F489110
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1053 | 356 | 1045 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10028143|Ga0157371_100281433 |
| Length | 179 |
| Sequence | LIQKLHAMRMKPSHELISLLNKEAPAVPKLDLDAIPQTNRTGYPAPYDKAVGDRWVRRLRPVAGLSHLGAAHVVLKPGAWSSQRHWHAEEDELVVILSGEAVLVEDGGETVLRVGDIAAWPKGVKDGHCLQNRGEVDCVMIAVSAGDAANDYGEYPDIDLRFSRDGYLHKDGTPYPPQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 4 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 5 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 6 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 7 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 8 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 9 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 10 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 11 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 12 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 13 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 14 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 18 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 19 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 20 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 139 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 142 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 211 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 212 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 216 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 243 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 246 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 247 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 248 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 249 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 250 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 251 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 252 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 253 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 254 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 255 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 256 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 257 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 258 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 259 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 260 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 261 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 262 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 263 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 264 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 265 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 283 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 284 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 294 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 295 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 296 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 307 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 308 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 313 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 314 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 315 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 316 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 319 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 320 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 321 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 322 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 327 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 328 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 329 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 330 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 331 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 341 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 342 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 344 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 345 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 346 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 348 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 349 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 350 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 351 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 352 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 353 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.24 |
| Metatranscriptomes | 0 |
| Isolates | 0.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.31 |
| Nodule | 0 |
| Rhizoplane | 3.13 |
| Rhizosphere | 87.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_2393116 | 2162886006 | Bacteria | 1518 |
| 2 | SwRhRL3b_contig_3059437 | 2162886006 | Bacteria | 1618 |
| 3 | SwRhRL3b_contig_457702 | 2162886006 | Bacteria | 1086 |
| 4 | MBSR1b_contig_4721503 | 2162886012 | Bacteria | 870 |
| 5 | JGI24736J21556_1000380 | 3300001904 | Bacteria | 8425 |
| 6 | JGI24741J21665_1011686 | 3300001915 | Bacteria | 1527 |
| 7 | JGI24741J21665_1025433 | 3300001915 | Unclassified | 905 |
| 8 | JGI24752J21851_1031004 | 3300001976 | Bacteria | 706 |
| 9 | JGI24740J21852_10004073 | 3300001979 | Bacteria | 6325 |
| 10 | JGI24740J21852_10006068 | 3300001979 | Bacteria | 5049 |
| 11 | JGI24740J21852_10020042 | 3300001979 | Bacteria | 2344 |
| 12 | JGI24740J21852_10076214 | 3300001979 | Bacteria | 887 |
| 13 | JGI24739J22299_10006920 | 3300001989 | Bacteria | 4272 |
| 14 | JGI24739J22299_10018997 | 3300001989 | Bacteria | 2465 |
| 15 | JGI24737J22298_10004108 | 3300001990 | Bacteria | 5084 |
| 16 | JGI24737J22298_10020537 | 3300001990 | Bacteria | 2108 |
| 17 | JGI24737J22298_10121900 | 3300001990 | Bacteria | 770 |
| 18 | JGI24743J22301_10008643 | 3300001991 | Bacteria | 1790 |
| 19 | JGI24735J21928_10002919 | 3300002067 | Bacteria | 5882 |
| 20 | JGI24735J21928_10006830 | 3300002067 | Bacteria | 3740 |
| 21 | JGI24738J21930_10019210 | 3300002075 | Bacteria | 1426 |
| 22 | JGI24738J21930_10027575 | 3300002075 | Bacteria | 1164 |
| 23 | JGI24738J21930_10059138 | 3300002075 | Bacteria | 786 |
| 24 | JGI25406J46586_10132469 | 3300003203 | Bacteria | 730 |
| 25 | JGI25153J46596_10001155 | 3300003215 | Bacteria | 15979 |
| 26 | rootH1_10052394 | 3300003316 | Bacteria | 4912 |
| 27 | Ga0055534_1005827 | 3300003784 | Bacteria | 3223 |
| 28 | Ga0055530_10000197 | 3300003791 | Bacteria | 54281 |
| 29 | Ga0055531_10008524 | 3300003794 | Bacteria | 5383 |
| 30 | Ga0065704_10113709 | 3300005289 | Bacteria | 1902 |
| 31 | Ga0065712_10398292 | 3300005290 | Bacteria | 734 |
| 32 | Ga0065715_10157897 | 3300005293 | Bacteria | 1658 |
| 33 | Ga0065707_10082019 | 3300005295 | Bacteria | 24573 |
| 34 | Ga0070658_10002803 | 3300005327 | Bacteria | 14482 |
| 35 | Ga0070658_10003377 | 3300005327 | Bacteria | 13153 |
| 36 | Ga0070658_10016537 | 3300005327 | Bacteria | 5903 |
| 37 | Ga0070658_10018766 | 3300005327 | Bacteria | 5540 |
| 38 | Ga0070658_10021373 | 3300005327 | Bacteria | 5186 |
| 39 | Ga0070658_10068054 | 3300005327 | Bacteria | 2910 |
| 40 | Ga0070658_10095345 | 3300005327 | Bacteria | 2456 |
| 41 | Ga0070658_10097037 | 3300005327 | Bacteria | 2434 |
| 42 | Ga0070658_10285681 | 3300005327 | Bacteria | 1405 |
| 43 | Ga0070658_10306522 | 3300005327 | Bacteria | 1354 |
| 44 | Ga0070658_10347241 | 3300005327 | Bacteria | 1270 |
| 45 | Ga0070658_10423728 | 3300005327 | Bacteria | 1145 |
| 46 | Ga0070658_10548228 | 3300005327 | Bacteria | 1001 |
| 47 | Ga0070658_10689605 | 3300005327 | Bacteria | 886 |
| 48 | Ga0070658_10736682 | 3300005327 | Bacteria | 856 |
| 49 | Ga0070676_10090890 | 3300005328 | Bacteria | 1870 |
| 50 | Ga0070676_10157038 | 3300005328 | Bacteria | 1461 |
| 51 | Ga0070683_100019869 | 3300005329 | Bacteria | 5971 |
| 52 | Ga0070683_100071884 | 3300005329 | Bacteria | 3228 |
| 53 | Ga0070683_100104557 | 3300005329 | Bacteria | 2669 |
| 54 | Ga0070683_100115603 | 3300005329 | Bacteria | 2533 |
| 55 | Ga0070683_100263198 | 3300005329 | Bacteria | 1640 |
| 56 | Ga0070683_100263397 | 3300005329 | Bacteria | 1640 |
| 57 | Ga0070690_100205593 | 3300005330 | Bacteria | 1372 |
| 58 | Ga0070690_100591973 | 3300005330 | Bacteria | 841 |
| 59 | Ga0070670_100024585 | 3300005331 | Bacteria | 5179 |
| 60 | Ga0070670_100058924 | 3300005331 | Bacteria | 3296 |
| 61 | Ga0070670_100158438 | 3300005331 | Bacteria | 1961 |
| 62 | Ga0070670_100701594 | 3300005331 | Bacteria | 910 |
| 63 | Ga0068869_100211770 | 3300005334 | Bacteria | 1532 |
| 64 | Ga0068869_100453908 | 3300005334 | Bacteria | 1063 |
| 65 | Ga0068869_100969869 | 3300005334 | Bacteria | 739 |
| 66 | Ga0070666_10000630 | 3300005335 | Bacteria | 21198 |
| 67 | Ga0070666_10594498 | 3300005335 | Bacteria | 807 |
| 68 | Ga0070680_100015126 | 3300005336 | Bacteria | 6042 |
| 69 | Ga0070680_100092035 | 3300005336 | Bacteria | 2511 |
| 70 | Ga0070680_100758450 | 3300005336 | Bacteria | 835 |
| 71 | Ga0070682_100117860 | 3300005337 | Bacteria | 1778 |
| 72 | Ga0070682_100141471 | 3300005337 | Bacteria | 1641 |
| 73 | Ga0070682_100208836 | 3300005337 | Bacteria | 1382 |
| 74 | Ga0068868_100223366 | 3300005338 | Bacteria | 1578 |
| 75 | Ga0068868_100407027 | 3300005338 | Bacteria | 1175 |
| 76 | Ga0068868_101146694 | 3300005338 | Bacteria | 717 |
| 77 | Ga0070660_100001159 | 3300005339 | Bacteria | 17807 |
| 78 | Ga0070660_100001476 | 3300005339 | Bacteria | 16095 |
| 79 | Ga0070660_100024417 | 3300005339 | Bacteria | 4483 |
| 80 | Ga0070660_100032537 | 3300005339 | Bacteria | 3925 |
| 81 | Ga0070660_100155021 | 3300005339 | Bacteria | 1843 |
| 82 | Ga0070660_100199843 | 3300005339 | Bacteria | 1621 |
| 83 | Ga0070660_100220477 | 3300005339 | Bacteria | 1541 |
| 84 | Ga0070660_100284271 | 3300005339 | Bacteria | 1354 |
| 85 | Ga0070660_100554676 | 3300005339 | Bacteria | 959 |
| 86 | Ga0070660_100673729 | 3300005339 | Bacteria | 867 |
| 87 | Ga0070660_100746407 | 3300005339 | Bacteria | 822 |
| 88 | Ga0070660_101305530 | 3300005339 | Bacteria | 616 |
| 89 | Ga0070689_100431659 | 3300005340 | Bacteria | 1118 |
| 90 | Ga0070689_101334296 | 3300005340 | Bacteria | 647 |
| 91 | Ga0070691_10071076 | 3300005341 | Bacteria | 1689 |
| 92 | Ga0070691_10770287 | 3300005341 | Bacteria | 583 |
| 93 | Ga0070687_100313353 | 3300005343 | Bacteria | 1000 |
| 94 | Ga0070661_100000001 | 3300005344 | Bacteria | 424830 |
| 95 | Ga0070661_100004337 | 3300005344 | Bacteria | 9786 |
| 96 | Ga0070661_100014609 | 3300005344 | Bacteria | 5536 |
| 97 | Ga0070661_100026908 | 3300005344 | Bacteria | 4140 |
| 98 | Ga0070661_100077870 | 3300005344 | Bacteria | 2445 |
| 99 | Ga0070661_100137949 | 3300005344 | Bacteria | 1836 |
| 100 | Ga0070661_100246747 | 3300005344 | Unclassified | 1377 |
| 101 | Ga0070661_100299978 | 3300005344 | Bacteria | 1250 |
| 102 | Ga0070661_100332183 | 3300005344 | Bacteria | 1189 |
| 103 | Ga0070661_100398411 | 3300005344 | Bacteria | 1088 |
| 104 | Ga0070661_100476548 | 3300005344 | Bacteria | 996 |
| 105 | Ga0070692_10018291 | 3300005345 | Bacteria | 3367 |
| 106 | Ga0070692_10030185 | 3300005345 | Bacteria | 2709 |
| 107 | Ga0070692_10100480 | 3300005345 | Bacteria | 1585 |
| 108 | Ga0070668_100039770 | 3300005347 | Bacteria | 3597 |
| 109 | Ga0070668_100105185 | 3300005347 | Bacteria | 2241 |
| 110 | Ga0070668_100124859 | 3300005347 | Bacteria | 2061 |
| 111 | Ga0070668_100403365 | 3300005347 | Bacteria | 1168 |
| 112 | Ga0070671_100022193 | 3300005355 | Bacteria | 5185 |
| 113 | Ga0070671_100029902 | 3300005355 | Bacteria | 4494 |
| 114 | Ga0070671_100555906 | 3300005355 | Bacteria | 990 |
| 115 | Ga0070674_100170289 | 3300005356 | Bacteria | 1660 |
| 116 | Ga0070673_100000613 | 3300005364 | Bacteria | 19502 |
| 117 | Ga0070673_100030292 | 3300005364 | Bacteria | 4046 |
| 118 | Ga0070673_101000435 | 3300005364 | Bacteria | 778 |
| 119 | Ga0070659_100001497 | 3300005366 | Bacteria | 16828 |
| 120 | Ga0070659_100001672 | 3300005366 | Bacteria | 15938 |
| 121 | Ga0070659_100002899 | 3300005366 | Bacteria | 12212 |
| 122 | Ga0070659_100004174 | 3300005366 | Bacteria | 10299 |
| 123 | Ga0070659_100035234 | 3300005366 | Bacteria | 3897 |
| 124 | Ga0070659_100039458 | 3300005366 | Bacteria | 3686 |
| 125 | Ga0070659_100066449 | 3300005366 | Bacteria | 2857 |
| 126 | Ga0070659_100141380 | 3300005366 | Bacteria | 1960 |
| 127 | Ga0070659_100201266 | 3300005366 | Bacteria | 1639 |
| 128 | Ga0070659_100218370 | 3300005366 | Bacteria | 1573 |
| 129 | Ga0070659_100424745 | 3300005366 | Bacteria | 1124 |
| 130 | Ga0070659_100458545 | 3300005366 | Bacteria | 1082 |
| 131 | Ga0070659_100527319 | 3300005366 | Bacteria | 1009 |
| 132 | Ga0070659_101299958 | 3300005366 | Bacteria | 645 |
| 133 | Ga0070667_100003077 | 3300005367 | Bacteria | 14332 |
| 134 | Ga0070667_100003302 | 3300005367 | Bacteria | 13792 |
| 135 | Ga0070667_100380319 | 3300005367 | Bacteria | 1282 |
| 136 | Ga0070667_100404435 | 3300005367 | Bacteria | 1243 |
| 137 | Ga0070667_100834494 | 3300005367 | Bacteria | 857 |
| 138 | Ga0070714_100023828 | 3300005435 | Bacteria | 5034 |
| 139 | Ga0070714_100263184 | 3300005435 | Bacteria | 1597 |
| 140 | Ga0070713_100079220 | 3300005436 | Bacteria | 2798 |
| 141 | Ga0070694_100024929 | 3300005444 | Bacteria | 3865 |
| 142 | Ga0070663_100002429 | 3300005455 | Bacteria | 10478 |
| 143 | Ga0070663_100005583 | 3300005455 | Bacteria | 7487 |
| 144 | Ga0070663_100028492 | 3300005455 | Bacteria | 3803 |
| 145 | Ga0070663_100028995 | 3300005455 | Bacteria | 3776 |
| 146 | Ga0070663_100212977 | 3300005455 | Bacteria | 1514 |
| 147 | Ga0070663_100444393 | 3300005455 | Bacteria | 1067 |
| 148 | Ga0070663_100498380 | 3300005455 | Bacteria | 1011 |
| 149 | Ga0070663_101203871 | 3300005455 | Bacteria | 666 |
| 150 | Ga0070663_101225404 | 3300005455 | Bacteria | 660 |
| 151 | Ga0070663_101247015 | 3300005455 | Bacteria | 655 |
| 152 | Ga0070678_100001960 | 3300005456 | Bacteria | 11113 |
| 153 | Ga0070678_100254941 | 3300005456 | Bacteria | 1473 |
| 154 | Ga0070662_100000183 | 3300005457 | Bacteria | 36515 |
| 155 | Ga0070662_100001950 | 3300005457 | Bacteria | 12681 |
| 156 | Ga0070662_100033982 | 3300005457 | Bacteria | 3594 |
| 157 | Ga0070662_100063612 | 3300005457 | Bacteria | 2699 |
| 158 | Ga0070662_100077429 | 3300005457 | Bacteria | 2468 |
| 159 | Ga0070662_100183278 | 3300005457 | Bacteria | 1652 |
| 160 | Ga0070662_100525951 | 3300005457 | Bacteria | 989 |
| 161 | Ga0070662_100550808 | 3300005457 | Bacteria | 966 |
| 162 | Ga0070662_100733772 | 3300005457 | Bacteria | 837 |
| 163 | Ga0070662_101087796 | 3300005457 | Bacteria | 686 |
| 164 | Ga0070662_101265971 | 3300005457 | Unclassified | 634 |
| 165 | Ga0070681_10001494 | 3300005458 | Bacteria | 20676 |
| 166 | Ga0070681_10004781 | 3300005458 | Bacteria | 12980 |
| 167 | Ga0070681_10024034 | 3300005458 | Bacteria | 6135 |
| 168 | Ga0070681_10025673 | 3300005458 | Bacteria | 5926 |
| 169 | Ga0070681_10120408 | 3300005458 | Bacteria | 2560 |
| 170 | Ga0070681_10238297 | 3300005458 | Bacteria | 1733 |
| 171 | Ga0068867_100969546 | 3300005459 | Bacteria | 769 |
| 172 | Ga0068867_101922976 | 3300005459 | Bacteria | 558 |
| 173 | Ga0070706_101056268 | 3300005467 | Bacteria | 748 |
| 174 | Ga0070699_100994270 | 3300005518 | Bacteria | 769 |
| 175 | Ga0070679_100001448 | 3300005530 | Bacteria | 20991 |
| 176 | Ga0070679_100019105 | 3300005530 | Bacteria | 6659 |
| 177 | Ga0070679_100040999 | 3300005530 | Bacteria | 4608 |
| 178 | Ga0070679_100072934 | 3300005530 | Bacteria | 3425 |
| 179 | Ga0070679_100119159 | 3300005530 | Bacteria | 2624 |
| 180 | Ga0070679_100372176 | 3300005530 | Bacteria | 1375 |
| 181 | Ga0070679_100816233 | 3300005530 | Bacteria | 876 |
| 182 | Ga0070679_101117448 | 3300005530 | Bacteria | 733 |
| 183 | Ga0070679_102005223 | 3300005530 | Bacteria | 528 |
| 184 | Ga0070684_100101049 | 3300005535 | Bacteria | 2576 |
| 185 | Ga0070684_100202819 | 3300005535 | Bacteria | 1807 |
| 186 | Ga0070684_100219514 | 3300005535 | Bacteria | 1735 |
| 187 | Ga0068853_100002487 | 3300005539 | Bacteria | 13809 |
| 188 | Ga0068853_100010266 | 3300005539 | Bacteria | 7574 |
| 189 | Ga0068853_100015278 | 3300005539 | Bacteria | 6309 |
| 190 | Ga0068853_100020000 | 3300005539 | Bacteria | 5562 |
| 191 | Ga0068853_100090163 | 3300005539 | Bacteria | 2694 |
| 192 | Ga0068853_100094613 | 3300005539 | Bacteria | 2633 |
| 193 | Ga0068853_100120161 | 3300005539 | Bacteria | 2343 |
| 194 | Ga0068853_100198188 | 3300005539 | Bacteria | 1826 |
| 195 | Ga0068853_100221131 | 3300005539 | Bacteria | 1729 |
| 196 | Ga0068853_100796336 | 3300005539 | Bacteria | 905 |
| 197 | Ga0068853_101741925 | 3300005539 | Bacteria | 604 |
| 198 | Ga0070672_100001691 | 3300005543 | Bacteria | 13764 |
| 199 | Ga0070672_100791652 | 3300005543 | Bacteria | 834 |
| 200 | Ga0070686_100377842 | 3300005544 | Bacteria | 1072 |
| 201 | Ga0070695_100008415 | 3300005545 | Bacteria | 6125 |
| 202 | Ga0070696_100077670 | 3300005546 | Bacteria | 2346 |
| 203 | Ga0070696_101329684 | 3300005546 | Bacteria | 611 |
| 204 | Ga0070693_100030191 | 3300005547 | Bacteria | 2962 |
| 205 | Ga0070693_100439818 | 3300005547 | Bacteria | 913 |
| 206 | Ga0070693_100603749 | 3300005547 | Bacteria | 792 |
| 207 | Ga0070693_100739418 | 3300005547 | Bacteria | 724 |
| 208 | Ga0070665_100020234 | 3300005548 | Bacteria | 6682 |
| 209 | Ga0070665_100178366 | 3300005548 | Bacteria | 2125 |
| 210 | Ga0070704_100521830 | 3300005549 | Bacteria | 1034 |
| 211 | Ga0068855_100003943 | 3300005563 | Bacteria | 18111 |
| 212 | Ga0068855_100004493 | 3300005563 | Bacteria | 17049 |
| 213 | Ga0068855_100026207 | 3300005563 | Bacteria | 6975 |
| 214 | Ga0068855_100111889 | 3300005563 | Bacteria | 3134 |
| 215 | Ga0068855_100112736 | 3300005563 | Bacteria | 3121 |
| 216 | Ga0068855_100170776 | 3300005563 | Unclassified | 2463 |
| 217 | Ga0068855_100197776 | 3300005563 | Bacteria | 2264 |
| 218 | Ga0068855_100387828 | 3300005563 | Bacteria | 1533 |
| 219 | Ga0068855_100688916 | 3300005563 | Bacteria | 1095 |
| 220 | Ga0068855_100852756 | 3300005563 | Bacteria | 965 |
| 221 | Ga0068855_101729156 | 3300005563 | Bacteria | 637 |
| 222 | Ga0068855_101769804 | 3300005563 | Bacteria | 628 |
