F489131
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1054 | 560 | 2108 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300041452|Ga0451793_0235356|Ga0451793_0235356_29_859 |
| Length | 276 |
| Sequence | MDGKVIVVTGALGALGRVVVDEALARRARIASVDHAPTQAPATADLFELGGVDLTDAAHARKAIDAAAAHFGKLDALINIAGGFAFETVADGDPRTWQRMYALNVMTALNASRAAIPHLISLGTGRIVNIGAMGALQAGSGMGAYAASKAGVHRLTEALAAELKGKITVNAVLPSVIDTAANRASMPKADFTKWVTPKELADVILFLANPFDQVIITIKFDIFEFCLVNFSDNIFIIRRDNLSAIIPINLITIIFRWIMGSRQNDACVALFIPNGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 88 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 179 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 189 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 212 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 244 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 245 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 246 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 247 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 248 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 249 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 250 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 334 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 337 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 338 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 339 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 342 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 343 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 344 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 345 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 346 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 347 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 348 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 349 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 350 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 351 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 352 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 353 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 354 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 355 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 356 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 357 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 391 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 393 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 397 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 402 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 403 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 404 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 405 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 408 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 409 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 410 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 411 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 412 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 413 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 414 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 415 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 416 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 418 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 419 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 422 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 423 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 424 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 425 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 426 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 427 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 428 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 429 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 432 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 433 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 434 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 437 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 438 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 439 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 440 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 441 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 442 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 443 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 444 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 445 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 446 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 447 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 448 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 449 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 450 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 451 | 2791355199 | |||
| 452 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 453 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 454 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 455 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 456 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 457 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 458 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 459 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 460 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 461 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 462 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 463 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 464 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 465 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 466 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 467 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 468 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 469 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 470 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 471 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 472 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 473 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 474 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 475 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 476 | 2904699407 | |||
| 477 | 2906610324 | |||
| 478 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 479 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 480 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 481 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 482 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 483 | 2922368715 | |||
| 484 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 485 | 2922425934 | |||
| 486 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 487 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 488 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 489 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 490 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 491 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 492 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 493 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 494 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 495 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 496 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 497 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 498 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 499 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 500 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 501 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 502 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 503 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 504 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 505 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 506 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 507 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 508 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 509 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 510 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 511 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 512 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 513 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 514 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 515 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 516 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 517 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 518 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 519 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 520 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 521 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 522 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 523 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 524 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 525 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 526 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 527 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 528 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 529 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 530 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 531 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 532 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 533 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 534 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 535 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 536 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 537 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 538 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 539 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 540 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 541 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 542 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 543 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 544 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 545 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 546 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 547 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 548 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 549 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 550 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 551 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 552 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 553 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 554 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 555 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 556 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 557 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 558 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 559 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 560 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.56 |
| Metatranscriptomes | 0 |
| Isolates | 11.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.82 |
| Nodule | 10.15 |
| Rhizoplane | 6.26 |
| Rhizosphere | 66.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451793_0235356 | 3300041452 | Bacteria | 1196 |
| 2 | JGI25406J46586_10000281 | 3300003203 | Bacteria | 22733 |
| 3 | JGI25165J46597_1007017 | 3300003214 | Bacteria | 1923 |
| 4 | rootL2_10100710 | 3300003322 | Bacteria | 2896 |
| 5 | JGI25404J52841_10011790 | 3300003659 | Bacteria | 1888 |
| 6 | JGI25404J52841_10012955 | 3300003659 | Bacteria | 1809 |
| 7 | JGI25404J52841_10031890 | 3300003659 | Bacteria | 1125 |
| 8 | Ga0055539_1003432 | 3300003752 | Bacteria | 2220 |
| 9 | Ga0055526_1019009 | 3300003771 | Bacteria | 2526 |
| 10 | Ga0065165_1053829 | 3300005262 | Bacteria | 1130 |
| 11 | Ga0070658_10034097 | 3300005327 | Bacteria | 4095 |
| 12 | Ga0070658_10203097 | 3300005327 | Bacteria | 1673 |
| 13 | Ga0070676_10029266 | 3300005328 | Bacteria | 3132 |
| 14 | Ga0070676_10281594 | 3300005328 | Bacteria | 1121 |
| 15 | Ga0070676_10622459 | 3300005328 | Bacteria | 781 |
| 16 | Ga0070683_100014826 | 3300005329 | Bacteria | 6832 |
| 17 | Ga0070683_100217859 | 3300005329 | Bacteria | 1814 |
| 18 | Ga0070690_100078908 | 3300005330 | Bacteria | 2152 |
| 19 | Ga0070670_100386448 | 3300005331 | Bacteria | 1234 |
| 20 | Ga0068869_100055860 | 3300005334 | Bacteria | 2878 |
| 21 | Ga0070680_100012011 | 3300005336 | Bacteria | 6719 |
| 22 | Ga0070680_100046708 | 3300005336 | Bacteria | 3524 |
| 23 | Ga0070680_100071792 | 3300005336 | Bacteria | 2845 |
| 24 | Ga0070680_100177524 | 3300005336 | Bacteria | 1793 |
| 25 | Ga0070682_100072086 | 3300005337 | Bacteria | 2213 |
| 26 | Ga0068868_100011517 | 3300005338 | Bacteria | 6441 |
| 27 | Ga0068868_100066951 | 3300005338 | Bacteria | 2857 |
| 28 | Ga0070660_100093459 | 3300005339 | Bacteria | 2375 |
| 29 | Ga0070691_10071785 | 3300005341 | Bacteria | 1681 |
| 30 | Ga0070687_100506183 | 3300005343 | Bacteria | 814 |
| 31 | Ga0070668_100130158 | 3300005347 | Bacteria | 2019 |
| 32 | Ga0070668_100142498 | 3300005347 | Bacteria | 1932 |
| 33 | Ga0070668_100156536 | 3300005347 | Bacteria | 1846 |
| 34 | Ga0070669_100152215 | 3300005353 | Bacteria | 1791 |
| 35 | Ga0070669_100687906 | 3300005353 | Bacteria | 863 |
| 36 | Ga0070671_100043116 | 3300005355 | Bacteria | 3750 |
| 37 | Ga0070674_100036986 | 3300005356 | Bacteria | 3281 |
| 38 | Ga0070674_100162383 | 3300005356 | Bacteria | 1696 |
| 39 | Ga0070674_100400321 | 3300005356 | Bacteria | 1122 |
| 40 | Ga0070673_100019014 | 3300005364 | Bacteria | 4927 |
| 41 | Ga0070673_100228435 | 3300005364 | Bacteria | 1614 |
