F489131

General Info

Members Datasets Scaffolds Average Seq Length
1054 560 2108 226

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_0235356|Ga0451793_0235356_29_859
Length 276
Sequence MDGKVIVVTGALGALGRVVVDEALARRARIASVDHAPTQAPATADLFELGGVDLTDAAHARKAIDAAAAHFGKLDALINIAGGFAFETVADGDPRTWQRMYALNVMTALNASRAAIPHLISLGTGRIVNIGAMGALQAGSGMGAYAASKAGVHRLTEALAAELKGKITVNAVLPSVIDTAANRASMPKADFTKWVTPKELADVILFLANPFDQVIITIKFDIFEFCLVNFSDNIFIIRRDNLSAIIPINLITIIFRWIMGSRQNDACVALFIPNGK

Samples

Sample ID Description Type Environment
1 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
88 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
178 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
179 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
180 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
212 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
244 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
249 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
270 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
271 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
272 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
273 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
274 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
279 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
280 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
281 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
282 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
283 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
289 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
300 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
301 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
302 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
305 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
306 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
307 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
310 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
311 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
314 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
322 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
323 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
324 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
325 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
328 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
329 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
330 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
348 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
349 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
350 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
351 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
352 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
353 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
354 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
355 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
356 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
357 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
358 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
373 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
374 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
375 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
376 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
377 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
378 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
387 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
390 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
391 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
392 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
393 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
397 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
398 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
402 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
403 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
404 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
405 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
406 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
407 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
408 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
409 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
410 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
411 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
412 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
413 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
414 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
415 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
416 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
417 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
418 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
419 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
420 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
421 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
422 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
423 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
424 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
425 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
426 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
427 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
428 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
429 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
430 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
431 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
432 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
433 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
434 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
435 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
436 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
437 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
438 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
439 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
440 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
441 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
442 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
443 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
444 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
445 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
446 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
447 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
448 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
449 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
450 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
451 2791355199
452 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
453 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
454 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
455 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
456 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
457 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
458 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
459 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
460 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
461 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
462 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
463 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
464 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
465 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
466 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
467 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
468 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
469 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
470 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
471 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
472 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
473 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
474 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
475 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
476 2904699407
477 2906610324
478 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
479 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
480 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
481 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
482 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
483 2922368715
484 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
485 2922425934
486 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
487 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
488 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
489 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
490 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
491 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
492 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
493 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
494 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
495 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
496 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
497 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
498 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
499 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
500 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
501 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
502 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
503 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
504 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
505 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
506 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
507 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
508 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
509 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
510 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
511 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
512 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
513 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
514 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
515 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
516 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
517 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
518 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
519 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
520 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
521 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
522 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
523 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
524 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
525 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
526 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
527 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