| 223 | Ga0070664_100002251 | 3300005564 | Bacteria | 15526 |
| 224 | Ga0070664_100006440 | 3300005564 | Bacteria | 9468 |
| 225 | Ga0070664_100028663 | 3300005564 | Bacteria | 4634 |
| 226 | Ga0070664_100047078 | 3300005564 | Bacteria | 3643 |
| 227 | Ga0070664_100068112 | 3300005564 | Bacteria | 3043 |
| 228 | Ga0070664_100068314 | 3300005564 | Bacteria | 3038 |
| 229 | Ga0070664_100070632 | 3300005564 | Bacteria | 2991 |
| 230 | Ga0070664_100157013 | 3300005564 | Bacteria | 2011 |
| 231 | Ga0070664_100168839 | 3300005564 | Unclassified | 1940 |
| 232 | Ga0070664_100812016 | 3300005564 | Bacteria | 875 |
| 233 | Ga0068857_100012269 | 3300005577 | Bacteria | 7455 |
| 234 | Ga0068857_100012687 | 3300005577 | Bacteria | 7344 |
| 235 | Ga0068857_100016853 | 3300005577 | Bacteria | 6401 |
| 236 | Ga0068857_100208205 | 3300005577 | Bacteria | 1784 |
| 237 | Ga0068857_100437446 | 3300005577 | Bacteria | 1221 |
| 238 | Ga0068857_100584191 | 3300005577 | Bacteria | 1055 |
| 239 | Ga0068857_100995463 | 3300005577 | Bacteria | 807 |
| 240 | Ga0068854_100006566 | 3300005578 | Bacteria | 7406 |
| 241 | Ga0068854_100017822 | 3300005578 | Bacteria | 4759 |
| 242 | Ga0068854_100213881 | 3300005578 | Bacteria | 1522 |
| 243 | Ga0068854_100391560 | 3300005578 | Bacteria | 1147 |
| 244 | Ga0068854_100488073 | 3300005578 | Bacteria | 1035 |
| 245 | Ga0068856_100017668 | 3300005614 | Bacteria | 6914 |
| 246 | Ga0068856_100025094 | 3300005614 | Bacteria | 5809 |
| 247 | Ga0068856_100071045 | 3300005614 | Bacteria | 3445 |
| 248 | Ga0068856_100282694 | 3300005614 | Bacteria | 1676 |
| 249 | Ga0068856_100435216 | 3300005614 | Bacteria | 1332 |
| 250 | Ga0068856_100460795 | 3300005614 | Bacteria | 1292 |
| 251 | Ga0068856_100504088 | 3300005614 | Bacteria | 1231 |
| 252 | Ga0068856_100616694 | 3300005614 | Bacteria | 1106 |
| 253 | Ga0068856_100810795 | 3300005614 | Bacteria | 956 |
| 254 | Ga0070702_101221436 | 3300005615 | Bacteria | 607 |
| 255 | Ga0068852_100000043 | 3300005616 | Bacteria | 89867 |
| 256 | Ga0068852_100003224 | 3300005616 | Bacteria | 11388 |
| 257 | Ga0068852_100087379 | 3300005616 | Bacteria | 2782 |
| 258 | Ga0068852_100105224 | 3300005616 | Bacteria | 2556 |
| 259 | Ga0068852_100134000 | 3300005616 | Bacteria | 2285 |
| 260 | Ga0068852_100186235 | 3300005616 | Bacteria | 1955 |
| 261 | Ga0068852_100247262 | 3300005616 | Bacteria | 1707 |
| 262 | Ga0068852_100263119 | 3300005616 | Bacteria | 1657 |
| 263 | Ga0068852_100327860 | 3300005616 | Bacteria | 1489 |
| 264 | Ga0068852_100371488 | 3300005616 | Bacteria | 1401 |
| 265 | Ga0068852_100447122 | 3300005616 | Bacteria | 1279 |
| 266 | Ga0068852_100509187 | 3300005616 | Bacteria | 1200 |
| 267 | Ga0068852_100577971 | 3300005616 | Bacteria | 1126 |
| 268 | Ga0068852_100652423 | 3300005616 | Bacteria | 1060 |
| 269 | Ga0068852_101301608 | 3300005616 | Bacteria | 748 |
| 270 | Ga0068859_100664366 | 3300005617 | Bacteria | 1134 |
| 271 | Ga0068864_100011893 | 3300005618 | Bacteria | 7185 |
| 272 | Ga0068851_10005339 | 3300005834 | Bacteria | 5833 |
| 273 | Ga0068851_10018748 | 3300005834 | Bacteria | 3338 |
| 274 | Ga0068851_10035286 | 3300005834 | Bacteria | 2499 |
| 275 | Ga0068851_10038966 | 3300005834 | Bacteria | 2386 |
| 276 | Ga0068851_10045538 | 3300005834 | Bacteria | 2217 |
| 277 | Ga0068870_10045636 | 3300005840 | Bacteria | 2295 |
| 278 | Ga0068863_100030776 | 3300005841 | Bacteria | 5125 |
| 279 | Ga0068863_100132055 | 3300005841 | Bacteria | 2384 |
| 280 | Ga0068858_100327860 | 3300005842 | Bacteria | 1464 |
| 281 | Ga0068860_100006788 | 3300005843 | Bacteria | 11471 |
| 282 | Ga0068860_100007732 | 3300005843 | Bacteria | 10742 |
| 283 | Ga0068860_100111287 | 3300005843 | Bacteria | 2618 |
| 284 | Ga0068860_100388182 | 3300005843 | Bacteria | 1379 |
| 285 | Ga0081538_10002850 | 3300005981 | Bacteria | 16534 |
| 286 | Ga0081539_10071277 | 3300005985 | Bacteria | 1862 |
| 287 | Ga0070717_10142382 | 3300006028 | Bacteria | 2069 |
| 288 | Ga0075365_10360716 | 3300006038 | Bacteria | 1024 |
| 289 | Ga0075365_10698794 | 3300006038 | Bacteria | 716 |
| 290 | Ga0075368_10055219 | 3300006042 | Bacteria | 1583 |
| 291 | Ga0075363_100043168 | 3300006048 | Bacteria | 2384 |
| 292 | Ga0075363_100090176 | 3300006048 | Bacteria | 1686 |
| 293 | Ga0075363_100293064 | 3300006048 | Bacteria | 943 |
| 294 | Ga0075364_10264046 | 3300006051 | Bacteria | 1170 |
| 295 | Ga0070716_101269268 | 3300006173 | Bacteria | 594 |
| 296 | Ga0075362_10036972 | 3300006177 | Bacteria | 2139 |
| 297 | Ga0075362_10179504 | 3300006177 | Bacteria | 1025 |
| 298 | Ga0075362_10262266 | 3300006177 | Bacteria | 852 |
| 299 | Ga0075362_10483872 | 3300006177 | Bacteria | 631 |
| 300 | Ga0075367_10133599 | 3300006178 | Bacteria | 1535 |
| 301 | Ga0075367_10167143 | 3300006178 | Bacteria | 1369 |
| 302 | Ga0075367_10221779 | 3300006178 | Bacteria | 1183 |
| 303 | Ga0075369_10025662 | 3300006186 | Bacteria | 2452 |
| 304 | Ga0075366_10020324 | 3300006195 | Bacteria | 3851 |
| 305 | Ga0075366_10075162 | 3300006195 | Bacteria | 2015 |
| 306 | Ga0075366_10318872 | 3300006195 | Bacteria | 952 |
| 307 | Ga0075366_10506399 | 3300006195 | Bacteria | 746 |
| 308 | Ga0075366_10531274 | 3300006195 | Bacteria | 728 |
| 309 | Ga0097621_100528173 | 3300006237 | Bacteria | 1072 |
| 310 | Ga0097621_100538564 | 3300006237 | Bacteria | 1062 |
| 311 | Ga0075370_10046646 | 3300006353 | Bacteria | 2452 |
| 312 | Ga0075370_10070416 | 3300006353 | Bacteria | 2000 |
| 313 | Ga0075370_10279050 | 3300006353 | Bacteria | 992 |
| 314 | Ga0068871_100005970 | 3300006358 | Bacteria | 8574 |
| 315 | Ga0068871_101463072 | 3300006358 | Bacteria | 645 |
| 316 | Ga0075430_100231300 | 3300006846 | Bacteria | 1533 |
| 317 | Ga0075431_100175944 | 3300006847 | Bacteria | 2198 |
| 318 | Ga0075433_10412856 | 3300006852 | Bacteria | 1191 |
| 319 | Ga0075429_100104297 | 3300006880 | Bacteria | 2476 |
| 320 | Ga0068865_100758238 | 3300006881 | Bacteria | 834 |
| 321 | Ga0097620_100664429 | 3300006931 | Bacteria | 1134 |
| 322 | Ga0097620_101631925 | 3300006931 | Bacteria | 712 |
| 323 | Ga0075435_100566673 | 3300007076 | Bacteria | 984 |
| 324 | Ga0105240_10023135 | 3300009093 | Bacteria | 8227 |
| 325 | Ga0105240_10285810 | 3300009093 | Bacteria | 1893 |
| 326 | Ga0105240_10296300 | 3300009093 | Bacteria | 1852 |
| 327 | Ga0105240_10459837 | 3300009093 | Bacteria | 1422 |
| 328 | Ga0111539_10180978 | 3300009094 | Bacteria | 2462 |
| 329 | Ga0111539_10230792 | 3300009094 | Bacteria | 2155 |
| 330 | Ga0105245_10000285 | 3300009098 | Bacteria | 48237 |
| 331 | Ga0114129_10380719 | 3300009147 | Bacteria | 1864 |
| 332 | Ga0105243_10265561 | 3300009148 | Bacteria | 1539 |
| 333 | Ga0105241_10032710 | 3300009174 | Bacteria | 3901 |
| 334 | Ga0105241_10038432 | 3300009174 | Bacteria | 3608 |
| 335 | Ga0105241_10144750 | 3300009174 | Bacteria | 1938 |
| 336 | Ga0105248_10008019 | 3300009177 | Bacteria | 11597 |
| 337 | Ga0105248_10013976 | 3300009177 | Bacteria | 8832 |
| 338 | Ga0105248_10046063 | 3300009177 | Bacteria | 4888 |
| 339 | Ga0105237_10013046 | 3300009545 | Bacteria | 8725 |
| 340 | Ga0105237_10013830 | 3300009545 | Bacteria | 8449 |
| 341 | Ga0105238_10014359 | 3300009551 | Bacteria | 8006 |
| 342 | Ga0105238_10014766 | 3300009551 | Bacteria | 7898 |
| 343 | Ga0105238_10027736 | 3300009551 | Bacteria | 5772 |
| 344 | Ga0105238_10249556 | 3300009551 | Bacteria | 1753 |
| 345 | Ga0105238_10490104 | 3300009551 | Bacteria | 1229 |
| 346 | Ga0105238_10738631 | 3300009551 | Bacteria | 998 |
| 347 | Ga0105238_12484118 | 3300009551 | Bacteria | 554 |
| 348 | Ga0105249_10000103 | 3300009553 | Bacteria | 118397 |
| 349 | Ga0105249_11441446 | 3300009553 | Bacteria | 761 |
| 350 | Ga0099796_10283404 | 3300010159 | Bacteria | 697 |
| 351 | Ga0105239_10473944 | 3300010375 | Bacteria | 1422 |
| 352 | Ga0105239_10523147 | 3300010375 | Bacteria | 1350 |
| 353 | Ga0105246_10000234 | 3300011119 | Bacteria | 28511 |
| 354 | Ga0157373_10003505 | 3300013100 | Bacteria | 11868 |
| 355 | Ga0157373_10019882 | 3300013100 | Bacteria | 4885 |
| 356 | Ga0157373_10023083 | 3300013100 | Bacteria | 4512 |
| 357 | Ga0157373_10093388 | 3300013100 | Bacteria | 2119 |
| 358 | Ga0157373_10122033 | 3300013100 | Bacteria | 1831 |
| 359 | Ga0157373_10142875 | 3300013100 | Bacteria | 1683 |
| 360 | Ga0157373_10179009 | 3300013100 | Bacteria | 1492 |
| 361 | Ga0157373_10204085 | 3300013100 | Bacteria | 1394 |
| 362 | Ga0157373_10600654 | 3300013100 | Bacteria | 801 |
| 363 | Ga0157371_10001424 | 3300013102 | Bacteria | 24845 |
| 364 | Ga0157371_10009211 | 3300013102 | Bacteria | 7792 |
| 365 | Ga0157371_10024590 | 3300013102 | Bacteria | 4396 |
| 366 | Ga0157371_10028143 | 3300013102 | Bacteria | 4072 |
| 367 | Ga0157371_10031247 | 3300013102 | Bacteria | 3836 |
| 368 | Ga0157371_10187667 | 3300013102 | Bacteria | 1480 |
| 369 | Ga0157371_10224176 | 3300013102 | Bacteria | 1350 |
| 370 | Ga0157371_10230240 | 3300013102 | Bacteria | 1332 |
| 371 | Ga0157371_10365775 | 3300013102 | Bacteria | 1052 |
| 372 | Ga0157371_10378073 | 3300013102 | Bacteria | 1034 |
| 373 | Ga0157371_10410021 | 3300013102 | Bacteria | 992 |
| 374 | Ga0157371_10850596 | 3300013102 | Bacteria | 690 |
| 375 | Ga0157371_10951705 | 3300013102 | Bacteria | 653 |
| 376 | Ga0157370_10002640 | 3300013104 | Bacteria | 21532 |
| 377 | Ga0157370_10016740 | 3300013104 | Bacteria | 7418 |
| 378 | Ga0157370_10017787 | 3300013104 | Bacteria | 7164 |
| 379 | Ga0157370_10054118 | 3300013104 | Bacteria | 3826 |
| 380 | Ga0157370_10154929 | 3300013104 | Bacteria | 2132 |
| 381 | Ga0157370_10162569 | 3300013104 | Bacteria | 2077 |
| 382 | Ga0157370_10197659 | 3300013104 | Bacteria | 1866 |
| 383 | Ga0157370_10260872 | 3300013104 | Bacteria | 1601 |
| 384 | Ga0157370_10512166 | 3300013104 | Unclassified | 1102 |
| 385 | Ga0157370_11065351 | 3300013104 | Bacteria | 731 |
| 386 | Ga0157369_10005291 | 3300013105 | Bacteria | 15039 |
| 387 | Ga0157369_10009565 | 3300013105 | Bacteria | 11088 |
| 388 | Ga0157369_10011956 | 3300013105 | Bacteria | 9859 |
| 389 | Ga0157369_10016077 | 3300013105 | Bacteria | 8419 |
| 390 | Ga0157369_10036687 | 3300013105 | Bacteria | 5370 |
| 391 | Ga0157369_10079144 | 3300013105 | Bacteria | 3521 |
| 392 | Ga0157369_10148511 | 3300013105 | Bacteria | 2478 |
| 393 | Ga0157369_10196462 | 3300013105 | Bacteria | 2118 |
| 394 | Ga0157369_10297249 | 3300013105 | Bacteria | 1680 |
| 395 | Ga0157369_10350719 | 3300013105 | Bacteria | 1533 |
| 396 | Ga0157369_10580459 | 3300013105 | Bacteria | 1158 |
| 397 | Ga0157369_11582134 | 3300013105 | Bacteria | 666 |
| 398 | Ga0157369_12418399 | 3300013105 | Bacteria | 532 |
| 399 | Ga0157374_10041303 | 3300013296 | Bacteria | 4250 |
| 400 | Ga0157374_10524342 | 3300013296 | Bacteria | 1191 |
| 401 | Ga0157378_10497478 | 3300013297 | Bacteria | 1217 |
| 402 | Ga0157378_10890919 | 3300013297 | Bacteria | 920 |
| 403 | Ga0163162_10010085 | 3300013306 | Bacteria | 9185 |
| 404 | Ga0163162_10424950 | 3300013306 | Bacteria | 1461 |
| 405 | Ga0163162_11678379 | 3300013306 | Bacteria | 725 |
| 406 | Ga0163162_13353548 | 3300013306 | Bacteria | 512 |
| 407 | Ga0157372_10005358 | 3300013307 | Bacteria | 13625 |
| 408 | Ga0157372_10026427 | 3300013307 | Bacteria | 6317 |
| 409 | Ga0157372_10091413 | 3300013307 | Bacteria | 3461 |
| 410 | Ga0157372_10199311 | 3300013307 | Bacteria | 2319 |
| 411 | Ga0157372_10306604 | 3300013307 | Bacteria | 1847 |
| 412 | Ga0157372_10316168 | 3300013307 | Bacteria | 1818 |
| 413 | Ga0157375_10016550 | 3300013308 | Bacteria | 6629 |
| 414 | Ga0157375_10331699 | 3300013308 | Bacteria | 1686 |
| 415 | Ga0157375_11392803 | 3300013308 | Bacteria | 826 |
| 416 | Ga0163163_10003524 | 3300014325 | Bacteria | 13288 |
| 417 | Ga0163163_12094545 | 3300014325 | Bacteria | 625 |
| 418 | Ga0157380_10013575 | 3300014326 | Bacteria | 5946 |
| 419 | Ga0157380_11061162 | 3300014326 | Bacteria | 847 |
| 420 | Ga0182008_10040430 | 3300014497 | Bacteria | 2329 |
| 421 | Ga0182008_10102452 | 3300014497 | Bacteria | 1416 |
| 422 | Ga0157377_10027784 | 3300014745 | Bacteria | 3040 |
| 423 | Ga0157377_10150530 | 3300014745 | Bacteria | 1438 |
| 424 | Ga0157379_10122684 | 3300014968 | Bacteria | 2338 |
| 425 | Ga0157376_11916234 | 3300014969 | Bacteria | 630 |
| 426 | Ga0182006_1056708 | 3300015261 | Bacteria | 1491 |
| 427 | Ga0163161_10405737 | 3300017792 | Bacteria | 1094 |
| 428 | Ga0213873_10000009 | 3300021358 | Bacteria | 237102 |
| 429 | Ga0213874_10027658 | 3300021377 | Bacteria | 1615 |
| 430 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 431 | Ga0213876_10208719 | 3300021384 | Bacteria | 1038 |
| 432 | Ga0213875_10008191 | 3300021388 | Bacteria | 5364 |
| 433 | Ga0209675_1000162 | 3300025291 | Bacteria | 83810 |
| 434 | Ga0209676_1000113 | 3300025292 | Bacteria | 207931 |
| 435 | Ga0209676_1000146 | 3300025292 | Bacteria | 174095 |
| 436 | Ga0209676_1002307 | 3300025292 | Bacteria | 13898 |
| 437 | Ga0209025_1035622 | 3300025294 | Bacteria | 2245 |
| 438 | Ga0209758_1063445 | 3300025297 | Bacteria | 1203 |
| 439 | Ga0209050_1000126 | 3300025298 | Bacteria | 188438 |
| 440 | Ga0209050_1013537 | 3300025298 | Bacteria | 3612 |
| 441 | Ga0209257_1000256 | 3300025304 | Bacteria | 123057 |
| 442 | Ga0209257_1002727 | 3300025304 | Bacteria | 16784 |
| 443 | Ga0207697_10003593 | 3300025315 | Bacteria | 7608 |
| 444 | Ga0207697_10054258 | 3300025315 | Bacteria | 1661 |
| 445 | Ga0207697_10056296 | 3300025315 | Unclassified | 1631 |
| 446 | Ga0207656_10003790 | 3300025321 | Bacteria | 5235 |
| 447 | Ga0207656_10017463 | 3300025321 | Bacteria | 2812 |
| 448 | Ga0207656_10020842 | 3300025321 | Bacteria | 2610 |
| 449 | Ga0207642_10058332 | 3300025899 | Bacteria | 1780 |
| 450 | Ga0207688_10093367 | 3300025901 | Bacteria | 1730 |
| 451 | Ga0207688_10310041 | 3300025901 | Bacteria | 966 |
| 452 | Ga0207680_10007697 | 3300025903 | Bacteria | 5264 |
| 453 | Ga0207680_10156783 | 3300025903 | Bacteria | 1523 |
| 454 | Ga0207680_10736518 | 3300025903 | Bacteria | 707 |
| 455 | Ga0207647_10000069 | 3300025904 | Bacteria | 80952 |
| 456 | Ga0207647_10006349 | 3300025904 | Bacteria | 8594 |
| 457 | Ga0207647_10012008 | 3300025904 | Bacteria | 6045 |
| 458 | Ga0207647_10028658 | 3300025904 | Bacteria | 3614 |
| 459 | Ga0207647_10036318 | 3300025904 | Bacteria | 3131 |
| 460 | Ga0207647_10132656 | 3300025904 | Bacteria | 1463 |
| 461 | Ga0207645_10113335 | 3300025907 | Bacteria | 1757 |
| 462 | Ga0207645_10282613 | 3300025907 | Bacteria | 1102 |
| 463 | Ga0207705_10000991 | 3300025909 | Bacteria | 23160 |
| 464 | Ga0207705_10002967 | 3300025909 | Bacteria | 12964 |
| 465 | Ga0207705_10007878 | 3300025909 | Bacteria | 7822 |
| 466 | Ga0207705_10008821 | 3300025909 | Bacteria | 7352 |
| 467 | Ga0207705_10009747 | 3300025909 | Bacteria | 6988 |
| 468 | Ga0207705_10010868 | 3300025909 | Bacteria | 6610 |
| 469 | Ga0207705_10034493 | 3300025909 | Bacteria | 3618 |
| 470 | Ga0207705_10051015 | 3300025909 | Bacteria | 2979 |
| 471 | Ga0207705_10090075 | 3300025909 | Bacteria | 2245 |
| 472 | Ga0207705_10101632 | 3300025909 | Bacteria | 2115 |
| 473 | Ga0207705_10131531 | 3300025909 | Bacteria | 1863 |
| 474 | Ga0207705_10185131 | 3300025909 | Bacteria | 1573 |
| 475 | Ga0207705_10208598 | 3300025909 | Bacteria | 1482 |
| 476 | Ga0207705_10529268 | 3300025909 | Bacteria | 916 |
| 477 | Ga0207705_10535133 | 3300025909 | Bacteria | 911 |
| 478 | Ga0207684_10854359 | 3300025910 | Bacteria | 767 |
| 479 | Ga0207654_10013252 | 3300025911 | Bacteria | 4238 |
| 480 | Ga0207654_10020008 | 3300025911 | Bacteria | 3541 |
| 481 | Ga0207707_10013904 | 3300025912 | Bacteria | 7017 |
| 482 | Ga0207707_10015225 | 3300025912 | Bacteria | 6697 |
| 483 | Ga0207707_10068256 | 3300025912 | Bacteria | 3098 |
| 484 | Ga0207707_10510449 | 3300025912 | Bacteria | 1024 |
| 485 | Ga0207707_10587938 | 3300025912 | Bacteria | 943 |
| 486 | Ga0207707_10670306 | 3300025912 | Bacteria | 873 |
| 487 | Ga0207695_10012923 | 3300025913 | Bacteria | 9992 |
| 488 | Ga0207695_10019220 | 3300025913 | Bacteria | 7868 |
| 489 | Ga0207695_10032866 | 3300025913 | Bacteria | 5671 |
| 490 | Ga0207695_10124440 | 3300025913 | Bacteria | 2542 |
| 491 | Ga0207695_10272782 | 3300025913 | Bacteria | 1587 |
| 492 | Ga0207695_11444970 | 3300025913 | Bacteria | 568 |
| 493 | Ga0207671_10002421 | 3300025914 | Bacteria | 19972 |
| 494 | Ga0207671_10027417 | 3300025914 | Bacteria | 4259 |
| 495 | Ga0207671_10028986 | 3300025914 | Bacteria | 4135 |
| 496 | Ga0207693_10069429 | 3300025915 | Bacteria | 2757 |
| 497 | Ga0207660_10039020 | 3300025917 | Bacteria | 3318 |
| 498 | Ga0207660_10047117 | 3300025917 | Bacteria | 3045 |
| 499 | Ga0207660_10287468 | 3300025917 | Bacteria | 1307 |
| 500 | Ga0207660_10291049 | 3300025917 | Bacteria | 1299 |
| 501 | Ga0207660_10608929 | 3300025917 | Bacteria | 890 |
| 502 | Ga0207660_10881821 | 3300025917 | Bacteria | 730 |
| 503 | Ga0207662_10280200 | 3300025918 | Bacteria | 1103 |
| 504 | Ga0207657_10000123 | 3300025919 | Bacteria | 77348 |
| 505 | Ga0207657_10000504 | 3300025919 | Bacteria | 41239 |
| 506 | Ga0207657_10000946 | 3300025919 | Bacteria | 30768 |
| 507 | Ga0207657_10001024 | 3300025919 | Bacteria | 29655 |
| 508 | Ga0207657_10006094 | 3300025919 | Bacteria | 12538 |
| 509 | Ga0207657_10006293 | 3300025919 | Bacteria | 12337 |
| 510 | Ga0207657_10018058 | 3300025919 | Bacteria | 6748 |
| 511 | Ga0207657_10023777 | 3300025919 | Bacteria | 5697 |
| 512 | Ga0207657_10036194 | 3300025919 | Bacteria | 4420 |
| 513 | Ga0207657_10043813 | 3300025919 | Bacteria | 3939 |
| 514 | Ga0207657_10055514 | 3300025919 | Bacteria | 3421 |
| 515 | Ga0207657_10083179 | 3300025919 | Bacteria | 2685 |
| 516 | Ga0207657_10195700 | 3300025919 | Bacteria | 1628 |
| 517 | Ga0207657_10401043 | 3300025919 | Bacteria | 1079 |
| 518 | Ga0207657_10464525 | 3300025919 | Bacteria | 993 |
| 519 | Ga0207657_10631780 | 3300025919 | Bacteria | 834 |
| 520 | Ga0207649_10000018 | 3300025920 | Bacteria | 225137 |
| 521 | Ga0207649_10009705 | 3300025920 | Bacteria | 5272 |
| 522 | Ga0207649_10019643 | 3300025920 | Bacteria | 3865 |
| 523 | Ga0207649_10020903 | 3300025920 | Bacteria | 3759 |
| 524 | Ga0207649_10030726 | 3300025920 | Unclassified | 3185 |