| 42 | Ga0070688_100340574 | 3300005365 | Bacteria | 1095 |
| 43 | Ga0070659_100235810 | 3300005366 | Bacteria | 1513 |
| 44 | Ga0070667_100109172 | 3300005367 | Bacteria | 2397 |
| 45 | Ga0070709_10001094 | 3300005434 | Bacteria | 14950 |
| 46 | Ga0070709_10041110 | 3300005434 | Bacteria | 2847 |
| 47 | Ga0070709_10202089 | 3300005434 | Bacteria | 1408 |
| 48 | Ga0070714_100038308 | 3300005435 | Bacteria | 4030 |
| 49 | Ga0070714_100054442 | 3300005435 | Bacteria | 3418 |
| 50 | Ga0070714_100282881 | 3300005435 | Bacteria | 1542 |
| 51 | Ga0070713_100006735 | 3300005436 | Bacteria | 8003 |
| 52 | Ga0070710_10005972 | 3300005437 | Bacteria | 5815 |
| 53 | Ga0070710_10066910 | 3300005437 | Bacteria | 2061 |
| 54 | Ga0070701_10125942 | 3300005438 | Bacteria | 1450 |
| 55 | Ga0070711_100003469 | 3300005439 | Bacteria | 9192 |
| 56 | Ga0070711_100155291 | 3300005439 | Bacteria | 1729 |
| 57 | Ga0070711_100649662 | 3300005439 | Bacteria | 884 |
| 58 | Ga0070700_100241200 | 3300005441 | Bacteria | 1292 |
| 59 | Ga0070708_100302416 | 3300005445 | Bacteria | 1506 |
| 60 | Ga0070663_100030492 | 3300005455 | Bacteria | 3696 |
| 61 | Ga0070663_100069828 | 3300005455 | Bacteria | 2553 |
| 62 | Ga0070663_100101625 | 3300005455 | Bacteria | 2146 |
| 63 | Ga0070663_100112165 | 3300005455 | Bacteria | 2050 |
| 64 | Ga0070663_100167570 | 3300005455 | Bacteria | 1695 |
| 65 | Ga0070678_100017537 | 3300005456 | Bacteria | 4614 |
| 66 | Ga0070678_100039996 | 3300005456 | Bacteria | 3314 |
| 67 | Ga0070678_100056119 | 3300005456 | Bacteria | 2878 |
| 68 | Ga0070678_100102030 | 3300005456 | Bacteria | 2225 |
| 69 | Ga0070662_100020030 | 3300005457 | Bacteria | 4552 |
| 70 | Ga0070662_100157581 | 3300005457 | Bacteria | 1773 |
| 71 | Ga0070662_100448936 | 3300005457 | Bacteria | 1070 |
| 72 | Ga0070681_10113617 | 3300005458 | Bacteria | 2647 |
| 73 | Ga0070681_10163131 | 3300005458 | Bacteria | 2152 |
| 74 | Ga0070681_10241891 | 3300005458 | Bacteria | 1718 |
| 75 | Ga0068867_100032942 | 3300005459 | Bacteria | 3749 |
| 76 | Ga0068867_100232873 | 3300005459 | Bacteria | 1490 |
| 77 | Ga0070698_100035656 | 3300005471 | Bacteria | 5141 |
| 78 | Ga0070698_100278044 | 3300005471 | Bacteria | 1606 |
| 79 | Ga0070698_100378639 | 3300005471 | Bacteria | 1348 |
| 80 | Ga0070698_100505426 | 3300005471 | Bacteria | 1147 |
| 81 | Ga0070679_100016725 | 3300005530 | Bacteria | 7086 |
| 82 | Ga0070679_100044244 | 3300005530 | Bacteria | 4436 |
| 83 | Ga0070679_100044856 | 3300005530 | Bacteria | 4404 |
| 84 | Ga0070679_100059816 | 3300005530 | Bacteria | 3797 |
| 85 | Ga0070679_100081880 | 3300005530 | Bacteria | 3218 |
| 86 | Ga0070684_100016386 | 3300005535 | Bacteria | 6056 |
| 87 | Ga0070684_100092163 | 3300005535 | Bacteria | 2696 |
| 88 | Ga0070684_100318891 | 3300005535 | Bacteria | 1428 |
| 89 | Ga0070697_100102945 | 3300005536 | Bacteria | 2373 |
| 90 | Ga0068853_100032728 | 3300005539 | Bacteria | 4406 |
| 91 | Ga0068853_100063118 | 3300005539 | Bacteria | 3208 |
| 92 | Ga0068853_100067836 | 3300005539 | Bacteria | 3100 |
| 93 | Ga0068853_100201434 | 3300005539 | Bacteria | 1812 |
| 94 | Ga0068853_100332967 | 3300005539 | Bacteria | 1409 |
| 95 | Ga0068853_100398999 | 3300005539 | Bacteria | 1287 |
| 96 | Ga0068853_100441134 | 3300005539 | Bacteria | 1223 |
| 97 | Ga0068853_100777793 | 3300005539 | Bacteria | 916 |
| 98 | Ga0070672_100160902 | 3300005543 | Bacteria | 1862 |
| 99 | Ga0070672_100326124 | 3300005543 | Bacteria | 1306 |
| 100 | Ga0070686_100441382 | 3300005544 | Bacteria | 998 |
| 101 | Ga0070696_100065382 | 3300005546 | Bacteria | 2550 |
| 102 | Ga0070696_100171572 | 3300005546 | Bacteria | 1604 |
| 103 | Ga0070696_100394342 | 3300005546 | Bacteria | 1081 |
| 104 | Ga0070693_100078642 | 3300005547 | Bacteria | 1960 |
| 105 | Ga0070665_100070951 | 3300005548 | Bacteria | 3490 |
| 106 | Ga0070665_100074289 | 3300005548 | Bacteria | 3405 |
| 107 | Ga0070665_100437026 | 3300005548 | Bacteria | 1318 |
| 108 | Ga0070665_100599282 | 3300005548 | Bacteria | 1115 |
| 109 | Ga0068855_100047648 | 3300005563 | Bacteria | 5063 |
| 110 | Ga0068855_100068829 | 3300005563 | Bacteria | 4120 |
| 111 | Ga0068855_100117677 | 3300005563 | Bacteria | 3044 |
| 112 | Ga0068855_100142890 | 3300005563 | Bacteria | 2726 |
| 113 | Ga0068855_101150668 | 3300005563 | Bacteria | 809 |
| 114 | Ga0070664_100041691 | 3300005564 | Bacteria | 3873 |
| 115 | Ga0070664_100230507 | 3300005564 | Bacteria | 1660 |
| 116 | Ga0068857_100022401 | 3300005577 | Bacteria | 5558 |
| 117 | Ga0068857_100052978 | 3300005577 | Bacteria | 3600 |
| 118 | Ga0068857_100468771 | 3300005577 | Bacteria | 1179 |
| 119 | Ga0068854_100129113 | 3300005578 | Bacteria | 1928 |
| 120 | Ga0068854_100266046 | 3300005578 | Bacteria | 1374 |
| 121 | Ga0068854_100720510 | 3300005578 | Bacteria | 863 |
| 122 | Ga0068856_100000082 | 3300005614 | Bacteria | 88302 |
| 123 | Ga0068856_100338009 | 3300005614 | Bacteria | 1524 |
| 124 | Ga0068856_101395149 | 3300005614 | Unclassified | 715 |
| 125 | Ga0070702_100047672 | 3300005615 | Bacteria | 2435 |
| 126 | Ga0070702_100072831 | 3300005615 | Bacteria | 2034 |
| 127 | Ga0068852_100570361 | 3300005616 | Bacteria | 1134 |
| 128 | Ga0068859_100031018 | 3300005617 | Bacteria | 5365 |
| 129 | Ga0068859_100370837 | 3300005617 | Bacteria | 1527 |
| 130 | Ga0068859_100890985 | 3300005617 | Bacteria | 975 |
| 131 | Ga0068864_100023523 | 3300005618 | Bacteria | 5175 |
| 132 | Ga0068864_100414963 | 3300005618 | Bacteria | 1282 |
| 133 | Ga0068866_10023610 | 3300005718 | Bacteria | 2863 |
| 134 | Ga0068861_100024737 | 3300005719 | Bacteria | 4346 |
| 135 | Ga0068861_100057655 | 3300005719 | Bacteria | 2967 |
| 136 | Ga0068861_100158740 | 3300005719 | Bacteria | 1863 |
| 137 | Ga0068861_100539935 | 3300005719 | Bacteria | 1061 |
| 138 | Ga0068870_10316074 | 3300005840 | Bacteria | 991 |
| 139 | Ga0068863_100160927 | 3300005841 | Bacteria | 2151 |
| 140 | Ga0068863_100343320 | 3300005841 | Bacteria | 1453 |
| 141 | Ga0068858_100155923 | 3300005842 | Bacteria | 2148 |
| 142 | Ga0068858_100320225 | 3300005842 | Bacteria | 1482 |
| 143 | Ga0068858_100354559 | 3300005842 | Bacteria | 1405 |
| 144 | Ga0068860_100083701 | 3300005843 | Bacteria | 3034 |
| 145 | Ga0068862_100045299 | 3300005844 | Bacteria | 3753 |
| 146 | Ga0068862_100118586 | 3300005844 | Bacteria | 2330 |
| 147 | Ga0068862_100127591 | 3300005844 | Bacteria | 2247 |
| 148 | Ga0068862_100161087 | 3300005844 | Bacteria | 2002 |
| 149 | Ga0068862_100200622 | 3300005844 | Bacteria | 1798 |
| 150 | Ga0081455_10004092 | 3300005937 | Bacteria | 16511 |
| 151 | Ga0081455_10012714 | 3300005937 | Bacteria | 8376 |
| 152 | Ga0081455_10117859 | 3300005937 | Bacteria | 2098 |
| 153 | Ga0081538_10072145 | 3300005981 | Bacteria | 1895 |
| 154 | Ga0081540_1005571 | 3300005983 | Bacteria | 9379 |
| 155 | Ga0081540_1010961 | 3300005983 | Bacteria | 6088 |
| 156 | Ga0081540_1012602 | 3300005983 | Bacteria | 5551 |
| 157 | Ga0081540_1014018 | 3300005983 | Bacteria | 5170 |
| 158 | Ga0081540_1014599 | 3300005983 | Bacteria | 5021 |
| 159 | Ga0081539_10001902 | 3300005985 | Bacteria | 32363 |
| 160 | Ga0081539_10026944 | 3300005985 | Bacteria | 3652 |
| 161 | Ga0070717_10191195 | 3300006028 | Bacteria | 1789 |
| 162 | Ga0070717_10216381 | 3300006028 | Bacteria | 1683 |
| 163 | Ga0075365_10029868 | 3300006038 | Bacteria | 3487 |
| 164 | Ga0075365_10042134 | 3300006038 | Bacteria | 2983 |
| 165 | Ga0075365_10062393 | 3300006038 | Bacteria | 2493 |
| 166 | Ga0075365_10062403 | 3300006038 | Bacteria | 2492 |
| 167 | Ga0075365_10107272 | 3300006038 | Bacteria | 1917 |
| 168 | Ga0075365_10160278 | 3300006038 | Bacteria | 1567 |
| 169 | Ga0075368_10021445 | 3300006042 | Bacteria | 2454 |
| 170 | Ga0075368_10131470 | 3300006042 | Bacteria | 1040 |
| 171 | Ga0075363_100001764 | 3300006048 | Bacteria | 8449 |
| 172 | Ga0075363_100015088 | 3300006048 | Bacteria | 3789 |
| 173 | Ga0075363_100156860 | 3300006048 | Bacteria | 1287 |
| 174 | Ga0075364_10026005 | 3300006051 | Bacteria | 3730 |
| 175 | Ga0075364_10085792 | 3300006051 | Bacteria | 2085 |
| 176 | Ga0070716_100062303 | 3300006173 | Bacteria | 2162 |
| 177 | Ga0070712_100033812 | 3300006175 | Bacteria | 3461 |
| 178 | Ga0075367_10005871 | 3300006178 | Bacteria | 6153 |
| 179 | Ga0075367_10032643 | 3300006178 | Bacteria | 2997 |
| 180 | Ga0075367_10125533 | 3300006178 | Bacteria | 1584 |
| 181 | Ga0075367_10344107 | 3300006178 | Bacteria | 941 |
| 182 | Ga0075366_10031763 | 3300006195 | Bacteria | 3108 |
| 183 | Ga0097621_100020182 | 3300006237 | Bacteria | 5132 |
| 184 | Ga0097621_100610704 | 3300006237 | Bacteria | 998 |
| 185 | Ga0075370_10007760 | 3300006353 | Bacteria | 5480 |
| 186 | Ga0075370_10072391 | 3300006353 | Bacteria | 1973 |
| 187 | Ga0075370_10199653 | 3300006353 | Bacteria | 1179 |
| 188 | Ga0068871_100037995 | 3300006358 | Bacteria | 3842 |
| 189 | Ga0068871_100565354 | 3300006358 | Bacteria | 1031 |
| 190 | Ga0075434_100102162 | 3300006871 | Bacteria | 2875 |
| 191 | Ga0068865_100173591 | 3300006881 | Bacteria | 1654 |
| 192 | Ga0068865_100233342 | 3300006881 | Bacteria | 1445 |
| 193 | Ga0097620_100031020 | 3300006931 | Bacteria | 5365 |
| 194 | Ga0097620_100370862 | 3300006931 | Bacteria | 1527 |
| 195 | Ga0097620_100891085 | 3300006931 | Bacteria | 975 |
| 196 | Ga0099824_1005168 | 3300006942 | Bacteria | 18498 |
| 197 | Ga0099822_1000080 | 3300006943 | Bacteria | 54304 |
| 198 | Ga0075435_100072603 | 3300007076 | Bacteria | 2812 |
| 199 | Ga0099795_10163541 | 3300007788 | Bacteria | 920 |
| 200 | Ga0105240_10093070 | 3300009093 | Bacteria | 3680 |
| 201 | Ga0105240_10243455 | 3300009093 | Bacteria | 2084 |
| 202 | Ga0105240_10525410 | 3300009093 | Bacteria | 1313 |
| 203 | Ga0105245_10018466 | 3300009098 | Bacteria | 6098 |
| 204 | Ga0105245_10071926 | 3300009098 | Bacteria | 3141 |
| 205 | Ga0105245_10303800 | 3300009098 | Bacteria | 1566 |
| 206 | Ga0105245_10951911 | 3300009098 | Bacteria | 902 |
| 207 | Ga0105247_10060702 | 3300009101 | Bacteria | 2343 |
| 208 | Ga0114129_10261607 | 3300009147 | Bacteria | 2319 |
| 209 | Ga0105243_10065518 | 3300009148 | Bacteria | 2918 |
| 210 | Ga0105241_10018025 | 3300009174 | Bacteria | 5190 |
| 211 | Ga0105242_10182773 | 3300009176 | Bacteria | 1851 |
| 212 | Ga0105242_10341975 | 3300009176 | Bacteria | 1379 |
| 213 | Ga0105248_10296754 | 3300009177 | Bacteria | 1820 |
| 214 | Ga0105248_10344985 | 3300009177 | Bacteria | 1676 |
| 215 | Ga0105237_10133289 | 3300009545 | Bacteria | 2479 |
| 216 | Ga0105237_11267513 | 3300009545 | Bacteria | 743 |
| 217 | Ga0105238_10017099 | 3300009551 | Bacteria | 7361 |
| 218 | Ga0105249_10702698 | 3300009553 | Bacteria | 1071 |
| 219 | Ga0099796_10032206 | 3300010159 | Bacteria | 1716 |
| 220 | Ga0099796_10095278 | 3300010159 | Bacteria | 1112 |
| 221 | Ga0105239_10027964 | 3300010375 | Bacteria | 6205 |
| 222 | Ga0105239_10090869 | 3300010375 | Bacteria | 3368 |
| 223 | Ga0105239_10093008 | 3300010375 | Bacteria | 3329 |
| 224 | Ga0105239_10176226 | 3300010375 | Bacteria | 2391 |
| 225 | Ga0105239_10651824 | 3300010375 | Bacteria | 1203 |
| 226 | Ga0157370_10018597 | 3300013104 | Bacteria | 6986 |
| 227 | Ga0157370_10091789 | 3300013104 | Bacteria | 2851 |
| 228 | Ga0157369_10044499 | 3300013105 | Bacteria | 4831 |
| 229 | Ga0157374_10031099 | 3300013296 | Bacteria | 4849 |
| 230 | Ga0157378_10018819 | 3300013297 | Bacteria | 6071 |
| 231 | Ga0157378_10022108 | 3300013297 | Bacteria | 5597 |
| 232 | Ga0157378_10438479 | 3300013297 | Bacteria | 1294 |
| 233 | Ga0157378_10578532 | 3300013297 | Bacteria | 1132 |
| 234 | Ga0163162_10039037 | 3300013306 | Bacteria | 4741 |
| 235 | Ga0163162_10162176 | 3300013306 | Bacteria | 2357 |
| 236 | Ga0163162_10452762 | 3300013306 | Bacteria | 1415 |
| 237 | Ga0157372_10061947 | 3300013307 | Bacteria | 4190 |
| 238 | Ga0157375_10043448 | 3300013308 | Bacteria | 4359 |
| 239 | Ga0157375_10148469 | 3300013308 | Bacteria | 2477 |
| 240 | Ga0157375_10283665 | 3300013308 | Bacteria | 1819 |
| 241 | Ga0157375_10391438 | 3300013308 | Bacteria | 1557 |
| 242 | Ga0163163_10009474 | 3300014325 | Bacteria | 8696 |
| 243 | Ga0163163_10105290 | 3300014325 | Bacteria | 2847 |
| 244 | Ga0163163_10122280 | 3300014325 | Bacteria | 2637 |
| 245 | Ga0163163_10574400 | 3300014325 | Bacteria | 1190 |
| 246 | Ga0157380_10106002 | 3300014326 | Bacteria | 2351 |
| 247 | Ga0157380_10225124 | 3300014326 | Bacteria | 1681 |
| 248 | Ga0157380_10520571 | 3300014326 | Bacteria | 1160 |
| 249 | Ga0182008_10112772 | 3300014497 | Bacteria | 1348 |
| 250 | Ga0157379_10085055 | 3300014968 | Bacteria | 2834 |
| 251 | Ga0157379_10372137 | 3300014968 | Bacteria | 1310 |
| 252 | Ga0157379_10865535 | 3300014968 | Bacteria | 856 |
| 253 | Ga0157376_10156322 | 3300014969 | Bacteria | 2062 |
| 254 | Ga0157376_10190326 | 3300014969 | Bacteria | 1881 |
| 255 | Ga0163161_10308897 | 3300017792 | Bacteria | 1247 |
| 256 | Ga0209677_100235 | 3300025253 | Bacteria | 38918 |
| 257 | Ga0209677_104125 | 3300025253 | Bacteria | 4344 |
| 258 | Ga0209233_1000995 | 3300025261 | Bacteria | 12116 |
| 259 | Ga0209233_1020532 | 3300025261 | Bacteria | 1730 |
| 260 | Ga0209564_1000726 | 3300025295 | Bacteria | 47041 |
| 261 | Ga0209758_1000160 | 3300025297 | Bacteria | 154304 |
| 262 | Ga0209758_1005354 | 3300025297 | Bacteria | 9951 |
| 263 | Ga0207697_10236607 | 3300025315 | Bacteria | 807 |
| 264 | Ga0207692_10468357 | 3300025898 | Bacteria | 795 |
| 265 | Ga0207642_10015226 | 3300025899 | Bacteria | 2860 |
| 266 | Ga0207642_10046811 | 3300025899 | Bacteria | 1929 |
| 267 | Ga0207710_10051593 | 3300025900 | Bacteria | 1848 |
| 268 | Ga0207710_10062572 | 3300025900 | Bacteria | 1691 |
| 269 | Ga0207688_10025042 | 3300025901 | Bacteria | 3274 |