528 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
529 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
530 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
531 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
532 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
533 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
534 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
535 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
536 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
537 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
538 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
539 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
540 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
541 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
542 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
543 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
544 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
545 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
546 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
547 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
548 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
549 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
550 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
551 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
552 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
553 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
554 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
555 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
556 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
557 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
558 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
559 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
560 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.56
Metatranscriptomes 0
Isolates 11.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.82
Nodule 10.15
Rhizoplane 6.26
Rhizosphere 66.13
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451793_0235356 3300041452 Bacteria 1196
2 JGI25406J46586_10000281 3300003203 Bacteria 22733
3 JGI25165J46597_1007017 3300003214 Bacteria 1923
4 rootL2_10100710 3300003322 Bacteria 2896
5 JGI25404J52841_10011790 3300003659 Bacteria 1888
6 JGI25404J52841_10012955 3300003659 Bacteria 1809
7 JGI25404J52841_10031890 3300003659 Bacteria 1125
8 Ga0055539_1003432 3300003752 Bacteria 2220
9 Ga0055526_1019009 3300003771 Bacteria 2526
10 Ga0065165_1053829 3300005262 Bacteria 1130
11 Ga0070658_10034097 3300005327 Bacteria 4095
12 Ga0070658_10203097 3300005327 Bacteria 1673
13 Ga0070676_10029266 3300005328 Bacteria 3132
14 Ga0070676_10281594 3300005328 Bacteria 1121
15 Ga0070676_10622459 3300005328 Bacteria 781
16 Ga0070683_100014826 3300005329 Bacteria 6832
17 Ga0070683_100217859 3300005329 Bacteria 1814
18 Ga0070690_100078908 3300005330 Bacteria 2152
19 Ga0070670_100386448 3300005331 Bacteria 1234
20 Ga0068869_100055860 3300005334 Bacteria 2878
21 Ga0070680_100012011 3300005336 Bacteria 6719
22 Ga0070680_100046708 3300005336 Bacteria 3524
23 Ga0070680_100071792 3300005336 Bacteria 2845
24 Ga0070680_100177524 3300005336 Bacteria 1793
25 Ga0070682_100072086 3300005337 Bacteria 2213
26 Ga0068868_100011517 3300005338 Bacteria 6441
27 Ga0068868_100066951 3300005338 Bacteria 2857
28 Ga0070660_100093459 3300005339 Bacteria 2375
29 Ga0070691_10071785 3300005341 Bacteria 1681
30 Ga0070687_100506183 3300005343 Bacteria 814
31 Ga0070668_100130158 3300005347 Bacteria 2019
32 Ga0070668_100142498 3300005347 Bacteria 1932
33 Ga0070668_100156536 3300005347 Bacteria 1846
34 Ga0070669_100152215 3300005353 Bacteria 1791
35 Ga0070669_100687906 3300005353 Bacteria 863
36 Ga0070671_100043116 3300005355 Bacteria 3750
37 Ga0070674_100036986 3300005356 Bacteria 3281
38 Ga0070674_100162383 3300005356 Bacteria 1696
39 Ga0070674_100400321 3300005356 Bacteria 1122
40 Ga0070673_100019014 3300005364 Bacteria 4927
41 Ga0070673_100228435 3300005364 Bacteria 1614
42 Ga0070688_100340574 3300005365 Bacteria 1095
43 Ga0070659_100235810 3300005366 Bacteria 1513
44 Ga0070667_100109172 3300005367 Bacteria 2397
45 Ga0070709_10001094 3300005434 Bacteria 14950
46 Ga0070709_10041110 3300005434 Bacteria 2847
47 Ga0070709_10202089 3300005434 Bacteria 1408
48 Ga0070714_100038308 3300005435 Bacteria 4030
49 Ga0070714_100054442 3300005435 Bacteria 3418
50 Ga0070714_100282881 3300005435 Bacteria 1542
51 Ga0070713_100006735 3300005436 Bacteria 8003
52 Ga0070710_10005972 3300005437 Bacteria 5815
53 Ga0070710_10066910 3300005437 Bacteria 2061
54 Ga0070701_10125942 3300005438 Bacteria 1450
55 Ga0070711_100003469 3300005439 Bacteria 9192
56 Ga0070711_100155291 3300005439 Bacteria 1729
57 Ga0070711_100649662 3300005439 Bacteria 884
58 Ga0070700_100241200 3300005441 Bacteria 1292
59 Ga0070708_100302416 3300005445 Bacteria 1506
60 Ga0070663_100030492 3300005455 Bacteria 3696
61 Ga0070663_100069828 3300005455 Bacteria 2553
62 Ga0070663_100101625 3300005455 Bacteria 2146
63 Ga0070663_100112165 3300005455 Bacteria 2050
64 Ga0070663_100167570 3300005455 Bacteria 1695
65 Ga0070678_100017537 3300005456 Bacteria 4614
66 Ga0070678_100039996 3300005456 Bacteria 3314
67 Ga0070678_100056119 3300005456 Bacteria 2878
68 Ga0070678_100102030 3300005456 Bacteria 2225
69 Ga0070662_100020030 3300005457 Bacteria 4552
70 Ga0070662_100157581 3300005457 Bacteria 1773
71 Ga0070662_100448936 3300005457 Bacteria 1070
72 Ga0070681_10113617 3300005458 Bacteria 2647
73 Ga0070681_10163131 3300005458 Bacteria 2152
74 Ga0070681_10241891 3300005458 Bacteria 1718
75 Ga0068867_100032942 3300005459 Bacteria 3749
76 Ga0068867_100232873 3300005459 Bacteria 1490
77 Ga0070698_100035656 3300005471 Bacteria 5141
78 Ga0070698_100278044 3300005471 Bacteria 1606
79 Ga0070698_100378639 3300005471 Bacteria 1348
80 Ga0070698_100505426 3300005471 Bacteria 1147
81 Ga0070679_100016725 3300005530 Bacteria 7086
82 Ga0070679_100044244 3300005530 Bacteria 4436
83 Ga0070679_100044856 3300005530 Bacteria 4404
84 Ga0070679_100059816 3300005530 Bacteria 3797
85 Ga0070679_100081880 3300005530 Bacteria 3218
86 Ga0070684_100016386 3300005535 Bacteria 6056
87 Ga0070684_100092163 3300005535 Bacteria 2696
88 Ga0070684_100318891 3300005535 Bacteria 1428
89 Ga0070697_100102945 3300005536 Bacteria 2373
90 Ga0068853_100032728 3300005539 Bacteria 4406
91 Ga0068853_100063118 3300005539 Bacteria 3208
92 Ga0068853_100067836 3300005539 Bacteria 3100
93 Ga0068853_100201434 3300005539 Bacteria 1812
94 Ga0068853_100332967 3300005539 Bacteria 1409
95 Ga0068853_100398999 3300005539 Bacteria 1287
96 Ga0068853_100441134 3300005539 Bacteria 1223
97 Ga0068853_100777793 3300005539 Bacteria 916
98 Ga0070672_100160902 3300005543 Bacteria 1862
99 Ga0070672_100326124 3300005543 Bacteria 1306
100 Ga0070686_100441382 3300005544 Bacteria 998
101 Ga0070696_100065382 3300005546 Bacteria 2550
102 Ga0070696_100171572 3300005546 Bacteria 1604
103 Ga0070696_100394342 3300005546 Bacteria 1081
104 Ga0070693_100078642 3300005547 Bacteria 1960
105 Ga0070665_100070951 3300005548 Bacteria 3490
106 Ga0070665_100074289 3300005548 Bacteria 3405
107 Ga0070665_100437026 3300005548 Bacteria 1318
108 Ga0070665_100599282 3300005548 Bacteria 1115
109 Ga0068855_100047648 3300005563 Bacteria 5063
110 Ga0068855_100068829 3300005563 Bacteria 4120
111 Ga0068855_100117677 3300005563 Bacteria 3044
112 Ga0068855_100142890 3300005563 Bacteria 2726
113 Ga0068855_101150668 3300005563 Bacteria 809
114 Ga0070664_100041691 3300005564 Bacteria 3873
115 Ga0070664_100230507 3300005564 Bacteria 1660
116 Ga0068857_100022401 3300005577 Bacteria 5558
117 Ga0068857_100052978 3300005577 Bacteria 3600
118 Ga0068857_100468771 3300005577 Bacteria 1179
119 Ga0068854_100129113 3300005578 Bacteria 1928
120 Ga0068854_100266046 3300005578 Bacteria 1374
121 Ga0068854_100720510 3300005578 Bacteria 863
122 Ga0068856_100000082 3300005614 Bacteria 88302
123 Ga0068856_100338009 3300005614 Bacteria 1524
124 Ga0068856_101395149 3300005614 Unclassified 715
125 Ga0070702_100047672 3300005615 Bacteria 2435
126 Ga0070702_100072831 3300005615 Bacteria 2034
127 Ga0068852_100570361 3300005616 Bacteria 1134
128 Ga0068859_100031018 3300005617 Bacteria 5365
129 Ga0068859_100370837 3300005617 Bacteria 1527
130 Ga0068859_100890985 3300005617 Bacteria 975
131 Ga0068864_100023523 3300005618 Bacteria 5175
132 Ga0068864_100414963 3300005618 Bacteria 1282
133 Ga0068866_10023610 3300005718 Bacteria 2863
134 Ga0068861_100024737 3300005719 Bacteria 4346
135 Ga0068861_100057655 3300005719 Bacteria 2967
136 Ga0068861_100158740 3300005719 Bacteria 1863
137 Ga0068861_100539935 3300005719 Bacteria 1061
138 Ga0068870_10316074 3300005840 Bacteria 991
139 Ga0068863_100160927 3300005841 Bacteria 2151
140 Ga0068863_100343320 3300005841 Bacteria 1453
141 Ga0068858_100155923 3300005842 Bacteria 2148
142 Ga0068858_100320225 3300005842 Bacteria 1482
143 Ga0068858_100354559 3300005842 Bacteria 1405
144 Ga0068860_100083701 3300005843 Bacteria 3034
145 Ga0068862_100045299 3300005844 Bacteria 3753
146 Ga0068862_100118586 3300005844 Bacteria 2330
147 Ga0068862_100127591 3300005844 Bacteria 2247
148 Ga0068862_100161087 3300005844 Bacteria 2002
149 Ga0068862_100200622 3300005844 Bacteria 1798
150 Ga0081455_10004092 3300005937 Bacteria 16511
151 Ga0081455_10012714 3300005937 Bacteria 8376
152 Ga0081455_10117859 3300005937 Bacteria 2098
153 Ga0081538_10072145 3300005981 Bacteria 1895
154 Ga0081540_1005571 3300005983 Bacteria 9379
155 Ga0081540_1010961 3300005983 Bacteria 6088
156 Ga0081540_1012602 3300005983 Bacteria 5551
157 Ga0081540_1014018 3300005983 Bacteria 5170
158 Ga0081540_1014599 3300005983 Bacteria 5021
159 Ga0081539_10001902 3300005985 Bacteria 32363
160 Ga0081539_10026944 3300005985 Bacteria 3652
161 Ga0070717_10191195 3300006028 Bacteria 1789
162 Ga0070717_10216381 3300006028 Bacteria 1683
163 Ga0075365_10029868 3300006038 Bacteria 3487
164 Ga0075365_10042134 3300006038 Bacteria 2983
165 Ga0075365_10062393 3300006038 Bacteria 2493
166 Ga0075365_10062403 3300006038 Bacteria 2492
167 Ga0075365_10107272 3300006038 Bacteria 1917
168 Ga0075365_10160278 3300006038 Bacteria 1567
169 Ga0075368_10021445 3300006042 Bacteria 2454
170 Ga0075368_10131470 3300006042 Bacteria 1040
171 Ga0075363_100001764 3300006048 Bacteria 8449
172 Ga0075363_100015088 3300006048 Bacteria 3789
173 Ga0075363_100156860 3300006048 Bacteria 1287
174 Ga0075364_10026005 3300006051 Bacteria 3730
175 Ga0075364_10085792 3300006051 Bacteria 2085
176 Ga0070716_100062303 3300006173 Bacteria 2162
177 Ga0070712_100033812 3300006175 Bacteria 3461
178 Ga0075367_10005871 3300006178 Bacteria 6153
179 Ga0075367_10032643 3300006178 Bacteria 2997
180 Ga0075367_10125533 3300006178 Bacteria 1584
181 Ga0075367_10344107 3300006178 Bacteria 941
182 Ga0075366_10031763 3300006195 Bacteria 3108
183 Ga0097621_100020182 3300006237 Bacteria 5132
184 Ga0097621_100610704 3300006237 Bacteria 998
185 Ga0075370_10007760 3300006353 Bacteria 5480
186 Ga0075370_10072391 3300006353 Bacteria 1973