| 525 | Ga0207649_10053426 | 3300025920 | Bacteria | 2510 |
| 526 | Ga0207649_10137790 | 3300025920 | Bacteria | 1666 |
| 527 | Ga0207649_10425958 | 3300025920 | Unclassified | 997 |
| 528 | Ga0207649_10431728 | 3300025920 | Bacteria | 991 |
| 529 | Ga0207649_10667629 | 3300025920 | Bacteria | 804 |
| 530 | Ga0207649_10854057 | 3300025920 | Unclassified | 712 |
| 531 | Ga0207652_10001433 | 3300025921 | Bacteria | 21127 |
| 532 | Ga0207652_10024932 | 3300025921 | Bacteria | 4966 |
| 533 | Ga0207652_10060515 | 3300025921 | Bacteria | 3267 |
| 534 | Ga0207652_10291484 | 3300025921 | Bacteria | 1472 |
| 535 | Ga0207652_10415114 | 3300025921 | Bacteria | 1214 |
| 536 | Ga0207652_11129588 | 3300025921 | Bacteria | 684 |
| 537 | Ga0207694_10002217 | 3300025924 | Bacteria | 15949 |
| 538 | Ga0207694_10003033 | 3300025924 | Bacteria | 13465 |
| 539 | Ga0207694_10008340 | 3300025924 | Bacteria | 7834 |
| 540 | Ga0207694_10030175 | 3300025924 | Bacteria | 4140 |
| 541 | Ga0207694_10034936 | 3300025924 | Bacteria | 3855 |
| 542 | Ga0207694_10066799 | 3300025924 | Bacteria | 2806 |
| 543 | Ga0207694_10289940 | 3300025924 | Bacteria | 1346 |
| 544 | Ga0207650_10011935 | 3300025925 | Bacteria | 5988 |
| 545 | Ga0207650_10036094 | 3300025925 | Bacteria | 3595 |
| 546 | Ga0207650_10154698 | 3300025925 | Bacteria | 1812 |
| 547 | Ga0207650_10220742 | 3300025925 | Bacteria | 1525 |
| 548 | Ga0207650_10371331 | 3300025925 | Bacteria | 1180 |
| 549 | Ga0207650_10599895 | 3300025925 | Bacteria | 926 |
| 550 | Ga0207659_10033609 | 3300025926 | Bacteria | 3532 |
| 551 | Ga0207659_10192355 | 3300025926 | Bacteria | 1624 |
| 552 | Ga0207700_10021189 | 3300025928 | Bacteria | 4432 |
| 553 | Ga0207664_10015933 | 3300025929 | Bacteria | 5474 |
| 554 | Ga0207664_10162370 | 3300025929 | Bacteria | 1906 |
| 555 | Ga0207664_10372533 | 3300025929 | Bacteria | 1267 |
| 556 | Ga0207664_10449906 | 3300025929 | Bacteria | 1149 |
| 557 | Ga0207644_10007787 | 3300025931 | Bacteria | 6995 |
| 558 | Ga0207644_10009323 | 3300025931 | Bacteria | 6444 |
| 559 | Ga0207644_10480352 | 3300025931 | Bacteria | 1023 |
| 560 | Ga0207690_10005486 | 3300025932 | Bacteria | 7481 |
| 561 | Ga0207690_10035197 | 3300025932 | Bacteria | 3233 |
| 562 | Ga0207690_10097074 | 3300025932 | Bacteria | 2096 |
| 563 | Ga0207690_10102515 | 3300025932 | Bacteria | 2046 |
| 564 | Ga0207690_10227811 | 3300025932 | Bacteria | 1429 |
| 565 | Ga0207690_10308614 | 3300025932 | Bacteria | 1240 |
| 566 | Ga0207690_10418816 | 3300025932 | Bacteria | 1071 |
| 567 | Ga0207690_10615479 | 3300025932 | Bacteria | 887 |
| 568 | Ga0207690_10826067 | 3300025932 | Bacteria | 766 |
| 569 | Ga0207690_10977762 | 3300025932 | Bacteria | 704 |
| 570 | Ga0207706_10000193 | 3300025933 | Bacteria | 68202 |
| 571 | Ga0207706_10002629 | 3300025933 | Bacteria | 17488 |
| 572 | Ga0207706_10003424 | 3300025933 | Bacteria | 15149 |
| 573 | Ga0207706_10010762 | 3300025933 | Bacteria | 8351 |
| 574 | Ga0207706_10025962 | 3300025933 | Bacteria | 5245 |
| 575 | Ga0207706_10065052 | 3300025933 | Bacteria | 3211 |
| 576 | Ga0207706_10089071 | 3300025933 | Bacteria | 2713 |
| 577 | Ga0207706_10289439 | 3300025933 | Bacteria | 1428 |
| 578 | Ga0207706_10324357 | 3300025933 | Bacteria | 1340 |
| 579 | Ga0207706_10487335 | 3300025933 | Bacteria | 1065 |
| 580 | Ga0207706_10500534 | 3300025933 | Bacteria | 1049 |
| 581 | Ga0207706_11235848 | 3300025933 | Bacteria | 619 |
| 582 | Ga0207670_10298458 | 3300025936 | Bacteria | 1261 |
| 583 | Ga0207670_10718708 | 3300025936 | Bacteria | 828 |
| 584 | Ga0207669_10246065 | 3300025937 | Bacteria | 1328 |
| 585 | Ga0207704_10294652 | 3300025938 | Bacteria | 1240 |
| 586 | Ga0207691_10001147 | 3300025940 | Bacteria | 26294 |
| 587 | Ga0207691_10280348 | 3300025940 | Bacteria | 1434 |
| 588 | Ga0207711_10017482 | 3300025941 | Bacteria | 5958 |
| 589 | Ga0207711_10028757 | 3300025941 | Bacteria | 4681 |
| 590 | Ga0207711_10959149 | 3300025941 | Bacteria | 794 |
| 591 | Ga0207689_10447860 | 3300025942 | Bacteria | 1079 |
| 592 | Ga0207661_10090118 | 3300025944 | Bacteria | 2553 |
| 593 | Ga0207661_10198982 | 3300025944 | Bacteria | 1760 |
| 594 | Ga0207661_10353973 | 3300025944 | Bacteria | 1325 |
| 595 | Ga0207661_12121440 | 3300025944 | Bacteria | 508 |
| 596 | Ga0207679_10009073 | 3300025945 | Bacteria | 6354 |
| 597 | Ga0207679_10081875 | 3300025945 | Bacteria | 2469 |
| 598 | Ga0207679_10083379 | 3300025945 | Bacteria | 2450 |
| 599 | Ga0207679_10089444 | 3300025945 | Bacteria | 2377 |
| 600 | Ga0207679_10175885 | 3300025945 | Unclassified | 1767 |
| 601 | Ga0207679_10324444 | 3300025945 | Bacteria | 1334 |
| 602 | Ga0207679_10735883 | 3300025945 | Bacteria | 896 |
| 603 | Ga0207667_10002490 | 3300025949 | Bacteria | 22955 |
| 604 | Ga0207667_10011976 | 3300025949 | Bacteria | 10040 |
| 605 | Ga0207667_10012325 | 3300025949 | Bacteria | 9861 |
| 606 | Ga0207667_10017613 | 3300025949 | Bacteria | 8035 |
| 607 | Ga0207667_10019585 | 3300025949 | Bacteria | 7548 |
| 608 | Ga0207667_10021844 | 3300025949 | Bacteria | 7083 |
| 609 | Ga0207667_10038532 | 3300025949 | Bacteria | 5103 |
| 610 | Ga0207667_10128228 | 3300025949 | Bacteria | 2613 |
| 611 | Ga0207667_10247312 | 3300025949 | Bacteria | 1825 |
| 612 | Ga0207667_10248859 | 3300025949 | Bacteria | 1818 |
| 613 | Ga0207667_10395800 | 3300025949 | Bacteria | 1407 |
| 614 | Ga0207667_10600544 | 3300025949 | Bacteria | 1110 |
| 615 | Ga0207667_11530638 | 3300025949 | Bacteria | 637 |
| 616 | Ga0207651_10014761 | 3300025960 | Bacteria | 4520 |
| 617 | Ga0207651_10042885 | 3300025960 | Bacteria | 3015 |
| 618 | Ga0207651_10191294 | 3300025960 | Bacteria | 1632 |
| 619 | Ga0207712_10000069 | 3300025961 | Bacteria | 127318 |
| 620 | Ga0207712_11022224 | 3300025961 | Bacteria | 734 |
| 621 | Ga0207668_10291889 | 3300025972 | Bacteria | 1342 |
| 622 | Ga0207668_11569134 | 3300025972 | Bacteria | 594 |
| 623 | Ga0207640_10045698 | 3300025981 | Bacteria | 2813 |
| 624 | Ga0207640_10088868 | 3300025981 | Bacteria | 2134 |
| 625 | Ga0207640_10091310 | 3300025981 | Bacteria | 2109 |
| 626 | Ga0207640_10162576 | 3300025981 | Bacteria | 1654 |
| 627 | Ga0207640_10309509 | 3300025981 | Bacteria | 1253 |
| 628 | Ga0207640_10537361 | 3300025981 | Bacteria | 980 |
| 629 | Ga0207658_10015187 | 3300025986 | Bacteria | 5282 |
| 630 | Ga0207658_10281570 | 3300025986 | Bacteria | 1425 |
| 631 | Ga0207658_10535266 | 3300025986 | Bacteria | 1047 |
| 632 | Ga0207658_11011418 | 3300025986 | Bacteria | 758 |
| 633 | Ga0207677_10179727 | 3300026023 | Bacteria | 1663 |
| 634 | Ga0207677_10447021 | 3300026023 | Bacteria | 1107 |
| 635 | Ga0207677_10450546 | 3300026023 | Bacteria | 1103 |
| 636 | Ga0207703_10320563 | 3300026035 | Bacteria | 1419 |
| 637 | Ga0207639_10000199 | 3300026041 | Bacteria | 45241 |
| 638 | Ga0207639_10000798 | 3300026041 | Bacteria | 21425 |
| 639 | Ga0207639_10003539 | 3300026041 | Bacteria | 10493 |
| 640 | Ga0207639_10023368 | 3300026041 | Bacteria | 4464 |
| 641 | Ga0207639_10042910 | 3300026041 | Bacteria | 3392 |
| 642 | Ga0207639_10062330 | 3300026041 | Bacteria | 2883 |
| 643 | Ga0207639_10257821 | 3300026041 | Bacteria | 1524 |
| 644 | Ga0207678_10009190 | 3300026067 | Bacteria | 8701 |
| 645 | Ga0207678_10014095 | 3300026067 | Bacteria | 7029 |
| 646 | Ga0207678_10017196 | 3300026067 | Bacteria | 6348 |
| 647 | Ga0207678_10024372 | 3300026067 | Bacteria | 5285 |
| 648 | Ga0207678_10024379 | 3300026067 | Bacteria | 5283 |
| 649 | Ga0207678_10025444 | 3300026067 | Bacteria | 5165 |
| 650 | Ga0207678_10074648 | 3300026067 | Bacteria | 2905 |
| 651 | Ga0207678_10433401 | 3300026067 | Bacteria | 1141 |
| 652 | Ga0207678_10507140 | 3300026067 | Bacteria | 1052 |
| 653 | Ga0207678_11021494 | 3300026067 | Bacteria | 732 |
| 654 | Ga0207678_11239915 | 3300026067 | Bacteria | 660 |
| 655 | Ga0207702_10007759 | 3300026078 | Bacteria | 9110 |
| 656 | Ga0207702_10022935 | 3300026078 | Bacteria | 5178 |
| 657 | Ga0207702_10024793 | 3300026078 | Bacteria | 4976 |
| 658 | Ga0207702_10024945 | 3300026078 | Bacteria | 4961 |
| 659 | Ga0207702_10025873 | 3300026078 | Bacteria | 4871 |
| 660 | Ga0207702_10033994 | 3300026078 | Bacteria | 4261 |
| 661 | Ga0207702_10058354 | 3300026078 | Bacteria | 3284 |
| 662 | Ga0207702_10072618 | 3300026078 | Bacteria | 2966 |
| 663 | Ga0207702_10522661 | 3300026078 | Bacteria | 1159 |
| 664 | Ga0207702_10898435 | 3300026078 | Bacteria | 878 |
| 665 | Ga0207702_11359256 | 3300026078 | Bacteria | 704 |
| 666 | Ga0207641_10025359 | 3300026088 | Bacteria | 4888 |
| 667 | Ga0207641_10115462 | 3300026088 | Bacteria | 2387 |
| 668 | Ga0207648_10259389 | 3300026089 | Bacteria | 1551 |
| 669 | Ga0207648_11491449 | 3300026089 | Bacteria | 636 |
| 670 | Ga0207676_10003563 | 3300026095 | Bacteria | 10999 |
| 671 | Ga0207676_10619733 | 3300026095 | Bacteria | 1041 |
| 672 | Ga0207674_10000580 | 3300026116 | Bacteria | 48154 |
| 673 | Ga0207674_10005390 | 3300026116 | Bacteria | 15219 |
| 674 | Ga0207674_10011216 | 3300026116 | Bacteria | 10072 |
| 675 | Ga0207674_10018837 | 3300026116 | Bacteria | 7488 |
| 676 | Ga0207674_10038782 | 3300026116 | Bacteria | 4941 |
| 677 | Ga0207674_10062694 | 3300026116 | Bacteria | 3754 |
| 678 | Ga0207674_10123899 | 3300026116 | Bacteria | 2550 |
| 679 | Ga0207674_10194816 | 3300026116 | Bacteria | 1976 |
| 680 | Ga0207675_100358828 | 3300026118 | Bacteria | 1430 |
| 681 | Ga0207683_10005822 | 3300026121 | Bacteria | 10566 |
| 682 | Ga0207683_10007206 | 3300026121 | Bacteria | 9534 |
| 683 | Ga0207683_10196562 | 3300026121 | Bacteria | 1832 |
| 684 | Ga0207698_10000388 | 3300026142 | Bacteria | 25382 |
| 685 | Ga0207698_10000449 | 3300026142 | Bacteria | 23772 |
| 686 | Ga0207698_10000703 | 3300026142 | Bacteria | 19442 |
| 687 | Ga0207698_10029780 | 3300026142 | Bacteria | 3915 |
| 688 | Ga0207698_10091007 | 3300026142 | Bacteria | 2496 |
| 689 | Ga0207698_10097135 | 3300026142 | Bacteria | 2430 |
| 690 | Ga0207698_10119516 | 3300026142 | Bacteria | 2227 |
| 691 | Ga0207698_10328013 | 3300026142 | Bacteria | 1436 |
| 692 | Ga0207698_10456781 | 3300026142 | Bacteria | 1234 |
| 693 | Ga0210002_1014486 | 3300027617 | Bacteria | 1237 |
| 694 | Ga0209813_10048030 | 3300027866 | Bacteria | 1324 |
| 695 | Ga0207428_10228442 | 3300027907 | Bacteria | 1393 |
| 696 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 697 | Ga0268266_10016834 | 3300028379 | Bacteria | 6248 |
| 698 | Ga0268266_10138249 | 3300028379 | Bacteria | 2184 |
| 699 | Ga0268266_10283725 | 3300028379 | Bacteria | 1540 |
| 700 | Ga0268265_10102231 | 3300028380 | Bacteria | 2318 |
| 701 | Ga0268264_10004758 | 3300028381 | Bacteria | 11524 |
| 702 | Ga0268264_10071632 | 3300028381 | Bacteria | 2937 |
| 703 | Ga0268264_10091232 | 3300028381 | Bacteria | 2628 |
| 704 | Ga0268264_10362729 | 3300028381 | Bacteria | 1383 |
| 705 | Ga0265334_10041533 | 3300028573 | Bacteria | 1798 |
| 706 | Ga0265338_10439203 | 3300028800 | Bacteria | 925 |
| 707 | Ga0265328_10053498 | 3300031239 | Bacteria | 1481 |
| 708 | Ga0265325_10083207 | 3300031241 | Bacteria | 1587 |
| 709 | Ga0265325_10222547 | 3300031241 | Bacteria | 863 |
| 710 | Ga0265340_10131183 | 3300031247 | Bacteria | 1149 |
| 711 | Ga0265339_10036292 | 3300031249 | Bacteria | 2760 |
| 712 | Ga0265327_10054725 | 3300031251 | Bacteria | 2064 |
| 713 | Ga0307408_100011699 | 3300031548 | Bacteria | 5802 |
| 714 | Ga0307408_100012386 | 3300031548 | Bacteria | 5647 |
| 715 | Ga0307408_100073431 | 3300031548 | Bacteria | 2535 |
| 716 | Ga0307408_100130409 | 3300031548 | Bacteria | 1960 |
| 717 | Ga0307408_101909264 | 3300031548 | Bacteria | 569 |
| 718 | Ga0316579_10031452 | 3300031691 | Bacteria | 2430 |
| 719 | Ga0316576_10453383 | 3300031727 | Bacteria | 947 |
| 720 | Ga0307405_10000445 | 3300031731 | Bacteria | 15493 |
| 721 | Ga0307405_10025543 | 3300031731 | Bacteria | 3393 |
| 722 | Ga0307405_10117036 | 3300031731 | Bacteria | 1816 |
| 723 | Ga0307405_10146823 | 3300031731 | Bacteria | 1653 |
| 724 | Ga0307405_10337372 | 3300031731 | Bacteria | 1157 |
| 725 | Ga0307405_11079815 | 3300031731 | Bacteria | 689 |
| 726 | Ga0316577_10566263 | 3300031733 | Bacteria | 646 |
| 727 | Ga0307413_10034421 | 3300031824 | Bacteria | 2895 |
| 728 | Ga0307413_10074432 | 3300031824 | Bacteria | 2151 |
| 729 | Ga0307413_10190906 | 3300031824 | Bacteria | 1471 |
| 730 | Ga0307413_10715152 | 3300031824 | Bacteria | 833 |
| 731 | Ga0307413_10845977 | 3300031824 | Bacteria | 773 |
| 732 | Ga0307410_10005366 | 3300031852 | Bacteria | 6777 |
| 733 | Ga0307410_10313018 | 3300031852 | Bacteria | 1243 |
| 734 | Ga0307406_10012211 | 3300031901 | Bacteria | 4893 |
| 735 | Ga0307406_10573673 | 3300031901 | Bacteria | 926 |
| 736 | Ga0307406_11706707 | 3300031901 | Bacteria | 558 |
| 737 | Ga0307407_10038169 | 3300031903 | Bacteria | 2659 |
| 738 | Ga0307412_10001453 | 3300031911 | Bacteria | 13173 |
| 739 | Ga0307412_10027719 | 3300031911 | Bacteria | 3536 |
| 740 | Ga0307412_10070875 | 3300031911 | Bacteria | 2377 |
| 741 | Ga0307409_100027415 | 3300031995 | Bacteria | 4037 |
| 742 | Ga0307409_100058278 | 3300031995 | Bacteria | 2999 |
| 743 | Ga0307409_100075243 | 3300031995 | Bacteria | 2702 |
| 744 | Ga0307409_100158881 | 3300031995 | Bacteria | 1974 |
| 745 | Ga0307409_100343378 | 3300031995 | Bacteria | 1406 |
| 746 | Ga0307416_100081790 | 3300032002 | Bacteria | 2732 |
| 747 | Ga0307416_100165055 | 3300032002 | Bacteria | 2053 |
| 748 | Ga0307414_10000607 | 3300032004 | Bacteria | 18398 |
| 749 | Ga0307414_10108606 | 3300032004 | Bacteria | 2105 |
| 750 | Ga0307414_10109773 | 3300032004 | Bacteria | 2096 |
| 751 | Ga0307414_10138487 | 3300032004 | Bacteria | 1901 |
| 752 | Ga0307414_10167786 | 3300032004 | Bacteria | 1751 |
| 753 | Ga0307414_10212200 | 3300032004 | Bacteria | 1583 |
| 754 | Ga0307414_10231500 | 3300032004 | Bacteria | 1524 |
| 755 | Ga0307414_10242360 | 3300032004 | Bacteria | 1493 |
| 756 | Ga0307414_11108488 | 3300032004 | Bacteria | 731 |
| 757 | Ga0307414_11569106 | 3300032004 | Bacteria | 613 |
| 758 | Ga0307414_11619868 | 3300032004 | Bacteria | 603 |
| 759 | Ga0307411_10130928 | 3300032005 | Bacteria | 1833 |
| 760 | Ga0307411_10336648 | 3300032005 | Bacteria | 1225 |
| 761 | Ga0307411_10401674 | 3300032005 | Bacteria | 1133 |
| 762 | Ga0307411_10520594 | 3300032005 | Bacteria | 1009 |
| 763 | Ga0307411_10826972 | 3300032005 | Bacteria | 817 |
| 764 | Ga0307415_100027644 | 3300032126 | Bacteria | 3596 |
| 765 | Ga0307415_100144897 | 3300032126 | Bacteria | 1819 |
| 766 | Ga0307415_100507266 | 3300032126 | Bacteria | 1056 |
| 767 | Ga0307415_100742262 | 3300032126 | Bacteria | 890 |
| 768 | Ga0307415_100766050 | 3300032126 | Bacteria | 878 |
| 769 | Ga0373936_0187459 | 3300035113 | Bacteria | 909 |
| 770 | Ga0373943_0013861 | 3300035170 | Bacteria | 3645 |
| 771 | Ga0373943_0392543 | 3300035170 | Bacteria | 800 |
| 772 | Ga0373931_0443009 | 3300035691 | Bacteria | 829 |
| 773 | Ga0373927_0255173 | 3300035695 | Bacteria | 1153 |
| 774 | Ga0373927_0444093 | 3300035695 | Bacteria | 856 |
| 775 | Ga0373937_0598278 | 3300036401 | Bacteria | 1047 |
| 776 | Ga0373937_1027458 | 3300036401 | Bacteria | 773 |
| 777 | Ga0316582_0002330 | 3300036647 | Bacteria | 8885 |
| 778 | Ga0373925_0014982 | 3300037068 | Bacteria | 5605 |
| 779 | Ga0373925_0016074 | 3300037068 | Bacteria | 5419 |
| 780 | Ga0373925_1022935 | 3300037068 | Bacteria | 680 |
| 781 | Ga0395899_0000287 | 3300037312 | Bacteria | 64885 |
| 782 | Ga0395899_0020496 | 3300037312 | Bacteria | 5011 |
| 783 | Ga0395899_0026549 | 3300037312 | Bacteria | 4369 |
| 784 | Ga0395899_0054171 | 3300037312 | Bacteria | 2969 |
| 785 | Ga0395899_0086819 | 3300037312 | Bacteria | 2272 |
| 786 | Ga0395899_0157483 | 3300037312 | Bacteria | 1606 |
| 787 | Ga0395899_0204359 | 3300037312 | Bacteria | 1375 |
| 788 | Ga0395899_0250124 | 3300037312 | Bacteria | 1216 |
| 789 | Ga0395899_0314434 | 3300037312 | Bacteria | 1056 |
| 790 | Ga0395899_0324449 | 3300037312 | Bacteria | 1036 |
| 791 | Ga0395900_0000031 | 3300037418 | Bacteria | 262393 |
| 792 | Ga0395900_0020351 | 3300037418 | Bacteria | 6773 |
| 793 | Ga0395900_0021453 | 3300037418 | Bacteria | 6603 |
| 794 | Ga0395900_0031110 | 3300037418 | Bacteria | 5483 |
| 795 | Ga0395900_0046969 | 3300037418 | Bacteria | 4446 |
| 796 | Ga0395900_0068337 | 3300037418 | Bacteria | 3651 |
| 797 | Ga0395900_0074177 | 3300037418 | Bacteria | 3498 |
| 798 | Ga0395900_0091530 | 3300037418 | Bacteria | 3125 |
| 799 | Ga0395900_0098104 | 3300037418 | Bacteria | 3010 |
| 800 | Ga0395900_0162102 | 3300037418 | Bacteria | 2280 |
| 801 | Ga0395900_0197842 | 3300037418 | Bacteria | 2035 |
| 802 | Ga0395900_0412769 | 3300037418 | Bacteria | 1312 |
| 803 | Ga0395900_0734539 | 3300037418 | Bacteria | 918 |
| 804 | Ga0395900_0977814 | 3300037418 | Bacteria | 767 |
| 805 | Ga0395900_0999385 | 3300037418 | Bacteria | 756 |
| 806 | Ga0395898_0003799 | 3300037466 | Bacteria | 16718 |
| 807 | Ga0395898_0012131 | 3300037466 | Bacteria | 8917 |
| 808 | Ga0395898_0023568 | 3300037466 | Bacteria | 6218 |
| 809 | Ga0395898_0032370 | 3300037466 | Bacteria | 5219 |
| 810 | Ga0395898_0068940 | 3300037466 | Bacteria | 3422 |
| 811 | Ga0395898_0184156 | 3300037466 | Bacteria | 1995 |
| 812 | Ga0395898_0304766 | 3300037466 | Bacteria | 1519 |
| 813 | Ga0395898_0673595 | 3300037466 | Unclassified | 976 |
| 814 | Ga0395898_0788184 | 3300037466 | Bacteria | 891 |
| 815 | Ga0395905_0002222 | 3300037471 | Bacteria | 21895 |
| 816 | Ga0395905_0009030 | 3300037471 | Bacteria | 9780 |
| 817 | Ga0395905_0012524 | 3300037471 | Bacteria | 8162 |
| 818 | Ga0395905_0029223 | 3300037471 | Bacteria | 5195 |
| 819 | Ga0395905_0029724 | 3300037471 | Bacteria | 5150 |
| 820 | Ga0395905_0036985 | 3300037471 | Bacteria | 4586 |
| 821 | Ga0395905_0049013 | 3300037471 | Bacteria | 3958 |
| 822 | Ga0395905_0076008 | 3300037471 | Bacteria | 3147 |
| 823 | Ga0395905_0159977 | 3300037471 | Bacteria | 2117 |
| 824 | Ga0395905_0170844 | 3300037471 | Bacteria | 2042 |
| 825 | Ga0395905_0300859 | 3300037471 | Bacteria | 1491 |
| 826 | Ga0395905_0302641 | 3300037471 | Bacteria | 1486 |
| 827 | Ga0395905_0443257 | 3300037471 | Bacteria | 1196 |
| 828 | Ga0395905_0527336 | 3300037471 | Bacteria | 1081 |