| 270 | Ga0207688_10205279 | 3300025901 | Bacteria | 1183 |
| 271 | Ga0207685_10193694 | 3300025905 | Bacteria | 950 |
| 272 | Ga0207699_10000199 | 3300025906 | Bacteria | 35901 |
| 273 | Ga0207699_10035185 | 3300025906 | Bacteria | 2848 |
| 274 | Ga0207645_10054536 | 3300025907 | Bacteria | 2553 |
| 275 | Ga0207645_10101239 | 3300025907 | Bacteria | 1859 |
| 276 | Ga0207643_10017275 | 3300025908 | Bacteria | 3944 |
| 277 | Ga0207643_10097662 | 3300025908 | Bacteria | 1719 |
| 278 | Ga0207643_10343751 | 3300025908 | Bacteria | 936 |
| 279 | Ga0207705_10117978 | 3300025909 | Bacteria | 1966 |
| 280 | Ga0207705_10230047 | 3300025909 | Bacteria | 1410 |
| 281 | Ga0207654_10288876 | 3300025911 | Bacteria | 1111 |
| 282 | Ga0207707_10019532 | 3300025912 | Bacteria | 5915 |
| 283 | Ga0207707_10038340 | 3300025912 | Bacteria | 4187 |
| 284 | Ga0207707_10081725 | 3300025912 | Bacteria | 2821 |
| 285 | Ga0207695_10128011 | 3300025913 | Bacteria | 2499 |
| 286 | Ga0207695_10558749 | 3300025913 | Bacteria | 1026 |
| 287 | Ga0207671_10028108 | 3300025914 | Bacteria | 4204 |
| 288 | Ga0207671_10145503 | 3300025914 | Bacteria | 1828 |
| 289 | Ga0207671_10692826 | 3300025914 | Bacteria | 810 |
| 290 | Ga0207693_10016309 | 3300025915 | Bacteria | 5940 |
| 291 | Ga0207693_10023034 | 3300025915 | Bacteria | 4946 |
| 292 | Ga0207663_10009125 | 3300025916 | Bacteria | 5229 |
| 293 | Ga0207663_10265882 | 3300025916 | Bacteria | 1268 |
| 294 | Ga0207663_10666147 | 3300025916 | Bacteria | 822 |
| 295 | Ga0207660_10024005 | 3300025917 | Bacteria | 4124 |
| 296 | Ga0207660_10076336 | 3300025917 | Bacteria | 2450 |
| 297 | Ga0207660_10240915 | 3300025917 | Bacteria | 1425 |
| 298 | Ga0207662_10420603 | 3300025918 | Bacteria | 909 |
| 299 | Ga0207662_10685968 | 3300025918 | Bacteria | 717 |
| 300 | Ga0207657_10107874 | 3300025919 | Bacteria | 2303 |
| 301 | Ga0207657_10313003 | 3300025919 | Bacteria | 1242 |
| 302 | Ga0207652_10009229 | 3300025921 | Bacteria | 7935 |
| 303 | Ga0207681_10122380 | 3300025923 | Bacteria | 1910 |
| 304 | Ga0207681_10787877 | 3300025923 | Bacteria | 794 |
| 305 | Ga0207694_10254868 | 3300025924 | Bacteria | 1436 |
| 306 | Ga0207650_10104033 | 3300025925 | Bacteria | 2190 |
| 307 | Ga0207687_10047676 | 3300025927 | Bacteria | 2971 |
| 308 | Ga0207687_10080533 | 3300025927 | Bacteria | 2351 |
| 309 | Ga0207700_10023396 | 3300025928 | Bacteria | 4259 |
| 310 | Ga0207700_10027500 | 3300025928 | Bacteria | 3984 |
| 311 | Ga0207664_10037833 | 3300025929 | Bacteria | 3737 |
| 312 | Ga0207664_10084718 | 3300025929 | Bacteria | 2586 |
| 313 | Ga0207664_10246443 | 3300025929 | Bacteria | 1558 |
| 314 | Ga0207644_10049291 | 3300025931 | Bacteria | 3014 |
| 315 | Ga0207690_10048975 | 3300025932 | Bacteria | 2814 |
| 316 | Ga0207690_10220619 | 3300025932 | Bacteria | 1450 |
| 317 | Ga0207706_10064081 | 3300025933 | Bacteria | 3236 |
| 318 | Ga0207706_10067934 | 3300025933 | Bacteria | 3137 |
| 319 | Ga0207706_10544844 | 3300025933 | Bacteria | 999 |
| 320 | Ga0207686_10358254 | 3300025934 | Bacteria | 1100 |
| 321 | Ga0207686_10681966 | 3300025934 | Bacteria | 815 |
| 322 | Ga0207709_10101125 | 3300025935 | Bacteria | 1906 |
| 323 | Ga0207669_10042690 | 3300025937 | Bacteria | 2649 |
| 324 | Ga0207669_10092936 | 3300025937 | Bacteria | 1969 |
| 325 | Ga0207704_10017791 | 3300025938 | Bacteria | 3695 |
| 326 | Ga0207704_10223241 | 3300025938 | Bacteria | 1396 |
| 327 | Ga0207665_10048262 | 3300025939 | Bacteria | 2857 |
| 328 | Ga0207691_10144219 | 3300025940 | Bacteria | 2097 |
| 329 | Ga0207691_10184406 | 3300025940 | Bacteria | 1822 |
| 330 | Ga0207711_10006349 | 3300025941 | Bacteria | 9970 |
| 331 | Ga0207711_10264243 | 3300025941 | Bacteria | 1582 |
| 332 | Ga0207711_10300140 | 3300025941 | Bacteria | 1481 |
| 333 | Ga0207689_10034390 | 3300025942 | Bacteria | 4210 |
| 334 | Ga0207689_10040742 | 3300025942 | Bacteria | 3844 |
| 335 | Ga0207689_10072682 | 3300025942 | Bacteria | 2825 |
| 336 | Ga0207661_10000410 | 3300025944 | Bacteria | 27651 |
| 337 | Ga0207661_10025556 | 3300025944 | Bacteria | 4490 |
| 338 | Ga0207661_10128801 | 3300025944 | Bacteria | 2165 |
| 339 | Ga0207661_10191029 | 3300025944 | Bacteria | 1795 |
| 340 | Ga0207679_10105971 | 3300025945 | Bacteria | 2209 |
| 341 | Ga0207679_10198426 | 3300025945 | Bacteria | 1675 |
| 342 | Ga0207679_10753129 | 3300025945 | Bacteria | 886 |
| 343 | Ga0207667_10015305 | 3300025949 | Bacteria | 8721 |
| 344 | Ga0207667_10340335 | 3300025949 | Bacteria | 1531 |
| 345 | Ga0207667_10351614 | 3300025949 | Bacteria | 1503 |
| 346 | Ga0207651_10005957 | 3300025960 | Bacteria | 6316 |
| 347 | Ga0207712_10785744 | 3300025961 | Bacteria | 836 |
| 348 | Ga0207668_10073885 | 3300025972 | Bacteria | 2445 |
| 349 | Ga0207668_10158561 | 3300025972 | Bacteria | 1760 |
| 350 | Ga0207668_10849036 | 3300025972 | Bacteria | 810 |
| 351 | Ga0207640_10060990 | 3300025981 | Bacteria | 2496 |
| 352 | Ga0207640_10079134 | 3300025981 | Bacteria | 2240 |
| 353 | Ga0207640_10409990 | 3300025981 | Bacteria | 1106 |
| 354 | Ga0207677_10138631 | 3300026023 | Bacteria | 1859 |
| 355 | Ga0207703_10147225 | 3300026035 | Bacteria | 2050 |
| 356 | Ga0207703_10255233 | 3300026035 | Bacteria | 1582 |
| 357 | Ga0207703_10525752 | 3300026035 | Bacteria | 1113 |
| 358 | Ga0207703_10961539 | 3300026035 | Bacteria | 819 |
| 359 | Ga0207639_10056395 | 3300026041 | Bacteria | 3011 |
| 360 | Ga0207639_10165950 | 3300026041 | Bacteria | 1865 |
| 361 | Ga0207639_10233761 | 3300026041 | Bacteria | 1595 |
| 362 | Ga0207639_10308612 | 3300026041 | Bacteria | 1401 |
| 363 | Ga0207678_10010615 | 3300026067 | Bacteria | 8092 |
| 364 | Ga0207678_10022267 | 3300026067 | Bacteria | 5551 |
| 365 | Ga0207678_10025488 | 3300026067 | Bacteria | 5162 |
| 366 | Ga0207678_10041263 | 3300026067 | Bacteria | 4001 |
| 367 | Ga0207678_10084343 | 3300026067 | Bacteria | 2717 |
| 368 | Ga0207678_10180874 | 3300026067 | Bacteria | 1801 |
| 369 | Ga0207702_10000048 | 3300026078 | Bacteria | 143125 |
| 370 | Ga0207702_10363745 | 3300026078 | Bacteria | 1387 |
| 371 | Ga0207702_11191953 | 3300026078 | Bacteria | 756 |
| 372 | Ga0207641_10114216 | 3300026088 | Bacteria | 2399 |
| 373 | Ga0207641_10114252 | 3300026088 | Bacteria | 2399 |
| 374 | Ga0207648_10316048 | 3300026089 | Bacteria | 1403 |
| 375 | Ga0207648_10369199 | 3300026089 | Bacteria | 1296 |
| 376 | Ga0207676_10017087 | 3300026095 | Bacteria | 5256 |
| 377 | Ga0207676_10520449 | 3300026095 | Bacteria | 1132 |
| 378 | Ga0207674_10019872 | 3300026116 | Bacteria | 7268 |
| 379 | Ga0207674_10022445 | 3300026116 | Bacteria | 6776 |
| 380 | Ga0207674_10279311 | 3300026116 | Bacteria | 1618 |
| 381 | Ga0207675_100317319 | 3300026118 | Bacteria | 1521 |
| 382 | Ga0207683_10023706 | 3300026121 | Bacteria | 5280 |
| 383 | Ga0207683_10047585 | 3300026121 | Bacteria | 3756 |
| 384 | Ga0207683_10048826 | 3300026121 | Bacteria | 3704 |
| 385 | Ga0207683_10078139 | 3300026121 | Bacteria | 2932 |
| 386 | Ga0207683_10524295 | 3300026121 | Bacteria | 1095 |
| 387 | Ga0207698_10434428 | 3300026142 | Bacteria | 1263 |
| 388 | Ga0207698_11267866 | 3300026142 | Unclassified | 751 |
| 389 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 390 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 391 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 392 | Ga0209700_100062 | 3300027363 | Bacteria | 145471 |
| 393 | Ga0209179_1005091 | 3300027512 | Bacteria | 2032 |
| 394 | Ga0209179_1051653 | 3300027512 | Bacteria | 882 |
| 395 | Ga0209588_1003456 | 3300027671 | Bacteria | 4384 |
| 396 | Ga0209813_10037989 | 3300027866 | Bacteria | 1453 |
| 397 | Ga0207428_10078431 | 3300027907 | Bacteria | 2584 |
| 398 | Ga0268266_10003304 | 3300028379 | Bacteria | 16206 |
| 399 | Ga0268266_10015514 | 3300028379 | Bacteria | 6535 |
| 400 | Ga0268266_10024812 | 3300028379 | Bacteria | 5101 |
| 401 | Ga0268266_10333285 | 3300028379 | Bacteria | 1422 |
| 402 | Ga0268266_10514402 | 3300028379 | Bacteria | 1144 |
| 403 | Ga0268266_10567827 | 3300028379 | Bacteria | 1088 |
| 404 | Ga0268266_10861559 | 3300028379 | Bacteria | 876 |
| 405 | Ga0268265_10029396 | 3300028380 | Bacteria | 3943 |
| 406 | Ga0268265_10063199 | 3300028380 | Bacteria | 2847 |
| 407 | Ga0268265_10082635 | 3300028380 | Bacteria | 2540 |
| 408 | Ga0268265_11140196 | 3300028380 | Bacteria | 775 |
| 409 | Ga0268265_11155322 | 3300028380 | Bacteria | 770 |
| 410 | Ga0268264_10029978 | 3300028381 | Bacteria | 4460 |
| 411 | Ga0268264_10057650 | 3300028381 | Bacteria | 3249 |
| 412 | Ga0265334_10047826 | 3300028573 | Bacteria | 1649 |
| 413 | Ga0307517_10000063 | 3300028786 | Bacteria | 144304 |
| 414 | Ga0307517_10161062 | 3300028786 | Bacteria | 1506 |
| 415 | Ga0265330_10010793 | 3300031235 | Bacteria | 4297 |
| 416 | Ga0265330_10030179 | 3300031235 | Bacteria | 2436 |
| 417 | Ga0265332_10052081 | 3300031238 | Bacteria | 1758 |
| 418 | Ga0265340_10109416 | 3300031247 | Bacteria | 1278 |
| 419 | Ga0265339_10007926 | 3300031249 | Bacteria | 6812 |
| 420 | Ga0265316_10139532 | 3300031344 | Bacteria | 1822 |
| 421 | Ga0307509_10106942 | 3300031507 | Bacteria | 2815 |
| 422 | Ga0307509_10162838 | 3300031507 | Bacteria | 2124 |
| 423 | Ga0307509_10615197 | 3300031507 | Bacteria | 758 |
| 424 | Ga0307509_10627582 | 3300031507 | Bacteria | 745 |
| 425 | Ga0307408_100283910 | 3300031548 | Bacteria | 1380 |
| 426 | Ga0307508_10086949 | 3300031616 | Bacteria | 2710 |
| 427 | Ga0307508_10110140 | 3300031616 | Bacteria | 2353 |
| 428 | Ga0307508_10233330 | 3300031616 | Bacteria | 1438 |
| 429 | Ga0265314_10015169 | 3300031711 | Bacteria | 6124 |
| 430 | Ga0265314_10141546 | 3300031711 | Bacteria | 1486 |
| 431 | Ga0265342_10219401 | 3300031712 | Bacteria | 1025 |
| 432 | Ga0307516_10019305 | 3300031730 | Bacteria | 7061 |
| 433 | Ga0307516_10050530 | 3300031730 | Bacteria | 4079 |
| 434 | Ga0307516_10073859 | 3300031730 | Bacteria | 3267 |
| 435 | Ga0307405_10220116 | 3300031731 | Bacteria | 1392 |
| 436 | Ga0307413_10229827 | 3300031824 | Bacteria | 1361 |
| 437 | Ga0307406_10056391 | 3300031901 | Bacteria | 2516 |
| 438 | Ga0307406_10222367 | 3300031901 | Bacteria | 1404 |
| 439 | Ga0307407_10448484 | 3300031903 | Bacteria | 936 |
| 440 | Ga0307412_10372253 | 3300031911 | Bacteria | 1154 |
| 441 | Ga0307409_100101210 | 3300031995 | Bacteria | 2390 |
| 442 | Ga0307416_100315508 | 3300032002 | Bacteria | 1562 |
| 443 | Ga0307414_10170181 | 3300032004 | Bacteria | 1741 |
| 444 | Ga0307415_100327322 | 3300032126 | Bacteria | 1280 |
| 445 | Ga0307507_10013500 | 3300033179 | Bacteria | 9906 |
| 446 | Ga0307510_10040869 | 3300033180 | Bacteria | 5081 |
| 447 | Ga0307510_10075468 | 3300033180 | Bacteria | 3323 |
| 448 | Ga0307510_10324839 | 3300033180 | Bacteria | 995 |
| 449 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 450 | Ga0373958_0030497 | 3300034819 | Bacteria | 1055 |
| 451 | Ga0373926_0132285 | 3300035083 | Bacteria | 945 |
| 452 | Ga0373926_0139788 | 3300035083 | Bacteria | 919 |
| 453 | Ga0373926_0195676 | 3300035083 | Bacteria | 777 |
| 454 | Ga0373934_0001166 | 3300035086 | Bacteria | 9586 |
| 455 | Ga0373934_0176385 | 3300035086 | Bacteria | 878 |
| 456 | Ga0373951_0047078 | 3300035091 | Bacteria | 1053 |
| 457 | Ga0373923_0026919 | 3300035111 | Bacteria | 2290 |
| 458 | Ga0373936_0007632 | 3300035113 | Bacteria | 4064 |
| 459 | Ga0373936_0069315 | 3300035113 | Bacteria | 1451 |
| 460 | Ga0373936_0085233 | 3300035113 | Bacteria | 1319 |
| 461 | Ga0373936_0277909 | 3300035113 | Bacteria | 752 |
| 462 | Ga0373941_0152650 | 3300035115 | Bacteria | 849 |
| 463 | Ga0373945_0032863 | 3300035116 | Bacteria | 1840 |
| 464 | Ga0373953_0002003 | 3300035117 | Bacteria | 6055 |
| 465 | Ga0373954_0134417 | 3300035118 | Bacteria | 1205 |
| 466 | Ga0373956_0100820 | 3300035119 | Bacteria | 1339 |
| 467 | Ga0373957_0004654 | 3300035120 | Bacteria | 4192 |
| 468 | Ga0373943_0005215 | 3300035170 | Bacteria | 5851 |
| 469 | Ga0373943_0036263 | 3300035170 | Bacteria | 2361 |
| 470 | Ga0373946_0004563 | 3300035171 | Bacteria | 4963 |
| 471 | Ga0373946_0025755 | 3300035171 | Bacteria | 2315 |
| 472 | Ga0373955_0053270 | 3300035172 | Bacteria | 2209 |
| 473 | Ga0373955_0061404 | 3300035172 | Bacteria | 2075 |
| 474 | Ga0373955_0091553 | 3300035172 | Bacteria | 1733 |
| 475 | Ga0373924_0033654 | 3300035410 | Bacteria | 2070 |
| 476 | Ga0373924_0125478 | 3300035410 | Bacteria | 1115 |
| 477 | Ga0373931_0024745 | 3300035691 | Bacteria | 3044 |
| 478 | Ga0373935_0000701 | 3300035692 | Bacteria | 17791 |
| 479 | Ga0373935_0056886 | 3300035692 | Bacteria | 2494 |
| 480 | Ga0373927_0001744 | 3300035695 | Bacteria | 16246 |
| 481 | Ga0373927_0013460 | 3300035695 | Bacteria | 5436 |
| 482 | Ga0373927_0028227 | 3300035695 | Bacteria | 3660 |
| 483 | Ga0373927_0028864 | 3300035695 | Bacteria | 3617 |
| 484 | Ga0373927_0098205 | 3300035695 | Bacteria | 1904 |
| 485 | Ga0373933_0000041 | 3300035724 | Bacteria | 79805 |
| 486 | Ga0373933_0105782 | 3300035724 | Bacteria | 1750 |
| 487 | Ga0373947_0001365 | 3300035725 | Bacteria | 15008 |
| 488 | Ga0373947_0054174 | 3300035725 | Bacteria | 2420 |
| 489 | Ga0373947_0229269 | 3300035725 | Bacteria | 1223 |
| 490 | Ga0373937_0573607 | 3300036401 | Bacteria | 1071 |
| 491 | Ga0373937_0704617 | 3300036401 | Bacteria | 956 |
| 492 | Ga0373925_0008661 | 3300037068 | Bacteria | 7413 |
| 493 | Ga0373925_0032651 | 3300037068 | Bacteria | 3832 |
| 494 | Ga0373925_0126787 | 3300037068 | Bacteria | 1987 |
| 495 | Ga0395900_0143381 | 3300037418 | Bacteria | 2445 |
| 496 | Ga0395900_0266835 | 3300037418 | Bacteria | 1708 |
| 497 | Ga0395900_0616266 | 3300037418 | Bacteria | 1024 |
| 498 | Ga0395898_0136484 | 3300037466 | Bacteria | 2349 |