187 Ga0075370_10199653 3300006353 Bacteria 1179
188 Ga0068871_100037995 3300006358 Bacteria 3842
189 Ga0068871_100565354 3300006358 Bacteria 1031
190 Ga0075434_100102162 3300006871 Bacteria 2875
191 Ga0068865_100173591 3300006881 Bacteria 1654
192 Ga0068865_100233342 3300006881 Bacteria 1445
193 Ga0097620_100031020 3300006931 Bacteria 5365
194 Ga0097620_100370862 3300006931 Bacteria 1527
195 Ga0097620_100891085 3300006931 Bacteria 975
196 Ga0099824_1005168 3300006942 Bacteria 18498
197 Ga0099822_1000080 3300006943 Bacteria 54304
198 Ga0075435_100072603 3300007076 Bacteria 2812
199 Ga0099795_10163541 3300007788 Bacteria 920
200 Ga0105240_10093070 3300009093 Bacteria 3680
201 Ga0105240_10243455 3300009093 Bacteria 2084
202 Ga0105240_10525410 3300009093 Bacteria 1313
203 Ga0105245_10018466 3300009098 Bacteria 6098
204 Ga0105245_10071926 3300009098 Bacteria 3141
205 Ga0105245_10303800 3300009098 Bacteria 1566
206 Ga0105245_10951911 3300009098 Bacteria 902
207 Ga0105247_10060702 3300009101 Bacteria 2343
208 Ga0114129_10261607 3300009147 Bacteria 2319
209 Ga0105243_10065518 3300009148 Bacteria 2918
210 Ga0105241_10018025 3300009174 Bacteria 5190
211 Ga0105242_10182773 3300009176 Bacteria 1851
212 Ga0105242_10341975 3300009176 Bacteria 1379
213 Ga0105248_10296754 3300009177 Bacteria 1820
214 Ga0105248_10344985 3300009177 Bacteria 1676
215 Ga0105237_10133289 3300009545 Bacteria 2479
216 Ga0105237_11267513 3300009545 Bacteria 743
217 Ga0105238_10017099 3300009551 Bacteria 7361
218 Ga0105249_10702698 3300009553 Bacteria 1071
219 Ga0099796_10032206 3300010159 Bacteria 1716
220 Ga0099796_10095278 3300010159 Bacteria 1112
221 Ga0105239_10027964 3300010375 Bacteria 6205
222 Ga0105239_10090869 3300010375 Bacteria 3368
223 Ga0105239_10093008 3300010375 Bacteria 3329
224 Ga0105239_10176226 3300010375 Bacteria 2391
225 Ga0105239_10651824 3300010375 Bacteria 1203
226 Ga0157370_10018597 3300013104 Bacteria 6986
227 Ga0157370_10091789 3300013104 Bacteria 2851
228 Ga0157369_10044499 3300013105 Bacteria 4831
229 Ga0157374_10031099 3300013296 Bacteria 4849
230 Ga0157378_10018819 3300013297 Bacteria 6071
231 Ga0157378_10022108 3300013297 Bacteria 5597
232 Ga0157378_10438479 3300013297 Bacteria 1294
233 Ga0157378_10578532 3300013297 Bacteria 1132
234 Ga0163162_10039037 3300013306 Bacteria 4741
235 Ga0163162_10162176 3300013306 Bacteria 2357
236 Ga0163162_10452762 3300013306 Bacteria 1415
237 Ga0157372_10061947 3300013307 Bacteria 4190
238 Ga0157375_10043448 3300013308 Bacteria 4359
239 Ga0157375_10148469 3300013308 Bacteria 2477
240 Ga0157375_10283665 3300013308 Bacteria 1819
241 Ga0157375_10391438 3300013308 Bacteria 1557
242 Ga0163163_10009474 3300014325 Bacteria 8696
243 Ga0163163_10105290 3300014325 Bacteria 2847
244 Ga0163163_10122280 3300014325 Bacteria 2637
245 Ga0163163_10574400 3300014325 Bacteria 1190
246 Ga0157380_10106002 3300014326 Bacteria 2351
247 Ga0157380_10225124 3300014326 Bacteria 1681
248 Ga0157380_10520571 3300014326 Bacteria 1160
249 Ga0182008_10112772 3300014497 Bacteria 1348
250 Ga0157379_10085055 3300014968 Bacteria 2834
251 Ga0157379_10372137 3300014968 Bacteria 1310
252 Ga0157379_10865535 3300014968 Bacteria 856
253 Ga0157376_10156322 3300014969 Bacteria 2062
254 Ga0157376_10190326 3300014969 Bacteria 1881
255 Ga0163161_10308897 3300017792 Bacteria 1247
256 Ga0209677_100235 3300025253 Bacteria 38918
257 Ga0209677_104125 3300025253 Bacteria 4344
258 Ga0209233_1000995 3300025261 Bacteria 12116
259 Ga0209233_1020532 3300025261 Bacteria 1730
260 Ga0209564_1000726 3300025295 Bacteria 47041
261 Ga0209758_1000160 3300025297 Bacteria 154304
262 Ga0209758_1005354 3300025297 Bacteria 9951
263 Ga0207697_10236607 3300025315 Bacteria 807
264 Ga0207692_10468357 3300025898 Bacteria 795
265 Ga0207642_10015226 3300025899 Bacteria 2860
266 Ga0207642_10046811 3300025899 Bacteria 1929
267 Ga0207710_10051593 3300025900 Bacteria 1848
268 Ga0207710_10062572 3300025900 Bacteria 1691
269 Ga0207688_10025042 3300025901 Bacteria 3274
270 Ga0207688_10205279 3300025901 Bacteria 1183
271 Ga0207685_10193694 3300025905 Bacteria 950
272 Ga0207699_10000199 3300025906 Bacteria 35901
273 Ga0207699_10035185 3300025906 Bacteria 2848
274 Ga0207645_10054536 3300025907 Bacteria 2553
275 Ga0207645_10101239 3300025907 Bacteria 1859
276 Ga0207643_10017275 3300025908 Bacteria 3944
277 Ga0207643_10097662 3300025908 Bacteria 1719
278 Ga0207643_10343751 3300025908 Bacteria 936
279 Ga0207705_10117978 3300025909 Bacteria 1966
280 Ga0207705_10230047 3300025909 Bacteria 1410
281 Ga0207654_10288876 3300025911 Bacteria 1111
282 Ga0207707_10019532 3300025912 Bacteria 5915
283 Ga0207707_10038340 3300025912 Bacteria 4187
284 Ga0207707_10081725 3300025912 Bacteria 2821
285 Ga0207695_10128011 3300025913 Bacteria 2499
286 Ga0207695_10558749 3300025913 Bacteria 1026
287 Ga0207671_10028108 3300025914 Bacteria 4204
288 Ga0207671_10145503 3300025914 Bacteria 1828
289 Ga0207671_10692826 3300025914 Bacteria 810
290 Ga0207693_10016309 3300025915 Bacteria 5940
291 Ga0207693_10023034 3300025915 Bacteria 4946
292 Ga0207663_10009125 3300025916 Bacteria 5229
293 Ga0207663_10265882 3300025916 Bacteria 1268
294 Ga0207663_10666147 3300025916 Bacteria 822
295 Ga0207660_10024005 3300025917 Bacteria 4124
296 Ga0207660_10076336 3300025917 Bacteria 2450
297 Ga0207660_10240915 3300025917 Bacteria 1425
298 Ga0207662_10420603 3300025918 Bacteria 909
299 Ga0207662_10685968 3300025918 Bacteria 717
300 Ga0207657_10107874 3300025919 Bacteria 2303
301 Ga0207657_10313003 3300025919 Bacteria 1242
302 Ga0207652_10009229 3300025921 Bacteria 7935
303 Ga0207681_10122380 3300025923 Bacteria 1910
304 Ga0207681_10787877 3300025923 Bacteria 794
305 Ga0207694_10254868 3300025924 Bacteria 1436
306 Ga0207650_10104033 3300025925 Bacteria 2190
307 Ga0207687_10047676 3300025927 Bacteria 2971
308 Ga0207687_10080533 3300025927 Bacteria 2351
309 Ga0207700_10023396 3300025928 Bacteria 4259
310 Ga0207700_10027500 3300025928 Bacteria 3984
311 Ga0207664_10037833 3300025929 Bacteria 3737
312 Ga0207664_10084718 3300025929 Bacteria 2586
313 Ga0207664_10246443 3300025929 Bacteria 1558
314 Ga0207644_10049291 3300025931 Bacteria 3014
315 Ga0207690_10048975 3300025932 Bacteria 2814
316 Ga0207690_10220619 3300025932 Bacteria 1450
317 Ga0207706_10064081 3300025933 Bacteria 3236
318 Ga0207706_10067934 3300025933 Bacteria 3137
319 Ga0207706_10544844 3300025933 Bacteria 999
320 Ga0207686_10358254 3300025934 Bacteria 1100
321 Ga0207686_10681966 3300025934 Bacteria 815
322 Ga0207709_10101125 3300025935 Bacteria 1906
323 Ga0207669_10042690 3300025937 Bacteria 2649
324 Ga0207669_10092936 3300025937 Bacteria 1969
325 Ga0207704_10017791 3300025938 Bacteria 3695
326 Ga0207704_10223241 3300025938 Bacteria 1396
327 Ga0207665_10048262 3300025939 Bacteria 2857
328 Ga0207691_10144219 3300025940 Bacteria 2097
329 Ga0207691_10184406 3300025940 Bacteria 1822
330 Ga0207711_10006349 3300025941 Bacteria 9970
331 Ga0207711_10264243 3300025941 Bacteria 1582
332 Ga0207711_10300140 3300025941 Bacteria 1481
333 Ga0207689_10034390 3300025942 Bacteria 4210
334 Ga0207689_10040742 3300025942 Bacteria 3844
335 Ga0207689_10072682 3300025942 Bacteria 2825
336 Ga0207661_10000410 3300025944 Bacteria 27651
337 Ga0207661_10025556 3300025944 Bacteria 4490
338 Ga0207661_10128801 3300025944 Bacteria 2165
339 Ga0207661_10191029 3300025944 Bacteria 1795
340 Ga0207679_10105971 3300025945 Bacteria 2209
341 Ga0207679_10198426 3300025945 Bacteria 1675
342 Ga0207679_10753129 3300025945 Bacteria 886
343 Ga0207667_10015305 3300025949 Bacteria 8721
344 Ga0207667_10340335 3300025949 Bacteria 1531
345 Ga0207667_10351614 3300025949 Bacteria 1503
346 Ga0207651_10005957 3300025960 Bacteria 6316
347 Ga0207712_10785744 3300025961 Bacteria 836
348 Ga0207668_10073885 3300025972 Bacteria 2445
349 Ga0207668_10158561 3300025972 Bacteria 1760
350 Ga0207668_10849036 3300025972 Bacteria 810
351 Ga0207640_10060990 3300025981 Bacteria 2496
352 Ga0207640_10079134 3300025981 Bacteria 2240
353 Ga0207640_10409990 3300025981 Bacteria 1106
354 Ga0207677_10138631 3300026023 Bacteria 1859
355 Ga0207703_10147225 3300026035 Bacteria 2050
356 Ga0207703_10255233 3300026035 Bacteria 1582
357 Ga0207703_10525752 3300026035 Bacteria 1113
358 Ga0207703_10961539 3300026035 Bacteria 819
359 Ga0207639_10056395 3300026041 Bacteria 3011
360 Ga0207639_10165950 3300026041 Bacteria 1865
361 Ga0207639_10233761 3300026041 Bacteria 1595
362 Ga0207639_10308612 3300026041 Bacteria 1401
363 Ga0207678_10010615 3300026067 Bacteria 8092
364 Ga0207678_10022267 3300026067 Bacteria 5551
365 Ga0207678_10025488 3300026067 Bacteria 5162
366 Ga0207678_10041263 3300026067 Bacteria 4001
367 Ga0207678_10084343 3300026067 Bacteria 2717
368 Ga0207678_10180874 3300026067 Bacteria 1801
369 Ga0207702_10000048 3300026078 Bacteria 143125
370 Ga0207702_10363745 3300026078 Bacteria 1387
371 Ga0207702_11191953 3300026078 Bacteria 756
372 Ga0207641_10114216 3300026088 Bacteria 2399
373 Ga0207641_10114252 3300026088 Bacteria 2399
374 Ga0207648_10316048 3300026089 Bacteria 1403
375 Ga0207648_10369199 3300026089 Bacteria 1296
376 Ga0207676_10017087 3300026095 Bacteria 5256
377 Ga0207676_10520449 3300026095 Bacteria 1132
378 Ga0207674_10019872 3300026116 Bacteria 7268
379 Ga0207674_10022445 3300026116 Bacteria 6776
380 Ga0207674_10279311 3300026116 Bacteria 1618
381 Ga0207675_100317319 3300026118 Bacteria 1521
382 Ga0207683_10023706 3300026121 Bacteria 5280
383 Ga0207683_10047585 3300026121 Bacteria 3756
384 Ga0207683_10048826 3300026121 Bacteria 3704
385 Ga0207683_10078139 3300026121 Bacteria 2932
386 Ga0207683_10524295 3300026121 Bacteria 1095
387 Ga0207698_10434428 3300026142 Bacteria 1263
388 Ga0207698_11267866 3300026142 Unclassified 751
389 Ga0209589_1000003 3300027357 Bacteria 629130
390 Ga0209489_100003 3300027361 Bacteria 663105
391 Ga0209700_100003 3300027363 Bacteria 663105
392 Ga0209700_100062 3300027363 Bacteria 145471
393 Ga0209179_1005091 3300027512 Bacteria 2032
394 Ga0209179_1051653 3300027512 Bacteria 882
395 Ga0209588_1003456 3300027671 Bacteria 4384
396 Ga0209813_10037989 3300027866 Bacteria 1453
397 Ga0207428_10078431 3300027907 Bacteria 2584
398 Ga0268266_10003304 3300028379 Bacteria 16206
399 Ga0268266_10015514 3300028379 Bacteria 6535
400 Ga0268266_10024812 3300028379 Bacteria 5101
401 Ga0268266_10333285 3300028379 Bacteria 1422
402 Ga0268266_10514402 3300028379 Bacteria 1144
403 Ga0268266_10567827 3300028379 Bacteria 1088
404 Ga0268266_10861559 3300028379 Bacteria 876
405 Ga0268265_10029396 3300028380 Bacteria 3943
406 Ga0268265_10063199 3300028380 Bacteria 2847
407 Ga0268265_10082635 3300028380 Bacteria 2540
408 Ga0268265_11140196 3300028380 Bacteria 775
409 Ga0268265_11155322 3300028380 Bacteria 770
410 Ga0268264_10029978 3300028381 Bacteria 4460
411 Ga0268264_10057650 3300028381 Bacteria 3249
412 Ga0265334_10047826 3300028573 Bacteria 1649
413 Ga0307517_10000063 3300028786 Bacteria 144304
414 Ga0307517_10161062 3300028786 Bacteria 1506
415 Ga0265330_10010793 3300031235 Bacteria 4297
416 Ga0265330_10030179 3300031235 Bacteria 2436