| 829 | Ga0395905_0670129 | 3300037471 | Bacteria | 939 |
| 830 | Ga0395905_0840034 | 3300037471 | Bacteria | 821 |
| 831 | Ga0395905_0876680 | 3300037471 | Bacteria | 800 |
| 832 | Ga0395905_1061240 | 3300037471 | Unclassified | 713 |
| 833 | Ga0395905_1632552 | 3300037471 | Bacteria | 550 |
| 834 | Ga0436364_0378593 | 3300037853 | Bacteria | 1303 |
| 835 | Ga0436364_0996148 | 3300037853 | Bacteria | 15568 |
| 836 | Ga0395901_0000035 | 3300038443 | Bacteria | 223888 |
| 837 | Ga0395901_0022979 | 3300038443 | Bacteria | 6391 |
| 838 | Ga0395901_0072007 | 3300038443 | Bacteria | 3602 |
| 839 | Ga0395901_0108065 | 3300038443 | Bacteria | 2920 |
| 840 | Ga0395901_0243027 | 3300038443 | Bacteria | 1877 |
| 841 | Ga0395901_0272451 | 3300038443 | Bacteria | 1760 |
| 842 | Ga0395901_0423619 | 3300038443 | Bacteria | 1364 |
| 843 | Ga0395901_0480585 | 3300038443 | Bacteria | 1267 |
| 844 | Ga0395901_0530851 | 3300038443 | Bacteria | 1194 |
| 845 | Ga0395901_0640889 | 3300038443 | Bacteria | 1067 |
| 846 | Ga0395901_0770463 | 3300038443 | Bacteria | 953 |
| 847 | Ga0237819_00303 | 3300038705 | Bacteria | 18154 |
| 848 | Ga0237816_02191 | 3300039145 | Bacteria | 1517 |
| 849 | Ga0436365_0183072 | 3300039437 | Bacteria | 14725 |
| 850 | Ga0436363_1629915 | 3300039450 | Bacteria | 837 |
| 851 | Ga0436363_1686935 | 3300039450 | Bacteria | 1160 |
| 852 | Ga0436362_0383697 | 3300039453 | Bacteria | 74416 |
| 853 | Ga0451837_1281924 | 3300041494 | Bacteria | 904 |
| 854 | Ga0439448_0266090 | 3300042005 | Bacteria | 606 |
| 855 | Ga0439462_0025131 | 3300042015 | Bacteria | 1567 |
| 856 | Ga0450889_000044 | 3300042144 | Bacteria | 11037 |
| 857 | Ga0439435_0031179 | 3300042436 | Bacteria | 1448 |
| 858 | Ga0439464_0154557 | 3300042439 | Bacteria | 719 |
| 859 | Ga0466969_0110114 | 3300044656 | Bacteria | 1290 |
| 860 | Ga0466969_0468914 | 3300044656 | Unclassified | 573 |
| 861 | Ga0466965_0209903 | 3300044683 | Bacteria | 1035 |
| 862 | Ga0466965_0387783 | 3300044683 | Bacteria | 770 |
| 863 | Ga0466966_0061375 | 3300044684 | Bacteria | 2371 |
| 864 | Ga0466966_0094752 | 3300044684 | Unclassified | 1850 |
| 865 | Ga0466966_0631426 | 3300044684 | Bacteria | 645 |
| 866 | Ga0466961_0009863 | 3300044693 | Bacteria | 6083 |
| 867 | Ga0466961_0238205 | 3300044693 | Bacteria | 1119 |
| 868 | Ga0466963_0000335 | 3300044694 | Bacteria | 21343 |
| 869 | Ga0466963_0159743 | 3300044694 | Bacteria | 1568 |
| 870 | Ga0466963_0333256 | 3300044694 | Bacteria | 1068 |
| 871 | Ga0466964_0409003 | 3300044706 | Bacteria | 711 |
| 872 | Ga0453684_0001089 | 3300044712 | Bacteria | 85906 |
| 873 | Ga0466971_0076361 | 3300044719 | Bacteria | 1524 |
| 874 | Ga0466970_0037549 | 3300044765 | Bacteria | 2568 |
| 875 | Ga0466970_0052209 | 3300044765 | Bacteria | 2182 |
| 876 | Ga0466970_0178195 | 3300044765 | Unclassified | 1179 |
| 877 | Ga0466957_0080109 | 3300044842 | Bacteria | 2033 |
| 878 | Ga0466957_0436810 | 3300044842 | Bacteria | 900 |
| 879 | Ga0466960_0011969 | 3300044901 | Bacteria | 3649 |
| 880 | Ga0466959_0012236 | 3300045049 | Bacteria | 6192 |
| 881 | Ga0466959_0049179 | 3300045049 | Bacteria | 3097 |
| 882 | Ga0466959_0158752 | 3300045049 | Bacteria | 1590 |
| 883 | Ga0451576_0000201 | 3300045051 | Bacteria | 150175 |
| 884 | Ga0466958_0182803 | 3300045836 | Unclassified | 1331 |
| 885 | Ga0466958_0183574 | 3300045836 | Bacteria | 1328 |
| 886 | Ga0466958_0215633 | 3300045836 | Bacteria | 1224 |
| 887 | Ga0466958_0244048 | 3300045836 | Bacteria | 1148 |
| 888 | Ga0466967_0020512 | 3300045976 | Bacteria | 5345 |
| 889 | Ga0466967_0098983 | 3300045976 | Bacteria | 2663 |
| 890 | Ga0466967_0259495 | 3300045976 | Bacteria | 1662 |
| 891 | Ga0466967_0404913 | 3300045976 | Bacteria | 1328 |
| 892 | Ga0466967_0489618 | 3300045976 | Bacteria | 1206 |
| 893 | Ga0466967_1398101 | 3300045976 | Bacteria | 697 |
| 894 | Ga0495590_0116685 | 3300046457 | Bacteria | 955 |
| 895 | Ga0495638_0001274 | 3300046460 | Bacteria | 23496 |
| 896 | Ga0495638_0023692 | 3300046460 | Bacteria | 4011 |
| 897 | Ga0495580_0631443 | 3300046472 | Unclassified | 706 |
| 898 | Ga0495583_0018403 | 3300046506 | Bacteria | 3678 |
| 899 | Ga0495643_0010369 | 3300046522 | Bacteria | 5737 |
| 900 | Ga0495643_0018963 | 3300046522 | Bacteria | 3985 |
| 901 | Ga0495644_0240472 | 3300046523 | Bacteria | 702 |
| 902 | Ga0495621_0000149 | 3300046539 | Bacteria | 15217 |
| 903 | Ga0495621_0099692 | 3300046539 | Bacteria | 1104 |
| 904 | Ga0495622_0194605 | 3300046557 | Bacteria | 905 |
| 905 | Ga0495668_0018443 | 3300046616 | Bacteria | 4032 |
| 906 | Ga0495625_0000231 | 3300046660 | Bacteria | 87237 |
| 907 | Ga0495625_0004912 | 3300046660 | Bacteria | 12445 |
| 908 | Ga0495669_0031735 | 3300046684 | Bacteria | 2320 |
| 909 | Ga0495669_0280856 | 3300046684 | Bacteria | 801 |
| 910 | Ga0495670_0004834 | 3300046691 | Bacteria | 6616 |
| 911 | Ga0495670_0089862 | 3300046691 | Bacteria | 1571 |
| 912 | Ga0496101_0067569 | 3300048904 | Bacteria | 2610 |
| 913 | Ga0496101_0556563 | 3300048904 | Bacteria | 907 |
| 914 | Ga0496102_0036646 | 3300048905 | Bacteria | 4419 |
| 915 | Ga0496102_0105107 | 3300048905 | Bacteria | 2627 |
| 916 | Ga0496102_0380716 | 3300048905 | Bacteria | 1328 |
| 917 | Ga0496102_0767589 | 3300048905 | Bacteria | 887 |
| 918 | Ga0496103_0007651 | 3300048906 | Bacteria | 6427 |
| 919 | Ga0496104_0719517 | 3300048907 | Bacteria | 906 |
| 920 | Ga0496104_0740400 | 3300048907 | Bacteria | 890 |
| 921 | Ga0496105_0155111 | 3300048908 | Bacteria | 1881 |
| 922 | Ga0496105_0263900 | 3300048908 | Bacteria | 1392 |
| 923 | Ga0496105_0292473 | 3300048908 | Bacteria | 1311 |
| 924 | Ga0496107_0132761 | 3300048910 | Bacteria | 1839 |
| 925 | Ga0496107_0825241 | 3300048910 | Bacteria | 678 |
| 926 | Ga0496108_0001925 | 3300048911 | Bacteria | 16631 |
| 927 | Ga0496108_0180117 | 3300048911 | Bacteria | 1830 |
| 928 | Ga0496109_0015923 | 3300048912 | Bacteria | 6567 |
| 929 | Ga0496109_0321539 | 3300048912 | Bacteria | 1460 |
| 930 | Ga0496110_0021431 | 3300048913 | Bacteria | 5472 |
| 931 | Ga0496111_0007998 | 3300048914 | Bacteria | 6973 |
| 932 | Ga0496111_0064928 | 3300048914 | Bacteria | 2649 |
| 933 | Ga0496111_1116105 | 3300048914 | Bacteria | 561 |
| 934 | Ga0496112_0002858 | 3300048915 | Bacteria | 14027 |
| 935 | Ga0496112_0019601 | 3300048915 | Bacteria | 6387 |
| 936 | Ga0496112_0151041 | 3300048915 | Bacteria | 2290 |
| 937 | Ga0496112_0293726 | 3300048915 | Bacteria | 1571 |
| 938 | Ga0496112_0690172 | 3300048915 | Bacteria | 949 |
| 939 | Ga0496112_0719359 | 3300048915 | Bacteria | 926 |
| 940 | Ga0496113_0016617 | 3300048916 | Bacteria | 5087 |
| 941 | Ga0496113_0022168 | 3300048916 | Bacteria | 4487 |
| 942 | Ga0496114_0042215 | 3300048917 | Bacteria | 3780 |
| 943 | Ga0496114_1215607 | 3300048917 | Bacteria | 640 |
| 944 | Ga0496117_0007348 | 3300048920 | Bacteria | 10796 |
| 945 | Ga0496118_0137078 | 3300048921 | Bacteria | 1559 |
| 946 | Ga0496123_0064154 | 3300048926 | Bacteria | 2342 |
| 947 | Ga0496124_0100265 | 3300048927 | Bacteria | 2348 |
| 948 | Ga0496126_0249921 | 3300048929 | Bacteria | 1478 |
| 949 | Ga0501032_0062790 | 3300049569 | Bacteria | 2488 |
| 950 | Ga0501033_0125664 | 3300049570 | Bacteria | 1860 |
| 951 | Ga0501034_0103060 | 3300049571 | Bacteria | 2847 |
| 952 | Ga0501034_0149862 | 3300049571 | Bacteria | 2309 |
| 953 | Ga0501034_0192577 | 3300049571 | Bacteria | 2001 |
| 954 | Ga0501034_0443868 | 3300049571 | Bacteria | 1216 |
| 955 | Ga0501034_0597792 | 3300049571 | Bacteria | 1009 |
| 956 | Ga0501034_1368510 | 3300049571 | Bacteria | 583 |
| 957 | Ga0501038_0051389 | 3300049574 | Bacteria | 3557 |
| 958 | Ga0501043_1006371 | 3300049579 | Bacteria | 593 |
| 959 | Ga0501047_0080312 | 3300049581 | Bacteria | 3134 |
| 960 | Ga0501047_0317618 | 3300049581 | Bacteria | 1398 |
| 961 | Ga0501047_0372880 | 3300049581 | Bacteria | 1262 |
| 962 | Ga0501047_0376042 | 3300049581 | Bacteria | 1255 |
| 963 | Ga0501047_0568342 | 3300049581 | Bacteria | 957 |
| 964 | Ga0501047_0674553 | 3300049581 | Bacteria | 852 |
| 965 | Ga0501070_0029379 | 3300049586 | Bacteria | 4610 |
| 966 | Ga0501070_0971658 | 3300049586 | Bacteria | 660 |
| 967 | Ga0501072_0856407 | 3300049588 | Bacteria | 711 |
| 968 | Ga0501209_016085 | 3300049656 | Bacteria | 1682 |
| 969 | Ga0501209_211395 | 3300049656 | Bacteria | 599 |
| 970 | Ga0501217_138341 | 3300049661 | Bacteria | 719 |
| 971 | Ga0501224_004198 | 3300049664 | Bacteria | 2037 |
| 972 | Ga0501224_016950 | 3300049664 | Bacteria | 1082 |
| 973 | Ga0501227_052572 | 3300049665 | Bacteria | 1031 |
| 974 | Ga0501227_240487 | 3300049665 | Bacteria | 516 |
| 975 | Ga0501233_028065 | 3300049668 | Bacteria | 1254 |
| 976 | Ga0501233_139981 | 3300049668 | Bacteria | 668 |
| 977 | Ga0501235_007990 | 3300049669 | Bacteria | 2305 |
| 978 | Ga0501249_070337 | 3300049679 | Bacteria | 817 |
| 979 | Ga0501257_024804 | 3300049686 | Bacteria | 1425 |
| 980 | Ga0501257_120176 | 3300049686 | Bacteria | 703 |
| 981 | Ga0501225_0023711 | 3300049705 | Bacteria | 1690 |
| 982 | Ga0501229_049571 | 3300049706 | Bacteria | 617 |
| 983 | Ga0501234_003083 | 3300049707 | Bacteria | 2619 |
| 984 | Ga0501083_0564025 | 3300049744 | Bacteria | 741 |
| 985 | Ga0501262_004084 | 3300049759 | Bacteria | 1684 |
| 986 | Ga0501263_028977 | 3300049760 | Bacteria | 775 |
| 987 | Ga0501267_013378 | 3300049764 | Bacteria | 853 |
| 988 | Ga0501272_024815 | 3300049769 | Bacteria | 737 |
| 989 | Ga0501279_073034 | 3300049775 | Bacteria | 580 |
| 990 | Ga0501035_0995231 | 3300049822 | Bacteria | 659 |
| 991 | Ga0501044_0000243 | 3300049823 | Bacteria | 68966 |
| 992 | Ga0501044_0012601 | 3300049823 | Bacteria | 9157 |
| 993 | Ga0501044_0387363 | 3300049823 | Bacteria | 1312 |
| 994 | Ga0501044_1125944 | 3300049823 | Bacteria | 654 |
| 995 | Ga0501044_1144261 | 3300049823 | Bacteria | 647 |
| 996 | Ga0501044_1352373 | 3300049823 | Bacteria | 578 |
| 997 | nmdc:mga03683_106303_c1 | 3300050489 | Bacteria | 1237 |
| 998 | nmdc:mga03683_528783_c1 | 3300050489 | Bacteria | 573 |
| 999 | nmdc:mga03n38_148726_c1 | 3300050490 | Bacteria | 1177 |
| 1000 | nmdc:mga03n38_156244_c1 | 3300050490 | Bacteria | 1151 |
| 1001 | nmdc:mga03n38_252515_c1 | 3300050490 | Bacteria | 932 |
| 1002 | nmdc:mga03n38_412011_c1 | 3300050490 | Bacteria | 746 |
| 1003 | nmdc:mga00v17_283525_c1 | 3300050491 | Bacteria | 1076 |
| 1004 | nmdc:mga0k408_279387_c1 | 3300050493 | Bacteria | 997 |
| 1005 | nmdc:mga0k408_302908_c1 | 3300050493 | Bacteria | 954 |
| 1006 | nmdc:mga0k408_36021_c1 | 3300050493 | Bacteria | 2839 |
| 1007 | nmdc:mga06z11_100992_c1 | 3300050494 | Bacteria | 1583 |
| 1008 | nmdc:mga06z11_125549_c1 | 3300050494 | Bacteria | 1436 |
| 1009 | nmdc:mga06z11_69426_c1 | 3300050494 | Bacteria | 1860 |
| 1010 | nmdc:mga04h51_141847_c1 | 3300050495 | Bacteria | 912 |
| 1011 | nmdc:mga04h51_145313_c1 | 3300050495 | Bacteria | 903 |
| 1012 | nmdc:mga07m45_1034_c1 | 3300050496 | Bacteria | 12353 |
| 1013 | nmdc:mga07m45_176878_c1 | 3300050496 | Bacteria | 1241 |
| 1014 | nmdc:mga07m45_51034_c1 | 3300050496 | Bacteria | 2332 |
| 1015 | nmdc:mga07m45_65136_c2 | 3300050496 | Bacteria | 1653 |
| 1016 | nmdc:mga05p37_96648_c1 | 3300050507 | Bacteria | 3639 |
| 1017 | nmdc:mga0qj67_65877_c1 | 3300050509 | Bacteria | 2884 |
| 1018 | nmdc:mga06r32_105072_c1 | 3300050510 | Bacteria | 2774 |
| 1019 | nmdc:mga08y16_210415_c1 | 3300050511 | Bacteria | 2014 |
| 1020 | nmdc:mga08y16_324484_c1 | 3300050511 | Bacteria | 1584 |
| 1021 | nmdc:mga0n895_171271_c1 | 3300050512 | Bacteria | 2203 |
| 1022 | nmdc:mga0rr50_414273_c1 | 3300050513 | Bacteria | 1139 |
| 1023 | nmdc:mga0sz30_20166_c1 | 3300050516 | Bacteria | 2687 |
| 1024 | nmdc:mga0sz30_45515_c1 | 3300050516 | Bacteria | 1851 |
| 1025 | Ga0495601_0363480 | 3300053077 | Bacteria | 940 |
| 1026 | Ga0500643_000172 | 3300053087 | Bacteria | 63436 |
| 1027 | Ga0500643_005263 | 3300053087 | Bacteria | 5614 |
| 1028 | Ga0500646_0122008 | 3300053090 | Bacteria | 839 |
| 1029 | Ga0500566_0124345 | 3300053094 | Bacteria | 1387 |
| 1030 | Ga0500641_0037147 | 3300053096 | Bacteria | 1951 |
| 1031 | Ga0500592_000031 | 3300053116 | Bacteria | 47686 |
| 1032 | Ga0500592_021396 | 3300053116 | Bacteria | 1041 |
| 1033 | Ga0500595_067755 | 3300053119 | Bacteria | 1064 |
| 1034 | Ga0500658_0175041 | 3300053134 | Bacteria | 976 |
| 1035 | Ga0500559_0002598 | 3300053136 | Bacteria | 9225 |
| 1036 | Ga0500568_0003398 | 3300053139 | Bacteria | 8897 |
| 1037 | Ga0500588_0163466 | 3300053146 | Bacteria | 811 |
| 1038 | Ga0500604_0083159 | 3300053151 | Bacteria | 1037 |
| 1039 | Ga0500616_0001475 | 3300053153 | Bacteria | 22359 |
| 1040 | Ga0500616_0182442 | 3300053153 | Bacteria | 944 |
| 1041 | Ga0500624_000327 | 3300053157 | Bacteria | 16208 |
| 1042 | Ga0500627_0000090 | 3300053158 | Bacteria | 30885 |
| 1043 | Ga0500636_0001484 | 3300053177 | Bacteria | 12740 |
| 1044 | Ga0501082_0953906 | 3300060353 | Bacteria | 750 |
| 1045 | Ga0466962_0550523 | 3300061719 | Bacteria | 586 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300061719 | Ga0466962_0550523 | Ga0466962_0550523_37_414 | 116 |
| 2 | 3300001991 | JGI24743J22301_10008643 | JGI24743J22301_100086433 | 124 |
| 3 | 3300005367 | Ga0070667_100003302 | Ga0070667_10000330210 | 124 |
| 4 | 3300009174 | Ga0105241_10032710 | Ga0105241_100327102 | 124 |
| 5 | 3300050512 | nmdc:mga0n895_171271_c1 | nmdc:mga0n895_171271_c1_1792_2187 | 124 |
| 6 | 3300003316 | rootH1_10052394 | rootH1_100523947 | 127 |
| 7 | 3300006195 | Ga0075366_10075162 | Ga0075366_100751622 | 127 |
| 8 | 3300037312 | Ga0395899_0204359 | Ga0395899_0204359_492_959 | 130 |
| 9 | 3300037466 | Ga0395898_0673595 | Ga0395898_0673595_68_535 | 130 |
| 10 | 3300037471 | Ga0395905_0302641 | Ga0395905_0302641_545_1012 | 130 |
| 11 | 3300014745 | Ga0157377_10027784 | Ga0157377_100277842 | 132 |
| 12 | 3300049571 | Ga0501034_1368510 | Ga0501034_1368510_131_559 | 132 |
| 13 | 3300013100 | Ga0157373_10093388 | Ga0157373_100933882 | 135 |
| 14 | 3300005327 | Ga0070658_10016537 | Ga0070658_100165373 | 137 |
| 15 | 3300005329 | Ga0070683_100104557 | Ga0070683_1001045572 | 137 |
| 16 | 3300005336 | Ga0070680_100015126 | Ga0070680_1000151264 | 137 |
| 17 | 3300005339 | Ga0070660_100024417 | Ga0070660_1000244176 | 137 |
| 18 | 3300005530 | Ga0070679_100119159 | Ga0070679_1001191592 | 137 |
| 19 | 3300005563 | Ga0068855_100197776 | Ga0068855_1001977761 | 137 |
| 20 | 3300005614 | Ga0068856_100616694 | Ga0068856_1006166942 | 137 |
| 21 | 3300013105 | Ga0157369_10079144 | Ga0157369_100791443 | 137 |
| 22 | 3300025904 | Ga0207647_10036318 | Ga0207647_100363182 | 137 |
| 23 | 3300025909 | Ga0207705_10002967 | Ga0207705_100029672 | 137 |
| 24 | 3300025917 | Ga0207660_10039020 | Ga0207660_100390201 | 137 |
| 25 | 3300025919 | Ga0207657_10001024 | Ga0207657_1000102426 | 137 |
| 26 | 3300025921 | Ga0207652_10024932 | Ga0207652_100249322 | 137 |
| 27 | 3300025944 | Ga0207661_10353973 | Ga0207661_103539732 | 137 |
| 28 | 3300025949 | Ga0207667_10017613 | Ga0207667_100176133 | 137 |
| 29 | 3300025981 | Ga0207640_10537361 | Ga0207640_105373612 | 137 |
| 30 | 3300026078 | Ga0207702_10022935 | Ga0207702_100229352 | 137 |
| 31 | 3300037471 | Ga0395905_0002222 | Ga0395905_0002222_393_839 | 137 |
| 32 | 3300044656 | Ga0466969_0468914 | Ga0466969_0468914_65_511 | 137 |
| 33 | 3300044684 | Ga0466966_0061375 | Ga0466966_0061375_189_635 | 137 |
| 34 | 3300044765 | Ga0466970_0178195 | Ga0466970_0178195_425_871 | 137 |
| 35 | 3300045836 | Ga0466958_0182803 | Ga0466958_0182803_600_1046 | 137 |
| 36 | 3300005435 | Ga0070714_100023828 | Ga0070714_1000238284 | 138 |
| 37 | 3300025929 | Ga0207664_10372533 | Ga0207664_103725332 | 138 |
| 38 | 3300026078 | Ga0207702_10522661 | Ga0207702_105226612 | 138 |
| 39 | 3300044706 | Ga0466964_0409003 | Ga0466964_0409003_107_574 | 138 |
| 40 | 3300044765 | Ga0466970_0052209 | Ga0466970_0052209_1513_1980 | 138 |
| 41 | 3300045976 | Ga0466967_0098983 | Ga0466967_0098983_1334_1801 | 138 |
| 42 | 3300044694 | Ga0466963_0159743 | Ga0466963_0159743_604_1071 | 141 |
| 43 | 3300044842 | Ga0466957_0080109 | Ga0466957_0080109_641_1108 | 141 |
| 44 | 3300045836 | Ga0466958_0215633 | Ga0466958_0215633_155_622 | 141 |
| 45 | iso_pu_bacteria | 2599185359 | 2600225287 | 141 |
| 46 | iso_pu_bacteria | 2879163058 | 2879166309 | 141 |
| 47 | iso_pu_bacteria | 2928526807 | 2928530141 | 141 |
| 48 | 3300001990 | JGI24737J22298_10121900 | JGI24737J22298_101219001 | 142 |
| 49 | 3300005327 | Ga0070658_10002803 | Ga0070658_100028039 | 142 |
| 50 | 3300005339 | Ga0070660_100032537 | Ga0070660_1000325374 | 142 |
| 51 | 3300005344 | Ga0070661_100332183 | Ga0070661_1003321832 | 142 |
| 52 | 3300005345 | Ga0070692_10018291 | Ga0070692_100182912 | 142 |
| 53 | 3300013102 | Ga0157371_10378073 | Ga0157371_103780732 | 142 |
| 54 | 3300013104 | Ga0157370_10162569 | Ga0157370_101625693 | 142 |
| 55 | 3300025904 | Ga0207647_10132656 | Ga0207647_101326562 | 142 |
| 56 | 3300025909 | Ga0207705_10008821 | Ga0207705_100088214 | 142 |
| 57 | 3300025919 | Ga0207657_10000504 | Ga0207657_1000050413 | 142 |
| 58 | 3300025920 | Ga0207649_10425958 | Ga0207649_104259582 | 142 |
| 59 | 3300037312 | Ga0395899_0000287 | Ga0395899_0000287_45510_45956 | 142 |
| 60 | 3300037418 | Ga0395900_0000031 | Ga0395900_0000031_209795_210241 | 142 |
| 61 | 3300037466 | Ga0395898_0012131 | Ga0395898_0012131_2651_3097 | 142 |
| 62 | 3300037471 | Ga0395905_0049013 | Ga0395905_0049013_1216_1662 | 142 |
| 63 | 3300038443 | Ga0395901_0000035 | Ga0395901_0000035_75671_76117 | 142 |
| 64 | 3300005347 | Ga0070668_100039770 | Ga0070668_1000397703 | 143 |
| 65 | 3300005356 | Ga0070674_100170289 | Ga0070674_1001702892 | 143 |
| 66 | 3300005366 | Ga0070659_100001672 | Ga0070659_10000167212 | 143 |
| 67 | 3300005455 | Ga0070663_100498380 | Ga0070663_1004983802 | 143 |
| 68 | 3300005539 | Ga0068853_100090163 | Ga0068853_1000901632 | 143 |
| 69 | 3300005843 | Ga0068860_100007732 | Ga0068860_1000077328 | 143 |
| 70 | 3300009094 | Ga0111539_10230792 | Ga0111539_102307922 | 143 |
| 71 | 3300009098 | Ga0105245_10000285 | Ga0105245_1000028536 | 143 |
| 72 | 3300013100 | Ga0157373_10179009 | Ga0157373_101790092 | 143 |