| 499 | Ga0395898_0389878 | 3300037466 | Bacteria | 1328 |
| 500 | Ga0395905_0173504 | 3300037471 | Bacteria | 2025 |
| 501 | Ga0395905_0369813 | 3300037471 | Bacteria | 1327 |
| 502 | Ga0395905_0471486 | 3300037471 | Bacteria | 1154 |
| 503 | Ga0436364_0836743 | 3300037853 | Bacteria | 3191 |
| 504 | Ga0395901_0155243 | 3300038443 | Bacteria | 2404 |
| 505 | Ga0436365_0096789 | 3300039437 | Bacteria | 2085 |
| 506 | Ga0436365_0662753 | 3300039437 | Bacteria | 1413 |
| 507 | Ga0436365_1159716 | 3300039437 | Bacteria | 1234 |
| 508 | Ga0436361_0041213 | 3300039447 | Bacteria | 3329 |
| 509 | Ga0436361_0782414 | 3300039447 | Bacteria | 1087 |
| 510 | Ga0436363_0979421 | 3300039450 | Bacteria | 871 |
| 511 | Ga0439465_0012175 | 3300041413 | Bacteria | 2693 |
| 512 | Ga0439459_0035459 | 3300042438 | Bacteria | 1037 |
| 513 | Ga0466969_0019057 | 3300044656 | Bacteria | 3570 |
| 514 | Ga0466966_0009411 | 3300044684 | Bacteria | 6469 |
| 515 | Ga0466961_0000013 | 3300044693 | Bacteria | 129640 |
| 516 | Ga0466964_0013303 | 3300044706 | Bacteria | 3122 |
| 517 | Ga0466971_0352587 | 3300044719 | Bacteria | 712 |
| 518 | Ga0466957_0066743 | 3300044842 | Bacteria | 2219 |
| 519 | Ga0466959_0037538 | 3300045049 | Bacteria | 3580 |
| 520 | Ga0466959_0287224 | 3300045049 | Bacteria | 1128 |
| 521 | Ga0466959_0344220 | 3300045049 | Bacteria | 1017 |
| 522 | Ga0466967_0106792 | 3300045976 | Bacteria | 2567 |
| 523 | Ga0495617_027351 | 3300046452 | Bacteria | 1919 |
| 524 | Ga0495617_029754 | 3300046452 | Bacteria | 1836 |
| 525 | Ga0495592_0068197 | 3300046454 | Bacteria | 2597 |
| 526 | Ga0495592_0170014 | 3300046454 | Bacteria | 1493 |
| 527 | Ga0495603_0000624 | 3300046455 | Bacteria | 19835 |
| 528 | Ga0495603_0029062 | 3300046455 | Bacteria | 3335 |
| 529 | Ga0495603_0064252 | 3300046455 | Bacteria | 2164 |
| 530 | Ga0495603_0066178 | 3300046455 | Bacteria | 2128 |
| 531 | Ga0495603_0152389 | 3300046455 | Bacteria | 1342 |
| 532 | Ga0495603_0237835 | 3300046455 | Bacteria | 1049 |
| 533 | Ga0495590_0028370 | 3300046457 | Bacteria | 1963 |
| 534 | Ga0495629_0001961 | 3300046459 | Bacteria | 16039 |
| 535 | Ga0495629_0074044 | 3300046459 | Bacteria | 2378 |
| 536 | Ga0495638_0015380 | 3300046460 | Bacteria | 5140 |
| 537 | Ga0495638_0150085 | 3300046460 | Bacteria | 1352 |
| 538 | Ga0495638_0340774 | 3300046460 | Bacteria | 794 |
| 539 | Ga0495641_0006064 | 3300046461 | Bacteria | 7944 |
| 540 | Ga0495641_0165710 | 3300046461 | Bacteria | 989 |
| 541 | Ga0495651_0058334 | 3300046462 | Bacteria | 2962 |
| 542 | Ga0495653_0000923 | 3300046463 | Bacteria | 22739 |
| 543 | Ga0495653_0187748 | 3300046463 | Bacteria | 1413 |
| 544 | Ga0495650_0034101 | 3300046471 | Bacteria | 2258 |
| 545 | Ga0495580_0008876 | 3300046472 | Bacteria | 7954 |
| 546 | Ga0495580_0009752 | 3300046472 | Bacteria | 7530 |
| 547 | Ga0495580_0229468 | 3300046472 | Bacteria | 1275 |
| 548 | Ga0495582_0000775 | 3300046473 | Bacteria | 17677 |
| 549 | Ga0495582_0036864 | 3300046473 | Bacteria | 2690 |
| 550 | Ga0495582_0085950 | 3300046473 | Bacteria | 1750 |
| 551 | Ga0495605_0056198 | 3300046474 | Bacteria | 1899 |
| 552 | Ga0495639_0000335 | 3300046475 | Bacteria | 22677 |
| 553 | Ga0495639_0026945 | 3300046475 | Bacteria | 2543 |
| 554 | Ga0495639_0038033 | 3300046475 | Bacteria | 2159 |
| 555 | Ga0495639_0043792 | 3300046475 | Bacteria | 2022 |
| 556 | Ga0495662_0000156 | 3300046476 | Bacteria | 26864 |
| 557 | Ga0495664_0003259 | 3300046477 | Bacteria | 8817 |
| 558 | Ga0495664_0195948 | 3300046477 | Bacteria | 1224 |
| 559 | Ga0495664_0199197 | 3300046477 | Bacteria | 1214 |
| 560 | Ga0495664_0216296 | 3300046477 | Bacteria | 1160 |
| 561 | Ga0495584_0044162 | 3300046491 | Bacteria | 2249 |
| 562 | Ga0495584_0143214 | 3300046491 | Bacteria | 1214 |
| 563 | Ga0495585_0069111 | 3300046492 | Bacteria | 1928 |
| 564 | Ga0495596_0163275 | 3300046500 | Bacteria | 866 |
| 565 | Ga0495596_0214691 | 3300046500 | Bacteria | 747 |
| 566 | Ga0495583_0197315 | 3300046506 | Bacteria | 819 |
| 567 | Ga0495606_0011399 | 3300046507 | Bacteria | 7254 |
| 568 | Ga0495616_0095266 | 3300046513 | Bacteria | 1403 |
| 569 | Ga0495616_0102082 | 3300046513 | Bacteria | 1344 |
| 570 | Ga0495618_0107432 | 3300046514 | Bacteria | 1787 |
| 571 | Ga0495628_0058246 | 3300046516 | Bacteria | 3036 |
| 572 | Ga0495628_0088877 | 3300046516 | Bacteria | 2394 |
| 573 | Ga0495630_0011736 | 3300046517 | Bacteria | 6349 |
| 574 | Ga0495630_0014880 | 3300046517 | Bacteria | 5674 |
| 575 | Ga0495631_0091415 | 3300046518 | Bacteria | 1310 |
| 576 | Ga0495632_0016800 | 3300046519 | Bacteria | 4058 |
| 577 | Ga0495632_0030062 | 3300046519 | Bacteria | 2823 |
| 578 | Ga0495632_0100694 | 3300046519 | Bacteria | 1362 |
| 579 | Ga0495632_0112541 | 3300046519 | Bacteria | 1277 |
| 580 | Ga0495637_0122108 | 3300046520 | Bacteria | 1001 |
| 581 | Ga0495644_0032075 | 3300046523 | Bacteria | 1985 |
| 582 | Ga0495644_0039460 | 3300046523 | Bacteria | 1780 |
| 583 | Ga0495648_0006521 | 3300046524 | Bacteria | 9507 |
| 584 | Ga0495663_0116283 | 3300046525 | Bacteria | 892 |
| 585 | Ga0495652_0043386 | 3300046529 | Bacteria | 3874 |
| 586 | Ga0495665_0000188 | 3300046531 | Bacteria | 31814 |
| 587 | Ga0495665_0012665 | 3300046531 | Bacteria | 4566 |
| 588 | Ga0495665_0177373 | 3300046531 | Bacteria | 1108 |
| 589 | Ga0495640_0002363 | 3300046533 | Bacteria | 15117 |
| 590 | Ga0495640_0013618 | 3300046533 | Bacteria | 6181 |
| 591 | Ga0495587_0075689 | 3300046536 | Bacteria | 1954 |
| 592 | Ga0495598_0009463 | 3300046537 | Bacteria | 2304 |
| 593 | Ga0495609_0033652 | 3300046538 | Bacteria | 2326 |
| 594 | Ga0495645_0153497 | 3300046543 | Bacteria | 1598 |
| 595 | Ga0495645_0182982 | 3300046543 | Bacteria | 1434 |
| 596 | Ga0495622_0013179 | 3300046557 | Bacteria | 3837 |
| 597 | Ga0495622_0033574 | 3300046557 | Bacteria | 2394 |
| 598 | Ga0495633_0016407 | 3300046558 | Bacteria | 3818 |
| 599 | Ga0495633_0248531 | 3300046558 | Bacteria | 812 |
| 600 | Ga0495667_0157075 | 3300046559 | Bacteria | 1463 |
| 601 | Ga0495667_0210438 | 3300046559 | Bacteria | 1243 |
| 602 | Ga0495668_0195365 | 3300046616 | Bacteria | 1108 |
| 603 | Ga0495668_0252894 | 3300046616 | Bacteria | 964 |
| 604 | Ga0495668_0276334 | 3300046616 | Bacteria | 920 |
| 605 | Ga0495634_0001338 | 3300046642 | Bacteria | 22465 |
| 606 | Ga0495634_0015371 | 3300046642 | Bacteria | 5502 |
| 607 | Ga0495634_0021255 | 3300046642 | Bacteria | 4590 |
| 608 | Ga0495611_0024186 | 3300046648 | Bacteria | 2641 |
| 609 | Ga0495625_0104026 | 3300046660 | Bacteria | 1947 |
| 610 | Ga0495635_0000187 | 3300046663 | Bacteria | 39002 |
| 611 | Ga0495635_0001384 | 3300046663 | Bacteria | 16177 |
| 612 | Ga0495635_0197970 | 3300046663 | Bacteria | 1363 |
| 613 | Ga0495659_0070319 | 3300046664 | Bacteria | 1310 |
| 614 | Ga0495659_0175657 | 3300046664 | Bacteria | 870 |
| 615 | Ga0495588_0012064 | 3300046674 | Bacteria | 4074 |
| 616 | Ga0495588_0014997 | 3300046674 | Bacteria | 3721 |
| 617 | Ga0495657_0119348 | 3300046675 | Bacteria | 1662 |
| 618 | Ga0495599_0012037 | 3300046678 | Bacteria | 5323 |
| 619 | Ga0495599_0137758 | 3300046678 | Bacteria | 1515 |
| 620 | Ga0495599_0148478 | 3300046678 | Bacteria | 1453 |
| 621 | Ga0495623_0021813 | 3300046679 | Bacteria | 4136 |
| 622 | Ga0495646_0005072 | 3300046680 | Bacteria | 8301 |
| 623 | Ga0495646_0071011 | 3300046680 | Bacteria | 2049 |
| 624 | Ga0495647_0006159 | 3300046681 | Bacteria | 3959 |
| 625 | Ga0495658_0000047 | 3300046683 | Bacteria | 59626 |
| 626 | Ga0495658_0005621 | 3300046683 | Bacteria | 6158 |
| 627 | Ga0495658_0011386 | 3300046683 | Bacteria | 4472 |
| 628 | Ga0495658_0323468 | 3300046683 | Bacteria | 978 |
| 629 | Ga0495669_0009623 | 3300046684 | Bacteria | 4078 |
| 630 | Ga0495669_0113868 | 3300046684 | Bacteria | 1264 |
| 631 | Ga0495613_0001031 | 3300046689 | Bacteria | 21255 |
| 632 | Ga0495613_0058593 | 3300046689 | Bacteria | 2826 |
| 633 | Ga0495624_0001259 | 3300046690 | Bacteria | 20006 |
| 634 | Ga0495670_0036547 | 3300046691 | Bacteria | 2447 |
| 635 | Ga0495670_0122196 | 3300046691 | Bacteria | 1353 |
| 636 | Ga0495671_0040521 | 3300046692 | Bacteria | 2349 |
| 637 | Ga0495649_0086014 | 3300046694 | Bacteria | 1678 |
| 638 | Ga0495649_0175238 | 3300046694 | Bacteria | 1121 |
| 639 | Ga0495589_0054129 | 3300046794 | Bacteria | 1979 |
| 640 | Ga0495581_0000563 | 3300047315 | Bacteria | 19241 |
| 641 | Ga0495581_0129449 | 3300047315 | Bacteria | 1471 |
| 642 | Ga0495581_0196069 | 3300047315 | Bacteria | 1181 |
| 643 | Ga0495604_0480924 | 3300047317 | Bacteria | 808 |
| 644 | Ga0495636_0122570 | 3300047318 | Bacteria | 1151 |
| 645 | Ga0495674_0022065 | 3300047319 | Bacteria | 5876 |
| 646 | Ga0495672_0016664 | 3300047320 | Bacteria | 4940 |
| 647 | Ga0495672_0101595 | 3300047320 | Bacteria | 1558 |
| 648 | Ga0495676_0060717 | 3300047321 | Bacteria | 2961 |
| 649 | Ga0495680_0085997 | 3300047322 | Bacteria | 2367 |
| 650 | Ga0495680_0568716 | 3300047322 | Bacteria | 762 |
| 651 | Ga0495683_0198201 | 3300047323 | Bacteria | 907 |
| 652 | Ga0495675_0074231 | 3300047444 | Bacteria | 2143 |
| 653 | Ga0495679_037119 | 3300047446 | Bacteria | 1535 |
| 654 | Ga0495685_065734 | 3300047447 | Bacteria | 1219 |
| 655 | Ga0495673_0110579 | 3300047469 | Bacteria | 1099 |
| 656 | Ga0495673_0142622 | 3300047469 | Bacteria | 933 |
| 657 | Ga0495684_0000325 | 3300047471 | Bacteria | 38298 |
| 658 | Ga0495684_0008519 | 3300047471 | Bacteria | 7942 |
| 659 | Ga0495684_0015183 | 3300047471 | Bacteria | 5931 |
| 660 | Ga0495686_0339526 | 3300047472 | Bacteria | 819 |
| 661 | Ga0495593_0026036 | 3300047673 | Bacteria | 3233 |
| 662 | Ga0495593_0038357 | 3300047673 | Bacteria | 2588 |
| 663 | Ga0495593_0251744 | 3300047673 | Bacteria | 884 |
| 664 | Ga0495602_0080234 | 3300048088 | Bacteria | 2749 |
| 665 | Ga0495626_0099927 | 3300048091 | Bacteria | 1266 |
| 666 | Ga0496100_0018892 | 3300048903 | Bacteria | 4101 |
| 667 | Ga0496100_0028609 | 3300048903 | Bacteria | 3439 |
| 668 | Ga0496100_0034263 | 3300048903 | Bacteria | 3185 |
| 669 | Ga0496100_0538469 | 3300048903 | Bacteria | 902 |
| 670 | Ga0496100_0547677 | 3300048903 | Bacteria | 895 |
| 671 | Ga0496100_0633153 | 3300048903 | Bacteria | 832 |
| 672 | Ga0496100_0799190 | 3300048903 | Bacteria | 739 |
| 673 | Ga0496100_0803515 | 3300048903 | Bacteria | 737 |
| 674 | Ga0496101_0173721 | 3300048904 | Bacteria | 1656 |
| 675 | Ga0496102_0028102 | 3300048905 | Bacteria | 5026 |
| 676 | Ga0496102_0070673 | 3300048905 | Bacteria | 3205 |
| 677 | Ga0496102_0181731 | 3300048905 | Bacteria | 1982 |
| 678 | Ga0496102_0438232 | 3300048905 | Bacteria | 1226 |
| 679 | Ga0496102_0552285 | 3300048905 | Bacteria | 1074 |
| 680 | Ga0496103_0048099 | 3300048906 | Bacteria | 2635 |
| 681 | Ga0496103_0075363 | 3300048906 | Bacteria | 2116 |
| 682 | Ga0496104_0016385 | 3300048907 | Bacteria | 6732 |
| 683 | Ga0496104_0017531 | 3300048907 | Bacteria | 6524 |
| 684 | Ga0496104_0127394 | 3300048907 | Bacteria | 2445 |
| 685 | Ga0496104_0205684 | 3300048907 | Bacteria | 1880 |
| 686 | Ga0496105_0013867 | 3300048908 | Bacteria | 6402 |
| 687 | Ga0496105_0048964 | 3300048908 | Bacteria | 3488 |
| 688 | Ga0496105_0065179 | 3300048908 | Bacteria | 3007 |
| 689 | Ga0496105_0428296 | 3300048908 | Bacteria | 1047 |
| 690 | Ga0496106_0010647 | 3300048909 | Bacteria | 6795 |
| 691 | Ga0496106_0045059 | 3300048909 | Bacteria | 3312 |
| 692 | Ga0496106_0097357 | 3300048909 | Bacteria | 2278 |
| 693 | Ga0496106_0150111 | 3300048909 | Bacteria | 1838 |
| 694 | Ga0496106_0201806 | 3300048909 | Bacteria | 1583 |
| 695 | Ga0496106_0209711 | 3300048909 | Bacteria | 1552 |
| 696 | Ga0496106_0227685 | 3300048909 | Bacteria | 1488 |
| 697 | Ga0496106_0289827 | 3300048909 | Bacteria | 1312 |
| 698 | Ga0496106_0402541 | 3300048909 | Bacteria | 1100 |
| 699 | Ga0496107_0065728 | 3300048910 | Bacteria | 2630 |
| 700 | Ga0496107_0112717 | 3300048910 | Bacteria | 2000 |
| 701 | Ga0496107_0132295 | 3300048910 | Bacteria | 1842 |
| 702 | Ga0496107_0350499 | 3300048910 | Bacteria | 1099 |
| 703 | Ga0496107_0390346 | 3300048910 | Bacteria | 1035 |
| 704 | Ga0496108_0013443 | 3300048911 | Bacteria | 6678 |
| 705 | Ga0496108_0197435 | 3300048911 | Bacteria | 1745 |
| 706 | Ga0496109_0007343 | 3300048912 | Bacteria | 9322 |
| 707 | Ga0496109_0008379 | 3300048912 | Bacteria | 8786 |
| 708 | Ga0496109_0141565 | 3300048912 | Bacteria | 2249 |
| 709 | Ga0496109_0253645 | 3300048912 | Bacteria | 1657 |
| 710 | Ga0496110_0004140 | 3300048913 | Bacteria | 11211 |
| 711 | Ga0496110_0061624 | 3300048913 | Bacteria | 3312 |
| 712 | Ga0496110_0067803 | 3300048913 | Bacteria | 3157 |
| 713 | Ga0496111_0019197 | 3300048914 | Bacteria | 4744 |
| 714 | Ga0496111_0085901 | 3300048914 | Bacteria | 2301 |
| 715 | Ga0496111_0270260 | 3300048914 | Bacteria | 1261 |
| 716 | Ga0496112_0000021 | 3300048915 | Bacteria | 156561 |
| 717 | Ga0496112_0006620 | 3300048915 | Bacteria | 10202 |
| 718 | Ga0496112_0025529 | 3300048915 | Bacteria | 5673 |
| 719 | Ga0496112_0109612 | 3300048915 | Bacteria | 2731 |
| 720 | Ga0496112_0194607 | 3300048915 | Bacteria | 1989 |
| 721 | Ga0496113_0003687 | 3300048916 | Bacteria | 9225 |
| 722 | Ga0496113_0003980 | 3300048916 | Bacteria | 8976 |
| 723 | Ga0496114_0029515 | 3300048917 | Bacteria | 4509 |
| 724 | Ga0496114_0049504 | 3300048917 | Bacteria | 3496 |
| 725 | Ga0496114_0194952 | 3300048917 | Bacteria | 1773 |
| 726 | Ga0496114_0739597 | 3300048917 | Bacteria | 860 |
| 727 | Ga0496115_0015849 | 3300048918 | Bacteria | 5725 |
| 728 | Ga0496115_0093337 | 3300048918 | Bacteria | 2461 |
| 729 | Ga0496115_0497248 | 3300048918 | Bacteria | 980 |
| 730 | Ga0496116_0105200 | 3300048919 | Bacteria | 1675 |