417 Ga0265332_10052081 3300031238 Bacteria 1758
418 Ga0265340_10109416 3300031247 Bacteria 1278
419 Ga0265339_10007926 3300031249 Bacteria 6812
420 Ga0265316_10139532 3300031344 Bacteria 1822
421 Ga0307509_10106942 3300031507 Bacteria 2815
422 Ga0307509_10162838 3300031507 Bacteria 2124
423 Ga0307509_10615197 3300031507 Bacteria 758
424 Ga0307509_10627582 3300031507 Bacteria 745
425 Ga0307408_100283910 3300031548 Bacteria 1380
426 Ga0307508_10086949 3300031616 Bacteria 2710
427 Ga0307508_10110140 3300031616 Bacteria 2353
428 Ga0307508_10233330 3300031616 Bacteria 1438
429 Ga0265314_10015169 3300031711 Bacteria 6124
430 Ga0265314_10141546 3300031711 Bacteria 1486
431 Ga0265342_10219401 3300031712 Bacteria 1025
432 Ga0307516_10019305 3300031730 Bacteria 7061
433 Ga0307516_10050530 3300031730 Bacteria 4079
434 Ga0307516_10073859 3300031730 Bacteria 3267
435 Ga0307405_10220116 3300031731 Bacteria 1392
436 Ga0307413_10229827 3300031824 Bacteria 1361
437 Ga0307406_10056391 3300031901 Bacteria 2516
438 Ga0307406_10222367 3300031901 Bacteria 1404
439 Ga0307407_10448484 3300031903 Bacteria 936
440 Ga0307412_10372253 3300031911 Bacteria 1154
441 Ga0307409_100101210 3300031995 Bacteria 2390
442 Ga0307416_100315508 3300032002 Bacteria 1562
443 Ga0307414_10170181 3300032004 Bacteria 1741
444 Ga0307415_100327322 3300032126 Bacteria 1280
445 Ga0307507_10013500 3300033179 Bacteria 9906
446 Ga0307510_10040869 3300033180 Bacteria 5081
447 Ga0307510_10075468 3300033180 Bacteria 3323
448 Ga0307510_10324839 3300033180 Bacteria 995
449 Ga0315911_1000001 3300033442 Bacteria 1088602
450 Ga0373958_0030497 3300034819 Bacteria 1055
451 Ga0373926_0132285 3300035083 Bacteria 945
452 Ga0373926_0139788 3300035083 Bacteria 919
453 Ga0373926_0195676 3300035083 Bacteria 777
454 Ga0373934_0001166 3300035086 Bacteria 9586
455 Ga0373934_0176385 3300035086 Bacteria 878
456 Ga0373951_0047078 3300035091 Bacteria 1053
457 Ga0373923_0026919 3300035111 Bacteria 2290
458 Ga0373936_0007632 3300035113 Bacteria 4064
459 Ga0373936_0069315 3300035113 Bacteria 1451
460 Ga0373936_0085233 3300035113 Bacteria 1319
461 Ga0373936_0277909 3300035113 Bacteria 752
462 Ga0373941_0152650 3300035115 Bacteria 849
463 Ga0373945_0032863 3300035116 Bacteria 1840
464 Ga0373953_0002003 3300035117 Bacteria 6055
465 Ga0373954_0134417 3300035118 Bacteria 1205
466 Ga0373956_0100820 3300035119 Bacteria 1339
467 Ga0373957_0004654 3300035120 Bacteria 4192
468 Ga0373943_0005215 3300035170 Bacteria 5851
469 Ga0373943_0036263 3300035170 Bacteria 2361
470 Ga0373946_0004563 3300035171 Bacteria 4963
471 Ga0373946_0025755 3300035171 Bacteria 2315
472 Ga0373955_0053270 3300035172 Bacteria 2209
473 Ga0373955_0061404 3300035172 Bacteria 2075
474 Ga0373955_0091553 3300035172 Bacteria 1733
475 Ga0373924_0033654 3300035410 Bacteria 2070
476 Ga0373924_0125478 3300035410 Bacteria 1115
477 Ga0373931_0024745 3300035691 Bacteria 3044
478 Ga0373935_0000701 3300035692 Bacteria 17791
479 Ga0373935_0056886 3300035692 Bacteria 2494
480 Ga0373927_0001744 3300035695 Bacteria 16246
481 Ga0373927_0013460 3300035695 Bacteria 5436
482 Ga0373927_0028227 3300035695 Bacteria 3660
483 Ga0373927_0028864 3300035695 Bacteria 3617
484 Ga0373927_0098205 3300035695 Bacteria 1904
485 Ga0373933_0000041 3300035724 Bacteria 79805
486 Ga0373933_0105782 3300035724 Bacteria 1750
487 Ga0373947_0001365 3300035725 Bacteria 15008
488 Ga0373947_0054174 3300035725 Bacteria 2420
489 Ga0373947_0229269 3300035725 Bacteria 1223
490 Ga0373937_0573607 3300036401 Bacteria 1071
491 Ga0373937_0704617 3300036401 Bacteria 956
492 Ga0373925_0008661 3300037068 Bacteria 7413
493 Ga0373925_0032651 3300037068 Bacteria 3832
494 Ga0373925_0126787 3300037068 Bacteria 1987
495 Ga0395900_0143381 3300037418 Bacteria 2445
496 Ga0395900_0266835 3300037418 Bacteria 1708
497 Ga0395900_0616266 3300037418 Bacteria 1024
498 Ga0395898_0136484 3300037466 Bacteria 2349
499 Ga0395898_0389878 3300037466 Bacteria 1328
500 Ga0395905_0173504 3300037471 Bacteria 2025
501 Ga0395905_0369813 3300037471 Bacteria 1327
502 Ga0395905_0471486 3300037471 Bacteria 1154
503 Ga0436364_0836743 3300037853 Bacteria 3191
504 Ga0395901_0155243 3300038443 Bacteria 2404
505 Ga0436365_0096789 3300039437 Bacteria 2085
506 Ga0436365_0662753 3300039437 Bacteria 1413
507 Ga0436365_1159716 3300039437 Bacteria 1234
508 Ga0436361_0041213 3300039447 Bacteria 3329
509 Ga0436361_0782414 3300039447 Bacteria 1087
510 Ga0436363_0979421 3300039450 Bacteria 871
511 Ga0439465_0012175 3300041413 Bacteria 2693
512 Ga0439459_0035459 3300042438 Bacteria 1037
513 Ga0466969_0019057 3300044656 Bacteria 3570
514 Ga0466966_0009411 3300044684 Bacteria 6469
515 Ga0466961_0000013 3300044693 Bacteria 129640
516 Ga0466964_0013303 3300044706 Bacteria 3122
517 Ga0466971_0352587 3300044719 Bacteria 712
518 Ga0466957_0066743 3300044842 Bacteria 2219
519 Ga0466959_0037538 3300045049 Bacteria 3580
520 Ga0466959_0287224 3300045049 Bacteria 1128
521 Ga0466959_0344220 3300045049 Bacteria 1017
522 Ga0466967_0106792 3300045976 Bacteria 2567
523 Ga0495617_027351 3300046452 Bacteria 1919
524 Ga0495617_029754 3300046452 Bacteria 1836
525 Ga0495592_0068197 3300046454 Bacteria 2597
526 Ga0495592_0170014 3300046454 Bacteria 1493
527 Ga0495603_0000624 3300046455 Bacteria 19835
528 Ga0495603_0029062 3300046455 Bacteria 3335
529 Ga0495603_0064252 3300046455 Bacteria 2164
530 Ga0495603_0066178 3300046455 Bacteria 2128
531 Ga0495603_0152389 3300046455 Bacteria 1342
532 Ga0495603_0237835 3300046455 Bacteria 1049
533 Ga0495590_0028370 3300046457 Bacteria 1963
534 Ga0495629_0001961 3300046459 Bacteria 16039
535 Ga0495629_0074044 3300046459 Bacteria 2378
536 Ga0495638_0015380 3300046460 Bacteria 5140
537 Ga0495638_0150085 3300046460 Bacteria 1352
538 Ga0495638_0340774 3300046460 Bacteria 794
539 Ga0495641_0006064 3300046461 Bacteria 7944
540 Ga0495641_0165710 3300046461 Bacteria 989
541 Ga0495651_0058334 3300046462 Bacteria 2962
542 Ga0495653_0000923 3300046463 Bacteria 22739
543 Ga0495653_0187748 3300046463 Bacteria 1413
544 Ga0495650_0034101 3300046471 Bacteria 2258
545 Ga0495580_0008876 3300046472 Bacteria 7954
546 Ga0495580_0009752 3300046472 Bacteria 7530
547 Ga0495580_0229468 3300046472 Bacteria 1275
548 Ga0495582_0000775 3300046473 Bacteria 17677
549 Ga0495582_0036864 3300046473 Bacteria 2690
550 Ga0495582_0085950 3300046473 Bacteria 1750
551 Ga0495605_0056198 3300046474 Bacteria 1899
552 Ga0495639_0000335 3300046475 Bacteria 22677
553 Ga0495639_0026945 3300046475 Bacteria 2543
554 Ga0495639_0038033 3300046475 Bacteria 2159
555 Ga0495639_0043792 3300046475 Bacteria 2022
556 Ga0495662_0000156 3300046476 Bacteria 26864
557 Ga0495664_0003259 3300046477 Bacteria 8817
558 Ga0495664_0195948 3300046477 Bacteria 1224
559 Ga0495664_0199197 3300046477 Bacteria 1214
560 Ga0495664_0216296 3300046477 Bacteria 1160
561 Ga0495584_0044162 3300046491 Bacteria 2249
562 Ga0495584_0143214 3300046491 Bacteria 1214
563 Ga0495585_0069111 3300046492 Bacteria 1928
564 Ga0495596_0163275 3300046500 Bacteria 866
565 Ga0495596_0214691 3300046500 Bacteria 747
566 Ga0495583_0197315 3300046506 Bacteria 819
567 Ga0495606_0011399 3300046507 Bacteria 7254
568 Ga0495616_0095266 3300046513 Bacteria 1403
569 Ga0495616_0102082 3300046513 Bacteria 1344
570 Ga0495618_0107432 3300046514 Bacteria 1787
571 Ga0495628_0058246 3300046516 Bacteria 3036
572 Ga0495628_0088877 3300046516 Bacteria 2394
573 Ga0495630_0011736 3300046517 Bacteria 6349
574 Ga0495630_0014880 3300046517 Bacteria 5674
575 Ga0495631_0091415 3300046518 Bacteria 1310
576 Ga0495632_0016800 3300046519 Bacteria 4058
577 Ga0495632_0030062 3300046519 Bacteria 2823
578 Ga0495632_0100694 3300046519 Bacteria 1362
579 Ga0495632_0112541 3300046519 Bacteria 1277
580 Ga0495637_0122108 3300046520 Bacteria 1001
581 Ga0495644_0032075 3300046523 Bacteria 1985
582 Ga0495644_0039460 3300046523 Bacteria 1780
583 Ga0495648_0006521 3300046524 Bacteria 9507
584 Ga0495663_0116283 3300046525 Bacteria 892
585 Ga0495652_0043386 3300046529 Bacteria 3874
586 Ga0495665_0000188 3300046531 Bacteria 31814
587 Ga0495665_0012665 3300046531 Bacteria 4566
588 Ga0495665_0177373 3300046531 Bacteria 1108
589 Ga0495640_0002363 3300046533 Bacteria 15117
590 Ga0495640_0013618 3300046533 Bacteria 6181
591 Ga0495587_0075689 3300046536 Bacteria 1954
592 Ga0495598_0009463 3300046537 Bacteria 2304
593 Ga0495609_0033652 3300046538 Bacteria 2326
594 Ga0495645_0153497 3300046543 Bacteria 1598
595 Ga0495645_0182982 3300046543 Bacteria 1434
596 Ga0495622_0013179 3300046557 Bacteria 3837
597 Ga0495622_0033574 3300046557 Bacteria 2394
598 Ga0495633_0016407 3300046558 Bacteria 3818
599 Ga0495633_0248531 3300046558 Bacteria 812
600 Ga0495667_0157075 3300046559 Bacteria 1463
601 Ga0495667_0210438 3300046559 Bacteria 1243
602 Ga0495668_0195365 3300046616 Bacteria 1108
603 Ga0495668_0252894 3300046616 Bacteria 964
604 Ga0495668_0276334 3300046616 Bacteria 920
605 Ga0495634_0001338 3300046642 Bacteria 22465
606 Ga0495634_0015371 3300046642 Bacteria 5502
607 Ga0495634_0021255 3300046642 Bacteria 4590
608 Ga0495611_0024186 3300046648 Bacteria 2641
609 Ga0495625_0104026 3300046660 Bacteria 1947
610 Ga0495635_0000187 3300046663 Bacteria 39002
611 Ga0495635_0001384 3300046663 Bacteria 16177
612 Ga0495635_0197970 3300046663 Bacteria 1363
613 Ga0495659_0070319 3300046664 Bacteria 1310
614 Ga0495659_0175657 3300046664 Bacteria 870
615 Ga0495588_0012064 3300046674 Bacteria 4074
616 Ga0495588_0014997 3300046674 Bacteria 3721
617 Ga0495657_0119348 3300046675 Bacteria 1662
618 Ga0495599_0012037 3300046678 Bacteria 5323
619 Ga0495599_0137758 3300046678 Bacteria 1515
620 Ga0495599_0148478 3300046678 Bacteria 1453
621 Ga0495623_0021813 3300046679 Bacteria 4136
622 Ga0495646_0005072 3300046680 Bacteria 8301
623 Ga0495646_0071011 3300046680 Bacteria 2049
624 Ga0495647_0006159 3300046681 Bacteria 3959
625 Ga0495658_0000047 3300046683 Bacteria 59626
626 Ga0495658_0005621 3300046683 Bacteria 6158
627 Ga0495658_0011386 3300046683 Bacteria 4472
628 Ga0495658_0323468 3300046683 Bacteria 978
629 Ga0495669_0009623 3300046684 Bacteria 4078
630 Ga0495669_0113868 3300046684 Bacteria 1264
631 Ga0495613_0001031 3300046689 Bacteria 21255
632 Ga0495613_0058593 3300046689 Bacteria 2826
633 Ga0495624_0001259 3300046690 Bacteria 20006
634 Ga0495670_0036547 3300046691 Bacteria 2447
635 Ga0495670_0122196 3300046691 Bacteria 1353
636 Ga0495671_0040521 3300046692 Bacteria 2349
637 Ga0495649_0086014 3300046694 Bacteria 1678
638 Ga0495649_0175238 3300046694 Bacteria 1121
639 Ga0495589_0054129 3300046794 Bacteria 1979
640 Ga0495581_0000563 3300047315 Bacteria 19241
641 Ga0495581_0129449 3300047315 Bacteria 1471
642 Ga0495581_0196069 3300047315 Bacteria 1181
643 Ga0495604_0480924 3300047317 Bacteria 808
644 Ga0495636_0122570 3300047318 Bacteria 1151
645 Ga0495674_0022065 3300047319 Bacteria 5876
646 Ga0495672_0016664 3300047320 Bacteria 4940
647 Ga0495672_0101595 3300047320 Bacteria 1558
648 Ga0495676_0060717 3300047321 Bacteria 2961
649 Ga0495680_0085997 3300047322 Bacteria 2367
650 Ga0495680_0568716 3300047322 Bacteria 762