| 73 | 3300025899 | Ga0207642_10058332 | Ga0207642_100583322 | 143 |
| 74 | 3300026067 | Ga0207678_10433401 | Ga0207678_104334012 | 143 |
| 75 | 3300028381 | Ga0268264_10071632 | Ga0268264_100716322 | 143 |
| 76 | iso_pu_bacteria | 2643221588 | 2643950773 | 143 |
| 77 | iso_pu_bacteria | 2852680915 | 2852683318 | 143 |
| 78 | 3300006358 | Ga0068871_101463072 | Ga0068871_1014630722 | 144 |
| 79 | 3300021377 | Ga0213874_10027658 | Ga0213874_100276582 | 144 |
| 80 | 3300039450 | Ga0436363_1629915 | Ga0436363_1629915_347_790 | 144 |
| 81 | iso_pu_bacteria | 2643221541 | 2643727878 | 144 |
| 82 | iso_pu_bacteria | 2643221606 | 2644043172 | 144 |
| 83 | iso_pu_bacteria | 2643221671 | 2644395396 | 144 |
| 84 | 3300005436 | Ga0070713_100079220 | Ga0070713_1000792202 | 145 |
| 85 | 3300005614 | Ga0068856_100810795 | Ga0068856_1008107953 | 145 |
| 86 | 3300005616 | Ga0068852_100577971 | Ga0068852_1005779712 | 145 |
| 87 | 3300005985 | Ga0081539_10071277 | Ga0081539_100712772 | 145 |
| 88 | 3300006028 | Ga0070717_10142382 | Ga0070717_101423822 | 145 |
| 89 | 3300010375 | Ga0105239_10523147 | Ga0105239_105231472 | 145 |
| 90 | 3300013100 | Ga0157373_10142875 | Ga0157373_101428752 | 145 |
| 91 | 3300013102 | Ga0157371_10951705 | Ga0157371_109517052 | 145 |
| 92 | 3300013105 | Ga0157369_10016077 | Ga0157369_100160777 | 145 |
| 93 | 3300025915 | Ga0207693_10069429 | Ga0207693_100694292 | 145 |
| 94 | 3300025928 | Ga0207700_10021189 | Ga0207700_100211895 | 145 |
| 95 | 3300026078 | Ga0207702_11359256 | Ga0207702_113592562 | 145 |
| 96 | 3300031251 | Ga0265327_10054725 | Ga0265327_100547251 | 145 |
| 97 | 3300037418 | Ga0395900_0068337 | Ga0395900_0068337_2156_2620 | 145 |
| 98 | 3300037418 | Ga0395900_0412769 | Ga0395900_0412769_854_1297 | 145 |
| 99 | 3300037471 | Ga0395905_1632552 | Ga0395905_1632552_72_536 | 145 |
| 100 | 3300038443 | Ga0395901_0480585 | Ga0395901_0480585_785_1249 | 145 |
| 101 | 3300044719 | Ga0466971_0076361 | Ga0466971_0076361_89_553 | 145 |
| 102 | 3300045976 | Ga0466967_0404913 | Ga0466967_0404913_295_738 | 145 |
| 103 | 3300048914 | Ga0496111_1116105 | Ga0496111_1116105_21_485 | 145 |
| 104 | 3300048926 | Ga0496123_0064154 | Ga0496123_0064154_1575_2030 | 145 |
| 105 | 3300048927 | Ga0496124_0100265 | Ga0496124_0100265_1544_1999 | 145 |
| 106 | 3300001904 | JGI24736J21556_1000380 | JGI24736J21556_10003808 | 146 |
| 107 | 3300001915 | JGI24741J21665_1011686 | JGI24741J21665_10116862 | 146 |
| 108 | 3300001915 | JGI24741J21665_1025433 | JGI24741J21665_10254332 | 146 |
| 109 | 3300001976 | JGI24752J21851_1031004 | JGI24752J21851_10310042 | 146 |
| 110 | 3300001979 | JGI24740J21852_10004073 | JGI24740J21852_100040734 | 146 |
| 111 | 3300001979 | JGI24740J21852_10006068 | JGI24740J21852_100060684 | 146 |
| 112 | 3300001979 | JGI24740J21852_10020042 | JGI24740J21852_100200422 | 146 |
| 113 | 3300001979 | JGI24740J21852_10076214 | JGI24740J21852_100762142 | 146 |
| 114 | 3300001989 | JGI24739J22299_10006920 | JGI24739J22299_100069203 | 146 |
| 115 | 3300001989 | JGI24739J22299_10018997 | JGI24739J22299_100189972 | 146 |
| 116 | 3300001990 | JGI24737J22298_10004108 | JGI24737J22298_100041084 | 146 |
| 117 | 3300001990 | JGI24737J22298_10020537 | JGI24737J22298_100205372 | 146 |
| 118 | 3300002067 | JGI24735J21928_10002919 | JGI24735J21928_100029195 | 146 |
| 119 | 3300002067 | JGI24735J21928_10006830 | JGI24735J21928_100068302 | 146 |
| 120 | 3300002075 | JGI24738J21930_10019210 | JGI24738J21930_100192103 | 146 |
| 121 | 3300002075 | JGI24738J21930_10027575 | JGI24738J21930_100275752 | 146 |
| 122 | 3300002075 | JGI24738J21930_10059138 | JGI24738J21930_100591382 | 146 |
| 123 | 3300005290 | Ga0065712_10398292 | Ga0065712_103982921 | 146 |
| 124 | 3300005293 | Ga0065715_10157897 | Ga0065715_101578972 | 146 |
| 125 | 3300005327 | Ga0070658_10021373 | Ga0070658_100213733 | 146 |
| 126 | 3300005327 | Ga0070658_10068054 | Ga0070658_100680542 | 146 |
| 127 | 3300005327 | Ga0070658_10095345 | Ga0070658_100953451 | 146 |
| 128 | 3300005327 | Ga0070658_10097037 | Ga0070658_100970374 | 146 |
| 129 | 3300005327 | Ga0070658_10285681 | Ga0070658_102856813 | 146 |
| 130 | 3300005327 | Ga0070658_10306522 | Ga0070658_103065221 | 146 |
| 131 | 3300005327 | Ga0070658_10423728 | Ga0070658_104237282 | 146 |
| 132 | 3300005327 | Ga0070658_10689605 | Ga0070658_106896052 | 146 |
| 133 | 3300005328 | Ga0070676_10090890 | Ga0070676_100908902 | 146 |
| 134 | 3300005328 | Ga0070676_10157038 | Ga0070676_101570382 | 146 |
| 135 | 3300005329 | Ga0070683_100019869 | Ga0070683_1000198692 | 146 |
| 136 | 3300005329 | Ga0070683_100115603 | Ga0070683_1001156032 | 146 |
| 137 | 3300005329 | Ga0070683_100263397 | Ga0070683_1002633971 | 146 |
| 138 | 3300005330 | Ga0070690_100205593 | Ga0070690_1002055932 | 146 |
| 139 | 3300005331 | Ga0070670_100024585 | Ga0070670_1000245855 | 146 |
| 140 | 3300005331 | Ga0070670_100058924 | Ga0070670_1000589244 | 146 |
| 141 | 3300005331 | Ga0070670_100158438 | Ga0070670_1001584382 | 146 |
| 142 | 3300005331 | Ga0070670_100701594 | Ga0070670_1007015942 | 146 |
| 143 | 3300005334 | Ga0068869_100211770 | Ga0068869_1002117702 | 146 |
| 144 | 3300005334 | Ga0068869_100969869 | Ga0068869_1009698692 | 146 |
| 145 | 3300005335 | Ga0070666_10000630 | Ga0070666_1000063024 | 146 |
| 146 | 3300005335 | Ga0070666_10594498 | Ga0070666_105944981 | 146 |
| 147 | 3300005337 | Ga0070682_100117860 | Ga0070682_1001178602 | 146 |
| 148 | 3300005337 | Ga0070682_100208836 | Ga0070682_1002088362 | 146 |
| 149 | 3300005338 | Ga0068868_100223366 | Ga0068868_1002233662 | 146 |
| 150 | 3300005338 | Ga0068868_100407027 | Ga0068868_1004070272 | 146 |
| 151 | 3300005338 | Ga0068868_101146694 | Ga0068868_1011466941 | 146 |
| 152 | 3300005339 | Ga0070660_100001159 | Ga0070660_10000115910 | 146 |
| 153 | 3300005339 | Ga0070660_100199843 | Ga0070660_1001998432 | 146 |
| 154 | 3300005339 | Ga0070660_100220477 | Ga0070660_1002204773 | 146 |
| 155 | 3300005339 | Ga0070660_100284271 | Ga0070660_1002842712 | 146 |
| 156 | 3300005339 | Ga0070660_100554676 | Ga0070660_1005546761 | 146 |
| 157 | 3300005339 | Ga0070660_100673729 | Ga0070660_1006737293 | 146 |
| 158 | 3300005339 | Ga0070660_101305530 | Ga0070660_1013055301 | 146 |
| 159 | 3300005340 | Ga0070689_100431659 | Ga0070689_1004316592 | 146 |
| 160 | 3300005341 | Ga0070691_10770287 | Ga0070691_107702871 | 146 |
| 161 | 3300005343 | Ga0070687_100313353 | Ga0070687_1003133532 | 146 |
| 162 | 3300005344 | Ga0070661_100000001 | Ga0070661_100000001133 | 146 |
| 163 | 3300005344 | Ga0070661_100004337 | Ga0070661_1000043372 | 146 |
| 164 | 3300005344 | Ga0070661_100026908 | Ga0070661_1000269083 | 146 |
| 165 | 3300005344 | Ga0070661_100077870 | Ga0070661_1000778703 | 146 |
| 166 | 3300005344 | Ga0070661_100137949 | Ga0070661_1001379492 | 146 |
| 167 | 3300005344 | Ga0070661_100246747 | Ga0070661_1002467472 | 146 |
| 168 | 3300005344 | Ga0070661_100299978 | Ga0070661_1002999782 | 146 |
| 169 | 3300005344 | Ga0070661_100398411 | Ga0070661_1003984113 | 146 |
| 170 | 3300005344 | Ga0070661_100476548 | Ga0070661_1004765481 | 146 |
| 171 | 3300005345 | Ga0070692_10030185 | Ga0070692_100301852 | 146 |
| 172 | 3300005347 | Ga0070668_100105185 | Ga0070668_1001051852 | 146 |
| 173 | 3300005347 | Ga0070668_100124859 | Ga0070668_1001248593 | 146 |
| 174 | 3300005347 | Ga0070668_100403365 | Ga0070668_1004033651 | 146 |
| 175 | 3300005355 | Ga0070671_100022193 | Ga0070671_1000221936 | 146 |
| 176 | 3300005355 | Ga0070671_100029902 | Ga0070671_1000299025 | 146 |
| 177 | 3300005355 | Ga0070671_100555906 | Ga0070671_1005559062 | 146 |
| 178 | 3300005364 | Ga0070673_100000613 | Ga0070673_10000061325 | 146 |
| 179 | 3300005364 | Ga0070673_100030292 | Ga0070673_1000302924 | 146 |
| 180 | 3300005364 | Ga0070673_101000435 | Ga0070673_1010004352 | 146 |
| 181 | 3300005366 | Ga0070659_100001497 | Ga0070659_10000149712 | 146 |
| 182 | 3300005366 | Ga0070659_100004174 | Ga0070659_10000417413 | 146 |
| 183 | 3300005366 | Ga0070659_100035234 | Ga0070659_1000352341 | 146 |
| 184 | 3300005366 | Ga0070659_100039458 | Ga0070659_1000394582 | 146 |
| 185 | 3300005366 | Ga0070659_100066449 | Ga0070659_1000664492 | 146 |
| 186 | 3300005366 | Ga0070659_100201266 | Ga0070659_1002012663 | 146 |
| 187 | 3300005366 | Ga0070659_100218370 | Ga0070659_1002183702 | 146 |
| 188 | 3300005366 | Ga0070659_100424745 | Ga0070659_1004247452 | 146 |
| 189 | 3300005366 | Ga0070659_100458545 | Ga0070659_1004585451 | 146 |
| 190 | 3300005366 | Ga0070659_101299958 | Ga0070659_1012999581 | 146 |
| 191 | 3300005367 | Ga0070667_100003077 | Ga0070667_1000030773 | 146 |
| 192 | 3300005367 | Ga0070667_100380319 | Ga0070667_1003803192 | 146 |
| 193 | 3300005367 | Ga0070667_100404435 | Ga0070667_1004044352 | 146 |
| 194 | 3300005367 | Ga0070667_100834494 | Ga0070667_1008344942 | 146 |
| 195 | 3300005435 | Ga0070714_100263184 | Ga0070714_1002631842 | 146 |
| 196 | 3300005455 | Ga0070663_100002429 | Ga0070663_10000242913 | 146 |
| 197 | 3300005455 | Ga0070663_100005583 | Ga0070663_1000055835 | 146 |
| 198 | 3300005455 | Ga0070663_100028492 | Ga0070663_1000284923 | 146 |
| 199 | 3300005455 | Ga0070663_100212977 | Ga0070663_1002129772 | 146 |
| 200 | 3300005455 | Ga0070663_100444393 | Ga0070663_1004443931 | 146 |
| 201 | 3300005455 | Ga0070663_101225404 | Ga0070663_1012254041 | 146 |
| 202 | 3300005456 | Ga0070678_100001960 | Ga0070678_10000196010 | 146 |
| 203 | 3300005456 | Ga0070678_100254941 | Ga0070678_1002549412 | 146 |
| 204 | 3300005457 | Ga0070662_100001950 | Ga0070662_10000195012 | 146 |
| 205 | 3300005457 | Ga0070662_100033982 | Ga0070662_1000339824 | 146 |
| 206 | 3300005457 | Ga0070662_100063612 | Ga0070662_1000636122 | 146 |
| 207 | 3300005457 | Ga0070662_100183278 | Ga0070662_1001832782 | 146 |
| 208 | 3300005457 | Ga0070662_100525951 | Ga0070662_1005259512 | 146 |
| 209 | 3300005457 | Ga0070662_100550808 | Ga0070662_1005508081 | 146 |
| 210 | 3300005457 | Ga0070662_101087796 | Ga0070662_1010877961 | 146 |
| 211 | 3300005457 | Ga0070662_101265971 | Ga0070662_1012659711 | 146 |
| 212 | 3300005458 | Ga0070681_10001494 | Ga0070681_100014945 | 146 |
| 213 | 3300005458 | Ga0070681_10024034 | Ga0070681_100240342 | 146 |
| 214 | 3300005458 | Ga0070681_10025673 | Ga0070681_100256734 | 146 |
| 215 | 3300005458 | Ga0070681_10238297 | Ga0070681_102382972 | 146 |
| 216 | 3300005459 | Ga0068867_100969546 | Ga0068867_1009695461 | 146 |
| 217 | 3300005530 | Ga0070679_100019105 | Ga0070679_1000191058 | 146 |
| 218 | 3300005530 | Ga0070679_100072934 | Ga0070679_1000729341 | 146 |
| 219 | 3300005530 | Ga0070679_100816233 | Ga0070679_1008162331 | 146 |
| 220 | 3300005530 | Ga0070679_101117448 | Ga0070679_1011174482 | 146 |
| 221 | 3300005535 | Ga0070684_100101049 | Ga0070684_1001010494 | 146 |
| 222 | 3300005539 | Ga0068853_100010266 | Ga0068853_1000102669 | 146 |
| 223 | 3300005539 | Ga0068853_100015278 | Ga0068853_1000152784 | 146 |
| 224 | 3300005539 | Ga0068853_100020000 | Ga0068853_1000200002 | 146 |
| 225 | 3300005539 | Ga0068853_100094613 | Ga0068853_1000946131 | 146 |
| 226 | 3300005539 | Ga0068853_100198188 | Ga0068853_1001981884 | 146 |
| 227 | 3300005539 | Ga0068853_100221131 | Ga0068853_1002211312 | 146 |
| 228 | 3300005539 | Ga0068853_100796336 | Ga0068853_1007963362 | 146 |
| 229 | 3300005539 | Ga0068853_101741925 | Ga0068853_1017419251 | 146 |
| 230 | 3300005543 | Ga0070672_100001691 | Ga0070672_10000169114 | 146 |
| 231 | 3300005543 | Ga0070672_100791652 | Ga0070672_1007916522 | 146 |
| 232 | 3300005546 | Ga0070696_101329684 | Ga0070696_1013296841 | 146 |
| 233 | 3300005547 | Ga0070693_100030191 | Ga0070693_1000301913 | 146 |
| 234 | 3300005547 | Ga0070693_100603749 | Ga0070693_1006037492 | 146 |
| 235 | 3300005548 | Ga0070665_100020234 | Ga0070665_1000202345 | 146 |
| 236 | 3300005548 | Ga0070665_100178366 | Ga0070665_1001783662 | 146 |
| 237 | 3300005563 | Ga0068855_100003943 | Ga0068855_1000039433 | 146 |
| 238 | 3300005563 | Ga0068855_100026207 | Ga0068855_1000262073 | 146 |
| 239 | 3300005563 | Ga0068855_100112736 | Ga0068855_1001127362 | 146 |
| 240 | 3300005563 | Ga0068855_100170776 | Ga0068855_1001707763 | 146 |
| 241 | 3300005563 | Ga0068855_100688916 | Ga0068855_1006889162 | 146 |
| 242 | 3300005563 | Ga0068855_100852756 | Ga0068855_1008527561 | 146 |
| 243 | 3300005563 | Ga0068855_101769804 | Ga0068855_1017698042 | 146 |
| 244 | 3300005564 | Ga0070664_100006440 | Ga0070664_10000644011 | 146 |
| 245 | 3300005564 | Ga0070664_100028663 | Ga0070664_1000286634 | 146 |
| 246 | 3300005564 | Ga0070664_100047078 | Ga0070664_1000470783 | 146 |
| 247 | 3300005564 | Ga0070664_100068112 | Ga0070664_1000681123 | 146 |
| 248 | 3300005564 | Ga0070664_100068314 | Ga0070664_1000683142 | 146 |
| 249 | 3300005564 | Ga0070664_100157013 | Ga0070664_1001570133 | 146 |
| 250 | 3300005564 | Ga0070664_100168839 | Ga0070664_1001688393 | 146 |
| 251 | 3300005564 | Ga0070664_100812016 | Ga0070664_1008120162 | 146 |
| 252 | 3300005577 | Ga0068857_100012269 | Ga0068857_1000122696 | 146 |
| 253 | 3300005577 | Ga0068857_100016853 | Ga0068857_1000168536 | 146 |
| 254 | 3300005577 | Ga0068857_100437446 | Ga0068857_1004374462 | 146 |
| 255 | 3300005577 | Ga0068857_100584191 | Ga0068857_1005841911 | 146 |
| 256 | 3300005577 | Ga0068857_100995463 | Ga0068857_1009954632 | 146 |
| 257 | 3300005578 | Ga0068854_100017822 | Ga0068854_1000178224 | 146 |
| 258 | 3300005578 | Ga0068854_100213881 | Ga0068854_1002138812 | 146 |
| 259 | 3300005578 | Ga0068854_100391560 | Ga0068854_1003915602 | 146 |
| 260 | 3300005578 | Ga0068854_100488073 | Ga0068854_1004880731 | 146 |
| 261 | 3300005614 | Ga0068856_100017668 | Ga0068856_1000176689 | 146 |
| 262 | 3300005614 | Ga0068856_100071045 | Ga0068856_1000710454 | 146 |
| 263 | 3300005614 | Ga0068856_100435216 | Ga0068856_1004352162 | 146 |
| 264 | 3300005614 | Ga0068856_100460795 | Ga0068856_1004607952 | 146 |
| 265 | 3300005614 | Ga0068856_100504088 | Ga0068856_1005040882 | 146 |
| 266 | 3300005616 | Ga0068852_100000043 | Ga0068852_10000004326 | 146 |
| 267 | 3300005616 | Ga0068852_100003224 | Ga0068852_1000032247 | 146 |
| 268 | 3300005616 | Ga0068852_100087379 | Ga0068852_1000873792 | 146 |
| 269 | 3300005616 | Ga0068852_100105224 | Ga0068852_1001052242 | 146 |
| 270 | 3300005616 | Ga0068852_100134000 | Ga0068852_1001340002 | 146 |
| 271 | 3300005616 | Ga0068852_100186235 | Ga0068852_1001862352 | 146 |
| 272 | 3300005616 | Ga0068852_100247262 | Ga0068852_1002472622 | 146 |
| 273 | 3300005616 | Ga0068852_100263119 | Ga0068852_1002631192 | 146 |
| 274 | 3300005616 | Ga0068852_100327860 | Ga0068852_1003278602 | 146 |
| 275 | 3300005616 | Ga0068852_100447122 | Ga0068852_1004471221 | 146 |
| 276 | 3300005616 | Ga0068852_100509187 | Ga0068852_1005091872 | 146 |
| 277 | 3300005616 | Ga0068852_100652423 | Ga0068852_1006524232 | 146 |
| 278 | 3300005616 | Ga0068852_101301608 | Ga0068852_1013016082 | 146 |
| 279 | 3300005618 | Ga0068864_100011893 | Ga0068864_1000118935 | 146 |
| 280 | 3300005834 | Ga0068851_10005339 | Ga0068851_100053394 | 146 |
| 281 | 3300005834 | Ga0068851_10018748 | Ga0068851_100187483 | 146 |
| 282 | 3300005834 | Ga0068851_10035286 | Ga0068851_100352863 | 146 |
| 283 | 3300005834 | Ga0068851_10038966 | Ga0068851_100389663 | 146 |
| 284 | 3300005834 | Ga0068851_10045538 | Ga0068851_100455382 | 146 |
| 285 | 3300005840 | Ga0068870_10045636 | Ga0068870_100456363 | 146 |
| 286 | 3300005841 | Ga0068863_100030776 | Ga0068863_1000307762 | 146 |
| 287 | 3300005841 | Ga0068863_100132055 | Ga0068863_1001320554 | 146 |
| 288 | 3300005842 | Ga0068858_100327860 | Ga0068858_1003278602 | 146 |
| 289 | 3300005843 | Ga0068860_100111287 | Ga0068860_1001112872 | 146 |
| 290 | 3300005843 | Ga0068860_100388182 | Ga0068860_1003881822 | 146 |
| 291 | 3300006173 | Ga0070716_101269268 | Ga0070716_1012692681 | 146 |
| 292 | 3300006177 | Ga0075362_10036972 | Ga0075362_100369722 | 146 |
| 293 | 3300006195 | Ga0075366_10318872 | Ga0075366_103188722 | 146 |
| 294 | 3300006237 | Ga0097621_100538564 | Ga0097621_1005385642 | 146 |
| 295 | 3300006353 | Ga0075370_10046646 | Ga0075370_100466462 | 146 |
| 296 | 3300006353 | Ga0075370_10279050 | Ga0075370_102790502 | 146 |
| 297 | 3300006358 | Ga0068871_100005970 | Ga0068871_1000059707 | 146 |
| 298 | 3300006931 | Ga0097620_101631925 | Ga0097620_1016319251 | 146 |
| 299 | 3300007076 | Ga0075435_100566673 | Ga0075435_1005666732 | 146 |
| 300 | 3300009093 | Ga0105240_10023135 | Ga0105240_100231354 | 146 |
| 301 | 3300009093 | Ga0105240_10285810 | Ga0105240_102858102 | 146 |
| 302 | 3300009093 | Ga0105240_10296300 | Ga0105240_102963002 | 146 |
| 303 | 3300009093 | Ga0105240_10459837 | Ga0105240_104598372 | 146 |
| 304 | 3300009148 | Ga0105243_10265561 | Ga0105243_102655612 | 146 |
| 305 | 3300009174 | Ga0105241_10038432 | Ga0105241_100384323 | 146 |
| 306 | 3300009174 | Ga0105241_10144750 | Ga0105241_101447503 | 146 |
| 307 | 3300009177 | Ga0105248_10008019 | Ga0105248_100080198 | 146 |
| 308 | 3300009177 | Ga0105248_10013976 | Ga0105248_100139768 | 146 |
| 309 | 3300009177 | Ga0105248_10046063 | Ga0105248_100460634 | 146 |
| 310 | 3300009545 | Ga0105237_10013046 | Ga0105237_100130464 | 146 |
| 311 | 3300009545 | Ga0105237_10013830 | Ga0105237_100138304 | 146 |
| 312 | 3300009551 | Ga0105238_10014359 | Ga0105238_100143595 | 146 |
| 313 | 3300009551 | Ga0105238_10014766 | Ga0105238_100147669 | 146 |
| 314 | 3300009551 | Ga0105238_10027736 | Ga0105238_100277367 | 146 |
| 315 | 3300009551 | Ga0105238_10249556 | Ga0105238_102495562 | 146 |
| 316 | 3300009551 | Ga0105238_10738631 | Ga0105238_107386312 | 146 |
| 317 | 3300009551 | Ga0105238_12484118 | Ga0105238_124841181 | 146 |
| 318 | 3300010375 | Ga0105239_10473944 | Ga0105239_104739442 | 146 |
| 319 | 3300013100 | Ga0157373_10003505 | Ga0157373_100035058 | 146 |
| 320 | 3300013100 | Ga0157373_10023083 | Ga0157373_100230834 | 146 |
| 321 | 3300013100 | Ga0157373_10122033 | Ga0157373_101220332 | 146 |
| 322 | 3300013100 | Ga0157373_10204085 | Ga0157373_102040852 | 146 |
| 323 | 3300013100 | Ga0157373_10600654 | Ga0157373_106006542 | 146 |
| 324 | 3300013102 | Ga0157371_10009211 | Ga0157371_100092117 | 146 |
| 325 | 3300013102 | Ga0157371_10024590 | Ga0157371_100245902 | 146 |
| 326 | 3300013102 | Ga0157371_10031247 | Ga0157371_100312472 | 146 |