| 731 | Ga0496117_0054893 | 3300048920 | Bacteria | 2788 |
| 732 | Ga0496117_0103442 | 3300048920 | Bacteria | 1795 |
| 733 | Ga0496117_0169936 | 3300048920 | Bacteria | 1267 |
| 734 | Ga0496118_0052584 | 3300048921 | Bacteria | 3105 |
| 735 | Ga0496118_0145815 | 3300048921 | Bacteria | 1491 |
| 736 | Ga0496119_0047744 | 3300048922 | Bacteria | 2661 |
| 737 | Ga0496119_0155388 | 3300048922 | Bacteria | 1222 |
| 738 | Ga0496121_0002742 | 3300048924 | Bacteria | 26192 |
| 739 | Ga0496121_0024447 | 3300048924 | Bacteria | 5775 |
| 740 | Ga0496121_0034621 | 3300048924 | Bacteria | 4544 |
| 741 | Ga0496121_0043514 | 3300048924 | Bacteria | 3888 |
| 742 | Ga0496121_0056434 | 3300048924 | Bacteria | 3262 |
| 743 | Ga0496121_0073209 | 3300048924 | Bacteria | 2747 |
| 744 | Ga0496121_0077405 | 3300048924 | Bacteria | 2649 |
| 745 | Ga0496121_0081807 | 3300048924 | Bacteria | 2555 |
| 746 | Ga0496121_0114288 | 3300048924 | Bacteria | 2052 |
| 747 | Ga0496121_0184984 | 3300048924 | Bacteria | 1499 |
| 748 | Ga0496121_0188726 | 3300048924 | Bacteria | 1480 |
| 749 | Ga0496121_0199758 | 3300048924 | Bacteria | 1426 |
| 750 | Ga0496121_0354191 | 3300048924 | Bacteria | 977 |
| 751 | Ga0496121_0419572 | 3300048924 | Bacteria | 871 |
| 752 | Ga0496122_0016696 | 3300048925 | Bacteria | 6922 |
| 753 | Ga0496122_0035337 | 3300048925 | Bacteria | 4068 |
| 754 | Ga0496123_0073879 | 3300048926 | Bacteria | 2113 |
| 755 | Ga0496123_0207966 | 3300048926 | Bacteria | 997 |
| 756 | Ga0496124_0041583 | 3300048927 | Bacteria | 3965 |
| 757 | Ga0496124_0072962 | 3300048927 | Bacteria | 2841 |
| 758 | Ga0496125_0074210 | 3300048928 | Bacteria | 2639 |
| 759 | Ga0496125_0161388 | 3300048928 | Bacteria | 1522 |
| 760 | Ga0496125_0293923 | 3300048928 | Bacteria | 999 |
| 761 | Ga0496126_0004520 | 3300048929 | Bacteria | 16556 |
| 762 | Ga0496126_0014485 | 3300048929 | Bacteria | 7969 |
| 763 | Ga0496126_0018300 | 3300048929 | Bacteria | 6950 |
| 764 | Ga0496126_0030809 | 3300048929 | Bacteria | 5078 |
| 765 | Ga0496126_0041355 | 3300048929 | Bacteria | 4266 |
| 766 | Ga0496126_0045430 | 3300048929 | Bacteria | 4036 |
| 767 | Ga0496126_0046504 | 3300048929 | Bacteria | 3979 |
| 768 | Ga0496126_0062972 | 3300048929 | Bacteria | 3326 |
| 769 | Ga0496126_0066922 | 3300048929 | Bacteria | 3211 |
| 770 | Ga0496126_0128014 | 3300048929 | Bacteria | 2196 |
| 771 | Ga0496126_0162545 | 3300048929 | Bacteria | 1907 |
| 772 | Ga0496126_0176023 | 3300048929 | Bacteria | 1820 |
| 773 | Ga0496126_0217898 | 3300048929 | Bacteria | 1605 |
| 774 | Ga0496126_0394225 | 3300048929 | Bacteria | 1124 |
| 775 | Ga0495682_0159909 | 3300049460 | Bacteria | 802 |
| 776 | Ga0501031_0000864 | 3300049568 | Bacteria | 18218 |
| 777 | Ga0501031_0035030 | 3300049568 | Bacteria | 3274 |
| 778 | Ga0501032_0001394 | 3300049569 | Bacteria | 19192 |
| 779 | Ga0501032_0018316 | 3300049569 | Bacteria | 4907 |
| 780 | Ga0501032_0019702 | 3300049569 | Bacteria | 4713 |
| 781 | Ga0501033_0000155 | 3300049570 | Bacteria | 65906 |
| 782 | Ga0501033_0001376 | 3300049570 | Bacteria | 21670 |
| 783 | Ga0501033_0067594 | 3300049570 | Bacteria | 2627 |
| 784 | Ga0501034_0000232 | 3300049571 | Bacteria | 103995 |
| 785 | Ga0501034_0175846 | 3300049571 | Bacteria | 2106 |
| 786 | Ga0501034_0216211 | 3300049571 | Bacteria | 1870 |
| 787 | Ga0501034_0504715 | 3300049571 | Bacteria | 1123 |
| 788 | Ga0501036_0000425 | 3300049572 | Bacteria | 29896 |
| 789 | Ga0501036_0173951 | 3300049572 | Bacteria | 1813 |
| 790 | Ga0501036_0254769 | 3300049572 | Bacteria | 1470 |
| 791 | Ga0501037_0000463 | 3300049573 | Bacteria | 33015 |
| 792 | Ga0501037_0009561 | 3300049573 | Bacteria | 7117 |
| 793 | Ga0501037_0082565 | 3300049573 | Bacteria | 2328 |
| 794 | Ga0501038_0000943 | 3300049574 | Bacteria | 25959 |
| 795 | Ga0501038_0021700 | 3300049574 | Bacteria | 5760 |
| 796 | Ga0501038_0160581 | 3300049574 | Bacteria | 1826 |
| 797 | Ga0501039_0008204 | 3300049575 | Bacteria | 7961 |
| 798 | Ga0501039_0031614 | 3300049575 | Bacteria | 4081 |
| 799 | Ga0501039_0063458 | 3300049575 | Bacteria | 2862 |
| 800 | Ga0501040_0047444 | 3300049576 | Bacteria | 2933 |
| 801 | Ga0501042_0031953 | 3300049578 | Bacteria | 3725 |
| 802 | Ga0501042_0093859 | 3300049578 | Bacteria | 2155 |
| 803 | Ga0501042_0100439 | 3300049578 | Bacteria | 2080 |
| 804 | Ga0501043_0000035 | 3300049579 | Bacteria | 133200 |
| 805 | Ga0501043_0005159 | 3300049579 | Bacteria | 10569 |
| 806 | Ga0501043_0009741 | 3300049579 | Bacteria | 7530 |
| 807 | Ga0501046_0027631 | 3300049580 | Bacteria | 4627 |
| 808 | Ga0501046_0033024 | 3300049580 | Bacteria | 4186 |
| 809 | Ga0501046_0039309 | 3300049580 | Bacteria | 3789 |
| 810 | Ga0501046_0056526 | 3300049580 | Bacteria | 3080 |
| 811 | Ga0501047_0000085 | 3300049581 | Bacteria | 118617 |
| 812 | Ga0501047_0062533 | 3300049581 | Bacteria | 3590 |
| 813 | Ga0501047_0117793 | 3300049581 | Bacteria | 2537 |
| 814 | Ga0501048_0000061 | 3300049582 | Bacteria | 54555 |
| 815 | Ga0501048_0017589 | 3300049582 | Bacteria | 5263 |
| 816 | Ga0501067_0002400 | 3300049583 | Bacteria | 10349 |
| 817 | Ga0501067_0027068 | 3300049583 | Bacteria | 3177 |
| 818 | Ga0501068_0003110 | 3300049584 | Bacteria | 8869 |
| 819 | Ga0501068_0004955 | 3300049584 | Bacteria | 7260 |
| 820 | Ga0501068_0118305 | 3300049584 | Bacteria | 1651 |
| 821 | Ga0501069_0043593 | 3300049585 | Bacteria | 2483 |
| 822 | Ga0501069_0054769 | 3300049585 | Bacteria | 2221 |
| 823 | Ga0501070_0000272 | 3300049586 | Bacteria | 48952 |
| 824 | Ga0501072_0000537 | 3300049588 | Bacteria | 27189 |
| 825 | Ga0501072_0414184 | 3300049588 | Bacteria | 1068 |
| 826 | Ga0501073_0000026 | 3300049589 | Bacteria | 124358 |
| 827 | Ga0501073_0054428 | 3300049589 | Bacteria | 2802 |
| 828 | Ga0501073_0118470 | 3300049589 | Bacteria | 1835 |
| 829 | Ga0501074_0000017 | 3300049590 | Bacteria | 76626 |
| 830 | Ga0501074_0024699 | 3300049590 | Bacteria | 4366 |
| 831 | Ga0501074_0035306 | 3300049590 | Bacteria | 3622 |
| 832 | Ga0501076_0074303 | 3300049592 | Bacteria | 2723 |
| 833 | Ga0501076_0157968 | 3300049592 | Bacteria | 1846 |
| 834 | Ga0501079_0014040 | 3300049741 | Bacteria | 6107 |
| 835 | Ga0501080_0005584 | 3300049742 | Bacteria | 11238 |
| 836 | Ga0501080_0036359 | 3300049742 | Bacteria | 4597 |
| 837 | Ga0501080_0038761 | 3300049742 | Bacteria | 4447 |
| 838 | Ga0501080_0149343 | 3300049742 | Bacteria | 2160 |
| 839 | Ga0501081_0190457 | 3300049743 | Bacteria | 1485 |
| 840 | Ga0501083_0000264 | 3300049744 | Bacteria | 33411 |
| 841 | Ga0501083_0015098 | 3300049744 | Bacteria | 5407 |
| 842 | Ga0501035_0000548 | 3300049822 | Bacteria | 41814 |
| 843 | Ga0501035_0002887 | 3300049822 | Bacteria | 16563 |
| 844 | Ga0501035_0053294 | 3300049822 | Bacteria | 3618 |
| 845 | Ga0501035_0324431 | 3300049822 | Bacteria | 1293 |
| 846 | Ga0501035_0556564 | 3300049822 | Bacteria | 939 |
| 847 | Ga0501044_0000051 | 3300049823 | Bacteria | 143658 |
| 848 | Ga0501044_0002908 | 3300049823 | Bacteria | 19491 |
| 849 | Ga0501044_0015682 | 3300049823 | Bacteria | 8159 |
| 850 | Ga0501044_0044996 | 3300049823 | Bacteria | 4577 |
| 851 | Ga0501044_0056733 | 3300049823 | Bacteria | 4021 |
| 852 | Ga0501045_0004421 | 3300049824 | Bacteria | 9701 |
| 853 | nmdc:mga03n38_69948_c1 | 3300050490 | Bacteria | 1622 |
| 854 | nmdc:mga00v17_241032_c1 | 3300050491 | Bacteria | 1172 |
| 855 | nmdc:mga00v17_58782_c1 | 3300050491 | Bacteria | 2357 |
| 856 | nmdc:mga0yw44_199478_c1 | 3300050492 | Bacteria | 1321 |
| 857 | nmdc:mga0yw44_5148_c1 | 3300050492 | Bacteria | 6124 |
| 858 | nmdc:mga0yw44_77380_c1 | 3300050492 | Bacteria | 2078 |
| 859 | nmdc:mga0k408_27004_c1 | 3300050493 | Bacteria | 3258 |
| 860 | nmdc:mga06z11_7637_c1 | 3300050494 | Bacteria | 4464 |
| 861 | nmdc:mga07m45_10610_c1 | 3300050496 | Bacteria | 4819 |
| 862 | nmdc:mga07m45_193668_c1 | 3300050496 | Bacteria | 1182 |
| 863 | nmdc:mga07m45_21995_c1 | 3300050496 | Bacteria | 3479 |
| 864 | nmdc:mga07m45_258776_c1 | 3300050496 | Bacteria | 1012 |
| 865 | nmdc:mga05p37_862963_c1 | 3300050507 | Bacteria | 981 |
| 866 | nmdc:mga08y16_196284_c1 | 3300050511 | Bacteria | 2092 |
| 867 | nmdc:mga08y16_493786_c1 | 3300050511 | Bacteria | 1244 |
| 868 | nmdc:mga0n895_530750_c1 | 3300050512 | Bacteria | 1184 |
| 869 | nmdc:mga0sz30_109892_c1 | 3300050516 | Bacteria | 1208 |
| 870 | nmdc:mga0sz30_273184_c1 | 3300050516 | Bacteria | 753 |
| 871 | Ga0495601_0016290 | 3300053077 | Bacteria | 4504 |
| 872 | Ga0495601_0162692 | 3300053077 | Bacteria | 1459 |
| 873 | Ga0495612_0043880 | 3300053078 | Bacteria | 1828 |
| 874 | Ga0495612_0081393 | 3300053078 | Bacteria | 1361 |
| 875 | Ga0495595_0027301 | 3300053084 | Bacteria | 2543 |
| 876 | Ga0495595_0033143 | 3300053084 | Bacteria | 2329 |
| 877 | Ga0495619_0010939 | 3300053085 | Bacteria | 5709 |
| 878 | Ga0495619_0071904 | 3300053085 | Bacteria | 2315 |
| 879 | Ga0495619_0085382 | 3300053085 | Bacteria | 2132 |
| 880 | Ga0500578_0101424 | 3300053086 | Bacteria | 1821 |
| 881 | Ga0500578_0181253 | 3300053086 | Bacteria | 1298 |
| 882 | Ga0500647_0016096 | 3300053091 | Bacteria | 3431 |
| 883 | Ga0500583_0064941 | 3300053092 | Bacteria | 1732 |
| 884 | Ga0500651_0141906 | 3300053093 | Bacteria | 1447 |
| 885 | Ga0500566_0001308 | 3300053094 | Bacteria | 14522 |
| 886 | Ga0500566_0002248 | 3300053094 | Bacteria | 11412 |
| 887 | Ga0500566_0036554 | 3300053094 | Bacteria | 2848 |
| 888 | Ga0500641_0001881 | 3300053096 | Bacteria | 7451 |
| 889 | Ga0500641_0006011 | 3300053096 | Bacteria | 4296 |
| 890 | Ga0500641_0012131 | 3300053096 | Bacteria | 3141 |
| 891 | Ga0500641_0080164 | 3300053096 | Bacteria | 1384 |
| 892 | Ga0500650_0048216 | 3300053098 | Bacteria | 1976 |
| 893 | Ga0500554_022916 | 3300053102 | Bacteria | 1750 |
| 894 | Ga0500554_025861 | 3300053102 | Bacteria | 1680 |
| 895 | Ga0500555_000359 | 3300053103 | Bacteria | 19406 |
| 896 | Ga0500556_0047341 | 3300053104 | Bacteria | 1542 |
| 897 | Ga0500562_034792 | 3300053108 | Bacteria | 1333 |
| 898 | Ga0500592_001571 | 3300053116 | Bacteria | 3691 |
| 899 | Ga0500595_003793 | 3300053119 | Bacteria | 6953 |
| 900 | Ga0500595_039911 | 3300053119 | Bacteria | 1517 |
| 901 | Ga0500607_231785 | 3300053121 | Bacteria | 756 |
| 902 | Ga0500608_088031 | 3300053122 | Bacteria | 1456 |
| 903 | Ga0500618_008918 | 3300053125 | Bacteria | 2765 |
| 904 | Ga0500642_0010090 | 3300053130 | Bacteria | 3315 |
| 905 | Ga0500652_040407 | 3300053131 | Bacteria | 1874 |
| 906 | Ga0500658_0111149 | 3300053134 | Bacteria | 1206 |
| 907 | Ga0500658_0190988 | 3300053134 | Bacteria | 935 |
| 908 | Ga0500559_0035914 | 3300053136 | Bacteria | 2142 |
| 909 | Ga0500559_0050244 | 3300053136 | Bacteria | 1839 |
| 910 | Ga0500561_0145658 | 3300053137 | Bacteria | 735 |
| 911 | Ga0500577_0000274 | 3300053142 | Bacteria | 13474 |
| 912 | Ga0500579_194710 | 3300053143 | Bacteria | 764 |
| 913 | Ga0500589_057710 | 3300053147 | Bacteria | 1787 |
| 914 | Ga0500590_027454 | 3300053148 | Bacteria | 2953 |
| 915 | Ga0500603_017374 | 3300053150 | Bacteria | 1718 |
| 916 | Ga0500603_049325 | 3300053150 | Bacteria | 1147 |
| 917 | Ga0500604_0089422 | 3300053151 | Bacteria | 1004 |
| 918 | Ga0500620_079162 | 3300053155 | Bacteria | 1137 |
| 919 | Ga0500627_0032689 | 3300053158 | Bacteria | 2194 |
| 920 | Ga0500636_0036791 | 3300053177 | Bacteria | 2896 |
| 921 | Ga0500637_0000088 | 3300053178 | Bacteria | 33146 |
| 922 | Ga0500637_0135409 | 3300053178 | Bacteria | 1427 |
| 923 | Ga0500637_0203632 | 3300053178 | Bacteria | 1125 |
| 924 | Ga0500611_010511 | 3300053727 | Bacteria | 1503 |
| 925 | Ga0500645_008427 | 3300053730 | Bacteria | 3521 |
| 926 | Ga0501084_0012701 | 3300054114 | Bacteria | 6978 |
| 927 | Ga0501082_0010719 | 3300060353 | Bacteria | 7888 |
| 928 | Ga0501082_0272665 | 3300060353 | Bacteria | 1473 |
| 929 | Ga0466962_0029856 | 3300061719 | Bacteria | 2610 |
| 930 | 2513654765 | 2513237096 | Bacteria | 8722461 |
| 931 | 2513675869 | 2513237098 | Bacteria | 9902361 |
| 932 | 2513692563 | 2513237101 | Bacteria | 7952346 |
| 933 | 2513855814 | 2513237137 | Bacteria | 9558895 |
| 934 | 2513863673 | 2513237137 | Bacteria | 9558895 |
| 935 | 2513915055 | 2513237145 | Bacteria | 8979722 |
| 936 | 2515629854 | 2515154112 | Bacteria | 8294334 |
| 937 | 2517106800 | 2517093001 | Bacteria | 9002274 |
| 938 | 2517892352 | 2517572143 | Bacteria | 9484767 |
| 939 | 2524538559 | 2524023228 | Bacteria | 10118060 |
| 940 | 2617349055 | 2617270735 | Bacteria | 9163226 |
| 941 | 2671120397 | 2667528175 | Bacteria | 7532676 |
| 942 | 2723845052 | 2721755755 | Bacteria | 8322773 |
| 943 | 2728751150 | 2728368998 | Bacteria | 8720350 |
| 944 | 2793072171 | 2791355197 | Bacteria | 8420563 |
| 945 | 2793082079 | |||
| 946 | 2824679185 | 2824671348 | Bacteria | 8369588 |
| 947 | 2824695789 | 2824687955 | Bacteria | 8360029 |
| 948 | 2824779582 | 2824773399 | Bacteria | 8360218 |
| 949 | 2847936254 | 2847930680 | Bacteria | 9342022 |
| 950 | 2874598095 | 2874590934 | Bacteria | 8299676 |
| 951 | 2874605231 | 2874604998 | Bacteria | 7834745 |
| 952 | 2874631897 | 2874628541 | Bacteria | 8630250 |
| 953 | 2874645436 | 2874645413 | Bacteria | 8214782 |
| 954 | 2876778427 | 2876771140 | Bacteria | 8287509 |
| 955 | 2876814300 | 2876808645 | Bacteria | 8824342 |
| 956 | 2876820373 | 2876818435 | Bacteria | 8274608 |
| 957 | 2879082221 | 2879074833 | Bacteria | 8279565 |
| 958 | 2879090673 | 2879083081 | Bacteria | 8587928 |
| 959 | 2879100556 | 2879099564 | Bacteria | 10442239 |
| 960 | 2879111225 | 2879110137 | Bacteria | 8907982 |
| 961 | 2879135368 | 2879127579 | Bacteria | 8294491 |
| 962 | 2879150577 | 2879142872 | Bacteria | 8267021 |
| 963 | 2885380536 | 2885374607 | Bacteria | 8927485 |
| 964 | 2885386571 | 2885383462 | Bacteria | 9473874 |
| 965 | 2889039806 | 2889033259 | Bacteria | 9099371 |
| 966 | 2893070545 | 2893066018 | Bacteria | 6158120 |
| 967 | 2903749335 | 2903748898 | Bacteria | 9972761 |
| 968 | 2903773982 | 2903768456 | Bacteria | 9749579 |
| 969 | 2904695857 | 2904690495 | Bacteria | 9412302 |
| 970 | 2904703494 | |||
| 971 | 2906618673 | |||
| 972 | 2906638888 | 2906635258 | Bacteria | 8601019 |
| 973 | 2906666331 | 2906660503 | Bacteria | 8595048 |
| 974 | 2908742650 | 2908739725 | Bacteria | 8628932 |
| 975 | 2908761158 | 2908756301 | Bacteria | 8864324 |
| 976 | 2922365391 | 2922361189 | Bacteria | 7436256 |
| 977 | 2922376912 | |||
| 978 | 2922391002 | 2922386360 | Bacteria | 7017218 |
| 979 | 2922430332 | |||
| 980 | 2932790133 | 2932784394 | Bacteria | 9704911 |
| 981 | 2932818087 | 2932809354 | Bacteria | 9135765 |
| 982 | 2932827921 | 2932818245 | Bacteria | 9955613 |
| 983 | 2935608923 | 2935608549 | Bacteria | 8203142 |
| 984 | 2935631626 | 2935630451 | Bacteria | 8169952 |
| 985 | 2935653376 | 2935648319 | Bacteria | 8801166 |
| 986 | 2935660153 | 2935656913 | Bacteria | 8965014 |
| 987 | 2935684187 | 2935675223 | Bacteria | 9928132 |
| 988 | 2935693383 | 2935684952 | Bacteria | 9590419 |
| 989 | 2935700151 | 2935694250 | Bacteria | 9291695 |
| 990 | 2935720828 | 2935713505 | Bacteria | 9608509 |
| 991 | 2935730685 | 2935722832 | Bacteria | 9608746 |
| 992 | 2935740550 | 2935732158 | Bacteria | 9706831 |
| 993 | 2935749976 | 2935741537 | Bacteria | 9707219 |
| 994 | 2935759204 | 2935750917 | Bacteria | 9590372 |
| 995 | 2935769622 | 2935760218 | Bacteria | 9817913 |
| 996 | 2935776919 | 2935769743 | Bacteria | 7878163 |
| 997 | 2935778570 | 2935777560 | Bacteria | 8077691 |
| 998 | 2935792235 | 2935785616 | Bacteria | 7962367 |
| 999 | 2935800398 | 2935793552 | Bacteria | 8012592 |
| 1000 | 2935819670 | 2935810662 | Bacteria | 9401221 |
| 1001 | 2935822083 | 2935819856 | Bacteria | 8261050 |
| 1002 | 2935847665 | 2935847175 | Bacteria | 8228321 |
| 1003 | 2935909063 | 2935908558 | Bacteria | 8568796 |
| 1004 | 2935919783 | 2935916978 | Bacteria | 9113783 |
| 1005 | 2935926363 | 2935926038 | Bacteria | 8601059 |
| 1006 | 2935934813 | 2935934488 | Bacteria | 8602579 |
| 1007 | 2935943263 | 2935942939 | Bacteria | 8599779 |
| 1008 | 2935951701 | 2935951376 | Bacteria | 8602333 |
| 1009 | 2935967826 | 2935967501 | Bacteria | 8603075 |
| 1010 | 2935982621 | 2935975950 | Bacteria | 8347125 |
| 1011 | 2936016246 | 2936011229 | Bacteria | 8801034 |
| 1012 | 2936024879 | 2936019824 | Bacteria | 8804134 |
| 1013 | 2936032127 | 2936028420 | Bacteria | 8965941 |
| 1014 | 2936046427 | 2936037263 | Bacteria | 9446081 |
| 1015 | 2936049988 | 2936046547 | Bacteria | 8903709 |
| 1016 | 2936060941 | 2936055302 | Bacteria | 8785755 |
| 1017 | 2940565270 | 2940556831 | Bacteria | 9590747 |
| 1018 | 2941511420 | 2941507105 | Bacteria | 8166816 |
| 1019 | 2941519121 | 2941515067 | Bacteria | 8166720 |
| 1020 | 2941526299 | 2941523033 | Bacteria | 8169134 |
| 1021 | 2941532857 | 2941531003 | Bacteria | 7653939 |
| 1022 | 3005480254 | 3005474847 | Bacteria | 9259049 |
| 1023 | 3005484360 | 3005483717 | Bacteria | 7877331 |
| 1024 | 3005588008 | 3005587118 | Bacteria | 7794411 |
| 1025 | 3005714947 | 3005710791 | Bacteria | 7622528 |
| 1026 | 8006940630 | 8006933436 | Bacteria | 10410654 |
| 1027 | 8006965777 | 8006964411 | Bacteria | 8966052 |
| 1028 | 8006980319 | 8006973647 | Bacteria | 10679141 |
| 1029 | 8006987013 | 8006984368 | Bacteria | 9651211 |
| 1030 | 8006996001 | 8006994254 | Bacteria | 8309700 |
| 1031 | 8016529574 | 8016522445 | Bacteria | 8156687 |
| 1032 | 8016534787 | 8016530956 | Bacteria | 8155261 |
| 1033 | 8016548004 | 8016539877 | Bacteria | 8155419 |
| 1034 | 8016554126 | 8016548790 | Bacteria | 8155074 |
| 1035 | 8016562503 | 8016557553 | Bacteria | 8154380 |
| 1036 | 8016577279 | 8016575299 | Bacteria | 8154085 |
| 1037 | 8016600293 | 8016595262 | Bacteria | 8149947 |
| 1038 | 8016610457 | 8016603502 | Bacteria | 8731218 |
| 1039 | 8016614478 | 8016613128 | Bacteria | 8794220 |
| 1040 | 8016626519 | 8016622563 | Bacteria | 7999408 |
| 1041 | 8016640286 | 8016630954 | Bacteria | 9217207 |
| 1042 | 8019534556 | 8019530166 | Bacteria | 8155624 |
| 1043 | 8019544916 | 8019538911 | Bacteria | 7872763 |
| 1044 | 8019553617 | 8019547302 | Bacteria | 7996444 |
| 1045 | 8019568608 | 8019565922 | Bacteria | 9639779 |
| 1046 | 8019628220 | 8019619141 | Bacteria | 9218857 |
| 1047 | 8019634409 | 8019629233 | Bacteria | 8687553 |
| 1048 | 8019645328 | 8019638758 | Bacteria | 9062356 |
| 1049 | 8019662289 | 8019659431 | Bacteria | 8577854 |
| 1050 | 8019671794 | 8019668869 | Bacteria | 8791617 |
| 1051 | 8019684300 | 8019678201 | Bacteria | 8863603 |
| 1052 | 8056673833 | 8056673599 | Bacteria | 7871253 |
| 1053 | 8056686691 | 8056681323 | Bacteria | 8472857 |
| 1054 | 8056693511 | 8056689827 | Bacteria | 6712655 |
| 1055 | Ga0451793_0235356 | |||
| 1056 | JGI25406J46586_10000281 | |||
| 1057 | JGI25165J46597_1007017 | |||
| 1058 | rootL2_10100710 | |||
| 1059 | JGI25404J52841_10011790 | |||
| 1060 | JGI25404J52841_10012955 | |||
| 1061 | JGI25404J52841_10031890 | |||
| 1062 | Ga0055539_1003432 | |||
| 1063 | Ga0055526_1019009 | |||
| 1064 | Ga0065165_1053829 | |||
| 1065 | Ga0070658_10034097 | |||
| 1066 | Ga0070658_10203097 | |||
| 1067 | Ga0070676_10029266 | |||
| 1068 | Ga0070676_10281594 | |||
| 1069 | Ga0070676_10622459 | |||
| 1070 | Ga0070683_100014826 | |||
| 1071 | Ga0070683_100217859 | |||
| 1072 | Ga0070690_100078908 | |||
| 1073 | Ga0070670_100386448 | |||
| 1074 | Ga0068869_100055860 | |||
| 1075 | Ga0070680_100012011 | |||
| 1076 | Ga0070680_100046708 | |||
| 1077 | Ga0070680_100071792 | |||
| 1078 | Ga0070680_100177524 | |||
| 1079 | Ga0070682_100072086 | |||
| 1080 | Ga0068868_100011517 | |||
| 1081 | Ga0068868_100066951 | |||
| 1082 | Ga0070660_100093459 | |||
| 1083 | Ga0070691_10071785 | |||
| 1084 | Ga0070687_100506183 | |||
| 1085 | Ga0070668_100130158 | |||
| 1086 | Ga0070668_100142498 | |||
| 1087 | Ga0070668_100156536 | |||
| 1088 | Ga0070669_100152215 | |||
| 1089 | Ga0070669_100687906 | |||
| 1090 | Ga0070671_100043116 | |||
| 1091 | Ga0070674_100036986 | |||
| 1092 | Ga0070674_100162383 | |||
| 1093 | Ga0070674_100400321 | |||
| 1094 | Ga0070673_100019014 | |||
| 1095 | Ga0070673_100228435 | |||
| 1096 | Ga0070688_100340574 | |||
| 1097 | Ga0070659_100235810 | |||
| 1098 | Ga0070667_100109172 | |||
| 1099 | Ga0070709_10001094 | |||
| 1100 | Ga0070709_10041110 | |||
| 1101 | Ga0070709_10202089 | |||
| 1102 | Ga0070714_100038308 | |||
| 1103 | Ga0070714_100054442 | |||
| 1104 | Ga0070714_100282881 | |||
| 1105 | Ga0070713_100006735 | |||
| 1106 | Ga0070710_10005972 | |||
| 1107 | Ga0070710_10066910 | |||
| 1108 | Ga0070701_10125942 | |||
| 1109 | Ga0070711_100003469 | |||
| 1110 | Ga0070711_100155291 | |||
| 1111 | Ga0070711_100649662 | |||
| 1112 | Ga0070700_100241200 | |||
| 1113 | Ga0070708_100302416 | |||
| 1114 | Ga0070663_100030492 | |||
| 1115 | Ga0070663_100069828 | |||
| 1116 | Ga0070663_100101625 | |||
| 1117 | Ga0070663_100112165 | |||
| 1118 | Ga0070663_100167570 | |||
| 1119 | Ga0070678_100017537 | |||
| 1120 | Ga0070678_100039996 | |||
| 1121 | Ga0070678_100056119 | |||
| 1122 | Ga0070678_100102030 | |||
| 1123 | Ga0070662_100020030 | |||
| 1124 | Ga0070662_100157581 | |||
| 1125 | Ga0070662_100448936 | |||
| 1126 | Ga0070681_10113617 | |||
| 1127 | Ga0070681_10163131 | |||
| 1128 | Ga0070681_10241891 | |||
| 1129 | Ga0068867_100032942 | |||
| 1130 | Ga0068867_100232873 | |||
| 1131 | Ga0070698_100035656 | |||
| 1132 | Ga0070698_100278044 | |||
| 1133 | Ga0070698_100378639 | |||
| 1134 | Ga0070698_100505426 | |||
| 1135 | Ga0070679_100016725 | |||
| 1136 | Ga0070679_100044244 | |||
| 1137 | Ga0070679_100044856 | |||
| 1138 | Ga0070679_100059816 | |||
| 1139 | Ga0070679_100081880 | |||
| 1140 | Ga0070684_100016386 | |||
| 1141 | Ga0070684_100092163 | |||
| 1142 | Ga0070684_100318891 | |||
| 1143 | Ga0070697_100102945 | |||
| 1144 | Ga0068853_100032728 | |||
| 1145 | Ga0068853_100063118 | |||
| 1146 | Ga0068853_100067836 | |||
| 1147 | Ga0068853_100201434 | |||
| 1148 | Ga0068853_100332967 | |||
| 1149 | Ga0068853_100398999 | |||
| 1150 | Ga0068853_100441134 | |||
| 1151 | Ga0068853_100777793 | |||
| 1152 | Ga0070672_100160902 | |||
| 1153 | Ga0070672_100326124 | |||
| 1154 | Ga0070686_100441382 | |||
| 1155 | Ga0070696_100065382 | |||
| 1156 | Ga0070696_100171572 | |||
| 1157 | Ga0070696_100394342 | |||
| 1158 | Ga0070693_100078642 | |||
| 1159 | Ga0070665_100070951 | |||
| 1160 | Ga0070665_100074289 | |||
| 1161 | Ga0070665_100437026 | |||
| 1162 | Ga0070665_100599282 | |||
| 1163 | Ga0068855_100047648 | |||
| 1164 | Ga0068855_100068829 | |||
| 1165 | Ga0068855_100117677 | |||
| 1166 | Ga0068855_100142890 | |||
| 1167 | Ga0068855_101150668 | |||
| 1168 | Ga0070664_100041691 | |||
| 1169 | Ga0070664_100230507 | |||
| 1170 | Ga0068857_100022401 | |||
| 1171 | Ga0068857_100052978 | |||
| 1172 | Ga0068857_100468771 | |||
| 1173 | Ga0068854_100129113 | |||
| 1174 | Ga0068854_100266046 | |||
| 1175 | Ga0068854_100720510 | |||
| 1176 | Ga0068856_100000082 | |||
| 1177 | Ga0068856_100338009 | |||
| 1178 | Ga0068856_101395149 | |||
| 1179 | Ga0070702_100047672 | |||
| 1180 | Ga0070702_100072831 | |||
| 1181 | Ga0068852_100570361 | |||
| 1182 | Ga0068859_100031018 | |||
| 1183 | Ga0068859_100370837 | |||
| 1184 | Ga0068859_100890985 | |||
| 1185 | Ga0068864_100023523 | |||
| 1186 | Ga0068864_100414963 | |||
| 1187 | Ga0068866_10023610 | |||
| 1188 | Ga0068861_100024737 | |||
| 1189 | Ga0068861_100057655 | |||
| 1190 | Ga0068861_100158740 | |||
| 1191 | Ga0068861_100539935 | |||
| 1192 | Ga0068870_10316074 | |||
| 1193 | Ga0068863_100160927 | |||
| 1194 | Ga0068863_100343320 | |||
| 1195 | Ga0068858_100155923 | |||
| 1196 | Ga0068858_100320225 | |||
| 1197 | Ga0068858_100354559 | |||
| 1198 | Ga0068860_100083701 | |||
| 1199 | Ga0068862_100045299 | |||
| 1200 | Ga0068862_100118586 | |||
| 1201 | Ga0068862_100127591 | |||
| 1202 | Ga0068862_100161087 | |||
| 1203 | Ga0068862_100200622 | |||
| 1204 | Ga0081455_10004092 | |||
| 1205 | Ga0081455_10012714 | |||
| 1206 | Ga0081455_10117859 | |||
| 1207 | Ga0081538_10072145 | |||
| 1208 | Ga0081540_1005571 | |||
| 1209 | Ga0081540_1010961 | |||
| 1210 | Ga0081540_1012602 | |||
| 1211 | Ga0081540_1014018 | |||
| 1212 | Ga0081540_1014599 | |||
| 1213 | Ga0081539_10001902 | |||
| 1214 | Ga0081539_10026944 | |||
| 1215 | Ga0070717_10191195 | |||
| 1216 | Ga0070717_10216381 | |||
| 1217 | Ga0075365_10029868 | |||
| 1218 | Ga0075365_10042134 | |||
| 1219 | Ga0075365_10062393 | |||
| 1220 | Ga0075365_10062403 | |||
| 1221 | Ga0075365_10107272 | |||
| 1222 | Ga0075365_10160278 | |||
| 1223 | Ga0075368_10021445 | |||
| 1224 | Ga0075368_10131470 | |||
| 1225 | Ga0075363_100001764 | |||
| 1226 | Ga0075363_100015088 | |||
| 1227 | Ga0075363_100156860 | |||
| 1228 | Ga0075364_10026005 | |||
| 1229 | Ga0075364_10085792 | |||
| 1230 | Ga0070716_100062303 | |||
| 1231 | Ga0070712_100033812 | |||
| 1232 | Ga0075367_10005871 | |||
| 1233 | Ga0075367_10032643 | |||
| 1234 | Ga0075367_10125533 | |||
| 1235 | Ga0075367_10344107 | |||
| 1236 | Ga0075366_10031763 | |||
| 1237 | Ga0097621_100020182 | |||
| 1238 | Ga0097621_100610704 | |||
| 1239 | Ga0075370_10007760 | |||
| 1240 | Ga0075370_10072391 | |||
| 1241 | Ga0075370_10199653 | |||
| 1242 | Ga0068871_100037995 | |||
| 1243 | Ga0068871_100565354 | |||
| 1244 | Ga0075434_100102162 | |||
| 1245 | Ga0068865_100173591 | |||
| 1246 | Ga0068865_100233342 | |||
| 1247 | Ga0097620_100031020 | |||
| 1248 | Ga0097620_100370862 | |||
| 1249 | Ga0097620_100891085 | |||
| 1250 | Ga0099824_1005168 | |||
| 1251 | Ga0099822_1000080 | |||
| 1252 | Ga0075435_100072603 | |||
| 1253 | Ga0099795_10163541 | |||
| 1254 | Ga0105240_10093070 | |||
| 1255 | Ga0105240_10243455 | |||
| 1256 | Ga0105240_10525410 | |||
| 1257 | Ga0105245_10018466 | |||
| 1258 | Ga0105245_10071926 | |||
| 1259 | Ga0105245_10303800 | |||
| 1260 | Ga0105245_10951911 | |||
| 1261 | Ga0105247_10060702 | |||
| 1262 | Ga0114129_10261607 | |||
| 1263 | Ga0105243_10065518 | |||
| 1264 | Ga0105241_10018025 | |||
| 1265 | Ga0105242_10182773 | |||
| 1266 | Ga0105242_10341975 | |||
| 1267 | Ga0105248_10296754 | |||
| 1268 | Ga0105248_10344985 | |||
| 1269 | Ga0105237_10133289 | |||
| 1270 | Ga0105237_11267513 | |||
| 1271 | Ga0105238_10017099 | |||
| 1272 | Ga0105249_10702698 | |||
| 1273 | Ga0099796_10032206 | |||
| 1274 | Ga0099796_10095278 | |||
| 1275 | Ga0105239_10027964 | |||
| 1276 | Ga0105239_10090869 | |||
| 1277 | Ga0105239_10093008 | |||
| 1278 | Ga0105239_10176226 | |||
| 1279 | Ga0105239_10651824 | |||
| 1280 | Ga0157370_10018597 | |||
| 1281 | Ga0157370_10091789 | |||
| 1282 | Ga0157369_10044499 | |||
| 1283 | Ga0157374_10031099 | |||
| 1284 | Ga0157378_10018819 | |||
| 1285 | Ga0157378_10022108 | |||
| 1286 | Ga0157378_10438479 | |||
| 1287 | Ga0157378_10578532 | |||
| 1288 | Ga0163162_10039037 | |||
| 1289 | Ga0163162_10162176 | |||
| 1290 | Ga0163162_10452762 | |||
| 1291 | Ga0157372_10061947 | |||
| 1292 | Ga0157375_10043448 | |||
| 1293 | Ga0157375_10148469 | |||
| 1294 | Ga0157375_10283665 | |||
| 1295 | Ga0157375_10391438 | |||
| 1296 | Ga0163163_10009474 | |||
| 1297 | Ga0163163_10105290 | |||
| 1298 | Ga0163163_10122280 | |||
| 1299 | Ga0163163_10574400 | |||
| 1300 | Ga0157380_10106002 | |||
| 1301 | Ga0157380_10225124 | |||
| 1302 | Ga0157380_10520571 | |||
| 1303 | Ga0182008_10112772 | |||
| 1304 | Ga0157379_10085055 | |||
| 1305 | Ga0157379_10372137 | |||
| 1306 | Ga0157379_10865535 | |||
| 1307 | Ga0157376_10156322 | |||
| 1308 | Ga0157376_10190326 | |||
| 1309 | Ga0163161_10308897 | |||
| 1310 | Ga0209677_100235 | |||
| 1311 | Ga0209677_104125 | |||
| 1312 | Ga0209233_1000995 | |||
| 1313 | Ga0209233_1020532 | |||
| 1314 | Ga0209564_1000726 | |||
| 1315 | Ga0209758_1000160 | |||
| 1316 | Ga0209758_1005354 | |||
| 1317 | Ga0207697_10236607 | |||
| 1318 | Ga0207692_10468357 | |||
| 1319 | Ga0207642_10015226 | |||
| 1320 | Ga0207642_10046811 | |||
| 1321 | Ga0207710_10051593 | |||
| 1322 | Ga0207710_10062572 | |||
| 1323 | Ga0207688_10025042 | |||
| 1324 | Ga0207688_10205279 | |||
| 1325 | Ga0207685_10193694 | |||
| 1326 | Ga0207699_10000199 | |||
| 1327 | Ga0207699_10035185 | |||
| 1328 | Ga0207645_10054536 | |||
| 1329 | Ga0207645_10101239 | |||
| 1330 | Ga0207643_10017275 | |||
| 1331 | Ga0207643_10097662 | |||
| 1332 | Ga0207643_10343751 | |||
| 1333 | Ga0207705_10117978 | |||
| 1334 | Ga0207705_10230047 | |||
| 1335 | Ga0207654_10288876 | |||
| 1336 | Ga0207707_10019532 | |||
| 1337 | Ga0207707_10038340 | |||
| 1338 | Ga0207707_10081725 | |||
| 1339 | Ga0207695_10128011 | |||
| 1340 | Ga0207695_10558749 | |||
| 1341 | Ga0207671_10028108 | |||
| 1342 | Ga0207671_10145503 | |||
| 1343 | Ga0207671_10692826 | |||
| 1344 | Ga0207693_10016309 | |||
| 1345 | Ga0207693_10023034 | |||
| 1346 | Ga0207663_10009125 | |||
| 1347 | Ga0207663_10265882 | |||
| 1348 | Ga0207663_10666147 | |||
| 1349 | Ga0207660_10024005 | |||
| 1350 | Ga0207660_10076336 | |||
| 1351 | Ga0207660_10240915 | |||
| 1352 | Ga0207662_10420603 | |||
| 1353 | Ga0207662_10685968 | |||
| 1354 | Ga0207657_10107874 | |||
| 1355 | Ga0207657_10313003 | |||
| 1356 | Ga0207652_10009229 | |||
| 1357 | Ga0207681_10122380 | |||
| 1358 | Ga0207681_10787877 | |||
| 1359 | Ga0207694_10254868 | |||
| 1360 | Ga0207650_10104033 | |||
| 1361 | Ga0207687_10047676 | |||
| 1362 | Ga0207687_10080533 | |||
| 1363 | Ga0207700_10023396 | |||
| 1364 | Ga0207700_10027500 | |||
| 1365 | Ga0207664_10037833 | |||
| 1366 | Ga0207664_10084718 | |||
| 1367 | Ga0207664_10246443 | |||
| 1368 | Ga0207644_10049291 | |||
| 1369 | Ga0207690_10048975 | |||
| 1370 | Ga0207690_10220619 | |||
| 1371 | Ga0207706_10064081 | |||
| 1372 | Ga0207706_10067934 | |||
| 1373 | Ga0207706_10544844 | |||
| 1374 | Ga0207686_10358254 | |||
| 1375 | Ga0207686_10681966 | |||
| 1376 | Ga0207709_10101125 | |||
| 1377 | Ga0207669_10042690 | |||
| 1378 | Ga0207669_10092936 | |||
| 1379 | Ga0207704_10017791 | |||
| 1380 | Ga0207704_10223241 | |||
| 1381 | Ga0207665_10048262 | |||
| 1382 | Ga0207691_10144219 | |||
| 1383 | Ga0207691_10184406 | |||
| 1384 | Ga0207711_10006349 | |||
| 1385 | Ga0207711_10264243 | |||
| 1386 | Ga0207711_10300140 | |||
| 1387 | Ga0207689_10034390 | |||
| 1388 | Ga0207689_10040742 | |||
| 1389 | Ga0207689_10072682 | |||
| 1390 | Ga0207661_10000410 | |||
| 1391 | Ga0207661_10025556 | |||
| 1392 | Ga0207661_10128801 | |||
| 1393 | Ga0207661_10191029 | |||
| 1394 | Ga0207679_10105971 | |||
| 1395 | Ga0207679_10198426 | |||
| 1396 | Ga0207679_10753129 | |||
| 1397 | Ga0207667_10015305 | |||
| 1398 | Ga0207667_10340335 | |||
| 1399 | Ga0207667_10351614 | |||
| 1400 | Ga0207651_10005957 | |||
| 1401 | Ga0207712_10785744 | |||
| 1402 | Ga0207668_10073885 | |||
| 1403 | Ga0207668_10158561 | |||
| 1404 | Ga0207668_10849036 | |||
| 1405 | Ga0207640_10060990 | |||
| 1406 | Ga0207640_10079134 | |||
| 1407 | Ga0207640_10409990 | |||
| 1408 | Ga0207677_10138631 | |||
| 1409 | Ga0207703_10147225 | |||
| 1410 | Ga0207703_10255233 | |||
| 1411 | Ga0207703_10525752 | |||
| 1412 | Ga0207703_10961539 | |||
| 1413 | Ga0207639_10056395 | |||
| 1414 | Ga0207639_10165950 | |||
| 1415 | Ga0207639_10233761 | |||
| 1416 | Ga0207639_10308612 | |||
| 1417 | Ga0207678_10010615 | |||
| 1418 | Ga0207678_10022267 | |||
| 1419 | Ga0207678_10025488 | |||
| 1420 | Ga0207678_10041263 | |||
| 1421 | Ga0207678_10084343 | |||
| 1422 | Ga0207678_10180874 | |||
| 1423 | Ga0207702_10000048 | |||
| 1424 | Ga0207702_10363745 | |||
| 1425 | Ga0207702_11191953 | |||
| 1426 | Ga0207641_10114216 | |||
| 1427 | Ga0207641_10114252 | |||
| 1428 | Ga0207648_10316048 | |||
| 1429 | Ga0207648_10369199 | |||
| 1430 | Ga0207676_10017087 | |||
| 1431 | Ga0207676_10520449 | |||
| 1432 | Ga0207674_10019872 | |||
| 1433 | Ga0207674_10022445 | |||
| 1434 | Ga0207674_10279311 | |||
| 1435 | Ga0207675_100317319 | |||
| 1436 | Ga0207683_10023706 | |||
| 1437 | Ga0207683_10047585 | |||
| 1438 | Ga0207683_10048826 | |||
| 1439 | Ga0207683_10078139 | |||
| 1440 | Ga0207683_10524295 | |||
| 1441 | Ga0207698_10434428 | |||
| 1442 | Ga0207698_11267866 | |||
| 1443 | Ga0209589_1000003 | |||
| 1444 | Ga0209489_100003 | |||
| 1445 | Ga0209700_100003 | |||
| 1446 | Ga0209700_100062 | |||
| 1447 | Ga0209179_1005091 | |||
| 1448 | Ga0209179_1051653 | |||
| 1449 | Ga0209588_1003456 | |||
| 1450 | Ga0209813_10037989 | |||
| 1451 | Ga0207428_10078431 | |||
| 1452 | Ga0268266_10003304 | |||
| 1453 | Ga0268266_10015514 | |||
| 1454 | Ga0268266_10024812 | |||
| 1455 | Ga0268266_10333285 | |||
| 1456 | Ga0268266_10514402 | |||
| 1457 | Ga0268266_10567827 | |||
| 1458 | Ga0268266_10861559 | |||
| 1459 | Ga0268265_10029396 | |||
| 1460 | Ga0268265_10063199 | |||
| 1461 | Ga0268265_10082635 | |||
| 1462 | Ga0268265_11140196 | |||
| 1463 | Ga0268265_11155322 | |||
| 1464 | Ga0268264_10029978 | |||
| 1465 | Ga0268264_10057650 | |||
| 1466 | Ga0265334_10047826 | |||
| 1467 | Ga0307517_10000063 | |||
| 1468 | Ga0307517_10161062 | |||
| 1469 | Ga0265330_10010793 | |||
| 1470 | Ga0265330_10030179 | |||
| 1471 | Ga0265332_10052081 | |||
| 1472 | Ga0265340_10109416 | |||
| 1473 | Ga0265339_10007926 | |||
| 1474 | Ga0265316_10139532 | |||
| 1475 | Ga0307509_10106942 | |||
| 1476 | Ga0307509_10162838 | |||
| 1477 | Ga0307509_10615197 | |||
| 1478 | Ga0307509_10627582 | |||
| 1479 | Ga0307408_100283910 | |||
| 1480 | Ga0307508_10086949 | |||
| 1481 | Ga0307508_10110140 | |||
| 1482 | Ga0307508_10233330 | |||
| 1483 | Ga0265314_10015169 | |||
| 1484 | Ga0265314_10141546 | |||
| 1485 | Ga0265342_10219401 | |||
| 1486 | Ga0307516_10019305 | |||
| 1487 | Ga0307516_10050530 | |||
| 1488 | Ga0307516_10073859 | |||
| 1489 | Ga0307405_10220116 | |||
| 1490 | Ga0307413_10229827 | |||
| 1491 | Ga0307406_10056391 | |||
| 1492 | Ga0307406_10222367 | |||
| 1493 | Ga0307407_10448484 | |||
| 1494 | Ga0307412_10372253 | |||
| 1495 | Ga0307409_100101210 | |||
| 1496 | Ga0307416_100315508 | |||
| 1497 | Ga0307414_10170181 | |||
| 1498 | Ga0307415_100327322 | |||
| 1499 | Ga0307507_10013500 | |||
| 1500 | Ga0307510_10040869 | |||
| 1501 | Ga0307510_10075468 | |||
| 1502 | Ga0307510_10324839 | |||
| 1503 | Ga0315911_1000001 | |||
| 1504 | Ga0373958_0030497 | |||
| 1505 | Ga0373926_0132285 | |||
| 1506 | Ga0373926_0139788 | |||
| 1507 | Ga0373926_0195676 | |||
| 1508 | Ga0373934_0001166 | |||
| 1509 | Ga0373934_0176385 | |||
| 1510 | Ga0373951_0047078 | |||
| 1511 | Ga0373923_0026919 | |||
| 1512 | Ga0373936_0007632 | |||
| 1513 | Ga0373936_0069315 | |||
| 1514 | Ga0373936_0085233 | |||
| 1515 | Ga0373936_0277909 | |||
| 1516 | Ga0373941_0152650 | |||
| 1517 | Ga0373945_0032863 | |||
| 1518 | Ga0373953_0002003 | |||
| 1519 | Ga0373954_0134417 | |||
| 1520 | Ga0373956_0100820 | |||
| 1521 | Ga0373957_0004654 | |||
| 1522 | Ga0373943_0005215 | |||
| 1523 | Ga0373943_0036263 | |||
| 1524 | Ga0373946_0004563 | |||
| 1525 | Ga0373946_0025755 | |||
| 1526 | Ga0373955_0053270 | |||
| 1527 | Ga0373955_0061404 | |||
| 1528 | Ga0373955_0091553 | |||
| 1529 | Ga0373924_0033654 | |||
| 1530 | Ga0373924_0125478 | |||
| 1531 | Ga0373931_0024745 | |||
| 1532 | Ga0373935_0000701 | |||
| 1533 | Ga0373935_0056886 | |||
| 1534 | Ga0373927_0001744 | |||
| 1535 | Ga0373927_0013460 | |||
| 1536 | Ga0373927_0028227 | |||
| 1537 | Ga0373927_0028864 | |||
| 1538 | Ga0373927_0098205 | |||
| 1539 | Ga0373933_0000041 | |||
| 1540 | Ga0373933_0105782 | |||
| 1541 | Ga0373947_0001365 | |||
| 1542 | Ga0373947_0054174 | |||
| 1543 | Ga0373947_0229269 | |||
| 1544 | Ga0373937_0573607 | |||
| 1545 | Ga0373937_0704617 | |||
| 1546 | Ga0373925_0008661 | |||
| 1547 | Ga0373925_0032651 | |||
| 1548 | Ga0373925_0126787 | |||
| 1549 | Ga0395900_0143381 | |||
| 1550 | Ga0395900_0266835 | |||
| 1551 | Ga0395900_0616266 | |||
| 1552 | Ga0395898_0136484 | |||
| 1553 | Ga0395898_0389878 | |||
| 1554 | Ga0395905_0173504 | |||
| 1555 | Ga0395905_0369813 | |||
| 1556 | Ga0395905_0471486 | |||
| 1557 | Ga0436364_0836743 | |||
| 1558 | Ga0395901_0155243 | |||
| 1559 | Ga0436365_0096789 | |||
| 1560 | Ga0436365_0662753 | |||
| 1561 | Ga0436365_1159716 | |||
| 1562 | Ga0436361_0041213 | |||
| 1563 | Ga0436361_0782414 | |||
| 1564 | Ga0436363_0979421 | |||
| 1565 | Ga0439465_0012175 | |||
| 1566 | Ga0439459_0035459 | |||
| 1567 | Ga0466969_0019057 | |||
| 1568 | Ga0466966_0009411 | |||
| 1569 | Ga0466961_0000013 | |||
| 1570 | Ga0466964_0013303 | |||
| 1571 | Ga0466971_0352587 | |||
| 1572 | Ga0466957_0066743 | |||
| 1573 | Ga0466959_0037538 | |||
| 1574 | Ga0466959_0287224 | |||
| 1575 | Ga0466959_0344220 | |||
| 1576 | Ga0466967_0106792 | |||
| 1577 | Ga0495617_027351 | |||
| 1578 | Ga0495617_029754 | |||
| 1579 | Ga0495592_0068197 | |||
| 1580 | Ga0495592_0170014 | |||
| 1581 | Ga0495603_0000624 | |||
| 1582 | Ga0495603_0029062 | |||
| 1583 | Ga0495603_0064252 | |||
| 1584 | Ga0495603_0066178 | |||
| 1585 | Ga0495603_0152389 | |||
| 1586 | Ga0495603_0237835 | |||
| 1587 | Ga0495590_0028370 | |||
| 1588 | Ga0495629_0001961 | |||
| 1589 | Ga0495629_0074044 | |||
| 1590 | Ga0495638_0015380 | |||
| 1591 | Ga0495638_0150085 | |||
| 1592 | Ga0495638_0340774 | |||
| 1593 | Ga0495641_0006064 | |||
| 1594 | Ga0495641_0165710 | |||
| 1595 | Ga0495651_0058334 | |||
| 1596 | Ga0495653_0000923 | |||
| 1597 | Ga0495653_0187748 | |||
| 1598 | Ga0495650_0034101 | |||
| 1599 | Ga0495580_0008876 | |||
| 1600 | Ga0495580_0009752 | |||
| 1601 | Ga0495580_0229468 | |||
| 1602 | Ga0495582_0000775 | |||
| 1603 | Ga0495582_0036864 | |||
| 1604 | Ga0495582_0085950 | |||
| 1605 | Ga0495605_0056198 | |||
| 1606 | Ga0495639_0000335 | |||
| 1607 | Ga0495639_0026945 | |||
| 1608 | Ga0495639_0038033 | |||
| 1609 | Ga0495639_0043792 | |||
| 1610 | Ga0495662_0000156 | |||
| 1611 | Ga0495664_0003259 | |||
| 1612 | Ga0495664_0195948 | |||
| 1613 | Ga0495664_0199197 | |||
| 1614 | Ga0495664_0216296 | |||
| 1615 | Ga0495584_0044162 | |||
| 1616 | Ga0495584_0143214 | |||
| 1617 | Ga0495585_0069111 | |||
| 1618 | Ga0495596_0163275 | |||
| 1619 | Ga0495596_0214691 | |||
| 1620 | Ga0495583_0197315 | |||
| 1621 | Ga0495606_0011399 | |||
| 1622 | Ga0495616_0095266 | |||
| 1623 | Ga0495616_0102082 | |||
| 1624 | Ga0495618_0107432 | |||
| 1625 | Ga0495628_0058246 | |||
| 1626 | Ga0495628_0088877 | |||
| 1627 | Ga0495630_0011736 | |||
| 1628 | Ga0495630_0014880 | |||
| 1629 | Ga0495631_0091415 | |||
| 1630 | Ga0495632_0016800 | |||
| 1631 | Ga0495632_0030062 | |||
| 1632 | Ga0495632_0100694 | |||
| 1633 | Ga0495632_0112541 | |||
| 1634 | Ga0495637_0122108 | |||
| 1635 | Ga0495644_0032075 | |||
| 1636 | Ga0495644_0039460 | |||
| 1637 | Ga0495648_0006521 | |||
| 1638 | Ga0495663_0116283 | |||
| 1639 | Ga0495652_0043386 | |||
| 1640 | Ga0495665_0000188 | |||
| 1641 | Ga0495665_0012665 | |||
| 1642 | Ga0495665_0177373 | |||
| 1643 | Ga0495640_0002363 | |||
| 1644 | Ga0495640_0013618 | |||
| 1645 | Ga0495587_0075689 | |||
| 1646 | Ga0495598_0009463 | |||
| 1647 | Ga0495609_0033652 | |||
| 1648 | Ga0495645_0153497 | |||
| 1649 | Ga0495645_0182982 | |||
| 1650 | Ga0495622_0013179 | |||
| 1651 | Ga0495622_0033574 | |||
| 1652 | Ga0495633_0016407 | |||
| 1653 | Ga0495633_0248531 | |||
| 1654 | Ga0495667_0157075 | |||
| 1655 | Ga0495667_0210438 | |||
| 1656 | Ga0495668_0195365 | |||
| 1657 | Ga0495668_0252894 | |||
| 1658 | Ga0495668_0276334 | |||
| 1659 | Ga0495634_0001338 | |||
| 1660 | Ga0495634_0015371 | |||
| 1661 | Ga0495634_0021255 | |||
| 1662 | Ga0495611_0024186 | |||
| 1663 | Ga0495625_0104026 | |||
| 1664 | Ga0495635_0000187 | |||
| 1665 | Ga0495635_0001384 | |||
| 1666 | Ga0495635_0197970 | |||
| 1667 | Ga0495659_0070319 | |||
| 1668 | Ga0495659_0175657 | |||
| 1669 | Ga0495588_0012064 | |||
| 1670 | Ga0495588_0014997 | |||
| 1671 | Ga0495657_0119348 | |||
| 1672 | Ga0495599_0012037 | |||
| 1673 | Ga0495599_0137758 | |||
| 1674 | Ga0495599_0148478 | |||
| 1675 | Ga0495623_0021813 | |||
| 1676 | Ga0495646_0005072 | |||
| 1677 | Ga0495646_0071011 | |||
| 1678 | Ga0495647_0006159 | |||
| 1679 | Ga0495658_0000047 | |||
| 1680 | Ga0495658_0005621 | |||
| 1681 | Ga0495658_0011386 | |||
| 1682 | Ga0495658_0323468 | |||
| 1683 | Ga0495669_0009623 | |||
| 1684 | Ga0495669_0113868 | |||
| 1685 | Ga0495613_0001031 | |||
| 1686 | Ga0495613_0058593 | |||
| 1687 | Ga0495624_0001259 | |||
| 1688 | Ga0495670_0036547 | |||
| 1689 | Ga0495670_0122196 | |||
| 1690 | Ga0495671_0040521 | |||
| 1691 | Ga0495649_0086014 | |||
| 1692 | Ga0495649_0175238 | |||
| 1693 | Ga0495589_0054129 | |||
| 1694 | Ga0495581_0000563 | |||
| 1695 | Ga0495581_0129449 | |||
| 1696 | Ga0495581_0196069 | |||
| 1697 | Ga0495604_0480924 | |||
| 1698 | Ga0495636_0122570 | |||
| 1699 | Ga0495674_0022065 | |||
| 1700 | Ga0495672_0016664 | |||
| 1701 | Ga0495672_0101595 | |||
| 1702 | Ga0495676_0060717 | |||
| 1703 | Ga0495680_0085997 | |||
| 1704 | Ga0495680_0568716 | |||
| 1705 | Ga0495683_0198201 | |||
| 1706 | Ga0495675_0074231 | |||
| 1707 | Ga0495679_037119 | |||
| 1708 | Ga0495685_065734 | |||
| 1709 | Ga0495673_0110579 | |||
| 1710 | Ga0495673_0142622 | |||
| 1711 | Ga0495684_0000325 | |||
| 1712 | Ga0495684_0008519 | |||
| 1713 | Ga0495684_0015183 | |||
| 1714 | Ga0495686_0339526 | |||
| 1715 | Ga0495593_0026036 | |||
| 1716 | Ga0495593_0038357 | |||
| 1717 | Ga0495593_0251744 | |||
| 1718 | Ga0495602_0080234 | |||
| 1719 | Ga0495626_0099927 | |||
| 1720 | Ga0496100_0018892 | |||
| 1721 | Ga0496100_0028609 | |||
| 1722 | Ga0496100_0034263 | |||
| 1723 | Ga0496100_0538469 | |||
| 1724 | Ga0496100_0547677 | |||
| 1725 | Ga0496100_0633153 | |||
| 1726 | Ga0496100_0799190 | |||
| 1727 | Ga0496100_0803515 | |||
| 1728 | Ga0496101_0173721 | |||
| 1729 | Ga0496102_0028102 | |||
| 1730 | Ga0496102_0070673 | |||
| 1731 | Ga0496102_0181731 | |||
| 1732 | Ga0496102_0438232 | |||
| 1733 | Ga0496102_0552285 | |||
| 1734 | Ga0496103_0048099 | |||
| 1735 | Ga0496103_0075363 | |||
| 1736 | Ga0496104_0016385 | |||
| 1737 | Ga0496104_0017531 | |||
| 1738 | Ga0496104_0127394 | |||
| 1739 | Ga0496104_0205684 | |||
| 1740 | Ga0496105_0013867 | |||
| 1741 | Ga0496105_0048964 | |||
| 1742 | Ga0496105_0065179 | |||
| 1743 | Ga0496105_0428296 | |||
| 1744 | Ga0496106_0010647 | |||
| 1745 | Ga0496106_0045059 | |||
| 1746 | Ga0496106_0097357 | |||
| 1747 | Ga0496106_0150111 | |||
| 1748 | Ga0496106_0201806 | |||
| 1749 | Ga0496106_0209711 | |||
| 1750 | Ga0496106_0227685 | |||
| 1751 | Ga0496106_0289827 | |||
| 1752 | Ga0496106_0402541 | |||
| 1753 | Ga0496107_0065728 | |||
| 1754 | Ga0496107_0112717 | |||
| 1755 | Ga0496107_0132295 | |||
| 1756 | Ga0496107_0350499 | |||
| 1757 | Ga0496107_0390346 | |||
| 1758 | Ga0496108_0013443 | |||
| 1759 | Ga0496108_0197435 | |||
| 1760 | Ga0496109_0007343 | |||
| 1761 | Ga0496109_0008379 | |||
| 1762 | Ga0496109_0141565 | |||
| 1763 | Ga0496109_0253645 | |||
| 1764 | Ga0496110_0004140 | |||
| 1765 | Ga0496110_0061624 | |||
| 1766 | Ga0496110_0067803 | |||
| 1767 | Ga0496111_0019197 | |||
| 1768 | Ga0496111_0085901 | |||
| 1769 | Ga0496111_0270260 | |||
| 1770 | Ga0496112_0000021 | |||
| 1771 | Ga0496112_0006620 | |||
| 1772 | Ga0496112_0025529 | |||
| 1773 | Ga0496112_0109612 | |||
| 1774 | Ga0496112_0194607 | |||
| 1775 | Ga0496113_0003687 | |||
| 1776 | Ga0496113_0003980 | |||
| 1777 | Ga0496114_0029515 | |||
| 1778 | Ga0496114_0049504 | |||
| 1779 | Ga0496114_0194952 | |||
| 1780 | Ga0496114_0739597 | |||
| 1781 | Ga0496115_0015849 | |||
| 1782 | Ga0496115_0093337 | |||
| 1783 | Ga0496115_0497248 | |||
| 1784 | Ga0496116_0105200 | |||
| 1785 | Ga0496117_0054893 | |||
| 1786 | Ga0496117_0103442 | |||
| 1787 | Ga0496117_0169936 | |||
| 1788 | Ga0496118_0052584 | |||
| 1789 | Ga0496118_0145815 | |||
| 1790 | Ga0496119_0047744 | |||
| 1791 | Ga0496119_0155388 | |||
| 1792 | Ga0496121_0002742 | |||
| 1793 | Ga0496121_0024447 | |||
| 1794 | Ga0496121_0034621 | |||
| 1795 | Ga0496121_0043514 | |||
| 1796 | Ga0496121_0056434 | |||
| 1797 | Ga0496121_0073209 | |||
| 1798 | Ga0496121_0077405 | |||
| 1799 | Ga0496121_0081807 | |||
| 1800 | Ga0496121_0114288 | |||
| 1801 | Ga0496121_0184984 | |||
| 1802 | Ga0496121_0188726 | |||
| 1803 | Ga0496121_0199758 | |||
| 1804 | Ga0496121_0354191 | |||
| 1805 | Ga0496121_0419572 | |||
| 1806 | Ga0496122_0016696 | |||
| 1807 | Ga0496122_0035337 | |||
| 1808 | Ga0496123_0073879 | |||
| 1809 | Ga0496123_0207966 | |||
| 1810 | Ga0496124_0041583 | |||
| 1811 | Ga0496124_0072962 | |||
| 1812 | Ga0496125_0074210 | |||
| 1813 | Ga0496125_0161388 | |||
| 1814 | Ga0496125_0293923 | |||
| 1815 | Ga0496126_0004520 | |||
| 1816 | Ga0496126_0014485 | |||
| 1817 | Ga0496126_0018300 | |||
| 1818 | Ga0496126_0030809 | |||
| 1819 | Ga0496126_0041355 | |||
| 1820 | Ga0496126_0045430 | |||
| 1821 | Ga0496126_0046504 | |||
| 1822 | Ga0496126_0062972 | |||
| 1823 | Ga0496126_0066922 | |||
| 1824 | Ga0496126_0128014 | |||
| 1825 | Ga0496126_0162545 | |||
| 1826 | Ga0496126_0176023 | |||
| 1827 | Ga0496126_0217898 | |||
| 1828 | Ga0496126_0394225 | |||
| 1829 | Ga0495682_0159909 | |||
| 1830 | Ga0501031_0000864 | |||
| 1831 | Ga0501031_0035030 | |||
| 1832 | Ga0501032_0001394 | |||
| 1833 | Ga0501032_0018316 | |||
| 1834 | Ga0501032_0019702 | |||
| 1835 | Ga0501033_0000155 | |||
| 1836 | Ga0501033_0001376 | |||
| 1837 | Ga0501033_0067594 | |||
| 1838 | Ga0501034_0000232 | |||
| 1839 | Ga0501034_0175846 | |||
| 1840 | Ga0501034_0216211 | |||
| 1841 | Ga0501034_0504715 | |||
| 1842 | Ga0501036_0000425 | |||
| 1843 | Ga0501036_0173951 | |||
| 1844 | Ga0501036_0254769 | |||
| 1845 | Ga0501037_0000463 | |||
| 1846 | Ga0501037_0009561 | |||
| 1847 | Ga0501037_0082565 | |||
| 1848 | Ga0501038_0000943 | |||
| 1849 | Ga0501038_0021700 | |||
| 1850 | Ga0501038_0160581 | |||
| 1851 | Ga0501039_0008204 | |||
| 1852 | Ga0501039_0031614 | |||
| 1853 | Ga0501039_0063458 | |||
| 1854 | Ga0501040_0047444 | |||
| 1855 | Ga0501042_0031953 | |||
| 1856 | Ga0501042_0093859 | |||
| 1857 | Ga0501042_0100439 | |||
| 1858 | Ga0501043_0000035 | |||
| 1859 | Ga0501043_0005159 | |||
| 1860 | Ga0501043_0009741 | |||
| 1861 | Ga0501046_0027631 | |||
| 1862 | Ga0501046_0033024 | |||
| 1863 | Ga0501046_0039309 | |||
| 1864 | Ga0501046_0056526 | |||
| 1865 | Ga0501047_0000085 | |||
| 1866 | Ga0501047_0062533 | |||
| 1867 | Ga0501047_0117793 | |||
| 1868 | Ga0501048_0000061 | |||
| 1869 | Ga0501048_0017589 | |||
| 1870 | Ga0501067_0002400 | |||
| 1871 | Ga0501067_0027068 | |||
| 1872 | Ga0501068_0003110 | |||
| 1873 | Ga0501068_0004955 | |||
| 1874 | Ga0501068_0118305 | |||
| 1875 | Ga0501069_0043593 | |||
| 1876 | Ga0501069_0054769 | |||
| 1877 | Ga0501070_0000272 | |||
| 1878 | Ga0501072_0000537 | |||
| 1879 | Ga0501072_0414184 | |||
| 1880 | Ga0501073_0000026 | |||
| 1881 | Ga0501073_0054428 | |||
| 1882 | Ga0501073_0118470 | |||
| 1883 | Ga0501074_0000017 | |||
| 1884 | Ga0501074_0024699 | |||
| 1885 | Ga0501074_0035306 | |||
| 1886 | Ga0501076_0074303 | |||
| 1887 | Ga0501076_0157968 | |||
| 1888 | Ga0501079_0014040 | |||
| 1889 | Ga0501080_0005584 | |||
| 1890 | Ga0501080_0036359 | |||
| 1891 | Ga0501080_0038761 | |||
| 1892 | Ga0501080_0149343 | |||
| 1893 | Ga0501081_0190457 | |||
| 1894 | Ga0501083_0000264 | |||
| 1895 | Ga0501083_0015098 | |||
| 1896 | Ga0501035_0000548 | |||
| 1897 | Ga0501035_0002887 | |||
| 1898 | Ga0501035_0053294 | |||
| 1899 | Ga0501035_0324431 | |||
| 1900 | Ga0501035_0556564 | |||
| 1901 | Ga0501044_0000051 | |||
| 1902 | Ga0501044_0002908 | |||
| 1903 | Ga0501044_0015682 | |||
| 1904 | Ga0501044_0044996 | |||
| 1905 | Ga0501044_0056733 | |||
| 1906 | Ga0501045_0004421 | |||
| 1907 | nmdc:mga03n38_69948_c1 | |||
| 1908 | nmdc:mga00v17_241032_c1 | |||
| 1909 | nmdc:mga00v17_58782_c1 | |||
| 1910 | nmdc:mga0yw44_199478_c1 | |||
| 1911 | nmdc:mga0yw44_5148_c1 | |||
| 1912 | nmdc:mga0yw44_77380_c1 | |||
| 1913 | nmdc:mga0k408_27004_c1 | |||
| 1914 | nmdc:mga06z11_7637_c1 | |||
| 1915 | nmdc:mga07m45_10610_c1 | |||
| 1916 | nmdc:mga07m45_193668_c1 | |||
| 1917 | nmdc:mga07m45_21995_c1 | |||
| 1918 | nmdc:mga07m45_258776_c1 | |||
| 1919 | nmdc:mga05p37_862963_c1 | |||
| 1920 | nmdc:mga08y16_196284_c1 | |||
| 1921 | nmdc:mga08y16_493786_c1 | |||
| 1922 | nmdc:mga0n895_530750_c1 | |||
| 1923 | nmdc:mga0sz30_109892_c1 | |||
| 1924 | nmdc:mga0sz30_273184_c1 | |||
| 1925 | Ga0495601_0016290 | |||
| 1926 | Ga0495601_0162692 | |||
| 1927 | Ga0495612_0043880 | |||
| 1928 | Ga0495612_0081393 | |||
| 1929 | Ga0495595_0027301 | |||
| 1930 | Ga0495595_0033143 | |||
| 1931 | Ga0495619_0010939 | |||
| 1932 | Ga0495619_0071904 | |||
| 1933 | Ga0495619_0085382 | |||
| 1934 | Ga0500578_0101424 | |||
| 1935 | Ga0500578_0181253 | |||
| 1936 | Ga0500647_0016096 | |||
| 1937 | Ga0500583_0064941 | |||
| 1938 | Ga0500651_0141906 | |||
| 1939 | Ga0500566_0001308 | |||
| 1940 | Ga0500566_0002248 | |||
| 1941 | Ga0500566_0036554 | |||
| 1942 | Ga0500641_0001881 | |||
| 1943 | Ga0500641_0006011 | |||
| 1944 | Ga0500641_0012131 | |||
| 1945 | Ga0500641_0080164 | |||
| 1946 | Ga0500650_0048216 | |||
| 1947 | Ga0500554_022916 | |||
| 1948 | Ga0500554_025861 | |||
| 1949 | Ga0500555_000359 | |||
| 1950 | Ga0500556_0047341 | |||
| 1951 | Ga0500562_034792 | |||
| 1952 | Ga0500592_001571 | |||
| 1953 | Ga0500595_003793 | |||
| 1954 | Ga0500595_039911 | |||
| 1955 | Ga0500607_231785 | |||
| 1956 | Ga0500608_088031 | |||
| 1957 | Ga0500618_008918 | |||
| 1958 | Ga0500642_0010090 | |||
| 1959 | Ga0500652_040407 | |||
| 1960 | Ga0500658_0111149 | |||
| 1961 | Ga0500658_0190988 | |||
| 1962 | Ga0500559_0035914 | |||
| 1963 | Ga0500559_0050244 | |||
| 1964 | Ga0500561_0145658 | |||
| 1965 | Ga0500577_0000274 | |||
| 1966 | Ga0500579_194710 | |||
| 1967 | Ga0500589_057710 | |||
| 1968 | Ga0500590_027454 | |||
| 1969 | Ga0500603_017374 | |||
| 1970 | Ga0500603_049325 | |||
| 1971 | Ga0500604_0089422 | |||
| 1972 | Ga0500620_079162 | |||
| 1973 | Ga0500627_0032689 | |||
| 1974 | Ga0500636_0036791 | |||
| 1975 | Ga0500637_0000088 | |||
| 1976 | Ga0500637_0135409 | |||
| 1977 | Ga0500637_0203632 | |||
| 1978 | Ga0500611_010511 | |||
| 1979 | Ga0500645_008427 | |||
| 1980 | Ga0501084_0012701 | |||
| 1981 | Ga0501082_0010719 | |||
| 1982 | Ga0501082_0272665 | |||
| 1983 | Ga0466962_0029856 | |||
| 1984 | 2513654765 | |||
| 1985 | 2513675869 | |||
| 1986 | 2513692563 | |||
| 1987 | 2513855814 | |||
| 1988 | 2513863673 | |||
| 1989 | 2513915055 | |||
| 1990 | 2515629854 | |||
| 1991 | 2517106800 | |||
| 1992 | 2517892352 | |||
| 1993 | 2524538559 | |||
| 1994 | 2617349055 | |||
| 1995 | 2671120397 | |||
| 1996 | 2723845052 | |||
| 1997 | 2728751150 | |||
| 1998 | 2793072171 | |||
| 1999 | 2793082079 | |||
| 2000 | 2824679185 | |||
| 2001 | 2824695789 | |||
| 2002 | 2824779582 | |||
| 2003 | 2847936254 | |||
| 2004 | 2874598095 | |||
| 2005 | 2874605231 | |||
| 2006 | 2874631897 | |||
| 2007 | 2874645436 | |||
| 2008 | 2876778427 | |||
| 2009 | 2876814300 | |||
| 2010 | 2876820373 | |||
| 2011 | 2879082221 | |||
| 2012 | 2879090673 | |||
| 2013 | 2879100556 | |||
| 2014 | 2879111225 | |||
| 2015 | 2879135368 | |||
| 2016 | 2879150577 | |||
| 2017 | 2885380536 | |||
| 2018 | 2885386571 | |||
| 2019 | 2889039806 | |||
| 2020 | 2893070545 | |||
| 2021 | 2903749335 | |||
| 2022 | 2903773982 | |||
| 2023 | 2904695857 | |||
| 2024 | 2904703494 | |||
| 2025 | 2906618673 | |||
| 2026 | 2906638888 | |||
| 2027 | 2906666331 | |||
| 2028 | 2908742650 | |||
| 2029 | 2908761158 | |||
| 2030 | 2922365391 | |||
| 2031 | 2922376912 | |||
| 2032 | 2922391002 | |||
| 2033 | 2922430332 | |||
| 2034 | 2932790133 | |||
| 2035 | 2932818087 | |||
| 2036 | 2932827921 | |||
| 2037 | 2935608923 | |||
| 2038 | 2935631626 | |||
| 2039 | 2935653376 | |||
| 2040 | 2935660153 | |||
| 2041 | 2935684187 | |||
| 2042 | 2935693383 | |||
| 2043 | 2935700151 | |||
| 2044 | 2935720828 | |||
| 2045 | 2935730685 | |||
| 2046 | 2935740550 | |||
| 2047 | 2935749976 | |||
| 2048 | 2935759204 | |||
| 2049 | 2935769622 | |||
| 2050 | 2935776919 | |||
| 2051 | 2935778570 | |||
| 2052 | 2935792235 | |||
| 2053 | 2935800398 | |||
| 2054 | 2935819670 | |||
| 2055 | 2935822083 | |||
| 2056 | 2935847665 | |||
| 2057 | 2935909063 | |||
| 2058 | 2935919783 | |||
| 2059 | 2935926363 | |||
| 2060 | 2935934813 | |||
| 2061 | 2935943263 | |||
| 2062 | 2935951701 | |||
| 2063 | 2935967826 | |||
| 2064 | 2935982621 | |||
| 2065 | 2936016246 | |||
| 2066 | 2936024879 | |||
| 2067 | 2936032127 | |||
| 2068 | 2936046427 | |||
| 2069 | 2936049988 | |||
| 2070 | 2936060941 | |||
| 2071 | 2940565270 | |||
| 2072 | 2941511420 | |||
| 2073 | 2941519121 | |||
| 2074 | 2941526299 | |||
| 2075 | 2941532857 | |||
| 2076 | 3005480254 | |||
| 2077 | 3005484360 | |||
| 2078 | 3005588008 | |||
| 2079 | 3005714947 | |||
| 2080 | 8006940630 | |||
| 2081 | 8006965777 | |||
| 2082 | 8006980319 | |||
| 2083 | 8006987013 | |||
| 2084 | 8006996001 | |||
| 2085 | 8016529574 | |||
| 2086 | 8016534787 | |||
| 2087 | 8016548004 | |||
| 2088 | 8016554126 | |||
| 2089 | 8016562503 | |||
| 2090 | 8016577279 | |||
| 2091 | 8016600293 | |||
| 2092 | 8016610457 | |||
| 2093 | 8016614478 | |||
| 2094 | 8016626519 | |||
| 2095 | 8016640286 | |||
| 2096 | 8019534556 | |||
| 2097 | 8019544916 | |||
| 2098 | 8019553617 | |||
| 2099 | 8019568608 | |||
| 2100 | 8019628220 | |||
| 2101 | 8019634409 | |||
| 2102 | 8019645328 | |||
| 2103 | 8019662289 | |||
| 2104 | 8019671794 | |||
| 2105 | 8019684300 | |||
| 2106 | 8056673833 | |||
| 2107 | 8056686691 | |||
| 2108 | 8056693511 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o3z-assembly1.cif.gz_D | crystal structure of sorbitol-6-phosphate 2-dehydrogenase srld from erwinia amylovora | 0.9243 | 4 | 224 |
| 6zzs-assembly2.cif.gz_F-2 | crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate | 0.9193 | 2 | 222 |
| 6xex-assembly1.cif.gz_B | structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a/v139q | 0.9192 | 1 | 222 |
| 3tzq-assembly1.cif.gz_A | crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum | 0.9188 | 2 | 221 |
| 6vsp-assembly1.cif.gz_B | structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a | 0.9142 | 1 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q869N3_132_238_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9531 | 2 | 36 | 3.90.180.10 |
| af_Q0JEC9_1_74_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9464 | 1 | 33 | 3.40.50.720 |
| af_A0A1D6ED38_49_231_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9237 | 1 | 171 | 3.40.50.720 |
| 3awdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9158 | 1 | 222 | 3.40.50.720 |
| 4npcA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9137 | 1 | 222 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5D3JYC9-F1-model_v4 | SDR family oxidoreductase | 0.9769 | 1 | 226 |
GO:0016616
GO:0030497 |
| AF-A0A1H6MA19-F1-model_v4 | 3-oxoacyl-[acyl-carrier protein] reductase | 0.976 | 1 | 226 |
GO:0016616
GO:0030497 |
| AF-A0A6F8NNH5-F1-model_v4 | deleted | 0.9752 | 1 | 226 |
|
| AF-A0A0S6UVM3-F1-model_v4 | 3-oxoacyl-[acyl-carrier protein] reductase | 0.9737 | 2 | 226 |
GO:0016616
GO:0030497 |
| AF-A0A6F8NNH5-F1-model_v4 | deleted | 0.9709 | 1 | 226 |
|