651 Ga0495683_0198201 3300047323 Bacteria 907
652 Ga0495675_0074231 3300047444 Bacteria 2143
653 Ga0495679_037119 3300047446 Bacteria 1535
654 Ga0495685_065734 3300047447 Bacteria 1219
655 Ga0495673_0110579 3300047469 Bacteria 1099
656 Ga0495673_0142622 3300047469 Bacteria 933
657 Ga0495684_0000325 3300047471 Bacteria 38298
658 Ga0495684_0008519 3300047471 Bacteria 7942
659 Ga0495684_0015183 3300047471 Bacteria 5931
660 Ga0495686_0339526 3300047472 Bacteria 819
661 Ga0495593_0026036 3300047673 Bacteria 3233
662 Ga0495593_0038357 3300047673 Bacteria 2588
663 Ga0495593_0251744 3300047673 Bacteria 884
664 Ga0495602_0080234 3300048088 Bacteria 2749
665 Ga0495626_0099927 3300048091 Bacteria 1266
666 Ga0496100_0018892 3300048903 Bacteria 4101
667 Ga0496100_0028609 3300048903 Bacteria 3439
668 Ga0496100_0034263 3300048903 Bacteria 3185
669 Ga0496100_0538469 3300048903 Bacteria 902
670 Ga0496100_0547677 3300048903 Bacteria 895
671 Ga0496100_0633153 3300048903 Bacteria 832
672 Ga0496100_0799190 3300048903 Bacteria 739
673 Ga0496100_0803515 3300048903 Bacteria 737
674 Ga0496101_0173721 3300048904 Bacteria 1656
675 Ga0496102_0028102 3300048905 Bacteria 5026
676 Ga0496102_0070673 3300048905 Bacteria 3205
677 Ga0496102_0181731 3300048905 Bacteria 1982
678 Ga0496102_0438232 3300048905 Bacteria 1226
679 Ga0496102_0552285 3300048905 Bacteria 1074
680 Ga0496103_0048099 3300048906 Bacteria 2635
681 Ga0496103_0075363 3300048906 Bacteria 2116
682 Ga0496104_0016385 3300048907 Bacteria 6732
683 Ga0496104_0017531 3300048907 Bacteria 6524
684 Ga0496104_0127394 3300048907 Bacteria 2445
685 Ga0496104_0205684 3300048907 Bacteria 1880
686 Ga0496105_0013867 3300048908 Bacteria 6402
687 Ga0496105_0048964 3300048908 Bacteria 3488
688 Ga0496105_0065179 3300048908 Bacteria 3007
689 Ga0496105_0428296 3300048908 Bacteria 1047
690 Ga0496106_0010647 3300048909 Bacteria 6795
691 Ga0496106_0045059 3300048909 Bacteria 3312
692 Ga0496106_0097357 3300048909 Bacteria 2278
693 Ga0496106_0150111 3300048909 Bacteria 1838
694 Ga0496106_0201806 3300048909 Bacteria 1583
695 Ga0496106_0209711 3300048909 Bacteria 1552
696 Ga0496106_0227685 3300048909 Bacteria 1488
697 Ga0496106_0289827 3300048909 Bacteria 1312
698 Ga0496106_0402541 3300048909 Bacteria 1100
699 Ga0496107_0065728 3300048910 Bacteria 2630
700 Ga0496107_0112717 3300048910 Bacteria 2000
701 Ga0496107_0132295 3300048910 Bacteria 1842
702 Ga0496107_0350499 3300048910 Bacteria 1099
703 Ga0496107_0390346 3300048910 Bacteria 1035
704 Ga0496108_0013443 3300048911 Bacteria 6678
705 Ga0496108_0197435 3300048911 Bacteria 1745
706 Ga0496109_0007343 3300048912 Bacteria 9322
707 Ga0496109_0008379 3300048912 Bacteria 8786
708 Ga0496109_0141565 3300048912 Bacteria 2249
709 Ga0496109_0253645 3300048912 Bacteria 1657
710 Ga0496110_0004140 3300048913 Bacteria 11211
711 Ga0496110_0061624 3300048913 Bacteria 3312
712 Ga0496110_0067803 3300048913 Bacteria 3157
713 Ga0496111_0019197 3300048914 Bacteria 4744
714 Ga0496111_0085901 3300048914 Bacteria 2301
715 Ga0496111_0270260 3300048914 Bacteria 1261
716 Ga0496112_0000021 3300048915 Bacteria 156561
717 Ga0496112_0006620 3300048915 Bacteria 10202
718 Ga0496112_0025529 3300048915 Bacteria 5673
719 Ga0496112_0109612 3300048915 Bacteria 2731
720 Ga0496112_0194607 3300048915 Bacteria 1989
721 Ga0496113_0003687 3300048916 Bacteria 9225
722 Ga0496113_0003980 3300048916 Bacteria 8976
723 Ga0496114_0029515 3300048917 Bacteria 4509
724 Ga0496114_0049504 3300048917 Bacteria 3496
725 Ga0496114_0194952 3300048917 Bacteria 1773
726 Ga0496114_0739597 3300048917 Bacteria 860
727 Ga0496115_0015849 3300048918 Bacteria 5725
728 Ga0496115_0093337 3300048918 Bacteria 2461
729 Ga0496115_0497248 3300048918 Bacteria 980
730 Ga0496116_0105200 3300048919 Bacteria 1675
731 Ga0496117_0054893 3300048920 Bacteria 2788
732 Ga0496117_0103442 3300048920 Bacteria 1795
733 Ga0496117_0169936 3300048920 Bacteria 1267
734 Ga0496118_0052584 3300048921 Bacteria 3105
735 Ga0496118_0145815 3300048921 Bacteria 1491
736 Ga0496119_0047744 3300048922 Bacteria 2661
737 Ga0496119_0155388 3300048922 Bacteria 1222
738 Ga0496121_0002742 3300048924 Bacteria 26192
739 Ga0496121_0024447 3300048924 Bacteria 5775
740 Ga0496121_0034621 3300048924 Bacteria 4544
741 Ga0496121_0043514 3300048924 Bacteria 3888
742 Ga0496121_0056434 3300048924 Bacteria 3262
743 Ga0496121_0073209 3300048924 Bacteria 2747
744 Ga0496121_0077405 3300048924 Bacteria 2649
745 Ga0496121_0081807 3300048924 Bacteria 2555
746 Ga0496121_0114288 3300048924 Bacteria 2052
747 Ga0496121_0184984 3300048924 Bacteria 1499
748 Ga0496121_0188726 3300048924 Bacteria 1480
749 Ga0496121_0199758 3300048924 Bacteria 1426
750 Ga0496121_0354191 3300048924 Bacteria 977
751 Ga0496121_0419572 3300048924 Bacteria 871
752 Ga0496122_0016696 3300048925 Bacteria 6922
753 Ga0496122_0035337 3300048925 Bacteria 4068
754 Ga0496123_0073879 3300048926 Bacteria 2113
755 Ga0496123_0207966 3300048926 Bacteria 997
756 Ga0496124_0041583 3300048927 Bacteria 3965
757 Ga0496124_0072962 3300048927 Bacteria 2841
758 Ga0496125_0074210 3300048928 Bacteria 2639
759 Ga0496125_0161388 3300048928 Bacteria 1522
760 Ga0496125_0293923 3300048928 Bacteria 999
761 Ga0496126_0004520 3300048929 Bacteria 16556
762 Ga0496126_0014485 3300048929 Bacteria 7969
763 Ga0496126_0018300 3300048929 Bacteria 6950
764 Ga0496126_0030809 3300048929 Bacteria 5078
765 Ga0496126_0041355 3300048929 Bacteria 4266
766 Ga0496126_0045430 3300048929 Bacteria 4036
767 Ga0496126_0046504 3300048929 Bacteria 3979
768 Ga0496126_0062972 3300048929 Bacteria 3326
769 Ga0496126_0066922 3300048929 Bacteria 3211
770 Ga0496126_0128014 3300048929 Bacteria 2196
771 Ga0496126_0162545 3300048929 Bacteria 1907
772 Ga0496126_0176023 3300048929 Bacteria 1820
773 Ga0496126_0217898 3300048929 Bacteria 1605
774 Ga0496126_0394225 3300048929 Bacteria 1124
775 Ga0495682_0159909 3300049460 Bacteria 802
776 Ga0501031_0000864 3300049568 Bacteria 18218
777 Ga0501031_0035030 3300049568 Bacteria 3274
778 Ga0501032_0001394 3300049569 Bacteria 19192
779 Ga0501032_0018316 3300049569 Bacteria 4907
780 Ga0501032_0019702 3300049569 Bacteria 4713
781 Ga0501033_0000155 3300049570 Bacteria 65906
782 Ga0501033_0001376 3300049570 Bacteria 21670
783 Ga0501033_0067594 3300049570 Bacteria 2627
784 Ga0501034_0000232 3300049571 Bacteria 103995
785 Ga0501034_0175846 3300049571 Bacteria 2106
786 Ga0501034_0216211 3300049571 Bacteria 1870
787 Ga0501034_0504715 3300049571 Bacteria 1123
788 Ga0501036_0000425 3300049572 Bacteria 29896
789 Ga0501036_0173951 3300049572 Bacteria 1813
790 Ga0501036_0254769 3300049572 Bacteria 1470
791 Ga0501037_0000463 3300049573 Bacteria 33015
792 Ga0501037_0009561 3300049573 Bacteria 7117
793 Ga0501037_0082565 3300049573 Bacteria 2328
794 Ga0501038_0000943 3300049574 Bacteria 25959
795 Ga0501038_0021700 3300049574 Bacteria 5760
796 Ga0501038_0160581 3300049574 Bacteria 1826
797 Ga0501039_0008204 3300049575 Bacteria 7961
798 Ga0501039_0031614 3300049575 Bacteria 4081
799 Ga0501039_0063458 3300049575 Bacteria 2862
800 Ga0501040_0047444 3300049576 Bacteria 2933
801 Ga0501042_0031953 3300049578 Bacteria 3725
802 Ga0501042_0093859 3300049578 Bacteria 2155
803 Ga0501042_0100439 3300049578 Bacteria 2080
804 Ga0501043_0000035 3300049579 Bacteria 133200
805 Ga0501043_0005159 3300049579 Bacteria 10569
806 Ga0501043_0009741 3300049579 Bacteria 7530
807 Ga0501046_0027631 3300049580 Bacteria 4627
808 Ga0501046_0033024 3300049580 Bacteria 4186
809 Ga0501046_0039309 3300049580 Bacteria 3789
810 Ga0501046_0056526 3300049580 Bacteria 3080
811 Ga0501047_0000085 3300049581 Bacteria 118617
812 Ga0501047_0062533 3300049581 Bacteria 3590
813 Ga0501047_0117793 3300049581 Bacteria 2537
814 Ga0501048_0000061 3300049582 Bacteria 54555
815 Ga0501048_0017589 3300049582 Bacteria 5263
816 Ga0501067_0002400 3300049583 Bacteria 10349
817 Ga0501067_0027068 3300049583 Bacteria 3177
818 Ga0501068_0003110 3300049584 Bacteria 8869
819 Ga0501068_0004955 3300049584 Bacteria 7260
820 Ga0501068_0118305 3300049584 Bacteria 1651
821 Ga0501069_0043593 3300049585 Bacteria 2483
822 Ga0501069_0054769 3300049585 Bacteria 2221
823 Ga0501070_0000272 3300049586 Bacteria 48952
824 Ga0501072_0000537 3300049588 Bacteria 27189
825 Ga0501072_0414184 3300049588 Bacteria 1068
826 Ga0501073_0000026 3300049589 Bacteria 124358
827 Ga0501073_0054428 3300049589 Bacteria 2802
828 Ga0501073_0118470 3300049589 Bacteria 1835
829 Ga0501074_0000017 3300049590 Bacteria 76626
830 Ga0501074_0024699 3300049590 Bacteria 4366
831 Ga0501074_0035306 3300049590 Bacteria 3622
832 Ga0501076_0074303 3300049592 Bacteria 2723
833 Ga0501076_0157968 3300049592 Bacteria 1846
834 Ga0501079_0014040 3300049741 Bacteria 6107
835 Ga0501080_0005584 3300049742 Bacteria 11238
836 Ga0501080_0036359 3300049742 Bacteria 4597
837 Ga0501080_0038761 3300049742 Bacteria 4447
838 Ga0501080_0149343 3300049742 Bacteria 2160
839 Ga0501081_0190457 3300049743 Bacteria 1485
840 Ga0501083_0000264 3300049744 Bacteria 33411
841 Ga0501083_0015098 3300049744 Bacteria 5407
842 Ga0501035_0000548 3300049822 Bacteria 41814
843 Ga0501035_0002887 3300049822 Bacteria 16563
844 Ga0501035_0053294 3300049822 Bacteria 3618
845 Ga0501035_0324431 3300049822 Bacteria 1293
846 Ga0501035_0556564 3300049822 Bacteria 939
847 Ga0501044_0000051 3300049823 Bacteria 143658
848 Ga0501044_0002908 3300049823 Bacteria 19491
849 Ga0501044_0015682 3300049823 Bacteria 8159
850 Ga0501044_0044996 3300049823 Bacteria 4577
851 Ga0501044_0056733 3300049823 Bacteria 4021
852 Ga0501045_0004421 3300049824 Bacteria 9701
853 nmdc:mga03n38_69948_c1 3300050490 Bacteria 1622
854 nmdc:mga00v17_241032_c1 3300050491 Bacteria 1172
855 nmdc:mga00v17_58782_c1 3300050491 Bacteria 2357
856 nmdc:mga0yw44_199478_c1 3300050492 Bacteria 1321
857 nmdc:mga0yw44_5148_c1 3300050492 Bacteria 6124
858 nmdc:mga0yw44_77380_c1 3300050492 Bacteria 2078
859 nmdc:mga0k408_27004_c1 3300050493 Bacteria 3258
860 nmdc:mga06z11_7637_c1 3300050494 Bacteria 4464
861 nmdc:mga07m45_10610_c1 3300050496 Bacteria 4819
862 nmdc:mga07m45_193668_c1 3300050496 Bacteria 1182
863 nmdc:mga07m45_21995_c1 3300050496 Bacteria 3479
864 nmdc:mga07m45_258776_c1 3300050496 Bacteria 1012
865 nmdc:mga05p37_862963_c1 3300050507 Bacteria 981
866 nmdc:mga08y16_196284_c1 3300050511 Bacteria 2092
867 nmdc:mga08y16_493786_c1 3300050511 Bacteria 1244
868 nmdc:mga0n895_530750_c1 3300050512 Bacteria 1184
869 nmdc:mga0sz30_109892_c1 3300050516 Bacteria 1208
870 nmdc:mga0sz30_273184_c1 3300050516 Bacteria 753
871 Ga0495601_0016290 3300053077 Bacteria 4504
872 Ga0495601_0162692 3300053077 Bacteria 1459
873 Ga0495612_0043880 3300053078 Bacteria 1828
874 Ga0495612_0081393 3300053078 Bacteria 1361
875 Ga0495595_0027301 3300053084 Bacteria 2543
876 Ga0495595_0033143 3300053084 Bacteria 2329
877 Ga0495619_0010939 3300053085 Bacteria 5709
878 Ga0495619_0071904 3300053085 Bacteria 2315
879 Ga0495619_0085382 3300053085 Bacteria 2132
880 Ga0500578_0101424 3300053086 Bacteria 1821
881 Ga0500578_0181253 3300053086 Bacteria 1298
882 Ga0500647_0016096 3300053091 Bacteria 3431