| 327 | 3300013102 | Ga0157371_10224176 | Ga0157371_102241762 | 146 |
| 328 | 3300013102 | Ga0157371_10230240 | Ga0157371_102302402 | 146 |
| 329 | 3300013102 | Ga0157371_10410021 | Ga0157371_104100211 | 146 |
| 330 | 3300013104 | Ga0157370_10002640 | Ga0157370_100026407 | 146 |
| 331 | 3300013104 | Ga0157370_10017787 | Ga0157370_100177872 | 146 |
| 332 | 3300013104 | Ga0157370_10054118 | Ga0157370_100541183 | 146 |
| 333 | 3300013104 | Ga0157370_10154929 | Ga0157370_101549294 | 146 |
| 334 | 3300013104 | Ga0157370_10197659 | Ga0157370_101976593 | 146 |
| 335 | 3300013104 | Ga0157370_10260872 | Ga0157370_102608722 | 146 |
| 336 | 3300013104 | Ga0157370_10512166 | Ga0157370_105121662 | 146 |
| 337 | 3300013104 | Ga0157370_11065351 | Ga0157370_110653512 | 146 |
| 338 | 3300013105 | Ga0157369_10009565 | Ga0157369_100095654 | 146 |
| 339 | 3300013105 | Ga0157369_10011956 | Ga0157369_100119565 | 146 |
| 340 | 3300013105 | Ga0157369_10036687 | Ga0157369_100366875 | 146 |
| 341 | 3300013105 | Ga0157369_10148511 | Ga0157369_101485112 | 146 |
| 342 | 3300013105 | Ga0157369_10196462 | Ga0157369_101964622 | 146 |
| 343 | 3300013105 | Ga0157369_10297249 | Ga0157369_102972493 | 146 |
| 344 | 3300013105 | Ga0157369_10350719 | Ga0157369_103507193 | 146 |
| 345 | 3300013105 | Ga0157369_10580459 | Ga0157369_105804592 | 146 |
| 346 | 3300013105 | Ga0157369_11582134 | Ga0157369_115821342 | 146 |
| 347 | 3300013105 | Ga0157369_12418399 | Ga0157369_124183991 | 146 |
| 348 | 3300013296 | Ga0157374_10041303 | Ga0157374_100413032 | 146 |
| 349 | 3300013296 | Ga0157374_10524342 | Ga0157374_105243422 | 146 |
| 350 | 3300013306 | Ga0163162_10010085 | Ga0163162_100100853 | 146 |
| 351 | 3300013306 | Ga0163162_10424950 | Ga0163162_104249502 | 146 |
| 352 | 3300013306 | Ga0163162_13353548 | Ga0163162_133535481 | 146 |
| 353 | 3300013307 | Ga0157372_10005358 | Ga0157372_1000535810 | 146 |
| 354 | 3300013307 | Ga0157372_10091413 | Ga0157372_100914132 | 146 |
| 355 | 3300013307 | Ga0157372_10199311 | Ga0157372_101993112 | 146 |
| 356 | 3300013307 | Ga0157372_10306604 | Ga0157372_103066043 | 146 |
| 357 | 3300013307 | Ga0157372_10316168 | Ga0157372_103161682 | 146 |
| 358 | 3300013308 | Ga0157375_10016550 | Ga0157375_100165505 | 146 |
| 359 | 3300013308 | Ga0157375_10331699 | Ga0157375_103316992 | 146 |
| 360 | 3300014325 | Ga0163163_10003524 | Ga0163163_1000352412 | 146 |
| 361 | 3300014497 | Ga0182008_10102452 | Ga0182008_101024522 | 146 |
| 362 | 3300014745 | Ga0157377_10150530 | Ga0157377_101505302 | 146 |
| 363 | 3300014968 | Ga0157379_10122684 | Ga0157379_101226843 | 146 |
| 364 | 3300021358 | Ga0213873_10000009 | Ga0213873_10000009136 | 146 |
| 365 | 3300021384 | Ga0213876_10000004 | Ga0213876_10000004181 | 146 |
| 366 | 3300021384 | Ga0213876_10208719 | Ga0213876_102087192 | 146 |
| 367 | 3300021388 | Ga0213875_10008191 | Ga0213875_100081916 | 146 |
| 368 | 3300025315 | Ga0207697_10003593 | Ga0207697_100035932 | 146 |
| 369 | 3300025315 | Ga0207697_10054258 | Ga0207697_100542582 | 146 |
| 370 | 3300025315 | Ga0207697_10056296 | Ga0207697_100562962 | 146 |
| 371 | 3300025321 | Ga0207656_10003790 | Ga0207656_100037904 | 146 |
| 372 | 3300025321 | Ga0207656_10017463 | Ga0207656_100174632 | 146 |
| 373 | 3300025321 | Ga0207656_10020842 | Ga0207656_100208423 | 146 |
| 374 | 3300025901 | Ga0207688_10093367 | Ga0207688_100933672 | 146 |
| 375 | 3300025901 | Ga0207688_10310041 | Ga0207688_103100412 | 146 |
| 376 | 3300025903 | Ga0207680_10007697 | Ga0207680_100076975 | 146 |
| 377 | 3300025903 | Ga0207680_10156783 | Ga0207680_101567832 | 146 |
| 378 | 3300025903 | Ga0207680_10736518 | Ga0207680_107365182 | 146 |
| 379 | 3300025904 | Ga0207647_10000069 | Ga0207647_1000006945 | 146 |
| 380 | 3300025904 | Ga0207647_10006349 | Ga0207647_100063498 | 146 |
| 381 | 3300025904 | Ga0207647_10012008 | Ga0207647_100120089 | 146 |
| 382 | 3300025904 | Ga0207647_10028658 | Ga0207647_100286582 | 146 |
| 383 | 3300025907 | Ga0207645_10113335 | Ga0207645_101133352 | 146 |
| 384 | 3300025907 | Ga0207645_10282613 | Ga0207645_102826132 | 146 |
| 385 | 3300025909 | Ga0207705_10007878 | Ga0207705_100078787 | 146 |
| 386 | 3300025909 | Ga0207705_10009747 | Ga0207705_100097472 | 146 |
| 387 | 3300025909 | Ga0207705_10010868 | Ga0207705_100108684 | 146 |
| 388 | 3300025909 | Ga0207705_10051015 | Ga0207705_100510152 | 146 |
| 389 | 3300025909 | Ga0207705_10101632 | Ga0207705_101016322 | 146 |
| 390 | 3300025909 | Ga0207705_10131531 | Ga0207705_101315311 | 146 |
| 391 | 3300025909 | Ga0207705_10208598 | Ga0207705_102085981 | 146 |
| 392 | 3300025909 | Ga0207705_10529268 | Ga0207705_105292682 | 146 |
| 393 | 3300025909 | Ga0207705_10535133 | Ga0207705_105351332 | 146 |
| 394 | 3300025911 | Ga0207654_10013252 | Ga0207654_100132522 | 146 |
| 395 | 3300025911 | Ga0207654_10020008 | Ga0207654_100200082 | 146 |
| 396 | 3300025912 | Ga0207707_10015225 | Ga0207707_100152254 | 146 |
| 397 | 3300025912 | Ga0207707_10068256 | Ga0207707_100682562 | 146 |
| 398 | 3300025912 | Ga0207707_10587938 | Ga0207707_105879382 | 146 |
| 399 | 3300025913 | Ga0207695_10012923 | Ga0207695_100129237 | 146 |
| 400 | 3300025913 | Ga0207695_10019220 | Ga0207695_100192202 | 146 |
| 401 | 3300025913 | Ga0207695_10032866 | Ga0207695_100328663 | 146 |
| 402 | 3300025913 | Ga0207695_10124440 | Ga0207695_101244403 | 146 |
| 403 | 3300025913 | Ga0207695_10272782 | Ga0207695_102727822 | 146 |
| 404 | 3300025914 | Ga0207671_10002421 | Ga0207671_100024214 | 146 |
| 405 | 3300025914 | Ga0207671_10027417 | Ga0207671_100274172 | 146 |
| 406 | 3300025914 | Ga0207671_10028986 | Ga0207671_100289865 | 146 |
| 407 | 3300025917 | Ga0207660_10047117 | Ga0207660_100471174 | 146 |
| 408 | 3300025917 | Ga0207660_10608929 | Ga0207660_106089292 | 146 |
| 409 | 3300025918 | Ga0207662_10280200 | Ga0207662_102802002 | 146 |
| 410 | 3300025919 | Ga0207657_10000946 | Ga0207657_1000094614 | 146 |
| 411 | 3300025919 | Ga0207657_10006094 | Ga0207657_100060943 | 146 |
| 412 | 3300025919 | Ga0207657_10006293 | Ga0207657_100062932 | 146 |
| 413 | 3300025919 | Ga0207657_10023777 | Ga0207657_100237776 | 146 |
| 414 | 3300025919 | Ga0207657_10036194 | Ga0207657_100361946 | 146 |
| 415 | 3300025919 | Ga0207657_10043813 | Ga0207657_100438131 | 146 |
| 416 | 3300025919 | Ga0207657_10055514 | Ga0207657_100555142 | 146 |
| 417 | 3300025919 | Ga0207657_10083179 | Ga0207657_100831792 | 146 |
| 418 | 3300025919 | Ga0207657_10195700 | Ga0207657_101957002 | 146 |
| 419 | 3300025919 | Ga0207657_10464525 | Ga0207657_104645251 | 146 |
| 420 | 3300025919 | Ga0207657_10631780 | Ga0207657_106317802 | 146 |
| 421 | 3300025920 | Ga0207649_10000018 | Ga0207649_10000018152 | 146 |
| 422 | 3300025920 | Ga0207649_10009705 | Ga0207649_100097057 | 146 |
| 423 | 3300025920 | Ga0207649_10019643 | Ga0207649_100196434 | 146 |
| 424 | 3300025920 | Ga0207649_10030726 | Ga0207649_100307262 | 146 |
| 425 | 3300025920 | Ga0207649_10053426 | Ga0207649_100534261 | 146 |
| 426 | 3300025920 | Ga0207649_10137790 | Ga0207649_101377901 | 146 |
| 427 | 3300025920 | Ga0207649_10431728 | Ga0207649_104317281 | 146 |
| 428 | 3300025920 | Ga0207649_10667629 | Ga0207649_106676291 | 146 |
| 429 | 3300025920 | Ga0207649_10854057 | Ga0207649_108540571 | 146 |
| 430 | 3300025921 | Ga0207652_11129588 | Ga0207652_111295881 | 146 |
| 431 | 3300025924 | Ga0207694_10002217 | Ga0207694_100022178 | 146 |
| 432 | 3300025924 | Ga0207694_10003033 | Ga0207694_100030338 | 146 |
| 433 | 3300025924 | Ga0207694_10008340 | Ga0207694_100083405 | 146 |
| 434 | 3300025924 | Ga0207694_10030175 | Ga0207694_100301753 | 146 |
| 435 | 3300025924 | Ga0207694_10034936 | Ga0207694_100349364 | 146 |
| 436 | 3300025924 | Ga0207694_10289940 | Ga0207694_102899402 | 146 |
| 437 | 3300025925 | Ga0207650_10011935 | Ga0207650_100119355 | 146 |
| 438 | 3300025925 | Ga0207650_10036094 | Ga0207650_100360944 | 146 |
| 439 | 3300025925 | Ga0207650_10154698 | Ga0207650_101546982 | 146 |
| 440 | 3300025925 | Ga0207650_10220742 | Ga0207650_102207422 | 146 |
| 441 | 3300025925 | Ga0207650_10371331 | Ga0207650_103713312 | 146 |
| 442 | 3300025925 | Ga0207650_10599895 | Ga0207650_105998952 | 146 |
| 443 | 3300025926 | Ga0207659_10033609 | Ga0207659_100336092 | 146 |
| 444 | 3300025926 | Ga0207659_10192355 | Ga0207659_101923552 | 146 |
| 445 | 3300025929 | Ga0207664_10015933 | Ga0207664_100159339 | 146 |
| 446 | 3300025929 | Ga0207664_10162370 | Ga0207664_101623702 | 146 |
| 447 | 3300025931 | Ga0207644_10007787 | Ga0207644_100077874 | 146 |
| 448 | 3300025931 | Ga0207644_10009323 | Ga0207644_100093235 | 146 |
| 449 | 3300025931 | Ga0207644_10480352 | Ga0207644_104803521 | 146 |
| 450 | 3300025932 | Ga0207690_10005486 | Ga0207690_1000548610 | 146 |
| 451 | 3300025932 | Ga0207690_10097074 | Ga0207690_100970742 | 146 |
| 452 | 3300025932 | Ga0207690_10102515 | Ga0207690_101025153 | 146 |
| 453 | 3300025932 | Ga0207690_10227811 | Ga0207690_102278112 | 146 |
| 454 | 3300025932 | Ga0207690_10308614 | Ga0207690_103086142 | 146 |
| 455 | 3300025932 | Ga0207690_10615479 | Ga0207690_106154792 | 146 |
| 456 | 3300025932 | Ga0207690_10977762 | Ga0207690_109777622 | 146 |
| 457 | 3300025933 | Ga0207706_10002629 | Ga0207706_100026298 | 146 |
| 458 | 3300025933 | Ga0207706_10003424 | Ga0207706_1000342410 | 146 |
| 459 | 3300025933 | Ga0207706_10010762 | Ga0207706_100107629 | 146 |
| 460 | 3300025933 | Ga0207706_10025962 | Ga0207706_100259624 | 146 |
| 461 | 3300025933 | Ga0207706_10289439 | Ga0207706_102894392 | 146 |
| 462 | 3300025933 | Ga0207706_10324357 | Ga0207706_103243572 | 146 |
| 463 | 3300025933 | Ga0207706_10487335 | Ga0207706_104873352 | 146 |
| 464 | 3300025933 | Ga0207706_10500534 | Ga0207706_105005342 | 146 |
| 465 | 3300025936 | Ga0207670_10298458 | Ga0207670_102984582 | 146 |
| 466 | 3300025937 | Ga0207669_10246065 | Ga0207669_102460652 | 146 |
| 467 | 3300025940 | Ga0207691_10001147 | Ga0207691_100011475 | 146 |
| 468 | 3300025940 | Ga0207691_10280348 | Ga0207691_102803482 | 146 |
| 469 | 3300025941 | Ga0207711_10017482 | Ga0207711_100174822 | 146 |
| 470 | 3300025941 | Ga0207711_10028757 | Ga0207711_100287572 | 146 |
| 471 | 3300025944 | Ga0207661_10090118 | Ga0207661_100901182 | 146 |
| 472 | 3300025944 | Ga0207661_10198982 | Ga0207661_101989822 | 146 |
| 473 | 3300025945 | Ga0207679_10009073 | Ga0207679_100090735 | 146 |
| 474 | 3300025945 | Ga0207679_10081875 | Ga0207679_100818752 | 146 |
| 475 | 3300025945 | Ga0207679_10083379 | Ga0207679_100833792 | 146 |
| 476 | 3300025945 | Ga0207679_10175885 | Ga0207679_101758853 | 146 |
| 477 | 3300025945 | Ga0207679_10324444 | Ga0207679_103244442 | 146 |
| 478 | 3300025945 | Ga0207679_10735883 | Ga0207679_107358832 | 146 |
| 479 | 3300025949 | Ga0207667_10011976 | Ga0207667_100119765 | 146 |
| 480 | 3300025949 | Ga0207667_10012325 | Ga0207667_100123258 | 146 |
| 481 | 3300025949 | Ga0207667_10019585 | Ga0207667_100195851 | 146 |
| 482 | 3300025949 | Ga0207667_10038532 | Ga0207667_100385328 | 146 |
| 483 | 3300025949 | Ga0207667_10128228 | Ga0207667_101282284 | 146 |
| 484 | 3300025949 | Ga0207667_10395800 | Ga0207667_103958001 | 146 |
| 485 | 3300025949 | Ga0207667_10600544 | Ga0207667_106005442 | 146 |
| 486 | 3300025960 | Ga0207651_10014761 | Ga0207651_100147615 | 146 |
| 487 | 3300025960 | Ga0207651_10042885 | Ga0207651_100428854 | 146 |
| 488 | 3300025960 | Ga0207651_10191294 | Ga0207651_101912943 | 146 |
| 489 | 3300025972 | Ga0207668_10291889 | Ga0207668_102918892 | 146 |
| 490 | 3300025981 | Ga0207640_10045698 | Ga0207640_100456984 | 146 |
| 491 | 3300025981 | Ga0207640_10088868 | Ga0207640_100888684 | 146 |
| 492 | 3300025981 | Ga0207640_10091310 | Ga0207640_100913102 | 146 |
| 493 | 3300025981 | Ga0207640_10162576 | Ga0207640_101625762 | 146 |
| 494 | 3300025981 | Ga0207640_10309509 | Ga0207640_103095092 | 146 |
| 495 | 3300025986 | Ga0207658_10015187 | Ga0207658_100151877 | 146 |
| 496 | 3300025986 | Ga0207658_10281570 | Ga0207658_102815702 | 146 |
| 497 | 3300025986 | Ga0207658_10535266 | Ga0207658_105352662 | 146 |
| 498 | 3300025986 | Ga0207658_11011418 | Ga0207658_110114182 | 146 |
| 499 | 3300026023 | Ga0207677_10179727 | Ga0207677_101797272 | 146 |
| 500 | 3300026023 | Ga0207677_10447021 | Ga0207677_104470212 | 146 |
| 501 | 3300026023 | Ga0207677_10450546 | Ga0207677_104505462 | 146 |
| 502 | 3300026035 | Ga0207703_10320563 | Ga0207703_103205632 | 146 |
| 503 | 3300026041 | Ga0207639_10000199 | Ga0207639_1000019940 | 146 |
| 504 | 3300026041 | Ga0207639_10000798 | Ga0207639_100007981 | 146 |
| 505 | 3300026041 | Ga0207639_10003539 | Ga0207639_100035394 | 146 |
| 506 | 3300026041 | Ga0207639_10042910 | Ga0207639_100429104 | 146 |
| 507 | 3300026041 | Ga0207639_10062330 | Ga0207639_100623302 | 146 |
| 508 | 3300026067 | Ga0207678_10009190 | Ga0207678_100091908 | 146 |
| 509 | 3300026067 | Ga0207678_10014095 | Ga0207678_100140955 | 146 |
| 510 | 3300026067 | Ga0207678_10024372 | Ga0207678_100243724 | 146 |
| 511 | 3300026067 | Ga0207678_10024379 | Ga0207678_100243797 | 146 |
| 512 | 3300026067 | Ga0207678_10025444 | Ga0207678_100254449 | 146 |
| 513 | 3300026067 | Ga0207678_10074648 | Ga0207678_100746482 | 146 |
| 514 | 3300026067 | Ga0207678_11239915 | Ga0207678_112399152 | 146 |
| 515 | 3300026078 | Ga0207702_10007759 | Ga0207702_100077594 | 146 |
| 516 | 3300026078 | Ga0207702_10024793 | Ga0207702_100247932 | 146 |
| 517 | 3300026078 | Ga0207702_10024945 | Ga0207702_100249453 | 146 |
| 518 | 3300026078 | Ga0207702_10025873 | Ga0207702_100258732 | 146 |
| 519 | 3300026078 | Ga0207702_10033994 | Ga0207702_100339943 | 146 |
| 520 | 3300026078 | Ga0207702_10058354 | Ga0207702_100583545 | 146 |
| 521 | 3300026078 | Ga0207702_10898435 | Ga0207702_108984352 | 146 |
| 522 | 3300026088 | Ga0207641_10025359 | Ga0207641_100253592 | 146 |
| 523 | 3300026088 | Ga0207641_10115462 | Ga0207641_101154622 | 146 |
| 524 | 3300026089 | Ga0207648_10259389 | Ga0207648_102593892 | 146 |
| 525 | 3300026095 | Ga0207676_10003563 | Ga0207676_1000356312 | 146 |
| 526 | 3300026095 | Ga0207676_10619733 | Ga0207676_106197332 | 146 |
| 527 | 3300026116 | Ga0207674_10000580 | Ga0207674_1000058027 | 146 |
| 528 | 3300026116 | Ga0207674_10005390 | Ga0207674_100053906 | 146 |
| 529 | 3300026116 | Ga0207674_10011216 | Ga0207674_100112167 | 146 |
| 530 | 3300026116 | Ga0207674_10018837 | Ga0207674_100188376 | 146 |
| 531 | 3300026116 | Ga0207674_10038782 | Ga0207674_100387822 | 146 |
| 532 | 3300026116 | Ga0207674_10062694 | Ga0207674_100626944 | 146 |
| 533 | 3300026116 | Ga0207674_10194816 | Ga0207674_101948162 | 146 |
| 534 | 3300026121 | Ga0207683_10005822 | Ga0207683_1000582210 | 146 |
| 535 | 3300026121 | Ga0207683_10007206 | Ga0207683_100072063 | 146 |
| 536 | 3300026121 | Ga0207683_10196562 | Ga0207683_101965623 | 146 |
| 537 | 3300026142 | Ga0207698_10000388 | Ga0207698_1000038810 | 146 |
| 538 | 3300026142 | Ga0207698_10000449 | Ga0207698_1000044924 | 146 |
| 539 | 3300026142 | Ga0207698_10000703 | Ga0207698_1000070319 | 146 |
| 540 | 3300026142 | Ga0207698_10029780 | Ga0207698_100297805 | 146 |
| 541 | 3300026142 | Ga0207698_10091007 | Ga0207698_100910072 | 146 |
| 542 | 3300026142 | Ga0207698_10097135 | Ga0207698_100971353 | 146 |
| 543 | 3300026142 | Ga0207698_10119516 | Ga0207698_101195162 | 146 |
| 544 | 3300026142 | Ga0207698_10328013 | Ga0207698_103280132 | 146 |
| 545 | 3300026142 | Ga0207698_10456781 | Ga0207698_104567811 | 146 |
| 546 | 3300028379 | Ga0268266_10016834 | Ga0268266_100168345 | 146 |
| 547 | 3300028379 | Ga0268266_10138249 | Ga0268266_101382492 | 146 |
| 548 | 3300028379 | Ga0268266_10283725 | Ga0268266_102837252 | 146 |
| 549 | 3300028380 | Ga0268265_10102231 | Ga0268265_101022311 | 146 |
| 550 | 3300028381 | Ga0268264_10091232 | Ga0268264_100912323 | 146 |
| 551 | 3300028381 | Ga0268264_10362729 | Ga0268264_103627292 | 146 |
| 552 | 3300031239 | Ga0265328_10053498 | Ga0265328_100534982 | 146 |
| 553 | 3300031548 | Ga0307408_100011699 | Ga0307408_1000116992 | 146 |
| 554 | 3300031548 | Ga0307408_100012386 | Ga0307408_1000123862 | 146 |
| 555 | 3300031548 | Ga0307408_100073431 | Ga0307408_1000734312 | 146 |
| 556 | 3300031548 | Ga0307408_100130409 | Ga0307408_1001304092 | 146 |
| 557 | 3300031691 | Ga0316579_10031452 | Ga0316579_100314522 | 146 |
| 558 | 3300031731 | Ga0307405_10025543 | Ga0307405_100255434 | 146 |
| 559 | 3300031731 | Ga0307405_10117036 | Ga0307405_101170362 | 146 |
| 560 | 3300031731 | Ga0307405_10337372 | Ga0307405_103373722 | 146 |
| 561 | 3300031731 | Ga0307405_11079815 | Ga0307405_110798151 | 146 |
| 562 | 3300031824 | Ga0307413_10034421 | Ga0307413_100344212 | 146 |
| 563 | 3300031824 | Ga0307413_10715152 | Ga0307413_107151522 | 146 |
| 564 | 3300031824 | Ga0307413_10845977 | Ga0307413_108459772 | 146 |
| 565 | 3300031852 | Ga0307410_10005366 | Ga0307410_100053664 | 146 |
| 566 | 3300031852 | Ga0307410_10313018 | Ga0307410_103130182 | 146 |
| 567 | 3300031901 | Ga0307406_10012211 | Ga0307406_100122113 | 146 |
| 568 | 3300031901 | Ga0307406_10573673 | Ga0307406_105736732 | 146 |
| 569 | 3300031901 | Ga0307406_11706707 | Ga0307406_117067071 | 146 |
| 570 | 3300031903 | Ga0307407_10038169 | Ga0307407_100381693 | 146 |
| 571 | 3300031911 | Ga0307412_10070875 | Ga0307412_100708752 | 146 |
| 572 | 3300031995 | Ga0307409_100075243 | Ga0307409_1000752432 | 146 |
| 573 | 3300031995 | Ga0307409_100158881 | Ga0307409_1001588812 | 146 |
| 574 | 3300031995 | Ga0307409_100343378 | Ga0307409_1003433782 | 146 |
| 575 | 3300032002 | Ga0307416_100081790 | Ga0307416_1000817902 | 146 |
| 576 | 3300032002 | Ga0307416_100165055 | Ga0307416_1001650552 | 146 |
| 577 | 3300032004 | Ga0307414_10138487 | Ga0307414_101384872 | 146 |
| 578 | 3300032004 | Ga0307414_10231500 | Ga0307414_102315002 | 146 |
| 579 | 3300032004 | Ga0307414_11569106 | Ga0307414_115691061 | 146 |
| 580 | 3300032005 | Ga0307411_10336648 | Ga0307411_103366482 | 146 |
| 581 | 3300032005 | Ga0307411_10520594 | Ga0307411_105205941 | 146 |
| 582 | 3300032005 | Ga0307411_10826972 | Ga0307411_108269722 | 146 |
| 583 | 3300032126 | Ga0307415_100027644 | Ga0307415_1000276443 | 146 |
| 584 | 3300032126 | Ga0307415_100144897 | Ga0307415_1001448973 | 146 |
| 585 | 3300032126 | Ga0307415_100742262 | Ga0307415_1007422622 | 146 |
