT_c00002 ARSoilYngRDRAFT_000024 234
439 3300000043 ARcpr5yngRDRAFT_c000052 ARcpr5yngRDRAFT_00005216 234
440 3300000044 ARSoilOldRDRAFT_c000001 ARSoilOldRDRAFT_00000143 234
441 3300000045 ARCol0oldRDRAFT_c00118 ARCol0oldRDRAFT_001184 234
442 3300000652 ARCol0yngRDRAFT_1000001 ARCol0yngRDRAFT_100000111 234
443 3300001430 JGI24032J14994_100737 JGI24032J14994_1007371 234
444 3300001915 JGI24741J21665_1003866 JGI24741J21665_10038662 234
445 3300001976 JGI24752J21851_1006376 JGI24752J21851_10063762 234
446 3300001977 JGI24746J21847_1000659 JGI24746J21847_10006596 234
447 3300001989 JGI24739J22299_10000177 JGI24739J22299_1000017721 234
448 3300001990 JGI24737J22298_10005064 JGI24737J22298_100050642 234
449 3300001990 JGI24737J22298_10005147 JGI24737J22298_100051472 234
450 3300002070 JGI24750J21931_1000821 JGI24750J21931_10008214 234
451 3300002070 JGI24750J21931_1000850 JGI24750J21931_10008504 234
452 3300002073 JGI24745J21846_1000205 JGI24745J21846_10002053 234
453 3300002074 JGI24748J21848_1000211 JGI24748J21848_10002115 234
454 3300002075 JGI24738J21930_10000256 JGI24738J21930_100002564 234
455 3300002076 JGI24749J21850_1006010 JGI24749J21850_10060102 234
456 3300002077 JGI24744J21845_10000112 JGI24744J21845_100001125 234
457 3300002155 JGI24033J26618_1000425 JGI24033J26618_10004254 234
458 3300002244 JGI24742J22300_10002461 JGI24742J22300_100024611 234
459 3300003659 JGI25404J52841_10002600 JGI25404J52841_100026003 234
460 3300003911 JGI25405J52794_10023352 JGI25405J52794_100233522 234
461 3300005290 Ga0065712_10001068 Ga0065712_100010686 234
462 3300005290 Ga0065712_10188505 Ga0065712_101885051 234
463 3300005293 Ga0065715_10003590 Ga0065715_100035904 234
464 3300005293 Ga0065715_10093721 Ga0065715_100937214 234
465 3300005328 Ga0070676_10012964 Ga0070676_100129644 234
466 3300005329 Ga0070683_100000098 Ga0070683_10000009854 234
467 3300005329 Ga0070683_101029154 Ga0070683_1010291541 234
468 3300005330 Ga0070690_100015149 Ga0070690_1000151494 234
469 3300005330 Ga0070690_100026107 Ga0070690_1000261074 234
470 3300005331 Ga0070670_100001544 Ga0070670_1000015443 234
471 3300005333 Ga0070677_10000092 Ga0070677_1000009231 234
472 3300005334 Ga0068869_100000054 Ga0068869_10000005424 234
473 3300005336 Ga0070680_100027363 Ga0070680_1000273634 234
474 3300005336 Ga0070680_100058485 Ga0070680_1000584853 234
475 3300005336 Ga0070680_100396210 Ga0070680_1003962102 234
476 3300005337 Ga0070682_100000181 Ga0070682_1000001814 234
477 3300005338 Ga0068868_100003816 Ga0068868_1000038168 234
478 3300005339 Ga0070660_100027651 Ga0070660_1000276512 234
479 3300005339 Ga0070660_100089794 Ga0070660_1000897942 234
480 3300005340 Ga0070689_100024070 Ga0070689_1000240704 234
481 3300005340 Ga0070689_100039552 Ga0070689_1000395524 234
482 3300005340 Ga0070689_100377502 Ga0070689_1003775022 234
483 3300005341 Ga0070691_10009004 Ga0070691_100090044 234
484 3300005341 Ga0070691_10014475 Ga0070691_100144754 234
485 3300005343 Ga0070687_100007432 Ga0070687_1000074324 234
486 3300005343 Ga0070687_100013713 Ga0070687_1000137134 234
487 3300005344 Ga0070661_100000153 Ga0070661_10000015352 234
488 3300005344 Ga0070661_100059218 Ga0070661_1000592183 234
489 3300005345 Ga0070692_10000320 Ga0070692_100003204 234
490 3300005347 Ga0070668_100024606 Ga0070668_1000246064 234
491 3300005353 Ga0070669_100027199 Ga0070669_1000271994 234
492 3300005353 Ga0070669_100070208 Ga0070669_1000702082 234
493 3300005354 Ga0070675_100027317 Ga0070675_1000273174 234
494 3300005354 Ga0070675_100378773 Ga0070675_1003787732 234
495 3300005355 Ga0070671_100011992 Ga0070671_1000119926 234
496 3300005355 Ga0070671_100114916 Ga0070671_1001149162 234
497 3300005356 Ga0070674_100017007 Ga0070674_1000170074 234
498 3300005356 Ga0070674_100083413 Ga0070674_1000834131 234
499 3300005356 Ga0070674_100212083 Ga0070674_1002120832 234
500 3300005364 Ga0070673_100005417 Ga0070673_1000054175 234
501 3300005365 Ga0070688_100023577 Ga0070688_1000235774 234
502 3300005366 Ga0070659_100025193 Ga0070659_1000251934 234
503 3300005366 Ga0070659_100054309 Ga0070659_1000543093 234
504 3300005367 Ga0070667_100029223 Ga0070667_1000292234 234
505 3300005367 Ga0070667_100107011 Ga0070667_1001070112 234
506 3300005406 Ga0070703_10004107 Ga0070703_100041074 234
507 3300005406 Ga0070703_10007172 Ga0070703_100071723 234
508 3300005435 Ga0070714_100603998 Ga0070714_1006039982 234
509 3300005436 Ga0070713_100016744 Ga0070713_1000167442 234
510 3300005437 Ga0070710_10004049 Ga0070710_100040497 234
511 3300005438 Ga0070701_10014309 Ga0070701_100143094 234
512 3300005439 Ga0070711_100062903 Ga0070711_1000629032 234
513 3300005440 Ga0070705_100000311 Ga0070705_1000003112 234
514 3300005440 Ga0070705_100109693 Ga0070705_1001096931 234
515 3300005441 Ga0070700_100013652 Ga0070700_1000136524 234
516 3300005444 Ga0070694_100122542 Ga0070694_1001225422 234
517 3300005445 Ga0070708_100015291 Ga0070708_1000152915 234
518 3300005455 Ga0070663_100002418 Ga0070663_1000024188 234
519 3300005455 Ga0070663_100156092 Ga0070663_1001560922 234
520 3300005456 Ga0070678_100000382 Ga0070678_1000003825 234
521 3300005457 Ga0070662_100019898 Ga0070662_1000198984 234
522 3300005457 Ga0070662_100033993 Ga0070662_1000339932 234
523 3300005458 Ga0070681_10042293 Ga0070681_100422934 234
524 3300005458 Ga0070681_10221004 Ga0070681_102210042 234
525 3300005459 Ga0068867_100021877 Ga0068867_1000218774 234
526 3300005466 Ga0070685_10004779 Ga0070685_100047795 234
527 3300005466 Ga0070685_10080613 Ga0070685_100806132 234
528 3300005530 Ga0070679_100041737 Ga0070679_1000417374 234
529 3300005530 Ga0070679_100051422 Ga0070679_1000514223 234
530 3300005535 Ga0070684_100030755 Ga0070684_1000307554 234
531 3300005535 Ga0070684_100050287 Ga0070684_1000502874 234
532 3300005535 Ga0070684_100394562 Ga0070684_1003945622 234
533 3300005536 Ga0070697_100074309 Ga0070697_1000743092 234
534 3300005539 Ga0068853_100001615 Ga0068853_10000161514 234
535 3300005539 Ga0068853_100054660 Ga0068853_1000546604 234
536 3300005543 Ga0070672_100010353 Ga0070672_1000103536 234
537 3300005543 Ga0070672_100173707 Ga0070672_1001737071 234
538 3300005544 Ga0070686_100014350 Ga0070686_1000143504 234
539 3300005545 Ga0070695_100015681 Ga0070695_1000156814 234
540 3300005546 Ga0070696_100004854 Ga0070696_1000048542 234
541 3300005546 Ga0070696_100060128 Ga0070696_1000601283 234
542 3300005546 Ga0070696_100350674 Ga0070696_1003506742 234
543 3300005546 Ga0070696_100456101 Ga0070696_1004561011 234
544 3300005547 Ga0070693_100004759 Ga0070693_1000047595 234
545 3300005548 Ga0070665_100047110 Ga0070665_1000471104 234
546 3300005548 Ga0070665_100141229 Ga0070665_1001412293 234
547 3300005549 Ga0070704_100093974 Ga0070704_1000939742 234
548 3300005549 Ga0070704_100096510 Ga0070704_1000965102 234
549 3300005563 Ga0068855_100057337 Ga0068855_1000573374 234
550 3300005564 Ga0070664_100014418 Ga0070664_1000144185 234
551 3300005564 Ga0070664_100047954 Ga0070664_1000479542 234
552 3300005564 Ga0070664_100106768 Ga0070664_1001067682 234
553 3300005577 Ga0068857_100032777 Ga0068857_1000327774 234
554 3300005577 Ga0068857_100151308 Ga0068857_1001513082 234
555 3300005578 Ga0068854_100000145 Ga0068854_1000001453 234
556 3300005578 Ga0068854_100051437 Ga0068854_1000514371 234
557 3300005614 Ga0068856_100084816 Ga0068856_1000848162 234
558 3300005615 Ga0070702_100001703 Ga0070702_1000017036 234
559 3300005616 Ga0068852_100028596 Ga0068852_1000285964 234
560 3300005617 Ga0068859_100062972 Ga0068859_1000629722 234
561 3300005617 Ga0068859_100066075 Ga0068859_1000660752 234
562 3300005617 Ga0068859_100075527 Ga0068859_1000755273 234
563 3300005618 Ga0068864_100014958 Ga0068864_1000149586 234
564 3300005618 Ga0068864_100135595 Ga0068864_1001355952 234
565 3300005718 Ga0068866_10000209 Ga0068866_1000020914 234
566 3300005719 Ga0068861_100021773 Ga0068861_1000217732 234
567 3300005719 Ga0068861_100037215 Ga0068861_1000372154 234
568 3300005834 Ga0068851_10021107 Ga0068851_100211073 234
569 3300005840 Ga0068870_10000029 Ga0068870_100000291 234
570 3300005841 Ga0068863_100019798 Ga0068863_1000197982 234
571 3300005841 Ga0068863_100113155 Ga0068863_1001131551 234
572 3300005842 Ga0068858_100035970 Ga0068858_1000359704 234
573 3300005842 Ga0068858_100117267 Ga0068858_1001172672 234
574 3300005842 Ga0068858_100170651 Ga0068858_1001706511 234
575 3300005843 Ga0068860_100044535 Ga0068860_1000445354 234
576 3300005843 Ga0068860_100059856 Ga0068860_1000598564 234
577 3300005843 Ga0068860_100395141 Ga0068860_1003951411 234
578 3300005844 Ga0068862_100011280 Ga0068862_1000112805 234
579 3300005844 Ga0068862_100036879 Ga0068862_1000368794 234
580 3300005937 Ga0081455_10000002 Ga0081455_10000002149 234
581 3300005937 Ga0081455_10007598 Ga0081455_100075982 234
582 3300005983 Ga0081540_1000150 Ga0081540_100015027 234
583 3300005983 Ga0081540_1014154 Ga0081540_10141543 234
584 3300006028 Ga0070717_10003573 Ga0070717_1000357310 234
585 3300006058 Ga0075432_10000858 Ga0075432_100008586 234
586 3300006163 Ga0070715_10004174 Ga0070715_100041742 234
587 3300006178 Ga0075367_10116176 Ga0075367_101161762 234
588 3300006194 Ga0075427_10006621 Ga0075427_100066212 234
589 3300006237 Ga0097621_100000328 Ga0097621_10000032830 234
590 3300006353 Ga0075370_10205919 Ga0075370_102059191 234
591 3300006358 Ga0068871_100007030 Ga0068871_1000070302 234
592 3300006358 Ga0068871_100023940 Ga0068871_1000239404 234
593 3300006844 Ga0075428_100002065 Ga0075428_1000020654 234
594 3300006846 Ga0075430_100000129 Ga0075430_1000001293 234
595 3300006847 Ga0075431_100000234 Ga0075431_10000023416 234
596 3300006852 Ga0075433_10000060 Ga0075433_1000006034 234
597 3300006852 Ga0075433_10005178 Ga0075433_100051784 234
598 3300006852 Ga0075433_10091829 Ga0075433_100918291 234
599 3300006871 Ga0075434_100000412 Ga0075434_10000041227 234
600 3300006871 Ga0075434_100003277 Ga0075434_1000032778 234
601 3300006871 Ga0075434_100049205 Ga0075434_1000492052 234
602 3300006871 Ga0075434_100109607 Ga0075434_1001096072 234
603 3300006880 Ga0075429_100000532 Ga0075429_10000053221 234
604 3300006881 Ga0068865_100011649 Ga0068865_1000116494 234
605 3300006881 Ga0068865_100061544 Ga0068865_1000615443 234
606 3300006881 Ga0068865_100395594 Ga0068865_1003955942 234
607 3300006914 Ga0075436_100070902 Ga0075436_1000709022 234
608 3300006914 Ga0075436_100470404 Ga0075436_1004704041 234
609 3300006931 Ga0097620_100062974 Ga0097620_1000629742 234
610 3300006931 Ga0097620_100066081 Ga0097620_1000660812 234
611 3300006931 Ga0097620_100075530 Ga0097620_1000755303 234
612 3300007076 Ga0075435_100008631 Ga0075435_1000086315 234
613 3300007076 Ga0075435_100074494 Ga0075435_1000744943 234
614 3300007076 Ga0075435_100128723 Ga0075435_1001287232 234
615 3300007076 Ga0075435_100247441 Ga0075435_1002474412 234
616 3300009036 Ga0105244_10020723 Ga0105244_100207234 234
617 3300009092 Ga0105250_10004829 Ga0105250_100048295 234
618 3300009093 Ga0105240_10071744 Ga0105240_100717444 234
619 3300009094 Ga0111539_10004252 Ga0111539_100042523 234
620 3300009094 Ga0111539_10058244 Ga0111539_100582442 234
621 3300009094 Ga0111539_10058514 Ga0111539_100585142 234
622 3300009094 Ga0111539_10087470 Ga0111539_100874702 234
623 3300009098 Ga0105245_10000882 Ga0105245_100008824 234
624 3300009101 Ga0105247_10001969 Ga0105247_1000196913 234
625 3300009101 Ga0105247_10113517 Ga0105247_101135172 234
626 3300009147 Ga0114129_10011377 Ga0114129_100113774 234
627 3300009148 Ga0105243_10024684 Ga0105243_100246842 234
628 3300009148 Ga0105243_10039281 Ga0105243_100392814 234
629 3300009148 Ga0105243_10137153 Ga0105243_101371532 234
630 3300009174 Ga0105241_10004094 Ga0105241_100040948 234
631 3300009176 Ga0105242_10021910 Ga0105242_100219102 234
632 3300009177 Ga0105248_10049550 Ga0105248_100495504 234
633 3300009177 Ga0105248_10381652 Ga0105248_103816521 234
634 3300009177 Ga0105248_10658159 Ga0105248_106581592 234
635 3300009545 Ga0105237_10016131 Ga0105237_100161314 234
636 3300009545 Ga0105237_10110080 Ga0105237_101100802 234
637 3300009545 Ga0105237_10380585 Ga0105237_103805852 234
638 3300009553 Ga0105249_10008019 Ga0105249_100080194 234
639 3300009553 Ga0105249_10037532 Ga0105249_100375324 234
640 3300009553 Ga0105249_10413790 Ga0105249_104137902 234
641 3300010375 Ga0105239_10049789 Ga0105239_100497894 234
642 3300010375 Ga0105239_10052026 Ga0105239_100520264 234
643 3300010375 Ga0105239_10349846 Ga0105239_103498462 234
644 3300011119 Ga0105246_10007744 Ga0105246_100077443 234
645 3300012502 Ga0157347_1004501 Ga0157347_10045012 234
646 3300012515 Ga0157338_1006414 Ga0157338_10064142 234
647 3300013100 Ga0157373_10006834 Ga0157373_100068346 234
648 3300013102 Ga0157371_10012862 Ga0157371_100128622 234
649 3300013296 Ga0157374_10000614 Ga0157374_100006146 234
650 3300013296 Ga0157374_10790265 Ga0157374_107902651 234
651 3300013297 Ga0157378_10000701 Ga0157378_100007019 234
652 3300013306 Ga0163162_10042063 Ga0163162_100420632 234
653 3300013306 Ga0163162_10467102 Ga0163162_104671022 234
654 3300013307 Ga0157372_10028350 Ga0157372_100283502 234
655 3300013307 Ga0157372_10338765 Ga0157372_103387652 234
656 3300013308 Ga0157375_10038574 Ga0157375_100385742 234
657 3300013308 Ga0157375_10159258 Ga0157375_101592582 234
658 3300013308 Ga0157375_10414997 Ga0157375_104149972 234
659 3300014325 Ga0163163_10007899 Ga0163163_100078999 234
660 3300014325 Ga0163163_10033764 Ga0163163_100337644 234
661 3300014326 Ga0157380_10001646 Ga0157380_1000164614 234
662 3300014326 Ga0157380_10107099 Ga0157380_101070992 234
663 3300014745 Ga0157377_10000514 Ga0157377_1000051414 234
664 3300014745 Ga0157377_10050193 Ga0157377_100501932 234
665 3300014968 Ga0157379_10003823 Ga0157379_1000382310 234
666 3300014968 Ga0157379_10129603 Ga0157379_101296032 234
667 3300014968 Ga0157379_10137747 Ga0157379_101377472 234
668 3300014968 Ga0157379_10270049 Ga0157379_102700492 234
669 3300014968 Ga0157379_10305929 Ga0157379_103059292 234
670 3300014969 Ga0157376_10000860 Ga0157376_1000086010 234
671 3300014969 Ga0157376_10748979 Ga0157376_107489791 234
672 3300017792 Ga0163161_10000956 Ga0163161_1000095619 234
673 3300017792 Ga0163161_10178929 Ga0163161_101789291 234
674 3300025271 Ga0207666_1000043 Ga0207666_10000434 234
675 3300025271 Ga0207666_1000617 Ga0207666_10006174 234
676 3300025290 Ga0207673_1000017 Ga0207673_10000177 234
677 3300025315 Ga0207697_10001136 Ga0207697_100011364 234
678 3300025315 Ga0207697_10008878 Ga0207697_100088782 234
679 3300025885 Ga0207653_10007260 Ga0207653_100072604 234
680 3300025885 Ga0207653_10015009 Ga0207653_100150092 234
681 3300025893 Ga0207682_10000021 Ga0207682_1000002134 234
682 3300025899 Ga0207642_10000063 Ga0207642_100000632 234
683 3300025900 Ga0207710_10028544 Ga0207710_100285442 234
684 3300025900 Ga0207710_10116105 Ga0207710_101161052 234
685 3300025901 Ga0207688_10000949 Ga0207688_100009494 234
686 3300025901 Ga0207688_10094425 Ga0207688_100944252 234
687 3300025903 Ga0207680_10009142 Ga0207680_100091422 234
688 3300025904 Ga0207647_10013700 Ga0207647_100137004 234
689 3300025904 Ga0207647_10021210 Ga0207647_100212104 234
690 3300025906 Ga0207699_10001682 Ga0207699_100016824 234
691 3300025907 Ga0207645_10018617 Ga0207645_100186174 234
692 3300025908 Ga0207643_10000108 Ga0207643_100001086 234
693 3300025911 Ga0207654_10001731 Ga0207654_100017314 234
694 3300025912 Ga0207707_10032373 Ga0207707_100323732 234
695 3300025913 Ga0207695_10212559 Ga0207695_102125591 234
696 3300025914 Ga0207671_10012822 Ga0207671_100128224 234
697 3300025914 Ga0207671_10055174 Ga0207671_100551742 234
698 3300025915 Ga0207693_10018314 Ga0207693_100183145 234
699 3300025916 Ga0207663_10008774 Ga0207663_100087744 234
700 3300025916 Ga0207663_10265191 Ga0207663_102651912 234
701 3300025917 Ga0207660_10000014 Ga0207660_1000001445 234
702 3300025918 Ga0207662_10005530 Ga0207662_100055302 234
703 3300025918 Ga0207662_10020149 Ga0207662_100201492 234
704 3300025919 Ga0207657_10034796 Ga0207657_100347962 234
705 3300025919 Ga0207657_10054202 Ga0207657_100542023 234
706 3300025919 Ga0207657_10286673 Ga0207657_102866732 234
707 3300025920 Ga0207649_10000086 Ga0207649_1000008618 234
708 3300025921 Ga0207652_10000255 Ga0207652_1000025535 234
709 3300025923 Ga0207681_10000024 Ga0207681_100000247 234
710 3300025925 Ga0207650_10005453 Ga0207650_100054538 234
711 3300025925 Ga0207650_10481834 Ga0207650_104818341 234
712 3300025926 Ga0207659_10000034 Ga0207659_10000034101 234
713 3300025926 Ga0207659_10315215 Ga0207659_103152152 234
714 3300025926 Ga0207659_10408687 Ga0207659_104086872 234
715 3300025927 Ga0207687_10000110 Ga0207687_1000011029 234
716 3300025928 Ga0207700_10001909 Ga0207700_100019097 234
717 3300025931 Ga0207644_10000868 Ga0207644_1000086817 234
718 3300025932 Ga0207690_10000270 Ga0207690_1000027014 234
719 3300025932 Ga0207690_10087572 Ga0207690_100875722 234
720 3300025933 Ga0207706_10033611 Ga0207706_100336112 234
721 3300025933 Ga0207706_10040100 Ga0207706_100401002 234
722 3300025933 Ga0207706_10189817 Ga0207706_101898172 234
723 3300025933 Ga0207706_10341766 Ga0207706_103417661 234
724 3300025934 Ga0207686_10000214 Ga0207686_1000021431 234
725 3300025935 Ga0207709_10000344 Ga0207709_1000034435 234
726 3300025935 Ga0207709_10010118 Ga0207709_100101182 234
727 3300025936 Ga0207670_10010144 Ga0207670_100101443 234
728 3300025936 Ga0207670_10015325 Ga0207670_100153254 234
729 3300025937 Ga0207669_10000295 Ga0207669_100002956 234
730 3300025937 Ga0207669_10025469 Ga0207669_100254694 234
731 3300025937 Ga0207669_10026480 Ga0207669_100264804 234
732 3300025938 Ga0207704_10000343 Ga0207704_1000034314 234
733 3300025938 Ga0207704_10165665 Ga0207704_101656652 234
734 3300025938 Ga0207704_10404826 Ga0207704_104048262 234
735 3300025939 Ga0207665_10001068 Ga0207665_100010684 234
736 3300025940 Ga0207691_10003768 Ga0207691_100037684 234
737 3300025940 Ga0207691_10286420 Ga0207691_102864202 234
738 3300025941 Ga0207711_10001706 Ga0207711_1000170618 234
739 3300025941 Ga0207711_10007798 Ga0207711_100077982 234
740 3300025942 Ga0207689_10002655 Ga0207689_100026555 234
741 3300025942 Ga0207689_10209544 Ga0207689_102095442 234
742 3300025944 Ga0207661_10000094 Ga0207661_100000942 234
743 3300025945 Ga0207679_10000025 Ga0207679_10000025109 234
744 3300025945 Ga0207679_10020011 Ga0207679_100200112 234
745 3300025945 Ga0207679_10132305 Ga0207679_101323052 234
746 3300025945 Ga0207679_10238500 Ga0207679_102385002 234
747 3300025949 Ga0207667_10006649 Ga0207667_1000664910 234
748 3300025960 Ga0207651_10000028 Ga0207651_1000002833 234
749 3300025961 Ga0207712_10000558 Ga0207712_1000055827 234
750 3300025972 Ga0207668_10000098 Ga0207668_1000009861 234
751 3300025972 Ga0207668_10045417 Ga0207668_100454172 234
752 3300025981 Ga0207640_10000104 Ga0207640_100001048 234
753 3300025986 Ga0207658_10291315 Ga0207658_102913152 234
754 3300026023 Ga0207677_10005087 Ga0207677_100050874 234
755 3300026023 Ga0207677_10012453 Ga0207677_100124534 234
756 3300026035 Ga0207703_10000594 Ga0207703_1000059437 234
757 3300026035 Ga0207703_10764680 Ga0207703_107646801 234
758 3300026041 Ga0207639_10000265 Ga0207639_1000026537 234
759 3300026067 Ga0207678_10003256 Ga0207678_100032564 234
760 3300026067 Ga0207678_10035004 Ga0207678_100350042 234
761 3300026075 Ga0207708_10024812 Ga0207708_100248124 234
762 3300026075 Ga0207708_10024934 Ga0207708_100249344 234
763 3300026078 Ga0207702_10001351 Ga0207702_1000135123 234
764 3300026078 Ga0207702_10897314 Ga0207702_108973141 234
765 3300026088 Ga0207641_10005095 Ga0207641_100050951 234
766 3300026089 Ga0207648_10004307 Ga0207648_100043074 234
767 3300026089 Ga0207648_10160756 Ga0207648_101607561 234
768 3300026095 Ga0207676_10000640 Ga0207676_1000064010 234
769 3300026116 Ga0207674_10005795 Ga0207674_1000579514 234
770 3300026116 Ga0207674_10094456 Ga0207674_100944564 234
771 3300026118 Ga0207675_100003849 Ga0207675_1000038494 234
772 3300026118 Ga0207675_100041946 Ga0207675_1000419462 234
773 3300026121 Ga0207683_10000001 Ga0207683_10000001109 234
774 3300026121 Ga0207683_10007134 Ga0207683_100071344 234
775 3300026142 Ga0207698_10001784 Ga0207698_1000178410 234
776 3300027252 Ga0209973_1000485 Ga0209973_10004853 234
777 3300027471 Ga0209995_1006935 Ga0209995_10069352 234
778 3300027617 Ga0210002_1001067 Ga0210002_10010672 234
779 3300027665 Ga0209983_1016594 Ga0209983_10165942 234
780 3300027682 Ga0209971_1011706 Ga0209971_10117062 234
781 3300027695 Ga0209966_1001536 Ga0209966_10015362 234
782 3300027717 Ga0209998_10002199 Ga0209998_100021992 234
783 3300027717 Ga0209998_10003000 Ga0209998_100030003 234
784 3300027717 Ga0209998_10012661 Ga0209998_100126612 234
785 3300027876 Ga0209974_10004169 Ga0209974_100041696 234
786 3300027876 Ga0209974_10014697 Ga0209974_100146972 234
787 3300027907 Ga0207428_10000146 Ga0207428_1000014657 234
788 3300027907 Ga0207428_10000221 Ga0207428_100002212 234
789 3300027907 Ga0207428_10000590 Ga0207428_1000059040 234
790 3300028379 Ga0268266_10022724 Ga0268266_100227245 234
791 3300028379 Ga0268266_10108502 Ga0268266_101085022 234
792 3300028379 Ga0268266_10602734 Ga0268266_106027341 234
793 3300028380 Ga0268265_10005507 Ga0268265_100055074 234
794 3300028380 Ga0268265_10228447 Ga0268265_102284472 234
795 3300028381 Ga0268264_10000456 Ga0268264_1000045639 234
796 3300028381 Ga0268264_10390491 Ga0268264_103904912 234
797 3300028381 Ga0268264_10575414 Ga0268264_105754141 234
798 3300034816 Ga0373930_0000005 Ga0373930_0000005_1198_1902 234
799 3300034817 Ga0373948_0000203 Ga0373948_0000203_4713_5417 234
800 3300034817 Ga0373948_0006852 Ga0373948_0006852_425_1150 234
801 3300034817 Ga0373948_0021977 Ga0373948_0021977_310_1050 234
802 3300034818 Ga0373950_0000614 Ga0373950_0000614_3550_4254 234
803 3300034819 Ga0373958_0000033 Ga0373958_0000033_952_1656 234
804 3300034819 Ga0373958_0000839 Ga0373958_0000839_592_1317 234
805 3300034820 Ga0373959_0000714 Ga0373959_0000714_1900_2604 234
806 3300034957 Ga0373938_0000517 Ga0373938_0000517_183_908 234
807 3300034957 Ga0373938_0002463 Ga0373938_0002463_273_1013 234
808 3300035083 Ga0373926_0028249 Ga0373926_0028249_573_1313 234
809 3300035084 Ga0373928_0000058 Ga0373928_0000058_10498_11202 234
810 3300035084 Ga0373928_0002188 Ga0373928_0002188_1647_2372 234
811 3300035084 Ga0373928_0003549 Ga0373928_0003549_937_1677 234
812 3300035085 Ga0373929_0000552 Ga0373929_0000552_4951_5655 234
813 3300035085 Ga0373929_0008568 Ga0373929_0008568_727_1452 234
814 3300035086 Ga0373934_0057166 Ga0373934_0057166_665_1405 234
815 3300035088 Ga0373940_0001756 Ga0373940_0001756_3110_3814 234
816 3300035088 Ga0373940_0007632 Ga0373940_0007632_1616_2341 234
817 3300035088 Ga0373940_0013713 Ga0373940_0013713_953_1693 234
818 3300035089 Ga0373944_0006589 Ga0373944_0006589_632_1372 234
819 3300035090 Ga0373949_0002457 Ga0373949_0002457_2436_3176 234
820 3300035090 Ga0373949_0027929 Ga0373949_0027929_170_895 234
821 3300035090 Ga0373949_0032644 Ga0373949_0032644_232_936 234
822 3300035091 Ga0373951_0002590 Ga0373951_0002590_2496_3221 234
823 3300035092 Ga0373952_0002862 Ga0373952_0002862_1094_1798 234
824 3300035092 Ga0373952_0003011 Ga0373952_0003011_945_1649 234
825 3300035092 Ga0373952_0004967 Ga0373952_0004967_1360_2085 234
826 3300035112 Ga0373932_0000987 Ga0373932_0000987_6918_7622 234
827 3300035112 Ga0373932_0003158 Ga0373932_0003158_257_997 234
828 3300035112 Ga0373932_0003436 Ga0373932_0003436_2540_3265 234
829 3300035113 Ga0373936_0010987 Ga0373936_0010987_250_990 234
830 3300035114 Ga0373939_0000783 Ga0373939_0000783_2467_3171 234
831 3300035114 Ga0373939_0002024 Ga0373939_0002024_3060_3785 234
832 3300035114 Ga0373939_0010179 Ga0373939_0010179_770_1510 234
833 3300035115 Ga0373941_0000140 Ga0373941_0000140_10243_10947 234
834 3300035115 Ga0373941_0003396 Ga0373941_0003396_1268_1993 234
835 3300035117 Ga0373953_0022523 Ga0373953_0022523_905_1645 234
836 3300035117 Ga0373953_0139634 Ga0373953_0139634_250_990 234
837 3300035118 Ga0373954_0004912 Ga0373954_0004912_5007_5747 234
838 3300035119 Ga0373956_0014602 Ga0373956_0014602_2094_2834 234
839 3300035120 Ga0373957_0083530 Ga0373957_0083530_250_990 234
840 3300035121 Ga0373960_0002027 Ga0373960_0002027_1360_2085 234
841 3300035121 Ga0373960_0003110 Ga0373960_0003110_1036_1740 234
842 3300035121 Ga0373960_0038885 Ga0373960_0038885_300_1040 234
843 3300035170 Ga0373943_0016382 Ga0373943_0016382_818_1558 234
844 3300035170 Ga0373943_0017942 Ga0373943_0017942_2048_2788 234
845 3300035171 Ga0373946_0012607 Ga0373946_0012607_2177_2917 234
846 3300035171 Ga0373946_0014256 Ga0373946_0014256_2055_2795 234
847 3300035172 Ga0373955_0024957 Ga0373955_0024957_27_767 234
848 3300035172 Ga0373955_0225138 Ga0373955_0225138_46_786 234
849 3300035207 Ga0373942_0004650 Ga0373942_0004650_945_1649 234
850 3300035207 Ga0373942_0005098 Ga0373942_0005098_1896_2621 234
851 3300035207 Ga0373942_0027485 Ga0373942_0027485_339_1079 234
852 3300035241 Ga0373961_0000385 Ga0373961_0000385_12570_13274 234
853 3300035241 Ga0373961_0018927 Ga0373961_0018927_965_1690 234
854 3300035241 Ga0373961_0023941 Ga0373961_0023941_58_846 234
855 3300035242 Ga0373962_0009009 Ga0373962_0009009_1360_2085 234
856 3300035242 Ga0373962_0011063 Ga0373962_0011063_1394_2098 234
857 3300035410 Ga0373924_0014049 Ga0373924_0014049_2211_2951 234
858 3300035691 Ga0373931_0000130 Ga0373931_0000130_32336_33061 234
859 3300035691 Ga0373931_0003847 Ga0373931_0003847_865_1653 234
860 3300035691 Ga0373931_0011865 Ga0373931_0011865_744_1448 234
861 3300035692 Ga0373935_0003155 Ga0373935_0003155_5732_6472 234
862 3300035692 Ga0373935_0030530 Ga0373935_0030530_1533_2273 234
863 3300035692 Ga0373935_0284115 Ga0373935_0284115_268_1008 234
864 3300035695 Ga0373927_0004274 Ga0373927_0004274_6097_6837 234
865 3300035724 Ga0373933_0005885 Ga0373933_0005885_876_1616 234
866 3300035724 Ga0373933_0127897 Ga0373933_0127897_568_1308 234
867 3300035725 Ga0373947_0004749 Ga0373947_0004749_5818_6558 234
868 3300036401 Ga0373937_0029083 Ga0373937_0029083_1788_2528 234
869 3300036401 Ga0373937_0205189 Ga0373937_0205189_291_1031 234
870 3300037068 Ga0373925_0001412 Ga0373925_0001412_12427_13167 234
871 3300038996 Ga0242420_008710 Ga0242420_008710_579_1283 234
872 3300042001 Ga0439441_028274 Ga0439441_028274_275_1015 234
873 3300042016 Ga0439463_007316 Ga0439463_007316_1473_2213 234
874 3300042436 Ga0439435_0020743 Ga0439435_0020743_280_1020 234
875 3300042439 Ga0439464_0025431 Ga0439464_0025431_417_1157 234
876 3300042461 Ga0439460_0032851 Ga0439460_0032851_591_1331 234
877 3300042876 Ga0451577_0076456 Ga0451577_0076456_1303_2007 234
878 3300044712 Ga0453684_0045660 Ga0453684_0045660_1571_2275 234
879 3300045051 Ga0451576_0005933 Ga0451576_0005933_14155_14859 234
880 3300046452 Ga0495617_009209 Ga0495617_009209_1449_2189 234
881 3300046454 Ga0495592_0007579 Ga0495592_0007579_1394_2134 234
882 3300046454 Ga0495592_0079259 Ga0495592_0079259_1337_2077 234
883 3300046455 Ga0495603_0010367 Ga0495603_0010367_3128_3868 234
884 3300046455 Ga0495603_0116140 Ga0495603_0116140_553_1293 234
885 3300046459 Ga0495629_0000909 Ga0495629_0000909_2904_3644 234
886 3300046461 Ga0495641_0015089 Ga0495641_0015089_289_1029 234
887 3300046461 Ga0495641_0036557 Ga0495641_0036557_1111_1851 234
888 3300046462 Ga0495651_0008748 Ga0495651_0008748_181_921 234
889 3300046462 Ga0495651_0011644 Ga0495651_0011644_4693_5433 234
890 3300046463 Ga0495653_0027062 Ga0495653_0027062_3703_4443 234
891 3300046463 Ga0495653_0054179 Ga0495653_0054179_671_1411 234
892 3300046473 Ga0495582_0002021 Ga0495582_0002021_8288_9028 234
893 3300046473 Ga0495582_0002597 Ga0495582_0002597_2358_3098 234
894 3300046474 Ga0495605_0032808 Ga0495605_0032808_1006_1746 234
895 3300046475 Ga0495639_0006208 Ga0495639_0006208_656_1396 234
896 3300046476 Ga0495662_0043060 Ga0495662_0043060_268_1008 234
897 3300046477 Ga0495664_0023714 Ga0495664_0023714_552_1292 234
898 3300046477 Ga0495664_0032029 Ga0495664_0032029_1482_2222 234
899 3300046491 Ga0495584_0004152 Ga0495584_0004152_6818_7558 234
900 3300046492 Ga0495585_0000856 Ga0495585_0000856_4855_5595 234
901 3300046499 Ga0495594_0161848 Ga0495594_0161848_94_834 234
902 3300046501 Ga0495607_0001563 Ga0495607_0001563_339_1079 234
903 3300046511 Ga0495608_0025614 Ga0495608_0025614_1018_1758 234
904 3300046511 Ga0495608_0029844 Ga0495608_0029844_2037_2777 234
905 3300046514 Ga0495618_0056529 Ga0495618_0056529_251_991 234
906 3300046516 Ga0495628_0010424 Ga0495628_0010424_5095_5835 234
907 3300046516 Ga0495628_0049175 Ga0495628_0049175_250_990 234
908 3300046517 Ga0495630_0286970 Ga0495630_0286970_268_1008 234
909 3300046520 Ga0495637_0008444 Ga0495637_0008444_26_766 234
910 3300046520 Ga0495637_0022486 Ga0495637_0022486_1307_2032 234
911 3300046523 Ga0495644_0000392 Ga0495644_0000392_7304_8044 234
912 3300046525 Ga0495663_0016049 Ga0495663_0016049_1247_1987 234
913 3300046529 Ga0495652_0009116 Ga0495652_0009116_7596_8336 234
914 3300046531 Ga0495665_0003663 Ga0495665_0003663_918_1658 234
915 3300046533 Ga0495640_0037750 Ga0495640_0037750_656_1396 234
916 3300046533 Ga0495640_0172767 Ga0495640_0172767_562_1302 234
917 3300046535 Ga0495586_0032773 Ga0495586_0032773_324_1064 234
918 3300046536 Ga0495587_0011728 Ga0495587_0011728_783_1523 234
919 3300046536 Ga0495587_0029163 Ga0495587_0029163_2424_3164 234
920 3300046537 Ga0495598_0001967 Ga0495598_0001967_2090_2830 234
921 3300046543 Ga0495645_0004078 Ga0495645_0004078_630_1370 234
922 3300046558 Ga0495633_0000645 Ga0495633_0000645_23836_24576 234
923 3300046559 Ga0495667_0015414 Ga0495667_0015414_4372_5112 234
924 3300046615 Ga0495656_0000157 Ga0495656_0000157_16710_17450 234
925 3300046642 Ga0495634_0068575 Ga0495634_0068575_784_1524 234
926 3300046648 Ga0495611_0001997 Ga0495611_0001997_5622_6362 234
927 3300046663 Ga0495635_0004119 Ga0495635_0004119_223_963 234
928 3300046663 Ga0495635_0161557 Ga0495635_0161557_192_932 234
929 3300046664 Ga0495659_0000900 Ga0495659_0000900_5851_6591 234
930 3300046674 Ga0495588_0010993 Ga0495588_0010993_3256_3996 234
931 3300046675 Ga0495657_0071813 Ga0495657_0071813_181_921 234
932 3300046678 Ga0495599_0008671 Ga0495599_0008671_219_959 234
933 3300046678 Ga0495599_0409653 Ga0495599_0409653_21_761 234
934 3300046679 Ga0495623_0089382 Ga0495623_0089382_998_1738 234
935 3300046680 Ga0495646_0001919 Ga0495646_0001919_6583_7323 234
936 3300046680 Ga0495646_0035551 Ga0495646_0035551_1333_2073 234
937 3300046681 Ga0495647_0005796 Ga0495647_0005796_273_1013 234
938 3300046681 Ga0495647_0039154 Ga0495647_0039154_598_1338 234
939 3300046683 Ga0495658_0000360 Ga0495658_0000360_9761_10501 234
940 3300046683 Ga0495658_0024624 Ga0495658_0024624_773_1513 234
941 3300046684 Ga0495669_0076118 Ga0495669_0076118_262_987 234
942 3300046689 Ga0495613_0018760 Ga0495613_0018760_1436_2176 234
943 3300046689 Ga0495613_0052318 Ga0495613_0052318_221_961 234
944 3300046690 Ga0495624_0007588 Ga0495624_0007588_5531_6271 234
945 3300046691 Ga0495670_0000213 Ga0495670_0000213_10410_11150 234
946 3300046809 Ga0495600_0014240 Ga0495600_0014240_313_1053 234
947 3300046809 Ga0495600_0022131 Ga0495600_0022131_267_1007 234
948 3300047315 Ga0495581_0012254 Ga0495581_0012254_2696_3436 234
949 3300047315 Ga0495581_0087282 Ga0495581_0087282_268_1008 234
950 3300047317 Ga0495604_0001954 Ga0495604_0001954_9032_9772 234
951 3300047321 Ga0495676_0035234 Ga0495676_0035234_2060_2800 234
952 3300047322 Ga0495680_0002446 Ga0495680_0002446_7550_8290 234
953 3300047322 Ga0495680_0009264 Ga0495680_0009264_1290_2030 234
954 3300047322 Ga0495680_0064647 Ga0495680_0064647_232_972 234
955 3300047444 Ga0495675_0006699 Ga0495675_0006699_290_1030 234
956 3300047446 Ga0495679_040117 Ga0495679_040117_43_783 234
957 3300047471 Ga0495684_0005638 Ga0495684_0005638_6298_7038 234
958 3300047673 Ga0495593_0004620 Ga0495593_0004620_1059_1799 234
959 3300047673 Ga0495593_0020466 Ga0495593_0020466_2716_3456 234
960 3300048088 Ga0495602_0002613 Ga0495602_0002613_5530_6270 234
961 3300048089 Ga0495614_0006737 Ga0495614_0006737_2155_2895 234
962 3300048903 Ga0496100_0001667 Ga0496100_0001667_4349_5074 234
963 3300048903 Ga0496100_0062922 Ga0496100_0062922_20_724 234
964 3300048903 Ga0496100_0295865 Ga0496100_0295865_355_1095 234
965 3300048904 Ga0496101_0000079 Ga0496101_0000079_47189_47914 234
966 3300048904 Ga0496101_0016662 Ga0496101_0016662_2722_3426 234
967 3300048904 Ga0496101_0135932 Ga0496101_0135932_23_763 234
968 3300048904 Ga0496101_0161750 Ga0496101_0161750_170_916 234
969 3300048905 Ga0496102_0004410 Ga0496102_0004410_5941_6666 234
970 3300048905 Ga0496102_0104825 Ga0496102_0104825_555_1295 234
971 3300048905 Ga0496102_0203216 Ga0496102_0203216_1144_1848 234
972 3300048906 Ga0496103_0003888 Ga0496103_0003888_3271_3996 234
973 3300048906 Ga0496103_0082312 Ga0496103_0082312_818_1558 234
974 3300048907 Ga0496104_0050199 Ga0496104_0050199_1940_2680 234
975 3300048907 Ga0496104_0135318 Ga0496104_0135318_522_1313 234
976 3300048907 Ga0496104_0150281 Ga0496104_0150281_509_1255 234
977 3300048907 Ga0496104_0256749 Ga0496104_0256749_20_724 234
978 3300048908 Ga0496105_0060404 Ga0496105_0060404_612_1316 234
979 3300048908 Ga0496105_0079013 Ga0496105_0079013_666_1406 234
980 3300048908 Ga0496105_0111416 Ga0496105_0111416_941_1732 234
981 3300048908 Ga0496105_0239347 Ga0496105_0239347_593_1339 234
982 3300048909 Ga0496106_0030064 Ga0496106_0030064_55_780 234
983 3300048909 Ga0496106_0041579 Ga0496106_0041579_246_950 234
984 3300048909 Ga0496106_0197745 Ga0496106_0197745_662_1366 234
985 3300048910 Ga0496107_0020541 Ga0496107_0020541_2453_3157 234
986 3300048910 Ga0496107_0023690 Ga0496107_0023690_405_1151 234
987 3300048910 Ga0496107_0025593 Ga0496107_0025593_183_908 234
988 3300048910 Ga0496107_0071064 Ga0496107_0071064_98_802 234
989 3300048910 Ga0496107_0443439 Ga0496107_0443439_140_880 234
990 3300048911 Ga0496108_0005809 Ga0496108_0005809_5797_6543 234
991 3300048911 Ga0496108_0081425 Ga0496108_0081425_1158_1883 234
992 3300048911 Ga0496108_0087944 Ga0496108_0087944_20_724 234
993 3300048911 Ga0496108_0118736 Ga0496108_0118736_1509_2213 234
994 3300048911 Ga0496108_0138143 Ga0496108_0138143_938_1729 234
995 3300048912 Ga0496109_0000223 Ga0496109_0000223_19544_20269 234
996 3300048912 Ga0496109_0050643 Ga0496109_0050643_612_1316 234
997 3300048912 Ga0496109_0062821 Ga0496109_0062821_1608_2399 234
998 3300048913 Ga0496110_0005653 Ga0496110_0005653_1454_2179 234
999 3300048913 Ga0496110_0133133 Ga0496110_0133133_1316_2107 234
1000 3300048913 Ga0496110_0136904 Ga0496110_0136904_612_1316 234
1001 3300048913 Ga0496110_0210296 Ga0496110_0210296_219_965 234
1002 3300048914 Ga0496111_0007705 Ga0496111_0007705_6305_7030 234
1003 3300048914 Ga0496111_0042491 Ga0496111_0042491_2287_2991 234
1004 3300048914 Ga0496111_0120204 Ga0496111_0120204_601_1305 234
1005 3300048915 Ga0496112_0055975 Ga0496112_0055975_1747_2472 234
1006 3300048915 Ga0496112_0088107 Ga0496112_0088107_1756_2460 234
1007 3300048915 Ga0496112_0167574 Ga0496112_0167574_527_1318 234
1008 3300048915 Ga0496112_0756676 Ga0496112_0756676_70_810 234
1009 3300048916 Ga0496113_0000624 Ga0496113_0000624_10465_11211 234
1010 3300048916 Ga0496113_0066235 Ga0496113_0066235_1204_1929 234
1011 3300048916 Ga0496113_0067511 Ga0496113_0067511_462_1166 234
1012 3300048916 Ga0496113_0233293 Ga0496113_0233293_73_777 234
1013 3300048916 Ga0496113_0311774 Ga0496113_0311774_201_941 234
1014 3300048917 Ga0496114_0198527 Ga0496114_0198527_417_1121 234
1015 3300048918 Ga0496115_0001792 Ga0496115_0001792_13099_13824 234
1016 3300048918 Ga0496115_0103501 Ga0496115_0103501_930_1670 234
1017 3300048918 Ga0496115_0105890 Ga0496115_0105890_1371_2075 234
1018 3300048929 Ga0496126_0287700 Ga0496126_0287700_313_1017 234
1019 3300049592 Ga0501076_0448358 Ga0501076_0448358_262_1002 234
1020 3300050494 nmdc:mga06z11_93342_c1 nmdc:mga06z11_93342_c1_867_1592 234
1021 3300050507 nmdc:mga05p37_111_c1 nmdc:mga05p37_111_c1_16084_16824 234
1022 3300050507 nmdc:mga05p37_64417_c1 nmdc:mga05p37_64417_c1_1828_2568 234
1023 3300050508 nmdc:mga09592_519_c1 nmdc:mga09592_519_c1_27400_28140 234
1024 3300050509 nmdc:mga0qj67_5814_c1 nmdc:mga0qj67_5814_c1_3781_4521 234
1025 3300050510 nmdc:mga06r32_3010_c1 nmdc:mga06r32_3010_c1_6925_7665 234
1026 3300050511 nmdc:mga08y16_11075_c1 nmdc:mga08y16_11075_c1_3686_4426 234
1027 3300050511 nmdc:mga08y16_223100_c1 nmdc:mga08y16_223100_c1_1016_1741 234
1028 3300050511 nmdc:mga08y16_59876_c1 nmdc:mga08y16_59876_c1_1881_2585 234
1029 3300050511 nmdc:mga08y16_82929_c1 nmdc:mga08y16_82929_c1_893_1648 234
1030 3300050512 nmdc:mga0n895_2911_c1 nmdc:mga0n895_2911_c1_3558_4298 234
1031 3300050512 nmdc:mga0n895_497_c1 nmdc:mga0n895_497_c1_18063_18788 234
1032 3300050512 nmdc:mga0n895_52554_c1 nmdc:mga0n895_52554_c1_2741_3445 234
1033 3300050512 nmdc:mga0n895_6865_c1 nmdc:mga0n895_6865_c1_8127_8867 234
1034 3300050513 nmdc:mga0rr50_636_c1 nmdc:mga0rr50_636_c1_12347_13087 234
1035 3300050513 nmdc:mga0rr50_702502_c1 nmdc:mga0rr50_702502_c1_77_781 234
1036 3300050514 nmdc:mga08x19_183599_c1 nmdc:mga08x19_183599_c1_13_753 234
1037 3300050514 nmdc:mga08x19_436421_c1 nmdc:mga08x19_436421_c1_147_902 234
1038 3300050515 nmdc:mga0a205_269192_c1 nmdc:mga0a205_269192_c1_778_1482 234
1039 3300050515 nmdc:mga0a205_5029_c1 nmdc:mga0a205_5029_c1_4053_4778 234
1040 3300050515 nmdc:mga0a205_50_c1 nmdc:mga0a205_50_c1_41783_42523 234
1041 3300053077 Ga0495601_0000259 Ga0495601_0000259_7699_8439 234
1042 3300053077 Ga0495601_0196120 Ga0495601_0196120_38_778 234
1043 3300053078 Ga0495612_0000173 Ga0495612_0000173_13018_13758 234
1044 3300053078 Ga0495612_0005917 Ga0495612_0005917_3703_4443 234
1045 3300053084 Ga0495595_0005278 Ga0495595_0005278_291_1031 234
1046 3300053084 Ga0495595_0011900 Ga0495595_0011900_1617_2357 234
1047 3300053085 Ga0495619_0000178 Ga0495619_0000178_16073_16813 234
1048 3300053085 Ga0495619_0001228 Ga0495619_0001228_12996_13736 234
1049 3300053085 Ga0495619_0032913 Ga0495619_0032913_268_1008 234
1050 3300053085 Ga0495619_0261479 Ga0495619_0261479_326_1066 234
1051 3300053096 Ga0500641_0000709 Ga0500641_0000709_10270_11013 234
1052 3300053119 Ga0500595_000001 Ga0500595_000001_916234_917013 234
1053 3300053153 Ga0500616_0093155 Ga0500616_0093155_45_818 234
1054 3300054114 Ga0501084_0025949 Ga0501084_0025949_2425_3165 234
1055 3300060353 Ga0501082_0050587 Ga0501082_0050587_2022_2762 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02390

Methyltransf_4

Putative methyltransferase

89

257

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8998 30 234
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.8858 30 233
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8785 30 234
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.8575 30 233
8hkr-assembly1.cif.gz_B crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.856 60 173
ID Description Score Start End Superfamily
af_A4HSE1_104_298_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9045 58 185 3.40.50.150
3dxzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8998 30 234 3.40.50.150
3dxzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8785 30 234 3.40.50.150
af_P9WFY9_38_258_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8752 24 233 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8732 58 137 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A166EXN6-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9799 37 233 GO:0008176
GO:0043527
AF-A0A1G6E0H6-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9773 36 234 GO:0008176
GO:0043527
AF-A0A1M3BV46-F1-model_v4 tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33) 0.9754 36 234 GO:0008176
GO:0043527
AF-A0A1E3W341-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9744 24 234 GO:0008176
GO:0043527
AF-A0A656Z2U6-F1-model_v4 tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33) 0.9743 16 234 GO:0008176
GO:0043527

Feature Viewer

pLDDT pTM Quality
87.75 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map