883 Ga0500583_0064941 3300053092 Bacteria 1732
884 Ga0500651_0141906 3300053093 Bacteria 1447
885 Ga0500566_0001308 3300053094 Bacteria 14522
886 Ga0500566_0002248 3300053094 Bacteria 11412
887 Ga0500566_0036554 3300053094 Bacteria 2848
888 Ga0500641_0001881 3300053096 Bacteria 7451
889 Ga0500641_0006011 3300053096 Bacteria 4296
890 Ga0500641_0012131 3300053096 Bacteria 3141
891 Ga0500641_0080164 3300053096 Bacteria 1384
892 Ga0500650_0048216 3300053098 Bacteria 1976
893 Ga0500554_022916 3300053102 Bacteria 1750
894 Ga0500554_025861 3300053102 Bacteria 1680
895 Ga0500555_000359 3300053103 Bacteria 19406
896 Ga0500556_0047341 3300053104 Bacteria 1542
897 Ga0500562_034792 3300053108 Bacteria 1333
898 Ga0500592_001571 3300053116 Bacteria 3691
899 Ga0500595_003793 3300053119 Bacteria 6953
900 Ga0500595_039911 3300053119 Bacteria 1517
901 Ga0500607_231785 3300053121 Bacteria 756
902 Ga0500608_088031 3300053122 Bacteria 1456
903 Ga0500618_008918 3300053125 Bacteria 2765
904 Ga0500642_0010090 3300053130 Bacteria 3315
905 Ga0500652_040407 3300053131 Bacteria 1874
906 Ga0500658_0111149 3300053134 Bacteria 1206
907 Ga0500658_0190988 3300053134 Bacteria 935
908 Ga0500559_0035914 3300053136 Bacteria 2142
909 Ga0500559_0050244 3300053136 Bacteria 1839
910 Ga0500561_0145658 3300053137 Bacteria 735
911 Ga0500577_0000274 3300053142 Bacteria 13474
912 Ga0500579_194710 3300053143 Bacteria 764
913 Ga0500589_057710 3300053147 Bacteria 1787
914 Ga0500590_027454 3300053148 Bacteria 2953
915 Ga0500603_017374 3300053150 Bacteria 1718
916 Ga0500603_049325 3300053150 Bacteria 1147
917 Ga0500604_0089422 3300053151 Bacteria 1004
918 Ga0500620_079162 3300053155 Bacteria 1137
919 Ga0500627_0032689 3300053158 Bacteria 2194
920 Ga0500636_0036791 3300053177 Bacteria 2896
921 Ga0500637_0000088 3300053178 Bacteria 33146
922 Ga0500637_0135409 3300053178 Bacteria 1427
923 Ga0500637_0203632 3300053178 Bacteria 1125
924 Ga0500611_010511 3300053727 Bacteria 1503
925 Ga0500645_008427 3300053730 Bacteria 3521
926 Ga0501084_0012701 3300054114 Bacteria 6978
927 Ga0501082_0010719 3300060353 Bacteria 7888
928 Ga0501082_0272665 3300060353 Bacteria 1473
929 Ga0466962_0029856 3300061719 Bacteria 2610
930 2513654765 2513237096 Bacteria 8722461
931 2513675869 2513237098 Bacteria 9902361
932 2513692563 2513237101 Bacteria 7952346
933 2513855814 2513237137 Bacteria 9558895
934 2513863673 2513237137 Bacteria 9558895
935 2513915055 2513237145 Bacteria 8979722
936 2515629854 2515154112 Bacteria 8294334
937 2517106800 2517093001 Bacteria 9002274
938 2517892352 2517572143 Bacteria 9484767
939 2524538559 2524023228 Bacteria 10118060
940 2617349055 2617270735 Bacteria 9163226
941 2671120397 2667528175 Bacteria 7532676
942 2723845052 2721755755 Bacteria 8322773
943 2728751150 2728368998 Bacteria 8720350
944 2793072171 2791355197 Bacteria 8420563
945 2793082079
946 2824679185 2824671348 Bacteria 8369588
947 2824695789 2824687955 Bacteria 8360029
948 2824779582 2824773399 Bacteria 8360218
949 2847936254 2847930680 Bacteria 9342022
950 2874598095 2874590934 Bacteria 8299676
951 2874605231 2874604998 Bacteria 7834745
952 2874631897 2874628541 Bacteria 8630250
953 2874645436 2874645413 Bacteria 8214782
954 2876778427 2876771140 Bacteria 8287509
955 2876814300 2876808645 Bacteria 8824342
956 2876820373 2876818435 Bacteria 8274608
957 2879082221 2879074833 Bacteria 8279565
958 2879090673 2879083081 Bacteria 8587928
959 2879100556 2879099564 Bacteria 10442239
960 2879111225 2879110137 Bacteria 8907982
961 2879135368 2879127579 Bacteria 8294491
962 2879150577 2879142872 Bacteria 8267021
963 2885380536 2885374607 Bacteria 8927485
964 2885386571 2885383462 Bacteria 9473874
965 2889039806 2889033259 Bacteria 9099371
966 2893070545 2893066018 Bacteria 6158120
967 2903749335 2903748898 Bacteria 9972761
968 2903773982 2903768456 Bacteria 9749579
969 2904695857 2904690495 Bacteria 9412302
970 2904703494
971 2906618673
972 2906638888 2906635258 Bacteria 8601019
973 2906666331 2906660503 Bacteria 8595048
974 2908742650 2908739725 Bacteria 8628932
975 2908761158 2908756301 Bacteria 8864324
976 2922365391 2922361189 Bacteria 7436256
977 2922376912
978 2922391002 2922386360 Bacteria 7017218
979 2922430332
980 2932790133 2932784394 Bacteria 9704911
981 2932818087 2932809354 Bacteria 9135765
982 2932827921 2932818245 Bacteria 9955613
983 2935608923 2935608549 Bacteria 8203142
984 2935631626 2935630451 Bacteria 8169952
985 2935653376 2935648319 Bacteria 8801166
986 2935660153 2935656913 Bacteria 8965014
987 2935684187 2935675223 Bacteria 9928132
988 2935693383 2935684952 Bacteria 9590419
989 2935700151 2935694250 Bacteria 9291695
990 2935720828 2935713505 Bacteria 9608509
991 2935730685 2935722832 Bacteria 9608746
992 2935740550 2935732158 Bacteria 9706831
993 2935749976 2935741537 Bacteria 9707219
994 2935759204 2935750917 Bacteria 9590372
995 2935769622 2935760218 Bacteria 9817913
996 2935776919 2935769743 Bacteria 7878163
997 2935778570 2935777560 Bacteria 8077691
998 2935792235 2935785616 Bacteria 7962367
999 2935800398 2935793552 Bacteria 8012592
1000 2935819670 2935810662 Bacteria 9401221
1001 2935822083 2935819856 Bacteria 8261050
1002 2935847665 2935847175 Bacteria 8228321
1003 2935909063 2935908558 Bacteria 8568796
1004 2935919783 2935916978 Bacteria 9113783
1005 2935926363 2935926038 Bacteria 8601059
1006 2935934813 2935934488 Bacteria 8602579
1007 2935943263 2935942939 Bacteria 8599779
1008 2935951701 2935951376 Bacteria 8602333
1009 2935967826 2935967501 Bacteria 8603075
1010 2935982621 2935975950 Bacteria 8347125
1011 2936016246 2936011229 Bacteria 8801034
1012 2936024879 2936019824 Bacteria 8804134
1013 2936032127 2936028420 Bacteria 8965941
1014 2936046427 2936037263 Bacteria 9446081
1015 2936049988 2936046547 Bacteria 8903709
1016 2936060941 2936055302 Bacteria 8785755
1017 2940565270 2940556831 Bacteria 9590747
1018 2941511420 2941507105 Bacteria 8166816
1019 2941519121 2941515067 Bacteria 8166720
1020 2941526299 2941523033 Bacteria 8169134
1021 2941532857 2941531003 Bacteria 7653939
1022 3005480254 3005474847 Bacteria 9259049
1023 3005484360 3005483717 Bacteria 7877331
1024 3005588008 3005587118 Bacteria 7794411
1025 3005714947 3005710791 Bacteria 7622528
1026 8006940630 8006933436 Bacteria 10410654
1027 8006965777 8006964411 Bacteria 8966052
1028 8006980319 8006973647 Bacteria 10679141
1029 8006987013 8006984368 Bacteria 9651211
1030 8006996001 8006994254 Bacteria 8309700
1031 8016529574 8016522445 Bacteria 8156687
1032 8016534787 8016530956 Bacteria 8155261
1033 8016548004 8016539877 Bacteria 8155419
1034 8016554126 8016548790 Bacteria 8155074
1035 8016562503 8016557553 Bacteria 8154380
1036 8016577279 8016575299 Bacteria 8154085
1037 8016600293 8016595262 Bacteria 8149947
1038 8016610457 8016603502 Bacteria 8731218
1039 8016614478 8016613128 Bacteria 8794220
1040 8016626519 8016622563 Bacteria 7999408
1041 8016640286 8016630954 Bacteria 9217207
1042 8019534556 8019530166 Bacteria 8155624
1043 8019544916 8019538911 Bacteria 7872763
1044 8019553617 8019547302 Bacteria 7996444
1045 8019568608 8019565922 Bacteria 9639779
1046 8019628220 8019619141 Bacteria 9218857
1047 8019634409 8019629233 Bacteria 8687553
1048 8019645328 8019638758 Bacteria 9062356
1049 8019662289 8019659431 Bacteria 8577854
1050 8019671794 8019668869 Bacteria 8791617
1051 8019684300 8019678201 Bacteria 8863603
1052 8056673833 8056673599 Bacteria 7871253
1053 8056686691 8056681323 Bacteria 8472857
1054 8056693511 8056689827 Bacteria 6712655
1055 Ga0451793_0235356
1056 JGI25406J46586_10000281
1057 JGI25165J46597_1007017
1058 rootL2_10100710
1059 JGI25404J52841_10011790
1060 JGI25404J52841_10012955
1061 JGI25404J52841_10031890
1062 Ga0055539_1003432
1063 Ga0055526_1019009
1064 Ga0065165_1053829
1065 Ga0070658_10034097
1066 Ga0070658_10203097
1067 Ga0070676_10029266
1068 Ga0070676_10281594
1069 Ga0070676_10622459
1070 Ga0070683_100014826
1071 Ga0070683_100217859
1072 Ga0070690_100078908
1073 Ga0070670_100386448
1074 Ga0068869_100055860
1075 Ga0070680_100012011
1076 Ga0070680_100046708
1077 Ga0070680_100071792
1078 Ga0070680_100177524
1079 Ga0070682_100072086
1080 Ga0068868_100011517
1081 Ga0068868_100066951
1082 Ga0070660_100093459
1083 Ga0070691_10071785
1084 Ga0070687_100506183
1085 Ga0070668_100130158
1086 Ga0070668_100142498
1087 Ga0070668_100156536
1088 Ga0070669_100152215
1089 Ga0070669_100687906
1090 Ga0070671_100043116
1091 Ga0070674_100036986
1092 Ga0070674_100162383
1093 Ga0070674_100400321
1094 Ga0070673_100019014
1095 Ga0070673_100228435
1096 Ga0070688_100340574
1097 Ga0070659_100235810
1098 Ga0070667_100109172
1099 Ga0070709_10001094
1100 Ga0070709_10041110
1101 Ga0070709_10202089
1102 Ga0070714_100038308
1103 Ga0070714_100054442
1104 Ga0070714_100282881
1105 Ga0070713_100006735
1106 Ga0070710_10005972
1107 Ga0070710_10066910
1108 Ga0070701_10125942
1109 Ga0070711_100003469
1110 Ga0070711_100155291
1111 Ga0070711_100649662
1112 Ga0070700_100241200
1113 Ga0070708_100302416
1114 Ga0070663_100030492
1115 Ga0070663_100069828
1116 Ga0070663_100101625
1117 Ga0070663_100112165
1118 Ga0070663_100167570
1119 Ga0070678_100017537
1120 Ga0070678_100039996
1121 Ga0070678_100056119
1122 Ga0070678_100102030
1123 Ga0070662_100020030
1124 Ga0070662_100157581
1125 Ga0070662_100448936
1126 Ga0070681_10113617
1127 Ga0070681_10163131
1128 Ga0070681_10241891
1129 Ga0068867_100032942
1130 Ga0068867_100232873
1131 Ga0070698_100035656
1132 Ga0070698_100278044
1133 Ga0070698_100378639
1134 Ga0070698_100505426
1135 Ga0070679_100016725
1136 Ga0070679_100044244
1137 Ga0070679_100044856
1138 Ga0070679_100059816
1139 Ga0070679_100081880
1140 Ga0070684_100016386
1141 Ga0070684_100092163
1142 Ga0070684_100318891
1143 Ga0070697_100102945
1144 Ga0068853_100032728
1145 Ga0068853_100063118
1146 Ga0068853_100067836
1147 Ga0068853_100201434
1148 Ga0068853_100332967
1149 Ga0068853_100398999
1150 Ga0068853_100441134
1151 Ga0068853_100777793
1152 Ga0070672_100160902
1153 Ga0070672_100326124
1154 Ga0070686_100441382
1155 Ga0070696_100065382
1156 Ga0070696_100171572
1157 Ga0070696_100394342
1158 Ga0070693_100078642
1159 Ga0070665_100070951
1160 Ga0070665_100074289
1161 Ga0070665_100437026
1162 Ga0070665_100599282
1163 Ga0068855_100047648
1164 Ga0068855_100068829
1165 Ga0068855_100117677
1166 Ga0068855_100142890
1167 Ga0068855_101150668
1168 Ga0070664_100041691
1169 Ga0070664_100230507
1170 Ga0068857_100022401
1171 Ga0068857_100052978
1172 Ga0068857_100468771
1173 Ga0068854_100129113
1174 Ga0068854_100266046
1175 Ga0068854_100720510
1176 Ga0068856_100000082
1177 Ga0068856_100338009
1178 Ga0068856_101395149
1179 Ga0070702_100047672
1180 Ga0070702_100072831
1181 Ga0068852_100570361
1182 Ga0068859_100031018
1183 Ga0068859_100370837
1184 Ga0068859_100890985
1185 Ga0068864_100023523
1186 Ga0068864_100414963
1187 Ga0068866_10023610
1188 Ga0068861_100024737
1189 Ga0068861_100057655
1190 Ga0068861_100158740
1191 Ga0068861_100539935
1192 Ga0068870_10316074
1193 Ga0068863_100160927
1194 Ga0068863_100343320
1195 Ga0068858_100155923
1196 Ga0068858_100320225
1197 Ga0068858_100354559
1198 Ga0068860_100083701
1199 Ga0068862_100045299
1200 Ga0068862_100118586
1201 Ga0068862_100127591
1202 Ga0068862_100161087
1203 Ga0068862_100200622
1204 Ga0081455_10004092
1205 Ga0081455_10012714
1206 Ga0081455_10117859
1207 Ga0081538_10072145
1208 Ga0081540_1005571
1209 Ga0081540_1010961
1210 Ga0081540_1012602
1211 Ga0081540_1014018
1212 Ga0081540_1014599
1213 Ga0081539_10001902
1214 Ga0081539_10026944
1215 Ga0070717_10191195
1216 Ga0070717_10216381
1217 Ga0075365_10029868
1218 Ga0075365_10042134
1219 Ga0075365_10062393
1220 Ga0075365_10062403
1221 Ga0075365_10107272
1222 Ga0075365_10160278
1223 Ga0075368_10021445
1224 Ga0075368_10131470
1225 Ga0075363_100001764
1226 Ga0075363_100015088
1227 Ga0075363_100156860
1228 Ga0075364_10026005
1229 Ga0075364_10085792
1230 Ga0070716_100062303
1231 Ga0070712_100033812
1232 Ga0075367_10005871
1233 Ga0075367_10032643
1234 Ga0075367_10125533
1235 Ga0075367_10344107
1236 Ga0075366_10031763
1237 Ga0097621_100020182
1238 Ga0097621_100610704
1239 Ga0075370_10007760
1240 Ga0075370_10072391
1241 Ga0075370_10199653
1242 Ga0068871_100037995
1243 Ga0068871_100565354
1244 Ga0075434_100102162
1245 Ga0068865_100173591
1246 Ga0068865_100233342
1247 Ga0097620_100031020
1248 Ga0097620_100370862
1249 Ga0097620_100891085
1250 Ga0099824_1005168
1251 Ga0099822_1000080
1252 Ga0075435_100072603
1253 Ga0099795_10163541
1254 Ga0105240_10093070
1255 Ga0105240_10243455
1256 Ga0105240_10525410
1257 Ga0105245_10018466
1258 Ga0105245_10071926
1259 Ga0105245_10303800
1260 Ga0105245_10951911
1261 Ga0105247_10060702
1262 Ga0114129_10261607
1263 Ga0105243_10065518
1264 Ga0105241_10018025
1265 Ga0105242_10182773
1266 Ga0105242_10341975
1267 Ga0105248_10296754
1268 Ga0105248_10344985
1269 Ga0105237_10133289
1270 Ga0105237_11267513
1271 Ga0105238_10017099
1272 Ga0105249_10702698
1273 Ga0099796_10032206
1274 Ga0099796_10095278
1275 Ga0105239_10027964
1276 Ga0105239_10090869
1277 Ga0105239_10093008
1278 Ga0105239_10176226
1279 Ga0105239_10651824
1280 Ga0157370_10018597
1281 Ga0157370_10091789
1282 Ga0157369_10044499
1283 Ga0157374_10031099
1284 Ga0157378_10018819
1285 Ga0157378_10022108
1286 Ga0157378_10438479
1287 Ga0157378_10578532
1288 Ga0163162_10039037
1289 Ga0163162_10162176
1290 Ga0163162_10452762
1291 Ga0157372_10061947
1292 Ga0157375_10043448
1293 Ga0157375_10148469
1294 Ga0157375_10283665
1295 Ga0157375_10391438
1296 Ga0163163_10009474
1297 Ga0163163_10105290
1298 Ga0163163_10122280
1299 Ga0163163_10574400
1300 Ga0157380_10106002
1301 Ga0157380_10225124
1302 Ga0157380_10520571
1303 Ga0182008_10112772
1304 Ga0157379_10085055
1305 Ga0157379_10372137
1306 Ga0157379_10865535
1307 Ga0157376_10156322
1308 Ga0157376_10190326
1309 Ga0163161_10308897
1310 Ga0209677_100235
1311 Ga0209677_104125
1312 Ga0209233_1000995
1313 Ga0209233_1020532
1314 Ga0209564_1000726
1315 Ga0209758_1000160
1316 Ga0209758_1005354
1317 Ga0207697_10236607
1318 Ga0207692_10468357
1319 Ga0207642_10015226
1320 Ga0207642_10046811
1321 Ga0207710_10051593
1322 Ga0207710_10062572
1323 Ga0207688_10025042
1324 Ga0207688_10205279
1325 Ga0207685_10193694
1326 Ga0207699_10000199
1327 Ga0207699_10035185
1328 Ga0207645_10054536
1329 Ga0207645_10101239
1330 Ga0207643_10017275
1331 Ga0207643_10097662
1332 Ga0207643_10343751
1333 Ga0207705_10117978
1334 Ga0207705_10230047
1335 Ga0207654_10288876
1336 Ga0207707_10019532
1337 Ga0207707_10038340
1338 Ga0207707_10081725
1339 Ga0207695_10128011
1340 Ga0207695_10558749
1341 Ga0207671_10028108
1342 Ga0207671_10145503
1343 Ga0207671_10692826
1344 Ga0207693_10016309
1345 Ga0207693_10023034
1346 Ga0207663_10009125
1347 Ga0207663_10265882
1348 Ga0207663_10666147
1349 Ga0207660_10024005
1350 Ga0207660_10076336
1351 Ga0207660_10240915
1352 Ga0207662_10420603
1353 Ga0207662_10685968
1354 Ga0207657_10107874
1355 Ga0207657_10313003
1356 Ga0207652_10009229
1357 Ga0207681_10122380
1358 Ga0207681_10787877
1359 Ga0207694_10254868
1360 Ga0207650_10104033
1361 Ga0207687_10047676
1362 Ga0207687_10080533
1363 Ga0207700_10023396
1364 Ga0207700_10027500
1365 Ga0207664_10037833
1366 Ga0207664_10084718
1367 Ga0207664_10246443
1368 Ga0207644_10049291
1369 Ga0207690_10048975
1370 Ga0207690_10220619
1371 Ga0207706_10064081
1372 Ga0207706_10067934
1373 Ga0207706_10544844
1374 Ga0207686_10358254
1375 Ga0207686_10681966
1376 Ga0207709_10101125
1377 Ga0207669_10042690
1378 Ga0207669_10092936
1379 Ga0207704_10017791
1380 Ga0207704_10223241
1381 Ga0207665_10048262
1382 Ga0207691_10144219
1383 Ga0207691_10184406
1384 Ga0207711_10006349
1385 Ga0207711_10264243
1386 Ga0207711_10300140
1387 Ga0207689_10034390
1388 Ga0207689_10040742
1389 Ga0207689_10072682
1390 Ga0207661_10000410
1391 Ga0207661_10025556
1392 Ga0207661_10128801
1393 Ga0207661_10191029
1394 Ga0207679_10105971
1395 Ga0207679_10198426
1396 Ga0207679_10753129
1397 Ga0207667_10015305
1398 Ga0207667_10340335
1399 Ga0207667_10351614
1400 Ga0207651_10005957
1401 Ga0207712_10785744
1402 Ga0207668_10073885
1403 Ga0207668_10158561
1404 Ga0207668_10849036
1405 Ga0207640_10060990
1406 Ga0207640_10079134
1407 Ga0207640_10409990
1408 Ga0207677_10138631
1409 Ga0207703_10147225
1410 Ga0207703_10255233
1411 Ga0207703_10525752
1412 Ga0207703_10961539
1413 Ga0207639_10056395
1414 Ga0207639_10165950
1415 Ga0207639_10233761
1416 Ga0207639_10308612
1417 Ga0207678_10010615
1418 Ga0207678_10022267
1419 Ga0207678_10025488
1420 Ga0207678_10041263
1421 Ga0207678_10084343
1422 Ga0207678_10180874
1423 Ga0207702_10000048
1424 Ga0207702_10363745
1425 Ga0207702_11191953
1426 Ga0207641_10114216
1427 Ga0207641_10114252
1428 Ga0207648_10316048
1429 Ga0207648_10369199
1430 Ga0207676_10017087
1431 Ga0207676_10520449
1432 Ga0207674_10019872
1433 Ga0207674_10022445
1434 Ga0207674_10279311
1435 Ga0207675_100317319
1436 Ga0207683_10023706
1437 Ga0207683_10047585
1438 Ga0207683_10048826
1439 Ga0207683_10078139
1440 Ga0207683_10524295
1441 Ga0207698_10434428
1442 Ga0207698_11267866
1443 Ga0209589_1000003
1444 Ga0209489_100003
1445 Ga0209700_100003
1446 Ga0209700_100062
1447 Ga0209179_1005091
1448 Ga0209179_1051653
1449 Ga0209588_1003456
1450 Ga0209813_10037989
1451 Ga0207428_10078431
1452 Ga0268266_10003304
1453 Ga0268266_10015514
1454 Ga0268266_10024812
1455 Ga0268266_10333285
1456 Ga0268266_10514402
1457 Ga0268266_10567827
1458 Ga0268266_10861559
1459 Ga0268265_10029396
1460 Ga0268265_10063199
1461 Ga0268265_10082635
1462 Ga0268265_11140196
1463 Ga0268265_11155322
1464 Ga0268264_10029978
1465 Ga0268264_10057650
1466 Ga0265334_10047826
1467 Ga0307517_10000063
1468 Ga0307517_10161062
1469 Ga0265330_10010793
1470 Ga0265330_10030179
1471 Ga0265332_10052081
1472 Ga0265340_10109416
1473 Ga0265339_10007926
1474 Ga0265316_10139532
1475 Ga0307509_10106942
1476 Ga0307509_10162838
1477 Ga0307509_10615197
1478 Ga0307509_10627582
1479 Ga0307408_100283910
1480 Ga0307508_10086949
1481 Ga0307508_10110140
1482 Ga0307508_10233330
1483 Ga0265314_10015169
1484 Ga0265314_10141546
1485 Ga0265342_10219401
1486 Ga0307516_10019305
1487 Ga0307516_10050530
1488 Ga0307516_10073859
1489 Ga0307405_10220116
1490 Ga0307413_10229827
1491 Ga0307406_10056391
1492 Ga0307406_10222367
1493 Ga0307407_10448484
1494 Ga0307412_10372253
1495 Ga0307409_100101210
1496 Ga0307416_100315508
1497 Ga0307414_10170181
1498 Ga0307415_100327322
1499 Ga0307507_10013500
1500 Ga0307510_10040869
1501 Ga0307510_10075468
1502 Ga0307510_10324839
1503 Ga0315911_1000001
1504 Ga0373958_0030497
1505 Ga0373926_0132285
1506 Ga0373926_0139788
1507 Ga0373926_0195676
1508 Ga0373934_0001166
1509 Ga0373934_0176385
1510 Ga0373951_0047078
1511 Ga0373923_0026919
1512 Ga0373936_0007632
1513 Ga0373936_0069315
1514 Ga0373936_0085233
1515 Ga0373936_0277909
1516 Ga0373941_0152650
1517 Ga0373945_0032863
1518 Ga0373953_0002003
1519 Ga0373954_0134417
1520 Ga0373956_0100820
1521 Ga0373957_0004654
1522 Ga0373943_0005215
1523 Ga0373943_0036263
1524 Ga0373946_0004563
1525 Ga0373946_0025755
1526 Ga0373955_0053270
1527 Ga0373955_0061404
1528 Ga0373955_0091553
1529 Ga0373924_0033654
1530 Ga0373924_0125478
1531 Ga0373931_0024745
1532 Ga0373935_0000701
1533 Ga0373935_0056886
1534 Ga0373927_0001744
1535 Ga0373927_0013460
1536 Ga0373927_0028227
1537 Ga0373927_0028864
1538 Ga0373927_0098205
1539 Ga0373933_0000041
1540 Ga0373933_0105782
1541 Ga0373947_0001365
1542 Ga0373947_0054174
1543 Ga0373947_0229269
1544 Ga0373937_0573607
1545 Ga0373937_0704617
1546 Ga0373925_0008661
1547 Ga0373925_0032651
1548 Ga0373925_0126787
1549 Ga0395900_0143381
1550 Ga0395900_0266835
1551 Ga0395900_0616266
1552 Ga0395898_0136484
1553 Ga0395898_0389878
1554 Ga0395905_0173504
1555 Ga0395905_0369813
1556 Ga0395905_0471486
1557 Ga0436364_0836743
1558 Ga0395901_0155243
1559 Ga0436365_0096789
1560 Ga0436365_0662753
1561 Ga0436365_1159716
1562 Ga0436361_0041213
1563 Ga0436361_0782414
1564 Ga0436363_0979421
1565 Ga0439465_0012175
1566 Ga0439459_0035459
1567 Ga0466969_0019057
1568 Ga0466966_0009411
1569 Ga0466961_0000013
1570 Ga0466964_0013303
1571 Ga0466971_0352587
1572 Ga0466957_0066743
1573 Ga0466959_0037538
1574 Ga0466959_0287224
1575 Ga0466959_0344220
1576 Ga0466967_0106792
1577 Ga0495617_027351
1578 Ga0495617_029754
1579 Ga0495592_0068197
1580 Ga0495592_0170014
1581 Ga0495603_0000624
1582 Ga0495603_0029062
1583 Ga0495603_0064252
1584 Ga0495603_0066178
1585 Ga0495603_0152389
1586 Ga0495603_0237835
1587 Ga0495590_0028370
1588 Ga0495629_0001961
1589 Ga0495629_0074044
1590 Ga0495638_0015380
1591 Ga0495638_0150085
1592 Ga0495638_0340774
1593 Ga0495641_0006064
1594 Ga0495641_0165710
1595 Ga0495651_0058334
1596 Ga0495653_0000923
1597 Ga0495653_0187748
1598 Ga0495650_0034101
1599 Ga0495580_0008876
1600 Ga0495580_0009752
1601 Ga0495580_0229468
1602 Ga0495582_0000775
1603 Ga0495582_0036864
1604 Ga0495582_0085950
1605 Ga0495605_0056198
1606 Ga0495639_0000335
1607 Ga0495639_0026945
1608 Ga0495639_0038033
1609 Ga0495639_0043792
1610 Ga0495662_0000156
1611 Ga0495664_0003259
1612 Ga0495664_0195948
1613 Ga0495664_0199197
1614 Ga0495664_0216296
1615 Ga0495584_0044162
1616 Ga0495584_0143214
1617 Ga0495585_0069111
1618 Ga0495596_0163275
1619 Ga0495596_0214691
1620 Ga0495583_0197315
1621 Ga0495606_0011399
1622 Ga0495616_0095266
1623 Ga0495616_0102082
1624 Ga0495618_0107432
1625 Ga0495628_0058246
1626 Ga0495628_0088877
1627 Ga0495630_0011736
1628 Ga0495630_0014880
1629 Ga0495631_0091415
1630 Ga0495632_0016800
1631 Ga0495632_0030062
1632 Ga0495632_0100694
1633 Ga0495632_0112541
1634 Ga0495637_0122108
1635 Ga0495644_0032075
1636 Ga0495644_0039460
1637 Ga0495648_0006521
1638 Ga0495663_0116283
1639 Ga0495652_0043386
1640 Ga0495665_0000188
1641 Ga0495665_0012665
1642 Ga0495665_0177373
1643 Ga0495640_0002363
1644 Ga0495640_0013618
1645 Ga0495587_0075689
1646 Ga0495598_0009463
1647 Ga0495609_0033652
1648 Ga0495645_0153497
1649 Ga0495645_0182982
1650 Ga0495622_0013179
1651 Ga0495622_0033574
1652 Ga0495633_0016407
1653 Ga0495633_0248531
1654 Ga0495667_0157075
1655 Ga0495667_0210438
1656 Ga0495668_0195365
1657 Ga0495668_0252894
1658 Ga0495668_0276334
1659 Ga0495634_0001338
1660 Ga0495634_0015371
1661 Ga0495634_0021255
1662 Ga0495611_0024186
1663 Ga0495625_0104026