| 586 | 3300032126 | Ga0307415_100766050 | Ga0307415_1007660502 | 146 |
| 587 | 3300035113 | Ga0373936_0187459 | Ga0373936_0187459_413_880 | 146 |
| 588 | 3300035170 | Ga0373943_0013861 | Ga0373943_0013861_1095_1562 | 146 |
| 589 | 3300035170 | Ga0373943_0392543 | Ga0373943_0392543_127_594 | 146 |
| 590 | 3300035695 | Ga0373927_0255173 | Ga0373927_0255173_278_745 | 146 |
| 591 | 3300036401 | Ga0373937_0598278 | Ga0373937_0598278_223_690 | 146 |
| 592 | 3300036401 | Ga0373937_1027458 | Ga0373937_1027458_255_725 | 146 |
| 593 | 3300036647 | Ga0316582_0002330 | Ga0316582_0002330_2308_2775 | 146 |
| 594 | 3300037068 | Ga0373925_0016074 | Ga0373925_0016074_1096_1563 | 146 |
| 595 | 3300037068 | Ga0373925_1022935 | Ga0373925_1022935_84_551 | 146 |
| 596 | 3300037312 | Ga0395899_0020496 | Ga0395899_0020496_3479_3925 | 146 |
| 597 | 3300037312 | Ga0395899_0026549 | Ga0395899_0026549_546_1010 | 146 |
| 598 | 3300037312 | Ga0395899_0054171 | Ga0395899_0054171_1859_2323 | 146 |
| 599 | 3300037312 | Ga0395899_0086819 | Ga0395899_0086819_1790_2257 | 146 |
| 600 | 3300037312 | Ga0395899_0157483 | Ga0395899_0157483_735_1202 | 146 |
| 601 | 3300037312 | Ga0395899_0250124 | Ga0395899_0250124_300_764 | 146 |
| 602 | 3300037312 | Ga0395899_0314434 | Ga0395899_0314434_420_866 | 146 |
| 603 | 3300037312 | Ga0395899_0324449 | Ga0395899_0324449_192_659 | 146 |
| 604 | 3300037418 | Ga0395900_0020351 | Ga0395900_0020351_1180_1647 | 146 |
| 605 | 3300037418 | Ga0395900_0021453 | Ga0395900_0021453_1931_2377 | 146 |
| 606 | 3300037418 | Ga0395900_0031110 | Ga0395900_0031110_2989_3456 | 146 |
| 607 | 3300037418 | Ga0395900_0046969 | Ga0395900_0046969_2777_3244 | 146 |
| 608 | 3300037418 | Ga0395900_0074177 | Ga0395900_0074177_2658_3104 | 146 |
| 609 | 3300037418 | Ga0395900_0091530 | Ga0395900_0091530_2474_2938 | 146 |
| 610 | 3300037418 | Ga0395900_0098104 | Ga0395900_0098104_1434_1901 | 146 |
| 611 | 3300037418 | Ga0395900_0162102 | Ga0395900_0162102_500_964 | 146 |
| 612 | 3300037418 | Ga0395900_0197842 | Ga0395900_0197842_1123_1590 | 146 |
| 613 | 3300037418 | Ga0395900_0734539 | Ga0395900_0734539_113_580 | 146 |
| 614 | 3300037418 | Ga0395900_0999385 | Ga0395900_0999385_24_488 | 146 |
| 615 | 3300037466 | Ga0395898_0003799 | Ga0395898_0003799_12042_12488 | 146 |
| 616 | 3300037466 | Ga0395898_0023568 | Ga0395898_0023568_4133_4579 | 146 |
| 617 | 3300037466 | Ga0395898_0032370 | Ga0395898_0032370_2742_3209 | 146 |
| 618 | 3300037466 | Ga0395898_0068940 | Ga0395898_0068940_482_949 | 146 |
| 619 | 3300037466 | Ga0395898_0184156 | Ga0395898_0184156_152_616 | 146 |
| 620 | 3300037466 | Ga0395898_0304766 | Ga0395898_0304766_86_532 | 146 |
| 621 | 3300037466 | Ga0395898_0788184 | Ga0395898_0788184_407_874 | 146 |
| 622 | 3300037471 | Ga0395905_0009030 | Ga0395905_0009030_1376_1843 | 146 |
| 623 | 3300037471 | Ga0395905_0012524 | Ga0395905_0012524_5857_6318 | 146 |
| 624 | 3300037471 | Ga0395905_0029223 | Ga0395905_0029223_65_529 | 146 |
| 625 | 3300037471 | Ga0395905_0029724 | Ga0395905_0029724_3198_3665 | 146 |
| 626 | 3300037471 | Ga0395905_0036985 | Ga0395905_0036985_15_485 | 146 |
| 627 | 3300037471 | Ga0395905_0076008 | Ga0395905_0076008_1020_1487 | 146 |
| 628 | 3300037471 | Ga0395905_0159977 | Ga0395905_0159977_1394_1858 | 146 |
| 629 | 3300037471 | Ga0395905_0170844 | Ga0395905_0170844_259_726 | 146 |
| 630 | 3300037471 | Ga0395905_0300859 | Ga0395905_0300859_620_1087 | 146 |
| 631 | 3300037471 | Ga0395905_0443257 | Ga0395905_0443257_527_991 | 146 |
| 632 | 3300037471 | Ga0395905_0527336 | Ga0395905_0527336_15_479 | 146 |
| 633 | 3300037471 | Ga0395905_0670129 | Ga0395905_0670129_334_798 | 146 |
| 634 | 3300037471 | Ga0395905_0876680 | Ga0395905_0876680_292_738 | 146 |
| 635 | 3300037471 | Ga0395905_1061240 | Ga0395905_1061240_91_558 | 146 |
| 636 | 3300037853 | Ga0436364_0996148 | Ga0436364_0996148_10978_11436 | 146 |
| 637 | 3300038443 | Ga0395901_0022979 | Ga0395901_0022979_1715_2161 | 146 |
| 638 | 3300038443 | Ga0395901_0072007 | Ga0395901_0072007_1992_2459 | 146 |
| 639 | 3300038443 | Ga0395901_0108065 | Ga0395901_0108065_676_1143 | 146 |
| 640 | 3300038443 | Ga0395901_0243027 | Ga0395901_0243027_1085_1531 | 146 |
| 641 | 3300038443 | Ga0395901_0423619 | Ga0395901_0423619_405_872 | 146 |
| 642 | 3300038443 | Ga0395901_0530851 | Ga0395901_0530851_172_618 | 146 |
| 643 | 3300038443 | Ga0395901_0640889 | Ga0395901_0640889_119_586 | 146 |
| 644 | 3300038443 | Ga0395901_0770463 | Ga0395901_0770463_395_841 | 146 |
| 645 | 3300039437 | Ga0436365_0183072 | Ga0436365_0183072_13815_14279 | 146 |
| 646 | 3300039450 | Ga0436363_1686935 | Ga0436363_1686935_266_730 | 146 |
| 647 | 3300039453 | Ga0436362_0383697 | Ga0436362_0383697_70588_71058 | 146 |
| 648 | 3300041494 | Ga0451837_1281924 | Ga0451837_1281924_157_618 | 146 |
| 649 | 3300042439 | Ga0439464_0154557 | Ga0439464_0154557_68_535 | 146 |
| 650 | 3300044656 | Ga0466969_0110114 | Ga0466969_0110114_670_1116 | 146 |
| 651 | 3300044683 | Ga0466965_0209903 | Ga0466965_0209903_117_617 | 146 |
| 652 | 3300044683 | Ga0466965_0387783 | Ga0466965_0387783_217_678 | 146 |
| 653 | 3300044684 | Ga0466966_0094752 | Ga0466966_0094752_969_1433 | 146 |
| 654 | 3300044684 | Ga0466966_0631426 | Ga0466966_0631426_153_614 | 146 |
| 655 | 3300044693 | Ga0466961_0009863 | Ga0466961_0009863_2739_3200 | 146 |
| 656 | 3300044693 | Ga0466961_0238205 | Ga0466961_0238205_19_483 | 146 |
| 657 | 3300044694 | Ga0466963_0000335 | Ga0466963_0000335_9166_9612 | 146 |
| 658 | 3300044694 | Ga0466963_0333256 | Ga0466963_0333256_219_665 | 146 |
| 659 | 3300044765 | Ga0466970_0037549 | Ga0466970_0037549_607_1068 | 146 |
| 660 | 3300044901 | Ga0466960_0011969 | Ga0466960_0011969_641_1141 | 146 |
| 661 | 3300045049 | Ga0466959_0012236 | Ga0466959_0012236_1304_1768 | 146 |
| 662 | 3300045049 | Ga0466959_0049179 | Ga0466959_0049179_1107_1568 | 146 |
| 663 | 3300045049 | Ga0466959_0158752 | Ga0466959_0158752_584_1030 | 146 |
| 664 | 3300045836 | Ga0466958_0183574 | Ga0466958_0183574_132_596 | 146 |
| 665 | 3300045836 | Ga0466958_0244048 | Ga0466958_0244048_384_845 | 146 |
| 666 | 3300045976 | Ga0466967_0020512 | Ga0466967_0020512_4728_5174 | 146 |
| 667 | 3300045976 | Ga0466967_0259495 | Ga0466967_0259495_281_748 | 146 |
| 668 | 3300045976 | Ga0466967_0489618 | Ga0466967_0489618_284_748 | 146 |
| 669 | 3300045976 | Ga0466967_1398101 | Ga0466967_1398101_133_597 | 146 |
| 670 | 3300046472 | Ga0495580_0631443 | Ga0495580_0631443_114_578 | 146 |
| 671 | 3300046523 | Ga0495644_0240472 | Ga0495644_0240472_98_565 | 146 |
| 672 | 3300046539 | Ga0495621_0000149 | Ga0495621_0000149_6371_6838 | 146 |
| 673 | 3300046539 | Ga0495621_0099692 | Ga0495621_0099692_74_541 | 146 |
| 674 | 3300046684 | Ga0495669_0031735 | Ga0495669_0031735_653_1120 | 146 |
| 675 | 3300046684 | Ga0495669_0280856 | Ga0495669_0280856_30_497 | 146 |
| 676 | 3300046691 | Ga0495670_0004834 | Ga0495670_0004834_3295_3762 | 146 |
| 677 | 3300048904 | Ga0496101_0067569 | Ga0496101_0067569_844_1311 | 146 |
| 678 | 3300048904 | Ga0496101_0556563 | Ga0496101_0556563_255_722 | 146 |
| 679 | 3300048905 | Ga0496102_0036646 | Ga0496102_0036646_928_1401 | 146 |
| 680 | 3300048905 | Ga0496102_0105107 | Ga0496102_0105107_875_1342 | 146 |
| 681 | 3300048905 | Ga0496102_0767589 | Ga0496102_0767589_97_564 | 146 |
| 682 | 3300048906 | Ga0496103_0007651 | Ga0496103_0007651_2143_2616 | 146 |
| 683 | 3300048907 | Ga0496104_0719517 | Ga0496104_0719517_407_874 | 146 |
| 684 | 3300048907 | Ga0496104_0740400 | Ga0496104_0740400_75_542 | 146 |
| 685 | 3300048908 | Ga0496105_0155111 | Ga0496105_0155111_1056_1523 | 146 |
| 686 | 3300048908 | Ga0496105_0292473 | Ga0496105_0292473_549_1016 | 146 |
| 687 | 3300048910 | Ga0496107_0132761 | Ga0496107_0132761_1327_1794 | 146 |
| 688 | 3300048910 | Ga0496107_0825241 | Ga0496107_0825241_109_576 | 146 |
| 689 | 3300048911 | Ga0496108_0001925 | Ga0496108_0001925_2007_2474 | 146 |
| 690 | 3300048911 | Ga0496108_0180117 | Ga0496108_0180117_944_1390 | 146 |
| 691 | 3300048912 | Ga0496109_0015923 | Ga0496109_0015923_2549_3016 | 146 |
| 692 | 3300048912 | Ga0496109_0321539 | Ga0496109_0321539_478_924 | 146 |
| 693 | 3300048913 | Ga0496110_0021431 | Ga0496110_0021431_1556_2023 | 146 |
| 694 | 3300048914 | Ga0496111_0007998 | Ga0496111_0007998_3745_4212 | 146 |
| 695 | 3300048914 | Ga0496111_0064928 | Ga0496111_0064928_1210_1677 | 146 |
| 696 | 3300048915 | Ga0496112_0002858 | Ga0496112_0002858_2667_3134 | 146 |
| 697 | 3300048915 | Ga0496112_0019601 | Ga0496112_0019601_3000_3467 | 146 |
| 698 | 3300048915 | Ga0496112_0151041 | Ga0496112_0151041_497_964 | 146 |
| 699 | 3300048915 | Ga0496112_0293726 | Ga0496112_0293726_444_911 | 146 |
| 700 | 3300048915 | Ga0496112_0690172 | Ga0496112_0690172_286_750 | 146 |
| 701 | 3300048916 | Ga0496113_0016617 | Ga0496113_0016617_4158_4625 | 146 |
| 702 | 3300048916 | Ga0496113_0022168 | Ga0496113_0022168_1990_2457 | 146 |
| 703 | 3300048917 | Ga0496114_1215607 | Ga0496114_1215607_45_512 | 146 |
| 704 | 3300048920 | Ga0496117_0007348 | Ga0496117_0007348_1400_1873 | 146 |
| 705 | 3300048921 | Ga0496118_0137078 | Ga0496118_0137078_105_578 | 146 |
| 706 | 3300048929 | Ga0496126_0249921 | Ga0496126_0249921_461_922 | 146 |
| 707 | 3300049656 | Ga0501209_016085 | Ga0501209_016085_817_1263 | 146 |
| 708 | 3300049656 | Ga0501209_211395 | Ga0501209_211395_101_547 | 146 |
| 709 | 3300049661 | Ga0501217_138341 | Ga0501217_138341_54_500 | 146 |
| 710 | 3300049664 | Ga0501224_004198 | Ga0501224_004198_958_1404 | 146 |
| 711 | 3300049664 | Ga0501224_016950 | Ga0501224_016950_404_865 | 146 |
| 712 | 3300049665 | Ga0501227_052572 | Ga0501227_052572_191_637 | 146 |
| 713 | 3300049665 | Ga0501227_240487 | Ga0501227_240487_53_499 | 146 |
| 714 | 3300049668 | Ga0501233_028065 | Ga0501233_028065_381_827 | 146 |
| 715 | 3300049668 | Ga0501233_139981 | Ga0501233_139981_53_499 | 146 |
| 716 | 3300049669 | Ga0501235_007990 | Ga0501235_007990_1470_1916 | 146 |
| 717 | 3300049679 | Ga0501249_070337 | Ga0501249_070337_226_672 | 146 |
| 718 | 3300049686 | Ga0501257_024804 | Ga0501257_024804_564_1010 | 146 |
| 719 | 3300049686 | Ga0501257_120176 | Ga0501257_120176_246_692 | 146 |
| 720 | 3300049705 | Ga0501225_0023711 | Ga0501225_0023711_1013_1459 | 146 |
| 721 | 3300049706 | Ga0501229_049571 | Ga0501229_049571_150_596 | 146 |
| 722 | 3300049707 | Ga0501234_003083 | Ga0501234_003083_1176_1622 | 146 |
| 723 | 3300049759 | Ga0501262_004084 | Ga0501262_004084_243_689 | 146 |
| 724 | 3300049760 | Ga0501263_028977 | Ga0501263_028977_264_710 | 146 |
| 725 | 3300049764 | Ga0501267_013378 | Ga0501267_013378_352_798 | 146 |
| 726 | 3300049769 | Ga0501272_024815 | Ga0501272_024815_172_618 | 146 |
| 727 | 3300049775 | Ga0501279_073034 | Ga0501279_073034_54_500 | 146 |
| 728 | 3300049823 | Ga0501044_1125944 | Ga0501044_1125944_138_584 | 146 |
| 729 | 3300050493 | nmdc:mga0k408_302908_c1 | nmdc:mga0k408_302908_c1_141_623 | 146 |
| 730 | 3300050496 | nmdc:mga07m45_1034_c1 | nmdc:mga07m45_1034_c1_405_887 | 146 |
| 731 | 3300050496 | nmdc:mga07m45_176878_c1 | nmdc:mga07m45_176878_c1_497_958 | 146 |
| 732 | 3300050496 | nmdc:mga07m45_51034_c1 | nmdc:mga07m45_51034_c1_582_1049 | 146 |
| 733 | 3300050513 | nmdc:mga0rr50_414273_c1 | nmdc:mga0rr50_414273_c1_166_633 | 146 |
| 734 | 3300050516 | nmdc:mga0sz30_20166_c1 | nmdc:mga0sz30_20166_c1_1838_2302 | 146 |
| 735 | 3300053146 | Ga0500588_0163466 | Ga0500588_0163466_194_655 | 146 |
| 736 | 2162886012 | MBSR1b_contig_4721503 | MBSR1b_0235.00004320 | 147 |
| 737 | 3300003203 | JGI25406J46586_10132469 | JGI25406J46586_101324691 | 147 |
| 738 | 3300003215 | JGI25153J46596_10001155 | JGI25153J46596_100011557 | 147 |
| 739 | 3300003784 | Ga0055534_1005827 | Ga0055534_10058273 | 147 |
| 740 | 3300003791 | Ga0055530_10000197 | Ga0055530_100001977 | 147 |
| 741 | 3300003794 | Ga0055531_10008524 | Ga0055531_100085244 | 147 |
| 742 | 3300005327 | Ga0070658_10003377 | Ga0070658_100033774 | 147 |
| 743 | 3300005327 | Ga0070658_10347241 | Ga0070658_103472412 | 147 |
| 744 | 3300005329 | Ga0070683_100071884 | Ga0070683_1000718844 | 147 |
| 745 | 3300005330 | Ga0070690_100591973 | Ga0070690_1005919731 | 147 |
| 746 | 3300005336 | Ga0070680_100758450 | Ga0070680_1007584501 | 147 |
| 747 | 3300005337 | Ga0070682_100141471 | Ga0070682_1001414711 | 147 |
| 748 | 3300005339 | Ga0070660_100001476 | Ga0070660_10000147614 | 147 |
| 749 | 3300005339 | Ga0070660_100746407 | Ga0070660_1007464071 | 147 |
| 750 | 3300005340 | Ga0070689_101334296 | Ga0070689_1013342962 | 147 |
| 751 | 3300005341 | Ga0070691_10071076 | Ga0070691_100710762 | 147 |
| 752 | 3300005344 | Ga0070661_100014609 | Ga0070661_1000146097 | 147 |
| 753 | 3300005345 | Ga0070692_10100480 | Ga0070692_101004802 | 147 |
| 754 | 3300005366 | Ga0070659_100002899 | Ga0070659_1000028996 | 147 |
| 755 | 3300005366 | Ga0070659_100141380 | Ga0070659_1001413802 | 147 |
| 756 | 3300005366 | Ga0070659_100527319 | Ga0070659_1005273191 | 147 |
| 757 | 3300005444 | Ga0070694_100024929 | Ga0070694_1000249292 | 147 |
| 758 | 3300005455 | Ga0070663_100028995 | Ga0070663_1000289953 | 147 |
| 759 | 3300005455 | Ga0070663_101203871 | Ga0070663_1012038712 | 147 |
| 760 | 3300005457 | Ga0070662_100000183 | Ga0070662_10000018320 | 147 |
| 761 | 3300005457 | Ga0070662_100077429 | Ga0070662_1000774293 | 147 |
| 762 | 3300005457 | Ga0070662_100733772 | Ga0070662_1007337722 | 147 |
| 763 | 3300005458 | Ga0070681_10004781 | Ga0070681_100047813 | 147 |
| 764 | 3300005458 | Ga0070681_10120408 | Ga0070681_101204082 | 147 |
| 765 | 3300005467 | Ga0070706_101056268 | Ga0070706_1010562681 | 147 |
| 766 | 3300005518 | Ga0070699_100994270 | Ga0070699_1009942701 | 147 |
| 767 | 3300005530 | Ga0070679_100001448 | Ga0070679_10000144813 | 147 |
| 768 | 3300005530 | Ga0070679_100372176 | Ga0070679_1003721762 | 147 |
| 769 | 3300005530 | Ga0070679_102005223 | Ga0070679_1020052231 | 147 |
| 770 | 3300005535 | Ga0070684_100202819 | Ga0070684_1002028192 | 147 |
| 771 | 3300005539 | Ga0068853_100002487 | Ga0068853_1000024874 | 147 |
| 772 | 3300005539 | Ga0068853_100120161 | Ga0068853_1001201612 | 147 |
| 773 | 3300005544 | Ga0070686_100377842 | Ga0070686_1003778422 | 147 |
| 774 | 3300005545 | Ga0070695_100008415 | Ga0070695_1000084158 | 147 |
| 775 | 3300005546 | Ga0070696_100077670 | Ga0070696_1000776702 | 147 |
| 776 | 3300005547 | Ga0070693_100439818 | Ga0070693_1004398182 | 147 |
| 777 | 3300005547 | Ga0070693_100739418 | Ga0070693_1007394181 | 147 |
| 778 | 3300005549 | Ga0070704_100521830 | Ga0070704_1005218302 | 147 |
| 779 | 3300005563 | Ga0068855_100004493 | Ga0068855_10000449315 | 147 |
| 780 | 3300005563 | Ga0068855_100111889 | Ga0068855_1001118892 | 147 |
| 781 | 3300005563 | Ga0068855_100387828 | Ga0068855_1003878282 | 147 |
| 782 | 3300005564 | Ga0070664_100002251 | Ga0070664_10000225111 | 147 |
| 783 | 3300005564 | Ga0070664_100070632 | Ga0070664_1000706323 | 147 |
| 784 | 3300005577 | Ga0068857_100012687 | Ga0068857_10001268710 | 147 |
| 785 | 3300005577 | Ga0068857_100208205 | Ga0068857_1002082053 | 147 |
| 786 | 3300005578 | Ga0068854_100006566 | Ga0068854_1000065668 | 147 |
| 787 | 3300005614 | Ga0068856_100025094 | Ga0068856_1000250943 | 147 |
| 788 | 3300005614 | Ga0068856_100282694 | Ga0068856_1002826944 | 147 |
| 789 | 3300005615 | Ga0070702_101221436 | Ga0070702_1012214361 | 147 |
| 790 | 3300005616 | Ga0068852_100371488 | Ga0068852_1003714882 | 147 |
| 791 | 3300005617 | Ga0068859_100664366 | Ga0068859_1006643661 | 147 |
| 792 | 3300005981 | Ga0081538_10002850 | Ga0081538_100028505 | 147 |
| 793 | 3300006038 | Ga0075365_10360716 | Ga0075365_103607162 | 147 |
| 794 | 3300006038 | Ga0075365_10698794 | Ga0075365_106987942 | 147 |
| 795 | 3300006042 | Ga0075368_10055219 | Ga0075368_100552192 | 147 |
| 796 | 3300006048 | Ga0075363_100043168 | Ga0075363_1000431682 | 147 |
| 797 | 3300006048 | Ga0075363_100090176 | Ga0075363_1000901762 | 147 |
| 798 | 3300006048 | Ga0075363_100293064 | Ga0075363_1002930641 | 147 |
| 799 | 3300006051 | Ga0075364_10264046 | Ga0075364_102640462 | 147 |
| 800 | 3300006177 | Ga0075362_10179504 | Ga0075362_101795042 | 147 |
| 801 | 3300006177 | Ga0075362_10262266 | Ga0075362_102622661 | 147 |
| 802 | 3300006177 | Ga0075362_10483872 | Ga0075362_104838722 | 147 |
| 803 | 3300006178 | Ga0075367_10133599 | Ga0075367_101335992 | 147 |
| 804 | 3300006178 | Ga0075367_10167143 | Ga0075367_101671432 | 147 |
| 805 | 3300006178 | Ga0075367_10221779 | Ga0075367_102217792 | 147 |
| 806 | 3300006186 | Ga0075369_10025662 | Ga0075369_100256622 | 147 |
| 807 | 3300006195 | Ga0075366_10020324 | Ga0075366_100203242 | 147 |
| 808 | 3300006195 | Ga0075366_10506399 | Ga0075366_105063991 | 147 |
| 809 | 3300006195 | Ga0075366_10531274 | Ga0075366_105312742 | 147 |
| 810 | 3300006237 | Ga0097621_100528173 | Ga0097621_1005281732 | 147 |
| 811 | 3300006353 | Ga0075370_10070416 | Ga0075370_100704162 | 147 |
| 812 | 3300006846 | Ga0075430_100231300 | Ga0075430_1002313002 | 147 |
| 813 | 3300006847 | Ga0075431_100175944 | Ga0075431_1001759442 | 147 |
| 814 | 3300006852 | Ga0075433_10412856 | Ga0075433_104128562 | 147 |
| 815 | 3300006881 | Ga0068865_100758238 | Ga0068865_1007582382 | 147 |
| 816 | 3300006931 | Ga0097620_100664429 | Ga0097620_1006644291 | 147 |
| 817 | 3300009094 | Ga0111539_10180978 | Ga0111539_101809782 | 147 |
| 818 | 3300009147 | Ga0114129_10380719 | Ga0114129_103807192 | 147 |
| 819 | 3300009553 | Ga0105249_11441446 | Ga0105249_114414462 | 147 |
| 820 | 3300010159 | Ga0099796_10283404 | Ga0099796_102834042 | 147 |
| 821 | 3300011119 | Ga0105246_10000234 | Ga0105246_100002344 | 147 |
| 822 | 3300013100 | Ga0157373_10019882 | Ga0157373_100198823 | 147 |
| 823 | 3300013102 | Ga0157371_10001424 | Ga0157371_1000142423 | 147 |
| 824 | 3300013102 | Ga0157371_10028143 | Ga0157371_100281433 | 147 |
| 825 | 3300013102 | Ga0157371_10187667 | Ga0157371_101876672 | 147 |
| 826 | 3300013102 | Ga0157371_10365775 | Ga0157371_103657752 | 147 |
| 827 | 3300013102 | Ga0157371_10850596 | Ga0157371_108505962 | 147 |
| 828 | 3300013104 | Ga0157370_10016740 | Ga0157370_100167402 | 147 |
| 829 | 3300013105 | Ga0157369_10005291 | Ga0157369_100052916 | 147 |
| 830 | 3300013297 | Ga0157378_10890919 | Ga0157378_108909192 | 147 |