1664 Ga0495635_0000187
1665 Ga0495635_0001384
1666 Ga0495635_0197970
1667 Ga0495659_0070319
1668 Ga0495659_0175657
1669 Ga0495588_0012064
1670 Ga0495588_0014997
1671 Ga0495657_0119348
1672 Ga0495599_0012037
1673 Ga0495599_0137758
1674 Ga0495599_0148478
1675 Ga0495623_0021813
1676 Ga0495646_0005072
1677 Ga0495646_0071011
1678 Ga0495647_0006159
1679 Ga0495658_0000047
1680 Ga0495658_0005621
1681 Ga0495658_0011386
1682 Ga0495658_0323468
1683 Ga0495669_0009623
1684 Ga0495669_0113868
1685 Ga0495613_0001031
1686 Ga0495613_0058593
1687 Ga0495624_0001259
1688 Ga0495670_0036547
1689 Ga0495670_0122196
1690 Ga0495671_0040521
1691 Ga0495649_0086014
1692 Ga0495649_0175238
1693 Ga0495589_0054129
1694 Ga0495581_0000563
1695 Ga0495581_0129449
1696 Ga0495581_0196069
1697 Ga0495604_0480924
1698 Ga0495636_0122570
1699 Ga0495674_0022065
1700 Ga0495672_0016664
1701 Ga0495672_0101595
1702 Ga0495676_0060717
1703 Ga0495680_0085997
1704 Ga0495680_0568716
1705 Ga0495683_0198201
1706 Ga0495675_0074231
1707 Ga0495679_037119
1708 Ga0495685_065734
1709 Ga0495673_0110579
1710 Ga0495673_0142622
1711 Ga0495684_0000325
1712 Ga0495684_0008519
1713 Ga0495684_0015183
1714 Ga0495686_0339526
1715 Ga0495593_0026036
1716 Ga0495593_0038357
1717 Ga0495593_0251744
1718 Ga0495602_0080234
1719 Ga0495626_0099927
1720 Ga0496100_0018892
1721 Ga0496100_0028609
1722 Ga0496100_0034263
1723 Ga0496100_0538469
1724 Ga0496100_0547677
1725 Ga0496100_0633153
1726 Ga0496100_0799190
1727 Ga0496100_0803515
1728 Ga0496101_0173721
1729 Ga0496102_0028102
1730 Ga0496102_0070673
1731 Ga0496102_0181731
1732 Ga0496102_0438232
1733 Ga0496102_0552285
1734 Ga0496103_0048099
1735 Ga0496103_0075363
1736 Ga0496104_0016385
1737 Ga0496104_0017531
1738 Ga0496104_0127394
1739 Ga0496104_0205684
1740 Ga0496105_0013867
1741 Ga0496105_0048964
1742 Ga0496105_0065179
1743 Ga0496105_0428296
1744 Ga0496106_0010647
1745 Ga0496106_0045059
1746 Ga0496106_0097357
1747 Ga0496106_0150111
1748 Ga0496106_0201806
1749 Ga0496106_0209711
1750 Ga0496106_0227685
1751 Ga0496106_0289827
1752 Ga0496106_0402541
1753 Ga0496107_0065728
1754 Ga0496107_0112717
1755 Ga0496107_0132295
1756 Ga0496107_0350499
1757 Ga0496107_0390346
1758 Ga0496108_0013443
1759 Ga0496108_0197435
1760 Ga0496109_0007343
1761 Ga0496109_0008379
1762 Ga0496109_0141565
1763 Ga0496109_0253645
1764 Ga0496110_0004140
1765 Ga0496110_0061624
1766 Ga0496110_0067803
1767 Ga0496111_0019197
1768 Ga0496111_0085901
1769 Ga0496111_0270260
1770 Ga0496112_0000021
1771 Ga0496112_0006620
1772 Ga0496112_0025529
1773 Ga0496112_0109612
1774 Ga0496112_0194607
1775 Ga0496113_0003687
1776 Ga0496113_0003980
1777 Ga0496114_0029515
1778 Ga0496114_0049504
1779 Ga0496114_0194952
1780 Ga0496114_0739597
1781 Ga0496115_0015849
1782 Ga0496115_0093337
1783 Ga0496115_0497248
1784 Ga0496116_0105200
1785 Ga0496117_0054893
1786 Ga0496117_0103442
1787 Ga0496117_0169936
1788 Ga0496118_0052584
1789 Ga0496118_0145815
1790 Ga0496119_0047744
1791 Ga0496119_0155388
1792 Ga0496121_0002742
1793 Ga0496121_0024447
1794 Ga0496121_0034621
1795 Ga0496121_0043514
1796 Ga0496121_0056434
1797 Ga0496121_0073209
1798 Ga0496121_0077405
1799 Ga0496121_0081807
1800 Ga0496121_0114288
1801 Ga0496121_0184984
1802 Ga0496121_0188726
1803 Ga0496121_0199758
1804 Ga0496121_0354191
1805 Ga0496121_0419572
1806 Ga0496122_0016696
1807 Ga0496122_0035337
1808 Ga0496123_0073879
1809 Ga0496123_0207966
1810 Ga0496124_0041583
1811 Ga0496124_0072962
1812 Ga0496125_0074210
1813 Ga0496125_0161388
1814 Ga0496125_0293923
1815 Ga0496126_0004520
1816 Ga0496126_0014485
1817 Ga0496126_0018300
1818 Ga0496126_0030809
1819 Ga0496126_0041355
1820 Ga0496126_0045430
1821 Ga0496126_0046504
1822 Ga0496126_0062972
1823 Ga0496126_0066922
1824 Ga0496126_0128014
1825 Ga0496126_0162545
1826 Ga0496126_0176023
1827 Ga0496126_0217898
1828 Ga0496126_0394225
1829 Ga0495682_0159909
1830 Ga0501031_0000864
1831 Ga0501031_0035030
1832 Ga0501032_0001394
1833 Ga0501032_0018316
1834 Ga0501032_0019702
1835 Ga0501033_0000155
1836 Ga0501033_0001376
1837 Ga0501033_0067594
1838 Ga0501034_0000232
1839 Ga0501034_0175846
1840 Ga0501034_0216211
1841 Ga0501034_0504715
1842 Ga0501036_0000425
1843 Ga0501036_0173951
1844 Ga0501036_0254769
1845 Ga0501037_0000463
1846 Ga0501037_0009561
1847 Ga0501037_0082565
1848 Ga0501038_0000943
1849 Ga0501038_0021700
1850 Ga0501038_0160581
1851 Ga0501039_0008204
1852 Ga0501039_0031614
1853 Ga0501039_0063458
1854 Ga0501040_0047444
1855 Ga0501042_0031953
1856 Ga0501042_0093859
1857 Ga0501042_0100439
1858 Ga0501043_0000035
1859 Ga0501043_0005159
1860 Ga0501043_0009741
1861 Ga0501046_0027631
1862 Ga0501046_0033024
1863 Ga0501046_0039309
1864 Ga0501046_0056526
1865 Ga0501047_0000085
1866 Ga0501047_0062533
1867 Ga0501047_0117793
1868 Ga0501048_0000061
1869 Ga0501048_0017589
1870 Ga0501067_0002400
1871 Ga0501067_0027068
1872 Ga0501068_0003110
1873 Ga0501068_0004955
1874 Ga0501068_0118305
1875 Ga0501069_0043593
1876 Ga0501069_0054769
1877 Ga0501070_0000272
1878 Ga0501072_0000537
1879 Ga0501072_0414184
1880 Ga0501073_0000026
1881 Ga0501073_0054428
1882 Ga0501073_0118470
1883 Ga0501074_0000017
1884 Ga0501074_0024699
1885 Ga0501074_0035306
1886 Ga0501076_0074303
1887 Ga0501076_0157968
1888 Ga0501079_0014040
1889 Ga0501080_0005584
1890 Ga0501080_0036359
1891 Ga0501080_0038761
1892 Ga0501080_0149343
1893 Ga0501081_0190457
1894 Ga0501083_0000264
1895 Ga0501083_0015098
1896 Ga0501035_0000548
1897 Ga0501035_0002887
1898 Ga0501035_0053294
1899 Ga0501035_0324431
1900 Ga0501035_0556564
1901 Ga0501044_0000051
1902 Ga0501044_0002908
1903 Ga0501044_0015682
1904 Ga0501044_0044996
1905 Ga0501044_0056733
1906 Ga0501045_0004421
1907 nmdc:mga03n38_69948_c1
1908 nmdc:mga00v17_241032_c1
1909 nmdc:mga00v17_58782_c1
1910 nmdc:mga0yw44_199478_c1
1911 nmdc:mga0yw44_5148_c1
1912 nmdc:mga0yw44_77380_c1
1913 nmdc:mga0k408_27004_c1
1914 nmdc:mga06z11_7637_c1
1915 nmdc:mga07m45_10610_c1
1916 nmdc:mga07m45_193668_c1
1917 nmdc:mga07m45_21995_c1
1918 nmdc:mga07m45_258776_c1
1919 nmdc:mga05p37_862963_c1
1920 nmdc:mga08y16_196284_c1
1921 nmdc:mga08y16_493786_c1
1922 nmdc:mga0n895_530750_c1
1923 nmdc:mga0sz30_109892_c1
1924 nmdc:mga0sz30_273184_c1
1925 Ga0495601_0016290
1926 Ga0495601_0162692
1927 Ga0495612_0043880
1928 Ga0495612_0081393
1929 Ga0495595_0027301
1930 Ga0495595_0033143
1931 Ga0495619_0010939
1932 Ga0495619_0071904
1933 Ga0495619_0085382
1934 Ga0500578_0101424
1935 Ga0500578_0181253
1936 Ga0500647_0016096
1937 Ga0500583_0064941
1938 Ga0500651_0141906
1939 Ga0500566_0001308
1940 Ga0500566_0002248
1941 Ga0500566_0036554
1942 Ga0500641_0001881
1943 Ga0500641_0006011
1944 Ga0500641_0012131
1945 Ga0500641_0080164
1946 Ga0500650_0048216
1947 Ga0500554_022916
1948 Ga0500554_025861
1949 Ga0500555_000359
1950 Ga0500556_0047341
1951 Ga0500562_034792
1952 Ga0500592_001571
1953 Ga0500595_003793
1954 Ga0500595_039911
1955 Ga0500607_231785
1956 Ga0500608_088031
1957 Ga0500618_008918
1958 Ga0500642_0010090
1959 Ga0500652_040407
1960 Ga0500658_0111149
1961 Ga0500658_0190988
1962 Ga0500559_0035914
1963 Ga0500559_0050244
1964 Ga0500561_0145658
1965 Ga0500577_0000274
1966 Ga0500579_194710
1967 Ga0500589_057710
1968 Ga0500590_027454
1969 Ga0500603_017374
1970 Ga0500603_049325
1971 Ga0500604_0089422
1972 Ga0500620_079162
1973 Ga0500627_0032689
1974 Ga0500636_0036791
1975 Ga0500637_0000088
1976 Ga0500637_0135409
1977 Ga0500637_0203632
1978 Ga0500611_010511
1979 Ga0500645_008427
1980 Ga0501084_0012701
1981 Ga0501082_0010719
1982 Ga0501082_0272665
1983 Ga0466962_0029856
1984 2513654765
1985 2513675869
1986 2513692563
1987 2513855814
1988 2513863673
1989 2513915055
1990 2515629854
1991 2517106800
1992 2517892352
1993 2524538559
1994 2617349055
1995 2671120397
1996 2723845052
1997 2728751150
1998 2793072171
1999 2793082079
2000 2824679185
2001 2824695789
2002 2824779582
2003 2847936254
2004 2874598095
2005 2874605231
2006 2874631897
2007 2874645436
2008 2876778427
2009 2876814300
2010 2876820373
2011 2879082221
2012 2879090673
2013 2879100556
2014 2879111225
2015 2879135368
2016 2879150577
2017 2885380536
2018 2885386571
2019 2889039806
2020 2893070545
2021 2903749335
2022 2903773982
2023 2904695857
2024 2904703494
2025 2906618673
2026 2906638888
2027 2906666331
2028 2908742650
2029 2908761158
2030 2922365391
2031 2922376912
2032 2922391002
2033 2922430332
2034 2932790133
2035 2932818087
2036 2932827921
2037 2935608923
2038 2935631626
2039 2935653376
2040 2935660153
2041 2935684187
2042 2935693383
2043 2935700151
2044 2935720828
2045 2935730685
2046 2935740550
2047 2935749976
2048 2935759204
2049 2935769622
2050 2935776919
2051 2935778570
2052 2935792235
2053 2935800398
2054 2935819670
2055 2935822083
2056 2935847665
2057 2935909063
2058 2935919783
2059 2935926363
2060 2935934813
2061 2935943263
2062 2935951701
2063 2935967826
2064 2935982621
2065 2936016246
2066 2936024879
2067 2936032127
2068 2936046427
2069 2936049988
2070 2936060941
2071 2940565270
2072 2941511420
2073 2941519121
2074 2941526299
2075 2941532857
2076 3005480254
2077 3005484360
2078 3005588008
2079 3005714947
2080 8006940630
2081 8006965777
2082 8006980319
2083 8006987013
2084 8006996001
2085 8016529574
2086 8016534787
2087 8016548004
2088 8016554126
2089 8016562503
2090 8016577279
2091 8016600293
2092 8016610457
2093 8016614478
2094 8016626519
2095 8016640286
2096 8019534556
2097 8019544916
2098 8019553617
2099 8019568608
2100 8019628220
2101 8019634409
2102 8019645328
2103 8019662289
2104 8019671794
2105 8019684300
2106 8056673833
2107 8056686691
2108 8056693511

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

4

190

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

10

218

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

6

185

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o3z-assembly1.cif.gz_D crystal structure of sorbitol-6-phosphate 2-dehydrogenase srld from erwinia amylovora 0.9243 4 224
6zzs-assembly2.cif.gz_F-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate 0.9193 2 222
6xex-assembly1.cif.gz_B structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a/v139q 0.9192 1 222
3tzq-assembly1.cif.gz_A crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum 0.9188 2 221
6vsp-assembly1.cif.gz_B structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a 0.9142 1 221
ID Description Score Start End Superfamily
af_Q869N3_132_238_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9531 2 36 3.90.180.10
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9464 1 33 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9237 1 171 3.40.50.720
3awdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9158 1 222 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9137 1 222 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5D3JYC9-F1-model_v4 SDR family oxidoreductase 0.9769 1 226 GO:0016616
GO:0030497
AF-A0A1H6MA19-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.976 1 226 GO:0016616
GO:0030497
AF-A0A6F8NNH5-F1-model_v4 deleted 0.9752 1 226
AF-A0A0S6UVM3-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.9737 2 226 GO:0016616
GO:0030497
AF-A0A6F8NNH5-F1-model_v4 deleted 0.9709 1 226

Map