| 831 | 3300013306 | Ga0163162_11678379 | Ga0163162_116783791 | 147 |
| 832 | 3300013307 | Ga0157372_10026427 | Ga0157372_100264275 | 147 |
| 833 | 3300013308 | Ga0157375_11392803 | Ga0157375_113928032 | 147 |
| 834 | 3300014325 | Ga0163163_12094545 | Ga0163163_120945452 | 147 |
| 835 | 3300014326 | Ga0157380_11061162 | Ga0157380_110611622 | 147 |
| 836 | 3300014497 | Ga0182008_10040430 | Ga0182008_100404302 | 147 |
| 837 | 3300014969 | Ga0157376_11916234 | Ga0157376_119162342 | 147 |
| 838 | 3300015261 | Ga0182006_1056708 | Ga0182006_10567082 | 147 |
| 839 | 3300017792 | Ga0163161_10405737 | Ga0163161_104057372 | 147 |
| 840 | 3300025291 | Ga0209675_1000162 | Ga0209675_100016250 | 147 |
| 841 | 3300025292 | Ga0209676_1000113 | Ga0209676_1000113119 | 147 |
| 842 | 3300025292 | Ga0209676_1000146 | Ga0209676_1000146120 | 147 |
| 843 | 3300025292 | Ga0209676_1002307 | Ga0209676_100230710 | 147 |
| 844 | 3300025294 | Ga0209025_1035622 | Ga0209025_10356222 | 147 |
| 845 | 3300025297 | Ga0209758_1063445 | Ga0209758_10634452 | 147 |
| 846 | 3300025298 | Ga0209050_1000126 | Ga0209050_1000126119 | 147 |
| 847 | 3300025298 | Ga0209050_1013537 | Ga0209050_10135372 | 147 |
| 848 | 3300025304 | Ga0209257_1000256 | Ga0209257_1000256113 | 147 |
| 849 | 3300025304 | Ga0209257_1002727 | Ga0209257_100272716 | 147 |
| 850 | 3300025909 | Ga0207705_10034493 | Ga0207705_100344934 | 147 |
| 851 | 3300025909 | Ga0207705_10185131 | Ga0207705_101851312 | 147 |
| 852 | 3300025910 | Ga0207684_10854359 | Ga0207684_108543592 | 147 |
| 853 | 3300025912 | Ga0207707_10013904 | Ga0207707_100139045 | 147 |
| 854 | 3300025912 | Ga0207707_10510449 | Ga0207707_105104492 | 147 |
| 855 | 3300025912 | Ga0207707_10670306 | Ga0207707_106703062 | 147 |
| 856 | 3300025913 | Ga0207695_11444970 | Ga0207695_114449701 | 147 |
| 857 | 3300025917 | Ga0207660_10287468 | Ga0207660_102874682 | 147 |
| 858 | 3300025917 | Ga0207660_10881821 | Ga0207660_108818211 | 147 |
| 859 | 3300025919 | Ga0207657_10000123 | Ga0207657_1000012332 | 147 |
| 860 | 3300025919 | Ga0207657_10401043 | Ga0207657_104010432 | 147 |
| 861 | 3300025920 | Ga0207649_10020903 | Ga0207649_100209032 | 147 |
| 862 | 3300025921 | Ga0207652_10060515 | Ga0207652_100605155 | 147 |
| 863 | 3300025921 | Ga0207652_10291484 | Ga0207652_102914842 | 147 |
| 864 | 3300025921 | Ga0207652_10415114 | Ga0207652_104151142 | 147 |
| 865 | 3300025929 | Ga0207664_10449906 | Ga0207664_104499062 | 147 |
| 866 | 3300025932 | Ga0207690_10035197 | Ga0207690_100351972 | 147 |
| 867 | 3300025932 | Ga0207690_10418816 | Ga0207690_104188161 | 147 |
| 868 | 3300025932 | Ga0207690_10826067 | Ga0207690_108260672 | 147 |
| 869 | 3300025933 | Ga0207706_10000193 | Ga0207706_1000019352 | 147 |
| 870 | 3300025933 | Ga0207706_10065052 | Ga0207706_100650524 | 147 |
| 871 | 3300025933 | Ga0207706_10089071 | Ga0207706_100890711 | 147 |
| 872 | 3300025933 | Ga0207706_11235848 | Ga0207706_112358482 | 147 |
| 873 | 3300025936 | Ga0207670_10718708 | Ga0207670_107187082 | 147 |
| 874 | 3300025938 | Ga0207704_10294652 | Ga0207704_102946522 | 147 |
| 875 | 3300025941 | Ga0207711_10959149 | Ga0207711_109591492 | 147 |
| 876 | 3300025944 | Ga0207661_12121440 | Ga0207661_121214401 | 147 |
| 877 | 3300025945 | Ga0207679_10089444 | Ga0207679_100894443 | 147 |
| 878 | 3300025949 | Ga0207667_10002490 | Ga0207667_1000249010 | 147 |
| 879 | 3300025949 | Ga0207667_10021844 | Ga0207667_100218444 | 147 |
| 880 | 3300025949 | Ga0207667_10247312 | Ga0207667_102473122 | 147 |
| 881 | 3300025949 | Ga0207667_10248859 | Ga0207667_102488592 | 147 |
| 882 | 3300025961 | Ga0207712_11022224 | Ga0207712_110222241 | 147 |
| 883 | 3300025972 | Ga0207668_11569134 | Ga0207668_115691341 | 147 |
| 884 | 3300026041 | Ga0207639_10023368 | Ga0207639_100233685 | 147 |
| 885 | 3300026041 | Ga0207639_10257821 | Ga0207639_102578212 | 147 |
| 886 | 3300026067 | Ga0207678_10017196 | Ga0207678_100171967 | 147 |
| 887 | 3300026067 | Ga0207678_10507140 | Ga0207678_105071402 | 147 |
| 888 | 3300026078 | Ga0207702_10072618 | Ga0207702_100726183 | 147 |
| 889 | 3300026116 | Ga0207674_10123899 | Ga0207674_101238992 | 147 |
| 890 | 3300027617 | Ga0210002_1014486 | Ga0210002_10144862 | 147 |
| 891 | 3300027866 | Ga0209813_10048030 | Ga0209813_100480302 | 147 |
| 892 | 3300027907 | Ga0207428_10228442 | Ga0207428_102284422 | 147 |
| 893 | 3300028573 | Ga0265334_10041533 | Ga0265334_100415332 | 147 |
| 894 | 3300028800 | Ga0265338_10439203 | Ga0265338_104392032 | 147 |
| 895 | 3300031241 | Ga0265325_10083207 | Ga0265325_100832072 | 147 |
| 896 | 3300031241 | Ga0265325_10222547 | Ga0265325_102225472 | 147 |
| 897 | 3300031247 | Ga0265340_10131183 | Ga0265340_101311832 | 147 |
| 898 | 3300031249 | Ga0265339_10036292 | Ga0265339_100362922 | 147 |
| 899 | 3300031548 | Ga0307408_101909264 | Ga0307408_1019092641 | 147 |
| 900 | 3300031727 | Ga0316576_10453383 | Ga0316576_104533832 | 147 |
| 901 | 3300031731 | Ga0307405_10000445 | Ga0307405_1000044517 | 147 |
| 902 | 3300031731 | Ga0307405_10146823 | Ga0307405_101468232 | 147 |
| 903 | 3300031733 | Ga0316577_10566263 | Ga0316577_105662631 | 147 |
| 904 | 3300031824 | Ga0307413_10074432 | Ga0307413_100744322 | 147 |
| 905 | 3300031824 | Ga0307413_10190906 | Ga0307413_101909062 | 147 |
| 906 | 3300031911 | Ga0307412_10001453 | Ga0307412_1000145310 | 147 |
| 907 | 3300031911 | Ga0307412_10027719 | Ga0307412_100277196 | 147 |
| 908 | 3300031995 | Ga0307409_100027415 | Ga0307409_1000274154 | 147 |
| 909 | 3300032004 | Ga0307414_10000607 | Ga0307414_1000060724 | 147 |
| 910 | 3300032004 | Ga0307414_10108606 | Ga0307414_101086064 | 147 |
| 911 | 3300032004 | Ga0307414_10109773 | Ga0307414_101097732 | 147 |
| 912 | 3300032004 | Ga0307414_10167786 | Ga0307414_101677862 | 147 |
| 913 | 3300032004 | Ga0307414_10212200 | Ga0307414_102122002 | 147 |
| 914 | 3300032004 | Ga0307414_10242360 | Ga0307414_102423602 | 147 |
| 915 | 3300032004 | Ga0307414_11108488 | Ga0307414_111084881 | 147 |
| 916 | 3300032004 | Ga0307414_11619868 | Ga0307414_116198681 | 147 |
| 917 | 3300032005 | Ga0307411_10130928 | Ga0307411_101309283 | 147 |
| 918 | 3300032005 | Ga0307411_10401674 | Ga0307411_104016742 | 147 |
| 919 | 3300032126 | Ga0307415_100507266 | Ga0307415_1005072662 | 147 |
| 920 | 3300035691 | Ga0373931_0443009 | Ga0373931_0443009_254_727 | 147 |
| 921 | 3300035695 | Ga0373927_0444093 | Ga0373927_0444093_254_727 | 147 |
| 922 | 3300037068 | Ga0373925_0014982 | Ga0373925_0014982_2688_3161 | 147 |
| 923 | 3300037853 | Ga0436364_0378593 | Ga0436364_0378593_41_499 | 147 |
| 924 | 3300042005 | Ga0439448_0266090 | Ga0439448_0266090_83_544 | 147 |
| 925 | 3300042015 | Ga0439462_0025131 | Ga0439462_0025131_263_712 | 147 |
| 926 | 3300042144 | Ga0450889_000044 | Ga0450889_000044_9152_9631 | 147 |
| 927 | 3300042436 | Ga0439435_0031179 | Ga0439435_0031179_317_766 | 147 |
| 928 | 3300044712 | Ga0453684_0001089 | Ga0453684_0001089_63259_63726 | 147 |
| 929 | 3300044842 | Ga0466957_0436810 | Ga0466957_0436810_350_817 | 147 |
| 930 | 3300045051 | Ga0451576_0000201 | Ga0451576_0000201_127454_127921 | 147 |
| 931 | 3300046460 | Ga0495638_0023692 | Ga0495638_0023692_1796_2251 | 147 |
| 932 | 3300046522 | Ga0495643_0010369 | Ga0495643_0010369_1254_1721 | 147 |
| 933 | 3300046522 | Ga0495643_0018963 | Ga0495643_0018963_1126_1575 | 147 |
| 934 | 3300048905 | Ga0496102_0380716 | Ga0496102_0380716_239_709 | 147 |
| 935 | 3300048915 | Ga0496112_0719359 | Ga0496112_0719359_250_708 | 147 |
| 936 | 3300049569 | Ga0501032_0062790 | Ga0501032_0062790_396_863 | 147 |
| 937 | 3300049570 | Ga0501033_0125664 | Ga0501033_0125664_167_640 | 147 |
| 938 | 3300049571 | Ga0501034_0103060 | Ga0501034_0103060_823_1293 | 147 |
| 939 | 3300049571 | Ga0501034_0149862 | Ga0501034_0149862_724_1197 | 147 |
| 940 | 3300049571 | Ga0501034_0192577 | Ga0501034_0192577_1178_1651 | 147 |
| 941 | 3300049571 | Ga0501034_0443868 | Ga0501034_0443868_230_688 | 147 |
| 942 | 3300049574 | Ga0501038_0051389 | Ga0501038_0051389_2865_3338 | 147 |
| 943 | 3300049579 | Ga0501043_1006371 | Ga0501043_1006371_68_541 | 147 |
| 944 | 3300049581 | Ga0501047_0080312 | Ga0501047_0080312_2582_3049 | 147 |
| 945 | 3300049581 | Ga0501047_0372880 | Ga0501047_0372880_616_1089 | 147 |
| 946 | 3300049581 | Ga0501047_0376042 | Ga0501047_0376042_716_1174 | 147 |
| 947 | 3300049581 | Ga0501047_0674553 | Ga0501047_0674553_176_649 | 147 |
| 948 | 3300049586 | Ga0501070_0029379 | Ga0501070_0029379_1598_2056 | 147 |
| 949 | 3300049586 | Ga0501070_0971658 | Ga0501070_0971658_112_588 | 147 |
| 950 | 3300049588 | Ga0501072_0856407 | Ga0501072_0856407_88_561 | 147 |
| 951 | 3300049744 | Ga0501083_0564025 | Ga0501083_0564025_180_638 | 147 |
| 952 | 3300049822 | Ga0501035_0995231 | Ga0501035_0995231_52_519 | 147 |
| 953 | 3300049823 | Ga0501044_0000243 | Ga0501044_0000243_40338_40811 | 147 |
| 954 | 3300049823 | Ga0501044_0012601 | Ga0501044_0012601_3190_3648 | 147 |
| 955 | 3300049823 | Ga0501044_1352373 | Ga0501044_1352373_65_538 | 147 |
| 956 | 3300050489 | nmdc:mga03683_106303_c1 | nmdc:mga03683_106303_c1_390_863 | 147 |
| 957 | 3300050489 | nmdc:mga03683_528783_c1 | nmdc:mga03683_528783_c1_76_546 | 147 |
| 958 | 3300050490 | nmdc:mga03n38_148726_c1 | nmdc:mga03n38_148726_c1_533_1003 | 147 |
| 959 | 3300050490 | nmdc:mga03n38_156244_c1 | nmdc:mga03n38_156244_c1_394_861 | 147 |
| 960 | 3300050490 | nmdc:mga03n38_252515_c1 | nmdc:mga03n38_252515_c1_411_881 | 147 |
| 961 | 3300050490 | nmdc:mga03n38_412011_c1 | nmdc:mga03n38_412011_c1_21_491 | 147 |
| 962 | 3300050491 | nmdc:mga00v17_283525_c1 | nmdc:mga00v17_283525_c1_258_728 | 147 |
| 963 | 3300050493 | nmdc:mga0k408_279387_c1 | nmdc:mga0k408_279387_c1_212_682 | 147 |
| 964 | 3300050493 | nmdc:mga0k408_36021_c1 | nmdc:mga0k408_36021_c1_92_565 | 147 |
| 965 | 3300050494 | nmdc:mga06z11_100992_c1 | nmdc:mga06z11_100992_c1_717_1187 | 147 |
| 966 | 3300050494 | nmdc:mga06z11_125549_c1 | nmdc:mga06z11_125549_c1_708_1178 | 147 |
| 967 | 3300050494 | nmdc:mga06z11_69426_c1 | nmdc:mga06z11_69426_c1_932_1405 | 147 |
| 968 | 3300050495 | nmdc:mga04h51_141847_c1 | nmdc:mga04h51_141847_c1_152_622 | 147 |
| 969 | 3300050495 | nmdc:mga04h51_145313_c1 | nmdc:mga04h51_145313_c1_259_729 | 147 |
| 970 | 3300050496 | nmdc:mga07m45_65136_c2 | nmdc:mga07m45_65136_c2_373_843 | 147 |
| 971 | 3300050507 | nmdc:mga05p37_96648_c1 | nmdc:mga05p37_96648_c1_969_1427 | 147 |
| 972 | 3300050509 | nmdc:mga0qj67_65877_c1 | nmdc:mga0qj67_65877_c1_1872_2333 | 147 |
| 973 | 3300050510 | nmdc:mga06r32_105072_c1 | nmdc:mga06r32_105072_c1_904_1365 | 147 |
| 974 | 3300050511 | nmdc:mga08y16_210415_c1 | nmdc:mga08y16_210415_c1_1007_1486 | 147 |
| 975 | 3300050511 | nmdc:mga08y16_324484_c1 | nmdc:mga08y16_324484_c1_510_983 | 147 |
| 976 | 3300050516 | nmdc:mga0sz30_45515_c1 | nmdc:mga0sz30_45515_c1_250_720 | 147 |
| 977 | 3300053077 | Ga0495601_0363480 | Ga0495601_0363480_357_830 | 147 |
| 978 | 3300053087 | Ga0500643_005263 | Ga0500643_005263_2256_2699 | 147 |
| 979 | 3300053094 | Ga0500566_0124345 | Ga0500566_0124345_487_960 | 147 |
| 980 | 3300053096 | Ga0500641_0037147 | Ga0500641_0037147_125_595 | 147 |
| 981 | 3300053116 | Ga0500592_021396 | Ga0500592_021396_30_497 | 147 |
| 982 | 3300053119 | Ga0500595_067755 | Ga0500595_067755_427_897 | 147 |
| 983 | 3300053134 | Ga0500658_0175041 | Ga0500658_0175041_256_726 | 147 |
| 984 | 3300053139 | Ga0500568_0003398 | Ga0500568_0003398_2255_2722 | 147 |
| 985 | 3300053151 | Ga0500604_0083159 | Ga0500604_0083159_420_869 | 147 |
| 986 | 3300053153 | Ga0500616_0001475 | Ga0500616_0001475_6563_7012 | 147 |
| 987 | 3300053153 | Ga0500616_0182442 | Ga0500616_0182442_342_815 | 147 |
| 988 | 3300053157 | Ga0500624_000327 | Ga0500624_000327_8273_8716 | 147 |
| 989 | 3300053177 | Ga0500636_0001484 | Ga0500636_0001484_9989_10432 | 147 |
| 990 | 3300060353 | Ga0501082_0953906 | Ga0501082_0953906_94_567 | 147 |
| 991 | 2162886006 | SwRhRL3b_contig_2393116 | SwRhRL3b_0432.00000360 | 148 |
| 992 | 2162886006 | SwRhRL3b_contig_3059437 | SwRhRL3b_0163.00001160 | 148 |
| 993 | 2162886006 | SwRhRL3b_contig_457702 | SwRhRL3b_0946.00000200 | 148 |
| 994 | 3300005289 | Ga0065704_10113709 | Ga0065704_101137093 | 148 |
| 995 | 3300005295 | Ga0065707_10082019 | Ga0065707_1008201924 | 148 |
| 996 | 3300005327 | Ga0070658_10018766 | Ga0070658_100187662 | 148 |
| 997 | 3300005327 | Ga0070658_10548228 | Ga0070658_105482281 | 148 |
| 998 | 3300005327 | Ga0070658_10736682 | Ga0070658_107366822 | 148 |
| 999 | 3300005329 | Ga0070683_100263198 | Ga0070683_1002631982 | 148 |
| 1000 | 3300005334 | Ga0068869_100453908 | Ga0068869_1004539082 | 148 |
| 1001 | 3300005336 | Ga0070680_100092035 | Ga0070680_1000920353 | 148 |
| 1002 | 3300005339 | Ga0070660_100155021 | Ga0070660_1001550212 | 148 |
| 1003 | 3300005455 | Ga0070663_101247015 | Ga0070663_1012470151 | 148 |
| 1004 | 3300005459 | Ga0068867_101922976 | Ga0068867_1019229761 | 148 |
| 1005 | 3300005530 | Ga0070679_100040999 | Ga0070679_1000409995 | 148 |
| 1006 | 3300005535 | Ga0070684_100219514 | Ga0070684_1002195141 | 148 |
| 1007 | 3300005563 | Ga0068855_101729156 | Ga0068855_1017291561 | 148 |
| 1008 | 3300005843 | Ga0068860_100006788 | Ga0068860_1000067889 | 148 |
| 1009 | 3300006880 | Ga0075429_100104297 | Ga0075429_1001042973 | 148 |
| 1010 | 3300009551 | Ga0105238_10490104 | Ga0105238_104901042 | 148 |
| 1011 | 3300009553 | Ga0105249_10000103 | Ga0105249_1000010321 | 148 |
| 1012 | 3300013297 | Ga0157378_10497478 | Ga0157378_104974782 | 148 |
| 1013 | 3300014326 | Ga0157380_10013575 | Ga0157380_100135752 | 148 |
| 1014 | 3300025909 | Ga0207705_10000991 | Ga0207705_100009917 | 148 |
| 1015 | 3300025909 | Ga0207705_10090075 | Ga0207705_100900753 | 148 |
| 1016 | 3300025917 | Ga0207660_10291049 | Ga0207660_102910492 | 148 |
| 1017 | 3300025919 | Ga0207657_10018058 | Ga0207657_100180588 | 148 |
| 1018 | 3300025921 | Ga0207652_10001433 | Ga0207652_100014336 | 148 |
| 1019 | 3300025924 | Ga0207694_10066799 | Ga0207694_100667993 | 148 |
| 1020 | 3300025942 | Ga0207689_10447860 | Ga0207689_104478602 | 148 |
| 1021 | 3300025949 | Ga0207667_11530638 | Ga0207667_115306381 | 148 |
| 1022 | 3300025961 | Ga0207712_10000069 | Ga0207712_1000006923 | 148 |
| 1023 | 3300026067 | Ga0207678_11021494 | Ga0207678_110214942 | 148 |
| 1024 | 3300026089 | Ga0207648_11491449 | Ga0207648_114914491 | 148 |
| 1025 | 3300026118 | Ga0207675_100358828 | Ga0207675_1003588282 | 148 |
| 1026 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022824 | 148 |
| 1027 | 3300028381 | Ga0268264_10004758 | Ga0268264_1000475810 | 148 |
| 1028 | 3300031995 | Ga0307409_100058278 | Ga0307409_1000582783 | 148 |
| 1029 | 3300037418 | Ga0395900_0977814 | Ga0395900_0977814_57_506 | 148 |
| 1030 | 3300037471 | Ga0395905_0840034 | Ga0395905_0840034_208_657 | 148 |
| 1031 | 3300038443 | Ga0395901_0272451 | Ga0395901_0272451_653_1102 | 148 |
| 1032 | 3300038705 | Ga0237819_00303 | Ga0237819_00303_14925_15377 | 148 |
| 1033 | 3300039145 | Ga0237816_02191 | Ga0237816_02191_540_992 | 148 |
| 1034 | 3300046457 | Ga0495590_0116685 | Ga0495590_0116685_298_762 | 148 |
| 1035 | 3300046460 | Ga0495638_0001274 | Ga0495638_0001274_20591_21049 | 148 |
| 1036 | 3300046506 | Ga0495583_0018403 | Ga0495583_0018403_926_1390 | 148 |
| 1037 | 3300046557 | Ga0495622_0194605 | Ga0495622_0194605_342_788 | 148 |
| 1038 | 3300046616 | Ga0495668_0018443 | Ga0495668_0018443_3505_3969 | 148 |
| 1039 | 3300046660 | Ga0495625_0000231 | Ga0495625_0000231_55281_55739 | 148 |
| 1040 | 3300046660 | Ga0495625_0004912 | Ga0495625_0004912_9282_9746 | 148 |
| 1041 | 3300046691 | Ga0495670_0089862 | Ga0495670_0089862_186_644 | 148 |
| 1042 | 3300048908 | Ga0496105_0263900 | Ga0496105_0263900_742_1215 | 148 |
| 1043 | 3300048917 | Ga0496114_0042215 | Ga0496114_0042215_69_542 | 148 |
| 1044 | 3300049571 | Ga0501034_0597792 | Ga0501034_0597792_172_645 | 148 |
| 1045 | 3300049581 | Ga0501047_0317618 | Ga0501047_0317618_797_1258 | 148 |
| 1046 | 3300049581 | Ga0501047_0568342 | Ga0501047_0568342_253_726 | 148 |
| 1047 | 3300049823 | Ga0501044_0387363 | Ga0501044_0387363_25_498 | 148 |
| 1048 | 3300049823 | Ga0501044_1144261 | Ga0501044_1144261_131_592 | 148 |
| 1049 | 3300053087 | Ga0500643_000172 | Ga0500643_000172_48776_49234 | 148 |
| 1050 | 3300053090 | Ga0500646_0122008 | Ga0500646_0122008_63_527 | 148 |
| 1051 | 3300053116 | Ga0500592_000031 | Ga0500592_000031_26017_26466 | 148 |
| 1052 | 3300053136 | Ga0500559_0002598 | Ga0500559_0002598_4171_4629 | 148 |
| 1053 | 3300053158 | Ga0500627_0000090 | Ga0500627_0000090_14385_14834 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i7d-assembly1.cif.gz_A | crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution | 0.9376 | 3 | 148 |
| 3i7d-assembly1.cif.gz_A | crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution | 0.9193 | 3 | 148 |
| 2dct-assembly1.cif.gz_A | crystal structure of the tt1209 from thermus thermophilus hb8 | 0.9189 | 41 | 119 |
| 5wsf-assembly1.cif.gz_D | crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii | 0.9092 | 3 | 120 |
| 3l2h-assembly1.cif.gz_D | crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution | 0.9069 | 28 | 141 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P24174_373_472_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9208 | 41 | 119 | 2.60.120.10 |
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9137 | 42 | 118 | 2.60.120.10 |
| 2pfwB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8972 | 41 | 118 | 2.60.120.10 |
| 3l2hD01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8964 | 28 | 141 | 2.60.120.10 |
| 3i7dB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8961 | 3 | 148 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2YQ73-F1-model_v4 | Cupin domain-containing protein | 0.9941 | 1 | 119 |
GO:0005886
GO:0015171 |
| AF-A0A2T6KQ38-F1-model_v4 | Cupin domain-containing protein | 0.9834 | 44 | 119 |
GO:0046872
|
| AF-A0A4S3FP28-F1-model_v4 | Transcriptional regulator | 0.9744 | 3 | 148 |
GO:0046872
|
| AF-A0A4U9HFH2-F1-model_v4 | Uncharacterized conserved protein, contains double-stranded beta-helix domain | 0.9723 | 38 | 117 |
|
| AF-A0A7Z2VW27-F1-model_v4 | Cupin domain-containing protein | 0.9711 | 1 | 148 |
GO:0046872
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar