F489110

General Info

Members Datasets Scaffolds Average Seq Length
1053 356 1045 153

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10028143|Ga0157371_100281433
Length 179
Sequence LIQKLHAMRMKPSHELISLLNKEAPAVPKLDLDAIPQTNRTGYPAPYDKAVGDRWVRRLRPVAGLSHLGAAHVVLKPGAWSSQRHWHAEEDELVVILSGEAVLVEDGGETVLRVGDIAAWPKGVKDGHCLQNRGEVDCVMIAVSAGDAANDYGEYPDIDLRFSRDGYLHKDGTPYPPQR

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
6 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
9 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
10 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
13 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
20 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
139 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
142 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
210 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
211 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
216 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
243 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
247 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
248 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
249 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
250 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
251 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
252 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
253 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
254 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
255 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
256 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
257 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
258 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
259 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
260 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
261 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
269 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
274 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
307 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
308 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
309 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
310 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
311 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
312 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
313 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
314 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
315 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
316 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
319 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
320 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
321 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
322 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
326 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
327 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
328 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
329 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
330 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
331 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
339 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
340 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
341 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
342 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
343 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
344 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
345 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
346 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
347 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
348 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
349 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
350 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
351 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
352 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
353 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
354 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.31
Nodule 0
Rhizoplane 3.13
Rhizosphere 87.46
Stem 0
Stem Tuber 0
Unclassified 2.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2393116 2162886006 Bacteria 1518
2 SwRhRL3b_contig_3059437 2162886006 Bacteria 1618
3 SwRhRL3b_contig_457702 2162886006 Bacteria 1086
4 MBSR1b_contig_4721503 2162886012 Bacteria 870
5 JGI24736J21556_1000380 3300001904 Bacteria 8425
6 JGI24741J21665_1011686 3300001915 Bacteria 1527
7 JGI24741J21665_1025433 3300001915 Unclassified 905
8 JGI24752J21851_1031004 3300001976 Bacteria 706
9 JGI24740J21852_10004073 3300001979 Bacteria 6325
10 JGI24740J21852_10006068 3300001979 Bacteria 5049
11 JGI24740J21852_10020042 3300001979 Bacteria 2344
12 JGI24740J21852_10076214 3300001979 Bacteria 887
13 JGI24739J22299_10006920 3300001989 Bacteria 4272
14 JGI24739J22299_10018997 3300001989 Bacteria 2465
15 JGI24737J22298_10004108 3300001990 Bacteria 5084
16 JGI24737J22298_10020537 3300001990 Bacteria 2108
17 JGI24737J22298_10121900 3300001990 Bacteria 770
18 JGI24743J22301_10008643 3300001991 Bacteria 1790
19 JGI24735J21928_10002919 3300002067 Bacteria 5882
20 JGI24735J21928_10006830 3300002067 Bacteria 3740
21 JGI24738J21930_10019210 3300002075 Bacteria 1426
22 JGI24738J21930_10027575 3300002075 Bacteria 1164
23 JGI24738J21930_10059138 3300002075 Bacteria 786
24 JGI25406J46586_10132469 3300003203 Bacteria 730
25 JGI25153J46596_10001155 3300003215 Bacteria 15979
26 rootH1_10052394 3300003316 Bacteria 4912
27 Ga0055534_1005827 3300003784 Bacteria 3223
28 Ga0055530_10000197 3300003791 Bacteria 54281
29 Ga0055531_10008524 3300003794 Bacteria 5383
30 Ga0065704_10113709 3300005289 Bacteria 1902
31 Ga0065712_10398292 3300005290 Bacteria 734
32 Ga0065715_10157897 3300005293 Bacteria 1658
33 Ga0065707_10082019 3300005295 Bacteria 24573
34 Ga0070658_10002803 3300005327 Bacteria 14482
35 Ga0070658_10003377 3300005327 Bacteria 13153
36 Ga0070658_10016537 3300005327 Bacteria 5903
37 Ga0070658_10018766 3300005327 Bacteria 5540
38 Ga0070658_10021373 3300005327 Bacteria 5186
39 Ga0070658_10068054 3300005327 Bacteria 2910
40 Ga0070658_10095345 3300005327 Bacteria 2456
41 Ga0070658_10097037 3300005327 Bacteria 2434
42 Ga0070658_10285681 3300005327 Bacteria 1405
43 Ga0070658_10306522 3300005327 Bacteria 1354
44 Ga0070658_10347241 3300005327 Bacteria 1270
45 Ga0070658_10423728 3300005327 Bacteria 1145
46 Ga0070658_10548228 3300005327 Bacteria 1001
47 Ga0070658_10689605 3300005327 Bacteria 886
48 Ga0070658_10736682 3300005327 Bacteria 856
49 Ga0070676_10090890 3300005328 Bacteria 1870
50 Ga0070676_10157038 3300005328 Bacteria 1461
51 Ga0070683_100019869 3300005329 Bacteria 5971
52 Ga0070683_100071884 3300005329 Bacteria 3228
53 Ga0070683_100104557 3300005329 Bacteria 2669
54 Ga0070683_100115603 3300005329 Bacteria 2533
55 Ga0070683_100263198 3300005329 Bacteria 1640
56 Ga0070683_100263397 3300005329 Bacteria 1640
57 Ga0070690_100205593 3300005330 Bacteria 1372
58 Ga0070690_100591973 3300005330 Bacteria 841
59 Ga0070670_100024585 3300005331 Bacteria 5179
60 Ga0070670_100058924 3300005331 Bacteria 3296
61 Ga0070670_100158438 3300005331 Bacteria 1961
62 Ga0070670_100701594 3300005331 Bacteria 910
63 Ga0068869_100211770 3300005334 Bacteria 1532
64 Ga0068869_100453908 3300005334 Bacteria 1063
65 Ga0068869_100969869 3300005334 Bacteria 739
66 Ga0070666_10000630 3300005335 Bacteria 21198
67 Ga0070666_10594498 3300005335 Bacteria 807
68 Ga0070680_100015126 3300005336 Bacteria 6042
69 Ga0070680_100092035 3300005336 Bacteria 2511
70 Ga0070680_100758450 3300005336 Bacteria 835
71 Ga0070682_100117860 3300005337 Bacteria 1778
72 Ga0070682_100141471 3300005337 Bacteria 1641
73 Ga0070682_100208836 3300005337 Bacteria 1382
74 Ga0068868_100223366 3300005338 Bacteria 1578
75 Ga0068868_100407027 3300005338 Bacteria 1175
76 Ga0068868_101146694 3300005338 Bacteria 717
77 Ga0070660_100001159 3300005339 Bacteria 17807
78 Ga0070660_100001476 3300005339 Bacteria 16095
79 Ga0070660_100024417 3300005339 Bacteria 4483
80 Ga0070660_100032537 3300005339 Bacteria 3925
81 Ga0070660_100155021 3300005339 Bacteria 1843
82 Ga0070660_100199843 3300005339 Bacteria 1621
83 Ga0070660_100220477 3300005339 Bacteria 1541
84 Ga0070660_100284271 3300005339 Bacteria 1354
85 Ga0070660_100554676 3300005339 Bacteria 959
86 Ga0070660_100673729 3300005339 Bacteria 867
87 Ga0070660_100746407 3300005339 Bacteria 822
88 Ga0070660_101305530 3300005339 Bacteria 616
89 Ga0070689_100431659 3300005340 Bacteria 1118
90 Ga0070689_101334296 3300005340 Bacteria 647
91 Ga0070691_10071076 3300005341 Bacteria 1689
92 Ga0070691_10770287 3300005341 Bacteria 583
93 Ga0070687_100313353 3300005343 Bacteria 1000
94 Ga0070661_100000001 3300005344 Bacteria 424830
95 Ga0070661_100004337 3300005344 Bacteria 9786
96 Ga0070661_100014609 3300005344 Bacteria 5536
97 Ga0070661_100026908 3300005344 Bacteria 4140
98 Ga0070661_100077870 3300005344 Bacteria 2445
99 Ga0070661_100137949 3300005344 Bacteria 1836
100 Ga0070661_100246747 3300005344 Unclassified 1377
101 Ga0070661_100299978 3300005344 Bacteria 1250
102 Ga0070661_100332183 3300005344 Bacteria 1189
103 Ga0070661_100398411 3300005344 Bacteria 1088
104 Ga0070661_100476548 3300005344 Bacteria 996
105 Ga0070692_10018291 3300005345 Bacteria 3367
106 Ga0070692_10030185 3300005345 Bacteria 2709
107 Ga0070692_10100480 3300005345 Bacteria 1585
108 Ga0070668_100039770 3300005347 Bacteria 3597
109 Ga0070668_100105185 3300005347 Bacteria 2241
110 Ga0070668_100124859 3300005347 Bacteria 2061
111 Ga0070668_100403365 3300005347 Bacteria 1168
112 Ga0070671_100022193 3300005355 Bacteria 5185
113 Ga0070671_100029902 3300005355 Bacteria 4494
114 Ga0070671_100555906 3300005355 Bacteria 990
115 Ga0070674_100170289 3300005356 Bacteria 1660
116 Ga0070673_100000613 3300005364 Bacteria 19502
117 Ga0070673_100030292 3300005364 Bacteria 4046
118 Ga0070673_101000435 3300005364 Bacteria 778
119 Ga0070659_100001497 3300005366 Bacteria 16828
120 Ga0070659_100001672 3300005366 Bacteria 15938
121 Ga0070659_100002899 3300005366 Bacteria 12212
122 Ga0070659_100004174 3300005366 Bacteria 10299
123 Ga0070659_100035234 3300005366 Bacteria 3897
124 Ga0070659_100039458 3300005366 Bacteria 3686
125 Ga0070659_100066449 3300005366 Bacteria 2857
126 Ga0070659_100141380 3300005366 Bacteria 1960
127 Ga0070659_100201266 3300005366 Bacteria 1639
128 Ga0070659_100218370 3300005366 Bacteria 1573
129 Ga0070659_100424745 3300005366 Bacteria 1124
130 Ga0070659_100458545 3300005366 Bacteria 1082
131 Ga0070659_100527319 3300005366 Bacteria 1009
132 Ga0070659_101299958 3300005366 Bacteria 645
133 Ga0070667_100003077 3300005367 Bacteria 14332
134 Ga0070667_100003302 3300005367 Bacteria 13792
135 Ga0070667_100380319 3300005367 Bacteria 1282
136 Ga0070667_100404435 3300005367 Bacteria 1243
137 Ga0070667_100834494 3300005367 Bacteria 857
138 Ga0070714_100023828 3300005435 Bacteria 5034
139 Ga0070714_100263184 3300005435 Bacteria 1597
140 Ga0070713_100079220 3300005436 Bacteria 2798
141 Ga0070694_100024929 3300005444 Bacteria 3865
142 Ga0070663_100002429 3300005455 Bacteria 10478
143 Ga0070663_100005583 3300005455 Bacteria 7487
144 Ga0070663_100028492 3300005455 Bacteria 3803
145 Ga0070663_100028995 3300005455 Bacteria 3776
146 Ga0070663_100212977 3300005455 Bacteria 1514
147 Ga0070663_100444393 3300005455 Bacteria 1067
148 Ga0070663_100498380 3300005455 Bacteria 1011
149 Ga0070663_101203871 3300005455 Bacteria 666
150 Ga0070663_101225404 3300005455 Bacteria 660
151 Ga0070663_101247015 3300005455 Bacteria 655
152 Ga0070678_100001960 3300005456 Bacteria 11113
153 Ga0070678_100254941 3300005456 Bacteria 1473
154 Ga0070662_100000183 3300005457 Bacteria 36515
155 Ga0070662_100001950 3300005457 Bacteria 12681
156 Ga0070662_100033982 3300005457 Bacteria 3594
157 Ga0070662_100063612 3300005457 Bacteria 2699
158 Ga0070662_100077429 3300005457 Bacteria 2468
159 Ga0070662_100183278 3300005457 Bacteria 1652
160 Ga0070662_100525951 3300005457 Bacteria 989
161 Ga0070662_100550808 3300005457 Bacteria 966
162 Ga0070662_100733772 3300005457 Bacteria 837
163 Ga0070662_101087796 3300005457 Bacteria 686
164 Ga0070662_101265971 3300005457 Unclassified 634
165 Ga0070681_10001494 3300005458 Bacteria 20676
166 Ga0070681_10004781 3300005458 Bacteria 12980
167 Ga0070681_10024034 3300005458 Bacteria 6135
168 Ga0070681_10025673 3300005458 Bacteria 5926
169 Ga0070681_10120408 3300005458 Bacteria 2560
170 Ga0070681_10238297 3300005458 Bacteria 1733
171 Ga0068867_100969546 3300005459 Bacteria 769
172 Ga0068867_101922976 3300005459 Bacteria 558
173 Ga0070706_101056268 3300005467 Bacteria 748
174 Ga0070699_100994270 3300005518 Bacteria 769
175 Ga0070679_100001448 3300005530 Bacteria 20991
176 Ga0070679_100019105 3300005530 Bacteria 6659
177 Ga0070679_100040999 3300005530 Bacteria 4608
178 Ga0070679_100072934 3300005530 Bacteria 3425
179 Ga0070679_100119159 3300005530 Bacteria 2624
180 Ga0070679_100372176 3300005530 Bacteria 1375
181 Ga0070679_100816233 3300005530 Bacteria 876
182 Ga0070679_101117448 3300005530 Bacteria 733
183 Ga0070679_102005223 3300005530 Bacteria 528
184 Ga0070684_100101049 3300005535 Bacteria 2576
185 Ga0070684_100202819 3300005535 Bacteria 1807
186 Ga0070684_100219514 3300005535 Bacteria 1735
187 Ga0068853_100002487 3300005539 Bacteria 13809
188 Ga0068853_100010266 3300005539 Bacteria 7574
189 Ga0068853_100015278 3300005539 Bacteria 6309
190 Ga0068853_100020000 3300005539 Bacteria 5562
191 Ga0068853_100090163 3300005539 Bacteria 2694
192 Ga0068853_100094613 3300005539 Bacteria 2633
193 Ga0068853_100120161 3300005539 Bacteria 2343
194 Ga0068853_100198188 3300005539 Bacteria 1826
195 Ga0068853_100221131 3300005539 Bacteria 1729
196 Ga0068853_100796336 3300005539 Bacteria 905
197 Ga0068853_101741925 3300005539 Bacteria 604
198 Ga0070672_100001691 3300005543 Bacteria 13764
199 Ga0070672_100791652 3300005543 Bacteria 834
200 Ga0070686_100377842 3300005544 Bacteria 1072
201 Ga0070695_100008415 3300005545 Bacteria 6125
202 Ga0070696_100077670 3300005546 Bacteria 2346
203 Ga0070696_101329684 3300005546 Bacteria 611
204 Ga0070693_100030191 3300005547 Bacteria 2962
205 Ga0070693_100439818 3300005547 Bacteria 913
206 Ga0070693_100603749 3300005547 Bacteria 792
207 Ga0070693_100739418 3300005547 Bacteria 724
208 Ga0070665_100020234 3300005548 Bacteria 6682
209 Ga0070665_100178366 3300005548 Bacteria 2125
210 Ga0070704_100521830 3300005549 Bacteria 1034
211 Ga0068855_100003943 3300005563 Bacteria 18111
212 Ga0068855_100004493 3300005563 Bacteria 17049
213 Ga0068855_100026207 3300005563 Bacteria 6975
214 Ga0068855_100111889 3300005563 Bacteria 3134
215 Ga0068855_100112736 3300005563 Bacteria 3121
216 Ga0068855_100170776 3300005563 Unclassified 2463
217 Ga0068855_100197776 3300005563 Bacteria 2264
218 Ga0068855_100387828 3300005563 Bacteria 1533
219 Ga0068855_100688916 3300005563 Bacteria 1095
220 Ga0068855_100852756 3300005563 Bacteria 965
221 Ga0068855_101729156 3300005563 Bacteria 637
222 Ga0068855_101769804 3300005563 Bacteria 628
223 Ga0070664_100002251 3300005564 Bacteria 15526
224 Ga0070664_100006440 3300005564 Bacteria 9468
225 Ga0070664_100028663 3300005564 Bacteria 4634
226 Ga0070664_100047078 3300005564 Bacteria 3643
227 Ga0070664_100068112 3300005564 Bacteria 3043
228 Ga0070664_100068314 3300005564 Bacteria 3038
229 Ga0070664_100070632 3300005564 Bacteria 2991
230 Ga0070664_100157013 3300005564 Bacteria 2011
231 Ga0070664_100168839 3300005564 Unclassified 1940
232 Ga0070664_100812016 3300005564 Bacteria 875
233 Ga0068857_100012269 3300005577 Bacteria 7455
234 Ga0068857_100012687 3300005577 Bacteria 7344
235 Ga0068857_100016853 3300005577 Bacteria 6401
236 Ga0068857_100208205 3300005577 Bacteria 1784
237 Ga0068857_100437446 3300005577 Bacteria 1221
238 Ga0068857_100584191 3300005577 Bacteria 1055
239 Ga0068857_100995463 3300005577 Bacteria 807
240 Ga0068854_100006566 3300005578 Bacteria 7406
241 Ga0068854_100017822 3300005578 Bacteria 4759
242 Ga0068854_100213881 3300005578 Bacteria 1522
243 Ga0068854_100391560 3300005578 Bacteria 1147
244 Ga0068854_100488073 3300005578 Bacteria 1035
245 Ga0068856_100017668 3300005614 Bacteria 6914
246 Ga0068856_100025094 3300005614 Bacteria 5809
247 Ga0068856_100071045 3300005614 Bacteria 3445
248 Ga0068856_100282694 3300005614 Bacteria 1676
249 Ga0068856_100435216 3300005614 Bacteria 1332
250 Ga0068856_100460795 3300005614 Bacteria 1292
251 Ga0068856_100504088 3300005614 Bacteria 1231
252 Ga0068856_100616694 3300005614 Bacteria 1106
253 Ga0068856_100810795 3300005614 Bacteria 956
254 Ga0070702_101221436 3300005615 Bacteria 607
255 Ga0068852_100000043 3300005616 Bacteria 89867
256 Ga0068852_100003224 3300005616 Bacteria 11388
257 Ga0068852_100087379 3300005616 Bacteria 2782
258 Ga0068852_100105224 3300005616 Bacteria 2556
259 Ga0068852_100134000 3300005616 Bacteria 2285
260 Ga0068852_100186235 3300005616 Bacteria 1955
261 Ga0068852_100247262 3300005616 Bacteria 1707
262 Ga0068852_100263119 3300005616 Bacteria 1657
263 Ga0068852_100327860 3300005616 Bacteria 1489
264 Ga0068852_100371488 3300005616 Bacteria 1401
265 Ga0068852_100447122 3300005616 Bacteria 1279
266 Ga0068852_100509187 3300005616 Bacteria 1200
267 Ga0068852_100577971 3300005616 Bacteria 1126
268 Ga0068852_100652423 3300005616 Bacteria 1060
269 Ga0068852_101301608 3300005616 Bacteria 748
270 Ga0068859_100664366 3300005617 Bacteria 1134
271 Ga0068864_100011893 3300005618 Bacteria 7185
272 Ga0068851_10005339 3300005834 Bacteria 5833
273 Ga0068851_10018748 3300005834 Bacteria 3338
274 Ga0068851_10035286 3300005834 Bacteria 2499
275 Ga0068851_10038966 3300005834 Bacteria 2386
276 Ga0068851_10045538 3300005834 Bacteria 2217
277 Ga0068870_10045636 3300005840 Bacteria 2295
278 Ga0068863_100030776 3300005841 Bacteria 5125
279 Ga0068863_100132055 3300005841 Bacteria 2384
280 Ga0068858_100327860 3300005842 Bacteria 1464
281 Ga0068860_100006788 3300005843 Bacteria 11471
282 Ga0068860_100007732 3300005843 Bacteria 10742
283 Ga0068860_100111287 3300005843 Bacteria 2618
284 Ga0068860_100388182 3300005843 Bacteria 1379
285 Ga0081538_10002850 3300005981 Bacteria 16534
286 Ga0081539_10071277 3300005985 Bacteria 1862
287 Ga0070717_10142382 3300006028 Bacteria 2069
288 Ga0075365_10360716 3300006038 Bacteria 1024
289 Ga0075365_10698794 3300006038 Bacteria 716
290 Ga0075368_10055219 3300006042 Bacteria 1583
291 Ga0075363_100043168 3300006048 Bacteria 2384
292 Ga0075363_100090176 3300006048 Bacteria 1686
293 Ga0075363_100293064 3300006048 Bacteria 943
294 Ga0075364_10264046 3300006051 Bacteria 1170
295 Ga0070716_101269268 3300006173 Bacteria 594
296 Ga0075362_10036972 3300006177 Bacteria 2139
297 Ga0075362_10179504 3300006177 Bacteria 1025
298 Ga0075362_10262266 3300006177 Bacteria 852
299 Ga0075362_10483872 3300006177 Bacteria 631
300 Ga0075367_10133599 3300006178 Bacteria 1535
301 Ga0075367_10167143 3300006178 Bacteria 1369
302 Ga0075367_10221779 3300006178 Bacteria 1183
303 Ga0075369_10025662 3300006186 Bacteria 2452
304 Ga0075366_10020324 3300006195 Bacteria 3851
305 Ga0075366_10075162 3300006195 Bacteria 2015
306 Ga0075366_10318872 3300006195 Bacteria 952
307 Ga0075366_10506399 3300006195 Bacteria 746
308 Ga0075366_10531274 3300006195 Bacteria 728
309 Ga0097621_100528173 3300006237 Bacteria 1072
310 Ga0097621_100538564 3300006237 Bacteria 1062
311 Ga0075370_10046646 3300006353 Bacteria 2452
312 Ga0075370_10070416 3300006353 Bacteria 2000
313 Ga0075370_10279050 3300006353 Bacteria 992
314 Ga0068871_100005970 3300006358 Bacteria 8574
315 Ga0068871_101463072 3300006358 Bacteria 645
316 Ga0075430_100231300 3300006846 Bacteria 1533
317 Ga0075431_100175944 3300006847 Bacteria 2198
318 Ga0075433_10412856 3300006852 Bacteria 1191
319 Ga0075429_100104297 3300006880 Bacteria 2476
320 Ga0068865_100758238 3300006881 Bacteria 834
321 Ga0097620_100664429 3300006931 Bacteria 1134
322 Ga0097620_101631925 3300006931 Bacteria 712
323 Ga0075435_100566673 3300007076 Bacteria 984
324 Ga0105240_10023135 3300009093 Bacteria 8227
325 Ga0105240_10285810 3300009093 Bacteria 1893
326 Ga0105240_10296300 3300009093 Bacteria 1852
327 Ga0105240_10459837 3300009093 Bacteria 1422
328 Ga0111539_10180978 3300009094 Bacteria 2462
329 Ga0111539_10230792 3300009094 Bacteria 2155
330 Ga0105245_10000285 3300009098 Bacteria 48237
331 Ga0114129_10380719 3300009147 Bacteria 1864
332 Ga0105243_10265561 3300009148 Bacteria 1539
333 Ga0105241_10032710 3300009174 Bacteria 3901
334 Ga0105241_10038432 3300009174 Bacteria 3608
335 Ga0105241_10144750 3300009174 Bacteria 1938
336 Ga0105248_10008019 3300009177 Bacteria 11597
337 Ga0105248_10013976 3300009177 Bacteria 8832
338 Ga0105248_10046063 3300009177 Bacteria 4888
339 Ga0105237_10013046 3300009545 Bacteria 8725
340 Ga0105237_10013830 3300009545 Bacteria 8449
341 Ga0105238_10014359 3300009551 Bacteria 8006
342 Ga0105238_10014766 3300009551 Bacteria 7898
343 Ga0105238_10027736 3300009551 Bacteria 5772
344 Ga0105238_10249556 3300009551 Bacteria 1753
345 Ga0105238_10490104 3300009551 Bacteria 1229
346 Ga0105238_10738631 3300009551 Bacteria 998
347 Ga0105238_12484118 3300009551 Bacteria 554
348 Ga0105249_10000103 3300009553 Bacteria 118397
349 Ga0105249_11441446 3300009553 Bacteria 761
350 Ga0099796_10283404 3300010159 Bacteria 697
351 Ga0105239_10473944 3300010375 Bacteria 1422
352 Ga0105239_10523147 3300010375 Bacteria 1350
353 Ga0105246_10000234 3300011119 Bacteria 28511
354 Ga0157373_10003505 3300013100 Bacteria 11868
355 Ga0157373_10019882 3300013100 Bacteria 4885
356 Ga0157373_10023083 3300013100 Bacteria 4512
357 Ga0157373_10093388 3300013100 Bacteria 2119
358 Ga0157373_10122033 3300013100 Bacteria 1831
359 Ga0157373_10142875 3300013100 Bacteria 1683
360 Ga0157373_10179009 3300013100 Bacteria 1492
361 Ga0157373_10204085 3300013100 Bacteria 1394
362 Ga0157373_10600654 3300013100 Bacteria 801
363 Ga0157371_10001424 3300013102 Bacteria 24845
364 Ga0157371_10009211 3300013102 Bacteria 7792
365 Ga0157371_10024590 3300013102 Bacteria 4396
366 Ga0157371_10028143 3300013102 Bacteria 4072
367 Ga0157371_10031247 3300013102 Bacteria 3836
368 Ga0157371_10187667 3300013102 Bacteria 1480
369 Ga0157371_10224176 3300013102 Bacteria 1350
370 Ga0157371_10230240 3300013102 Bacteria 1332
371 Ga0157371_10365775 3300013102 Bacteria 1052
372 Ga0157371_10378073 3300013102 Bacteria 1034
373 Ga0157371_10410021 3300013102 Bacteria 992
374 Ga0157371_10850596 3300013102 Bacteria 690
375 Ga0157371_10951705 3300013102 Bacteria 653
376 Ga0157370_10002640 3300013104 Bacteria 21532
377 Ga0157370_10016740 3300013104 Bacteria 7418
378 Ga0157370_10017787 3300013104 Bacteria 7164
379 Ga0157370_10054118 3300013104 Bacteria 3826
380 Ga0157370_10154929 3300013104 Bacteria 2132
381 Ga0157370_10162569 3300013104 Bacteria 2077
382 Ga0157370_10197659 3300013104 Bacteria 1866
383 Ga0157370_10260872 3300013104 Bacteria 1601
384 Ga0157370_10512166 3300013104 Unclassified 1102
385 Ga0157370_11065351 3300013104 Bacteria 731
386 Ga0157369_10005291 3300013105 Bacteria 15039
387 Ga0157369_10009565 3300013105 Bacteria 11088
388 Ga0157369_10011956 3300013105 Bacteria 9859
389 Ga0157369_10016077 3300013105 Bacteria 8419
390 Ga0157369_10036687 3300013105 Bacteria 5370
391 Ga0157369_10079144 3300013105 Bacteria 3521
392 Ga0157369_10148511 3300013105 Bacteria 2478
393 Ga0157369_10196462 3300013105 Bacteria 2118
394 Ga0157369_10297249 3300013105 Bacteria 1680
395 Ga0157369_10350719 3300013105 Bacteria 1533
396 Ga0157369_10580459 3300013105 Bacteria 1158
397 Ga0157369_11582134 3300013105 Bacteria 666
398 Ga0157369_12418399 3300013105 Bacteria 532
399 Ga0157374_10041303 3300013296 Bacteria 4250
400 Ga0157374_10524342 3300013296 Bacteria 1191
401 Ga0157378_10497478 3300013297 Bacteria 1217
402 Ga0157378_10890919 3300013297 Bacteria 920
403 Ga0163162_10010085 3300013306 Bacteria 9185
404 Ga0163162_10424950 3300013306 Bacteria 1461
405 Ga0163162_11678379 3300013306 Bacteria 725
406 Ga0163162_13353548 3300013306 Bacteria 512
407 Ga0157372_10005358 3300013307 Bacteria 13625
408 Ga0157372_10026427 3300013307 Bacteria 6317
409 Ga0157372_10091413 3300013307 Bacteria 3461
410 Ga0157372_10199311 3300013307 Bacteria 2319
411 Ga0157372_10306604 3300013307 Bacteria 1847
412 Ga0157372_10316168 3300013307 Bacteria 1818
413 Ga0157375_10016550 3300013308 Bacteria 6629
414 Ga0157375_10331699 3300013308 Bacteria 1686
415 Ga0157375_11392803 3300013308 Bacteria 826
416 Ga0163163_10003524 3300014325 Bacteria 13288
417 Ga0163163_12094545 3300014325 Bacteria 625
418 Ga0157380_10013575 3300014326 Bacteria 5946
419 Ga0157380_11061162 3300014326 Bacteria 847
420 Ga0182008_10040430 3300014497 Bacteria 2329
421 Ga0182008_10102452 3300014497 Bacteria 1416
422 Ga0157377_10027784 3300014745 Bacteria 3040
423 Ga0157377_10150530 3300014745 Bacteria 1438
424 Ga0157379_10122684 3300014968 Bacteria 2338
425 Ga0157376_11916234 3300014969 Bacteria 630
426 Ga0182006_1056708 3300015261 Bacteria 1491
427 Ga0163161_10405737 3300017792 Bacteria 1094
428 Ga0213873_10000009 3300021358 Bacteria 237102
429 Ga0213874_10027658 3300021377 Bacteria 1615
430 Ga0213876_10000004 3300021384 Bacteria 943822
431 Ga0213876_10208719 3300021384 Bacteria 1038
432 Ga0213875_10008191 3300021388 Bacteria 5364
433 Ga0209675_1000162 3300025291 Bacteria 83810
434 Ga0209676_1000113 3300025292 Bacteria 207931
435 Ga0209676_1000146 3300025292 Bacteria 174095
436 Ga0209676_1002307 3300025292 Bacteria 13898
437 Ga0209025_1035622 3300025294 Bacteria 2245
438 Ga0209758_1063445 3300025297 Bacteria 1203
439 Ga0209050_1000126 3300025298 Bacteria 188438
440 Ga0209050_1013537 3300025298 Bacteria 3612
441 Ga0209257_1000256 3300025304 Bacteria 123057
442 Ga0209257_1002727 3300025304 Bacteria 16784
443 Ga0207697_10003593 3300025315 Bacteria 7608
444 Ga0207697_10054258 3300025315 Bacteria 1661
445 Ga0207697_10056296 3300025315 Unclassified 1631
446 Ga0207656_10003790 3300025321 Bacteria 5235
447 Ga0207656_10017463 3300025321 Bacteria 2812
448 Ga0207656_10020842 3300025321 Bacteria 2610
449 Ga0207642_10058332 3300025899 Bacteria 1780
450 Ga0207688_10093367 3300025901 Bacteria 1730
451 Ga0207688_10310041 3300025901 Bacteria 966
452 Ga0207680_10007697 3300025903 Bacteria 5264
453 Ga0207680_10156783 3300025903 Bacteria 1523
454 Ga0207680_10736518 3300025903 Bacteria 707
455 Ga0207647_10000069 3300025904 Bacteria 80952
456 Ga0207647_10006349 3300025904 Bacteria 8594
457 Ga0207647_10012008 3300025904 Bacteria 6045
458 Ga0207647_10028658 3300025904 Bacteria 3614
459 Ga0207647_10036318 3300025904 Bacteria 3131
460 Ga0207647_10132656 3300025904 Bacteria 1463
461 Ga0207645_10113335 3300025907 Bacteria 1757
462 Ga0207645_10282613 3300025907 Bacteria 1102
463 Ga0207705_10000991 3300025909 Bacteria 23160
464 Ga0207705_10002967 3300025909 Bacteria 12964
465 Ga0207705_10007878 3300025909 Bacteria 7822
466 Ga0207705_10008821 3300025909 Bacteria 7352
467 Ga0207705_10009747 3300025909 Bacteria 6988
468 Ga0207705_10010868 3300025909 Bacteria 6610
469 Ga0207705_10034493 3300025909 Bacteria 3618
470 Ga0207705_10051015 3300025909 Bacteria 2979
471 Ga0207705_10090075 3300025909 Bacteria 2245
472 Ga0207705_10101632 3300025909 Bacteria 2115
473 Ga0207705_10131531 3300025909 Bacteria 1863
474 Ga0207705_10185131 3300025909 Bacteria 1573
475 Ga0207705_10208598 3300025909 Bacteria 1482
476 Ga0207705_10529268 3300025909 Bacteria 916
477 Ga0207705_10535133 3300025909 Bacteria 911
478 Ga0207684_10854359 3300025910 Bacteria 767
479 Ga0207654_10013252 3300025911 Bacteria 4238
480 Ga0207654_10020008 3300025911 Bacteria 3541
481 Ga0207707_10013904 3300025912 Bacteria 7017
482 Ga0207707_10015225 3300025912 Bacteria 6697
483 Ga0207707_10068256 3300025912 Bacteria 3098
484 Ga0207707_10510449 3300025912 Bacteria 1024
485 Ga0207707_10587938 3300025912 Bacteria 943
486 Ga0207707_10670306 3300025912 Bacteria 873
487 Ga0207695_10012923 3300025913 Bacteria 9992
488 Ga0207695_10019220 3300025913 Bacteria 7868
489 Ga0207695_10032866 3300025913 Bacteria 5671
490 Ga0207695_10124440 3300025913 Bacteria 2542
491 Ga0207695_10272782 3300025913 Bacteria 1587
492 Ga0207695_11444970 3300025913 Bacteria 568
493 Ga0207671_10002421 3300025914 Bacteria 19972
494 Ga0207671_10027417 3300025914 Bacteria 4259
495 Ga0207671_10028986 3300025914 Bacteria 4135
496 Ga0207693_10069429 3300025915 Bacteria 2757
497 Ga0207660_10039020 3300025917 Bacteria 3318
498 Ga0207660_10047117 3300025917 Bacteria 3045
499 Ga0207660_10287468 3300025917 Bacteria 1307
500 Ga0207660_10291049 3300025917 Bacteria 1299
501 Ga0207660_10608929 3300025917 Bacteria 890
502 Ga0207660_10881821 3300025917 Bacteria 730
503 Ga0207662_10280200 3300025918 Bacteria 1103
504 Ga0207657_10000123 3300025919 Bacteria 77348
505 Ga0207657_10000504 3300025919 Bacteria 41239
506 Ga0207657_10000946 3300025919 Bacteria 30768
507 Ga0207657_10001024 3300025919 Bacteria 29655
508 Ga0207657_10006094 3300025919 Bacteria 12538
509 Ga0207657_10006293 3300025919 Bacteria 12337
510 Ga0207657_10018058 3300025919 Bacteria 6748
511 Ga0207657_10023777 3300025919 Bacteria 5697
512 Ga0207657_10036194 3300025919 Bacteria 4420
513 Ga0207657_10043813 3300025919 Bacteria 3939
514 Ga0207657_10055514 3300025919 Bacteria 3421
515 Ga0207657_10083179 3300025919 Bacteria 2685
516 Ga0207657_10195700 3300025919 Bacteria 1628
517 Ga0207657_10401043 3300025919 Bacteria 1079
518 Ga0207657_10464525 3300025919 Bacteria 993
519 Ga0207657_10631780 3300025919 Bacteria 834
520 Ga0207649_10000018 3300025920 Bacteria 225137
521 Ga0207649_10009705 3300025920 Bacteria 5272
522 Ga0207649_10019643 3300025920 Bacteria 3865
523 Ga0207649_10020903 3300025920 Bacteria 3759
524 Ga0207649_10030726 3300025920 Unclassified 3185
525 Ga0207649_10053426 3300025920 Bacteria 2510
526 Ga0207649_10137790 3300025920 Bacteria 1666
527 Ga0207649_10425958 3300025920 Unclassified 997
528 Ga0207649_10431728 3300025920 Bacteria 991
529 Ga0207649_10667629 3300025920 Bacteria 804
530 Ga0207649_10854057 3300025920 Unclassified 712
531 Ga0207652_10001433 3300025921 Bacteria 21127
532 Ga0207652_10024932 3300025921 Bacteria 4966
533 Ga0207652_10060515 3300025921 Bacteria 3267
534 Ga0207652_10291484 3300025921 Bacteria 1472
535 Ga0207652_10415114 3300025921 Bacteria 1214
536 Ga0207652_11129588 3300025921 Bacteria 684
537 Ga0207694_10002217 3300025924 Bacteria 15949
538 Ga0207694_10003033 3300025924 Bacteria 13465
539 Ga0207694_10008340 3300025924 Bacteria 7834
540 Ga0207694_10030175 3300025924 Bacteria 4140
541 Ga0207694_10034936 3300025924 Bacteria 3855
542 Ga0207694_10066799 3300025924 Bacteria 2806
543 Ga0207694_10289940 3300025924 Bacteria 1346
544 Ga0207650_10011935 3300025925 Bacteria 5988
545 Ga0207650_10036094 3300025925 Bacteria 3595
546 Ga0207650_10154698 3300025925 Bacteria 1812
547 Ga0207650_10220742 3300025925 Bacteria 1525
548 Ga0207650_10371331 3300025925 Bacteria 1180
549 Ga0207650_10599895 3300025925 Bacteria 926
550 Ga0207659_10033609 3300025926 Bacteria 3532
551 Ga0207659_10192355 3300025926 Bacteria 1624
552 Ga0207700_10021189 3300025928 Bacteria 4432
553 Ga0207664_10015933 3300025929 Bacteria 5474
554 Ga0207664_10162370 3300025929 Bacteria 1906
555 Ga0207664_10372533 3300025929 Bacteria 1267
556 Ga0207664_10449906 3300025929 Bacteria 1149
557 Ga0207644_10007787 3300025931 Bacteria 6995
558 Ga0207644_10009323 3300025931 Bacteria 6444
559 Ga0207644_10480352 3300025931 Bacteria 1023
560 Ga0207690_10005486 3300025932 Bacteria 7481
561 Ga0207690_10035197 3300025932 Bacteria 3233
562 Ga0207690_10097074 3300025932 Bacteria 2096
563 Ga0207690_10102515 3300025932 Bacteria 2046
564 Ga0207690_10227811 3300025932 Bacteria 1429
565 Ga0207690_10308614 3300025932 Bacteria 1240
566 Ga0207690_10418816 3300025932 Bacteria 1071
567 Ga0207690_10615479 3300025932 Bacteria 887
568 Ga0207690_10826067 3300025932 Bacteria 766
569 Ga0207690_10977762 3300025932 Bacteria 704
570 Ga0207706_10000193 3300025933 Bacteria 68202
571 Ga0207706_10002629 3300025933 Bacteria 17488
572 Ga0207706_10003424 3300025933 Bacteria 15149
573 Ga0207706_10010762 3300025933 Bacteria 8351
574 Ga0207706_10025962 3300025933 Bacteria 5245
575 Ga0207706_10065052 3300025933 Bacteria 3211
576 Ga0207706_10089071 3300025933 Bacteria 2713
577 Ga0207706_10289439 3300025933 Bacteria 1428
578 Ga0207706_10324357 3300025933 Bacteria 1340
579 Ga0207706_10487335 3300025933 Bacteria 1065
580 Ga0207706_10500534 3300025933 Bacteria 1049
581 Ga0207706_11235848 3300025933 Bacteria 619
582 Ga0207670_10298458 3300025936 Bacteria 1261
583 Ga0207670_10718708 3300025936 Bacteria 828
584 Ga0207669_10246065 3300025937 Bacteria 1328
585 Ga0207704_10294652 3300025938 Bacteria 1240
586 Ga0207691_10001147 3300025940 Bacteria 26294
587 Ga0207691_10280348 3300025940 Bacteria 1434
588 Ga0207711_10017482 3300025941 Bacteria 5958
589 Ga0207711_10028757 3300025941 Bacteria 4681
590 Ga0207711_10959149 3300025941 Bacteria 794
591 Ga0207689_10447860 3300025942 Bacteria 1079
592 Ga0207661_10090118 3300025944 Bacteria 2553
593 Ga0207661_10198982 3300025944 Bacteria 1760
594 Ga0207661_10353973 3300025944 Bacteria 1325
595 Ga0207661_12121440 3300025944 Bacteria 508
596 Ga0207679_10009073 3300025945 Bacteria 6354
597 Ga0207679_10081875 3300025945 Bacteria 2469
598 Ga0207679_10083379 3300025945 Bacteria 2450
599 Ga0207679_10089444 3300025945 Bacteria 2377
600 Ga0207679_10175885 3300025945 Unclassified 1767
601 Ga0207679_10324444 3300025945 Bacteria 1334
602 Ga0207679_10735883 3300025945 Bacteria 896
603 Ga0207667_10002490 3300025949 Bacteria 22955
604 Ga0207667_10011976 3300025949 Bacteria 10040
605 Ga0207667_10012325 3300025949 Bacteria 9861
606 Ga0207667_10017613 3300025949 Bacteria 8035
607 Ga0207667_10019585 3300025949 Bacteria 7548
608 Ga0207667_10021844 3300025949 Bacteria 7083
609 Ga0207667_10038532 3300025949 Bacteria 5103
610 Ga0207667_10128228 3300025949 Bacteria 2613
611 Ga0207667_10247312 3300025949 Bacteria 1825
612 Ga0207667_10248859 3300025949 Bacteria 1818
613 Ga0207667_10395800 3300025949 Bacteria 1407
614 Ga0207667_10600544 3300025949 Bacteria 1110
615 Ga0207667_11530638 3300025949 Bacteria 637
616 Ga0207651_10014761 3300025960 Bacteria 4520
617 Ga0207651_10042885 3300025960 Bacteria 3015
618 Ga0207651_10191294 3300025960 Bacteria 1632
619 Ga0207712_10000069 3300025961 Bacteria 127318
620 Ga0207712_11022224 3300025961 Bacteria 734
621 Ga0207668_10291889 3300025972 Bacteria 1342
622 Ga0207668_11569134 3300025972 Bacteria 594
623 Ga0207640_10045698 3300025981 Bacteria 2813
624 Ga0207640_10088868 3300025981 Bacteria 2134
625 Ga0207640_10091310 3300025981 Bacteria 2109
626 Ga0207640_10162576 3300025981 Bacteria 1654
627 Ga0207640_10309509 3300025981 Bacteria 1253
628 Ga0207640_10537361 3300025981 Bacteria 980
629 Ga0207658_10015187 3300025986 Bacteria 5282
630 Ga0207658_10281570 3300025986 Bacteria 1425
631 Ga0207658_10535266 3300025986 Bacteria 1047
632 Ga0207658_11011418 3300025986 Bacteria 758
633 Ga0207677_10179727 3300026023 Bacteria 1663
634 Ga0207677_10447021 3300026023 Bacteria 1107
635 Ga0207677_10450546 3300026023 Bacteria 1103
636 Ga0207703_10320563 3300026035 Bacteria 1419
637 Ga0207639_10000199 3300026041 Bacteria 45241
638 Ga0207639_10000798 3300026041 Bacteria 21425
639 Ga0207639_10003539 3300026041 Bacteria 10493
640 Ga0207639_10023368 3300026041 Bacteria 4464
641 Ga0207639_10042910 3300026041 Bacteria 3392
642 Ga0207639_10062330 3300026041 Bacteria 2883
643 Ga0207639_10257821 3300026041 Bacteria 1524
644 Ga0207678_10009190 3300026067 Bacteria 8701
645 Ga0207678_10014095 3300026067 Bacteria 7029
646 Ga0207678_10017196 3300026067 Bacteria 6348
647 Ga0207678_10024372 3300026067 Bacteria 5285
648 Ga0207678_10024379 3300026067 Bacteria 5283
649 Ga0207678_10025444 3300026067 Bacteria 5165
650 Ga0207678_10074648 3300026067 Bacteria 2905
651 Ga0207678_10433401 3300026067 Bacteria 1141
652 Ga0207678_10507140 3300026067 Bacteria 1052
653 Ga0207678_11021494 3300026067 Bacteria 732
654 Ga0207678_11239915 3300026067 Bacteria 660
655 Ga0207702_10007759 3300026078 Bacteria 9110
656 Ga0207702_10022935 3300026078 Bacteria 5178
657 Ga0207702_10024793 3300026078 Bacteria 4976
658 Ga0207702_10024945 3300026078 Bacteria 4961
659 Ga0207702_10025873 3300026078 Bacteria 4871
660 Ga0207702_10033994 3300026078 Bacteria 4261
661 Ga0207702_10058354 3300026078 Bacteria 3284
662 Ga0207702_10072618 3300026078 Bacteria 2966
663 Ga0207702_10522661 3300026078 Bacteria 1159
664 Ga0207702_10898435 3300026078 Bacteria 878
665 Ga0207702_11359256 3300026078 Bacteria 704
666 Ga0207641_10025359 3300026088 Bacteria 4888
667 Ga0207641_10115462 3300026088 Bacteria 2387
668 Ga0207648_10259389 3300026089 Bacteria 1551
669 Ga0207648_11491449 3300026089 Bacteria 636
670 Ga0207676_10003563 3300026095 Bacteria 10999
671 Ga0207676_10619733 3300026095 Bacteria 1041
672 Ga0207674_10000580 3300026116 Bacteria 48154
673 Ga0207674_10005390 3300026116 Bacteria 15219
674 Ga0207674_10011216 3300026116 Bacteria 10072
675 Ga0207674_10018837 3300026116 Bacteria 7488
676 Ga0207674_10038782 3300026116 Bacteria 4941
677 Ga0207674_10062694 3300026116 Bacteria 3754
678 Ga0207674_10123899 3300026116 Bacteria 2550
679 Ga0207674_10194816 3300026116 Bacteria 1976
680 Ga0207675_100358828 3300026118 Bacteria 1430
681 Ga0207683_10005822 3300026121 Bacteria 10566
682 Ga0207683_10007206 3300026121 Bacteria 9534
683 Ga0207683_10196562 3300026121 Bacteria 1832
684 Ga0207698_10000388 3300026142 Bacteria 25382
685 Ga0207698_10000449 3300026142 Bacteria 23772
686 Ga0207698_10000703 3300026142 Bacteria 19442
687 Ga0207698_10029780 3300026142 Bacteria 3915
688 Ga0207698_10091007 3300026142 Bacteria 2496
689 Ga0207698_10097135 3300026142 Bacteria 2430
690 Ga0207698_10119516 3300026142 Bacteria 2227
691 Ga0207698_10328013 3300026142 Bacteria 1436
692 Ga0207698_10456781 3300026142 Bacteria 1234
693 Ga0210002_1014486 3300027617 Bacteria 1237
694 Ga0209813_10048030 3300027866 Bacteria 1324
695 Ga0207428_10228442 3300027907 Bacteria 1393
696 Ga0268266_10000002 3300028379 Bacteria 3059047
697 Ga0268266_10016834 3300028379 Bacteria 6248
698 Ga0268266_10138249 3300028379 Bacteria 2184
699 Ga0268266_10283725 3300028379 Bacteria 1540
700 Ga0268265_10102231 3300028380 Bacteria 2318
701 Ga0268264_10004758 3300028381 Bacteria 11524
702 Ga0268264_10071632 3300028381 Bacteria 2937
703 Ga0268264_10091232 3300028381 Bacteria 2628
704 Ga0268264_10362729 3300028381 Bacteria 1383
705 Ga0265334_10041533 3300028573 Bacteria 1798
706 Ga0265338_10439203 3300028800 Bacteria 925
707 Ga0265328_10053498 3300031239 Bacteria 1481
708 Ga0265325_10083207 3300031241 Bacteria 1587
709 Ga0265325_10222547 3300031241 Bacteria 863
710 Ga0265340_10131183 3300031247 Bacteria 1149
711 Ga0265339_10036292 3300031249 Bacteria 2760
712 Ga0265327_10054725 3300031251 Bacteria 2064
713 Ga0307408_100011699 3300031548 Bacteria 5802
714 Ga0307408_100012386 3300031548 Bacteria 5647
715 Ga0307408_100073431 3300031548 Bacteria 2535
716 Ga0307408_100130409 3300031548 Bacteria 1960
717 Ga0307408_101909264 3300031548 Bacteria 569
718 Ga0316579_10031452 3300031691 Bacteria 2430
719 Ga0316576_10453383 3300031727 Bacteria 947
720 Ga0307405_10000445 3300031731 Bacteria 15493
721 Ga0307405_10025543 3300031731 Bacteria 3393
722 Ga0307405_10117036 3300031731 Bacteria 1816
723 Ga0307405_10146823 3300031731 Bacteria 1653
724 Ga0307405_10337372 3300031731 Bacteria 1157
725 Ga0307405_11079815 3300031731 Bacteria 689
726 Ga0316577_10566263 3300031733 Bacteria 646
727 Ga0307413_10034421 3300031824 Bacteria 2895
728 Ga0307413_10074432 3300031824 Bacteria 2151
729 Ga0307413_10190906 3300031824 Bacteria 1471
730 Ga0307413_10715152 3300031824 Bacteria 833
731 Ga0307413_10845977 3300031824 Bacteria 773
732 Ga0307410_10005366 3300031852 Bacteria 6777
733 Ga0307410_10313018 3300031852 Bacteria 1243
734 Ga0307406_10012211 3300031901 Bacteria 4893
735 Ga0307406_10573673 3300031901 Bacteria 926
736 Ga0307406_11706707 3300031901 Bacteria 558
737 Ga0307407_10038169 3300031903 Bacteria 2659
738 Ga0307412_10001453 3300031911 Bacteria 13173
739 Ga0307412_10027719 3300031911 Bacteria 3536
740 Ga0307412_10070875 3300031911 Bacteria 2377
741 Ga0307409_100027415 3300031995 Bacteria 4037
742 Ga0307409_100058278 3300031995 Bacteria 2999
743 Ga0307409_100075243 3300031995 Bacteria 2702
744 Ga0307409_100158881 3300031995 Bacteria 1974
745 Ga0307409_100343378 3300031995 Bacteria 1406
746 Ga0307416_100081790 3300032002 Bacteria 2732
747 Ga0307416_100165055 3300032002 Bacteria 2053
748 Ga0307414_10000607 3300032004 Bacteria 18398
749 Ga0307414_10108606 3300032004 Bacteria 2105
750 Ga0307414_10109773 3300032004 Bacteria 2096
751 Ga0307414_10138487 3300032004 Bacteria 1901
752 Ga0307414_10167786 3300032004 Bacteria 1751
753 Ga0307414_10212200 3300032004 Bacteria 1583
754 Ga0307414_10231500 3300032004 Bacteria 1524
755 Ga0307414_10242360 3300032004 Bacteria 1493
756 Ga0307414_11108488 3300032004 Bacteria 731
757 Ga0307414_11569106 3300032004 Bacteria 613
758 Ga0307414_11619868 3300032004 Bacteria 603
759 Ga0307411_10130928 3300032005 Bacteria 1833
760 Ga0307411_10336648 3300032005 Bacteria 1225
761 Ga0307411_10401674 3300032005 Bacteria 1133
762 Ga0307411_10520594 3300032005 Bacteria 1009
763 Ga0307411_10826972 3300032005 Bacteria 817
764 Ga0307415_100027644 3300032126 Bacteria 3596
765 Ga0307415_100144897 3300032126 Bacteria 1819
766 Ga0307415_100507266 3300032126 Bacteria 1056
767 Ga0307415_100742262 3300032126 Bacteria 890
768 Ga0307415_100766050 3300032126 Bacteria 878
769 Ga0373936_0187459 3300035113 Bacteria 909
770 Ga0373943_0013861 3300035170 Bacteria 3645
771 Ga0373943_0392543 3300035170 Bacteria 800
772 Ga0373931_0443009 3300035691 Bacteria 829
773 Ga0373927_0255173 3300035695 Bacteria 1153
774 Ga0373927_0444093 3300035695 Bacteria 856
775 Ga0373937_0598278 3300036401 Bacteria 1047
776 Ga0373937_1027458 3300036401 Bacteria 773
777 Ga0316582_0002330 3300036647 Bacteria 8885
778 Ga0373925_0014982 3300037068 Bacteria 5605
779 Ga0373925_0016074 3300037068 Bacteria 5419
780 Ga0373925_1022935 3300037068 Bacteria 680
781 Ga0395899_0000287 3300037312 Bacteria 64885
782 Ga0395899_0020496 3300037312 Bacteria 5011
783 Ga0395899_0026549 3300037312 Bacteria 4369
784 Ga0395899_0054171 3300037312 Bacteria 2969
785 Ga0395899_0086819 3300037312 Bacteria 2272
786 Ga0395899_0157483 3300037312 Bacteria 1606
787 Ga0395899_0204359 3300037312 Bacteria 1375
788 Ga0395899_0250124 3300037312 Bacteria 1216
789 Ga0395899_0314434 3300037312 Bacteria 1056
790 Ga0395899_0324449 3300037312 Bacteria 1036
791 Ga0395900_0000031 3300037418 Bacteria 262393
792 Ga0395900_0020351 3300037418 Bacteria 6773
793 Ga0395900_0021453 3300037418 Bacteria 6603
794 Ga0395900_0031110 3300037418 Bacteria 5483
795 Ga0395900_0046969 3300037418 Bacteria 4446
796 Ga0395900_0068337 3300037418 Bacteria 3651
797 Ga0395900_0074177 3300037418 Bacteria 3498
798 Ga0395900_0091530 3300037418 Bacteria 3125
799 Ga0395900_0098104 3300037418 Bacteria 3010
800 Ga0395900_0162102 3300037418 Bacteria 2280
801 Ga0395900_0197842 3300037418 Bacteria 2035
802 Ga0395900_0412769 3300037418 Bacteria 1312
803 Ga0395900_0734539 3300037418 Bacteria 918
804 Ga0395900_0977814 3300037418 Bacteria 767
805 Ga0395900_0999385 3300037418 Bacteria 756
806 Ga0395898_0003799 3300037466 Bacteria 16718
807 Ga0395898_0012131 3300037466 Bacteria 8917
808 Ga0395898_0023568 3300037466 Bacteria 6218
809 Ga0395898_0032370 3300037466 Bacteria 5219
810 Ga0395898_0068940 3300037466 Bacteria 3422
811 Ga0395898_0184156 3300037466 Bacteria 1995
812 Ga0395898_0304766 3300037466 Bacteria 1519
813 Ga0395898_0673595 3300037466 Unclassified 976
814 Ga0395898_0788184 3300037466 Bacteria 891
815 Ga0395905_0002222 3300037471 Bacteria 21895
816 Ga0395905_0009030 3300037471 Bacteria 9780
817 Ga0395905_0012524 3300037471 Bacteria 8162
818 Ga0395905_0029223 3300037471 Bacteria 5195
819 Ga0395905_0029724 3300037471 Bacteria 5150
820 Ga0395905_0036985 3300037471 Bacteria 4586
821 Ga0395905_0049013 3300037471 Bacteria 3958
822 Ga0395905_0076008 3300037471 Bacteria 3147
823 Ga0395905_0159977 3300037471 Bacteria 2117
824 Ga0395905_0170844 3300037471 Bacteria 2042
825 Ga0395905_0300859 3300037471 Bacteria 1491
826 Ga0395905_0302641 3300037471 Bacteria 1486
827 Ga0395905_0443257 3300037471 Bacteria 1196
828 Ga0395905_0527336 3300037471 Bacteria 1081
829 Ga0395905_0670129 3300037471 Bacteria 939
830 Ga0395905_0840034 3300037471 Bacteria 821
831 Ga0395905_0876680 3300037471 Bacteria 800
832 Ga0395905_1061240 3300037471 Unclassified 713
833 Ga0395905_1632552 3300037471 Bacteria 550
834 Ga0436364_0378593 3300037853 Bacteria 1303
835 Ga0436364_0996148 3300037853 Bacteria 15568
836 Ga0395901_0000035 3300038443 Bacteria 223888
837 Ga0395901_0022979 3300038443 Bacteria 6391
838 Ga0395901_0072007 3300038443 Bacteria 3602
839 Ga0395901_0108065 3300038443 Bacteria 2920
840 Ga0395901_0243027 3300038443 Bacteria 1877
841 Ga0395901_0272451 3300038443 Bacteria 1760
842 Ga0395901_0423619 3300038443 Bacteria 1364
843 Ga0395901_0480585 3300038443 Bacteria 1267
844 Ga0395901_0530851 3300038443 Bacteria 1194
845 Ga0395901_0640889 3300038443 Bacteria 1067
846 Ga0395901_0770463 3300038443 Bacteria 953
847 Ga0237819_00303 3300038705 Bacteria 18154
848 Ga0237816_02191 3300039145 Bacteria 1517
849 Ga0436365_0183072 3300039437 Bacteria 14725
850 Ga0436363_1629915 3300039450 Bacteria 837
851 Ga0436363_1686935 3300039450 Bacteria 1160
852 Ga0436362_0383697 3300039453 Bacteria 74416
853 Ga0451837_1281924 3300041494 Bacteria 904
854 Ga0439448_0266090 3300042005 Bacteria 606
855 Ga0439462_0025131 3300042015 Bacteria 1567
856 Ga0450889_000044 3300042144 Bacteria 11037
857 Ga0439435_0031179 3300042436 Bacteria 1448
858 Ga0439464_0154557 3300042439 Bacteria 719
859 Ga0466969_0110114 3300044656 Bacteria 1290
860 Ga0466969_0468914 3300044656 Unclassified 573
861 Ga0466965_0209903 3300044683 Bacteria 1035
862 Ga0466965_0387783 3300044683 Bacteria 770
863 Ga0466966_0061375 3300044684 Bacteria 2371
864 Ga0466966_0094752 3300044684 Unclassified 1850
865 Ga0466966_0631426 3300044684 Bacteria 645
866 Ga0466961_0009863 3300044693 Bacteria 6083
867 Ga0466961_0238205 3300044693 Bacteria 1119
868 Ga0466963_0000335 3300044694 Bacteria 21343
869 Ga0466963_0159743 3300044694 Bacteria 1568
870 Ga0466963_0333256 3300044694 Bacteria 1068
871 Ga0466964_0409003 3300044706 Bacteria 711
872 Ga0453684_0001089 3300044712 Bacteria 85906
873 Ga0466971_0076361 3300044719 Bacteria 1524
874 Ga0466970_0037549 3300044765 Bacteria 2568
875 Ga0466970_0052209 3300044765 Bacteria 2182
876 Ga0466970_0178195 3300044765 Unclassified 1179
877 Ga0466957_0080109 3300044842 Bacteria 2033
878 Ga0466957_0436810 3300044842 Bacteria 900
879 Ga0466960_0011969 3300044901 Bacteria 3649
880 Ga0466959_0012236 3300045049 Bacteria 6192
881 Ga0466959_0049179 3300045049 Bacteria 3097
882 Ga0466959_0158752 3300045049 Bacteria 1590
883 Ga0451576_0000201 3300045051 Bacteria 150175
884 Ga0466958_0182803 3300045836 Unclassified 1331
885 Ga0466958_0183574 3300045836 Bacteria 1328
886 Ga0466958_0215633 3300045836 Bacteria 1224
887 Ga0466958_0244048 3300045836 Bacteria 1148
888 Ga0466967_0020512 3300045976 Bacteria 5345
889 Ga0466967_0098983 3300045976 Bacteria 2663
890 Ga0466967_0259495 3300045976 Bacteria 1662
891 Ga0466967_0404913 3300045976 Bacteria 1328
892 Ga0466967_0489618 3300045976 Bacteria 1206
893 Ga0466967_1398101 3300045976 Bacteria 697
894 Ga0495590_0116685 3300046457 Bacteria 955
895 Ga0495638_0001274 3300046460 Bacteria 23496
896 Ga0495638_0023692 3300046460 Bacteria 4011
897 Ga0495580_0631443 3300046472 Unclassified 706
898 Ga0495583_0018403 3300046506 Bacteria 3678
899 Ga0495643_0010369 3300046522 Bacteria 5737
900 Ga0495643_0018963 3300046522 Bacteria 3985
901 Ga0495644_0240472 3300046523 Bacteria 702
902 Ga0495621_0000149 3300046539 Bacteria 15217
903 Ga0495621_0099692 3300046539 Bacteria 1104
904 Ga0495622_0194605 3300046557 Bacteria 905
905 Ga0495668_0018443 3300046616 Bacteria 4032
906 Ga0495625_0000231 3300046660 Bacteria 87237
907 Ga0495625_0004912 3300046660 Bacteria 12445
908 Ga0495669_0031735 3300046684 Bacteria 2320
909 Ga0495669_0280856 3300046684 Bacteria 801
910 Ga0495670_0004834 3300046691 Bacteria 6616
911 Ga0495670_0089862 3300046691 Bacteria 1571
912 Ga0496101_0067569 3300048904 Bacteria 2610
913 Ga0496101_0556563 3300048904 Bacteria 907
914 Ga0496102_0036646 3300048905 Bacteria 4419
915 Ga0496102_0105107 3300048905 Bacteria 2627
916 Ga0496102_0380716 3300048905 Bacteria 1328
917 Ga0496102_0767589 3300048905 Bacteria 887
918 Ga0496103_0007651 3300048906 Bacteria 6427
919 Ga0496104_0719517 3300048907 Bacteria 906
920 Ga0496104_0740400 3300048907 Bacteria 890
921 Ga0496105_0155111 3300048908 Bacteria 1881
922 Ga0496105_0263900 3300048908 Bacteria 1392
923 Ga0496105_0292473 3300048908 Bacteria 1311
924 Ga0496107_0132761 3300048910 Bacteria 1839
925 Ga0496107_0825241 3300048910 Bacteria 678
926 Ga0496108_0001925 3300048911 Bacteria 16631
927 Ga0496108_0180117 3300048911 Bacteria 1830
928 Ga0496109_0015923 3300048912 Bacteria 6567
929 Ga0496109_0321539 3300048912 Bacteria 1460
930 Ga0496110_0021431 3300048913 Bacteria 5472
931 Ga0496111_0007998 3300048914 Bacteria 6973
932 Ga0496111_0064928 3300048914 Bacteria 2649
933 Ga0496111_1116105 3300048914 Bacteria 561
934 Ga0496112_0002858 3300048915 Bacteria 14027
935 Ga0496112_0019601 3300048915 Bacteria 6387
936 Ga0496112_0151041 3300048915 Bacteria 2290
937 Ga0496112_0293726 3300048915 Bacteria 1571
938 Ga0496112_0690172 3300048915 Bacteria 949
939 Ga0496112_0719359 3300048915 Bacteria 926
940 Ga0496113_0016617 3300048916 Bacteria 5087
941 Ga0496113_0022168 3300048916 Bacteria 4487
942 Ga0496114_0042215 3300048917 Bacteria 3780
943 Ga0496114_1215607 3300048917 Bacteria 640
944 Ga0496117_0007348 3300048920 Bacteria 10796
945 Ga0496118_0137078 3300048921 Bacteria 1559
946 Ga0496123_0064154 3300048926 Bacteria 2342
947 Ga0496124_0100265 3300048927 Bacteria 2348
948 Ga0496126_0249921 3300048929 Bacteria 1478
949 Ga0501032_0062790 3300049569 Bacteria 2488
950 Ga0501033_0125664 3300049570 Bacteria 1860
951 Ga0501034_0103060 3300049571 Bacteria 2847
952 Ga0501034_0149862 3300049571 Bacteria 2309
953 Ga0501034_0192577 3300049571 Bacteria 2001
954 Ga0501034_0443868 3300049571 Bacteria 1216
955 Ga0501034_0597792 3300049571 Bacteria 1009
956 Ga0501034_1368510 3300049571 Bacteria 583
957 Ga0501038_0051389 3300049574 Bacteria 3557
958 Ga0501043_1006371 3300049579 Bacteria 593
959 Ga0501047_0080312 3300049581 Bacteria 3134
960 Ga0501047_0317618 3300049581 Bacteria 1398
961 Ga0501047_0372880 3300049581 Bacteria 1262
962 Ga0501047_0376042 3300049581 Bacteria 1255
963 Ga0501047_0568342 3300049581 Bacteria 957
964 Ga0501047_0674553 3300049581 Bacteria 852
965 Ga0501070_0029379 3300049586 Bacteria 4610
966 Ga0501070_0971658 3300049586 Bacteria 660
967 Ga0501072_0856407 3300049588 Bacteria 711
968 Ga0501209_016085 3300049656 Bacteria 1682
969 Ga0501209_211395 3300049656 Bacteria 599
970 Ga0501217_138341 3300049661 Bacteria 719
971 Ga0501224_004198 3300049664 Bacteria 2037
972 Ga0501224_016950 3300049664 Bacteria 1082
973 Ga0501227_052572 3300049665 Bacteria 1031
974 Ga0501227_240487 3300049665 Bacteria 516
975 Ga0501233_028065 3300049668 Bacteria 1254
976 Ga0501233_139981 3300049668 Bacteria 668
977 Ga0501235_007990 3300049669 Bacteria 2305
978 Ga0501249_070337 3300049679 Bacteria 817
979 Ga0501257_024804 3300049686 Bacteria 1425
980 Ga0501257_120176 3300049686 Bacteria 703
981 Ga0501225_0023711 3300049705 Bacteria 1690
982 Ga0501229_049571 3300049706 Bacteria 617
983 Ga0501234_003083 3300049707 Bacteria 2619
984 Ga0501083_0564025 3300049744 Bacteria 741
985 Ga0501262_004084 3300049759 Bacteria 1684
986 Ga0501263_028977 3300049760 Bacteria 775
987 Ga0501267_013378 3300049764 Bacteria 853
988 Ga0501272_024815 3300049769 Bacteria 737
989 Ga0501279_073034 3300049775 Bacteria 580
990 Ga0501035_0995231 3300049822 Bacteria 659
991 Ga0501044_0000243 3300049823 Bacteria 68966
992 Ga0501044_0012601 3300049823 Bacteria 9157
993 Ga0501044_0387363 3300049823 Bacteria 1312
994 Ga0501044_1125944 3300049823 Bacteria 654
995 Ga0501044_1144261 3300049823 Bacteria 647
996 Ga0501044_1352373 3300049823 Bacteria 578
997 nmdc:mga03683_106303_c1 3300050489 Bacteria 1237
998 nmdc:mga03683_528783_c1 3300050489 Bacteria 573
999 nmdc:mga03n38_148726_c1 3300050490 Bacteria 1177
1000 nmdc:mga03n38_156244_c1 3300050490 Bacteria 1151
1001 nmdc:mga03n38_252515_c1 3300050490 Bacteria 932
1002 nmdc:mga03n38_412011_c1 3300050490 Bacteria 746
1003 nmdc:mga00v17_283525_c1 3300050491 Bacteria 1076
1004 nmdc:mga0k408_279387_c1 3300050493 Bacteria 997
1005 nmdc:mga0k408_302908_c1 3300050493 Bacteria 954
1006 nmdc:mga0k408_36021_c1 3300050493 Bacteria 2839
1007 nmdc:mga06z11_100992_c1 3300050494 Bacteria 1583
1008 nmdc:mga06z11_125549_c1 3300050494 Bacteria 1436
1009 nmdc:mga06z11_69426_c1 3300050494 Bacteria 1860
1010 nmdc:mga04h51_141847_c1 3300050495 Bacteria 912
1011 nmdc:mga04h51_145313_c1 3300050495 Bacteria 903
1012 nmdc:mga07m45_1034_c1 3300050496 Bacteria 12353
1013 nmdc:mga07m45_176878_c1 3300050496 Bacteria 1241
1014 nmdc:mga07m45_51034_c1 3300050496 Bacteria 2332
1015 nmdc:mga07m45_65136_c2 3300050496 Bacteria 1653
1016 nmdc:mga05p37_96648_c1 3300050507 Bacteria 3639
1017 nmdc:mga0qj67_65877_c1 3300050509 Bacteria 2884
1018 nmdc:mga06r32_105072_c1 3300050510 Bacteria 2774
1019 nmdc:mga08y16_210415_c1 3300050511 Bacteria 2014
1020 nmdc:mga08y16_324484_c1 3300050511 Bacteria 1584
1021 nmdc:mga0n895_171271_c1 3300050512 Bacteria 2203
1022 nmdc:mga0rr50_414273_c1 3300050513 Bacteria 1139
1023 nmdc:mga0sz30_20166_c1 3300050516 Bacteria 2687
1024 nmdc:mga0sz30_45515_c1 3300050516 Bacteria 1851
1025 Ga0495601_0363480 3300053077 Bacteria 940
1026 Ga0500643_000172 3300053087 Bacteria 63436
1027 Ga0500643_005263 3300053087 Bacteria 5614
1028 Ga0500646_0122008 3300053090 Bacteria 839
1029 Ga0500566_0124345 3300053094 Bacteria 1387
1030 Ga0500641_0037147 3300053096 Bacteria 1951
1031 Ga0500592_000031 3300053116 Bacteria 47686
1032 Ga0500592_021396 3300053116 Bacteria 1041
1033 Ga0500595_067755 3300053119 Bacteria 1064
1034 Ga0500658_0175041 3300053134 Bacteria 976
1035 Ga0500559_0002598 3300053136 Bacteria 9225
1036 Ga0500568_0003398 3300053139 Bacteria 8897
1037 Ga0500588_0163466 3300053146 Bacteria 811
1038 Ga0500604_0083159 3300053151 Bacteria 1037
1039 Ga0500616_0001475 3300053153 Bacteria 22359
1040 Ga0500616_0182442 3300053153 Bacteria 944
1041 Ga0500624_000327 3300053157 Bacteria 16208
1042 Ga0500627_0000090 3300053158 Bacteria 30885
1043 Ga0500636_0001484 3300053177 Bacteria 12740
1044 Ga0501082_0953906 3300060353 Bacteria 750
1045 Ga0466962_0550523 3300061719 Bacteria 586

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061719 Ga0466962_0550523 Ga0466962_0550523_37_414 116
2 3300001991 JGI24743J22301_10008643 JGI24743J22301_100086433 124
3 3300005367 Ga0070667_100003302 Ga0070667_10000330210 124
4 3300009174 Ga0105241_10032710 Ga0105241_100327102 124
5 3300050512 nmdc:mga0n895_171271_c1 nmdc:mga0n895_171271_c1_1792_2187 124
6 3300003316 rootH1_10052394 rootH1_100523947 127
7 3300006195 Ga0075366_10075162 Ga0075366_100751622 127
8 3300037312 Ga0395899_0204359 Ga0395899_0204359_492_959 130
9 3300037466 Ga0395898_0673595 Ga0395898_0673595_68_535 130
10 3300037471 Ga0395905_0302641 Ga0395905_0302641_545_1012 130
11 3300014745 Ga0157377_10027784 Ga0157377_100277842 132
12 3300049571 Ga0501034_1368510 Ga0501034_1368510_131_559 132
13 3300013100 Ga0157373_10093388 Ga0157373_100933882 135
14 3300005327 Ga0070658_10016537 Ga0070658_100165373 137
15 3300005329 Ga0070683_100104557 Ga0070683_1001045572 137
16 3300005336 Ga0070680_100015126 Ga0070680_1000151264 137
17 3300005339 Ga0070660_100024417 Ga0070660_1000244176 137
18 3300005530 Ga0070679_100119159 Ga0070679_1001191592 137
19 3300005563 Ga0068855_100197776 Ga0068855_1001977761 137
20 3300005614 Ga0068856_100616694 Ga0068856_1006166942 137
21 3300013105 Ga0157369_10079144 Ga0157369_100791443 137
22 3300025904 Ga0207647_10036318 Ga0207647_100363182 137
23 3300025909 Ga0207705_10002967 Ga0207705_100029672 137
24 3300025917 Ga0207660_10039020 Ga0207660_100390201 137
25 3300025919 Ga0207657_10001024 Ga0207657_1000102426 137
26 3300025921 Ga0207652_10024932 Ga0207652_100249322 137
27 3300025944 Ga0207661_10353973 Ga0207661_103539732 137
28 3300025949 Ga0207667_10017613 Ga0207667_100176133 137
29 3300025981 Ga0207640_10537361 Ga0207640_105373612 137
30 3300026078 Ga0207702_10022935 Ga0207702_100229352 137
31 3300037471 Ga0395905_0002222 Ga0395905_0002222_393_839 137
32 3300044656 Ga0466969_0468914 Ga0466969_0468914_65_511 137
33 3300044684 Ga0466966_0061375 Ga0466966_0061375_189_635 137
34 3300044765 Ga0466970_0178195 Ga0466970_0178195_425_871 137
35 3300045836 Ga0466958_0182803 Ga0466958_0182803_600_1046 137
36 3300005435 Ga0070714_100023828 Ga0070714_1000238284 138
37 3300025929 Ga0207664_10372533 Ga0207664_103725332 138
38 3300026078 Ga0207702_10522661 Ga0207702_105226612 138
39 3300044706 Ga0466964_0409003 Ga0466964_0409003_107_574 138
40 3300044765 Ga0466970_0052209 Ga0466970_0052209_1513_1980 138
41 3300045976 Ga0466967_0098983 Ga0466967_0098983_1334_1801 138
42 3300044694 Ga0466963_0159743 Ga0466963_0159743_604_1071 141
43 3300044842 Ga0466957_0080109 Ga0466957_0080109_641_1108 141
44 3300045836 Ga0466958_0215633 Ga0466958_0215633_155_622 141
45 iso_pu_bacteria 2599185359 2600225287 141
46 iso_pu_bacteria 2879163058 2879166309 141
47 iso_pu_bacteria 2928526807 2928530141 141
48 3300001990 JGI24737J22298_10121900 JGI24737J22298_101219001 142
49 3300005327 Ga0070658_10002803 Ga0070658_100028039 142
50 3300005339 Ga0070660_100032537 Ga0070660_1000325374 142
51 3300005344 Ga0070661_100332183 Ga0070661_1003321832 142
52 3300005345 Ga0070692_10018291 Ga0070692_100182912 142
53 3300013102 Ga0157371_10378073 Ga0157371_103780732 142
54 3300013104 Ga0157370_10162569 Ga0157370_101625693 142
55 3300025904 Ga0207647_10132656 Ga0207647_101326562 142
56 3300025909 Ga0207705_10008821 Ga0207705_100088214 142
57 3300025919 Ga0207657_10000504 Ga0207657_1000050413 142
58 3300025920 Ga0207649_10425958 Ga0207649_104259582 142
59 3300037312 Ga0395899_0000287 Ga0395899_0000287_45510_45956 142
60 3300037418 Ga0395900_0000031 Ga0395900_0000031_209795_210241 142
61 3300037466 Ga0395898_0012131 Ga0395898_0012131_2651_3097 142
62 3300037471 Ga0395905_0049013 Ga0395905_0049013_1216_1662 142
63 3300038443 Ga0395901_0000035 Ga0395901_0000035_75671_76117 142
64 3300005347 Ga0070668_100039770 Ga0070668_1000397703 143
65 3300005356 Ga0070674_100170289 Ga0070674_1001702892 143
66 3300005366 Ga0070659_100001672 Ga0070659_10000167212 143
67 3300005455 Ga0070663_100498380 Ga0070663_1004983802 143
68 3300005539 Ga0068853_100090163 Ga0068853_1000901632 143
69 3300005843 Ga0068860_100007732 Ga0068860_1000077328 143
70 3300009094 Ga0111539_10230792 Ga0111539_102307922 143
71 3300009098 Ga0105245_10000285 Ga0105245_1000028536 143
72 3300013100 Ga0157373_10179009 Ga0157373_101790092 143
73 3300025899 Ga0207642_10058332 Ga0207642_100583322 143
74 3300026067 Ga0207678_10433401 Ga0207678_104334012 143
75 3300028381 Ga0268264_10071632 Ga0268264_100716322 143
76 iso_pu_bacteria 2643221588 2643950773 143
77 iso_pu_bacteria 2852680915 2852683318 143
78 3300006358 Ga0068871_101463072 Ga0068871_1014630722 144
79 3300021377 Ga0213874_10027658 Ga0213874_100276582 144
80 3300039450 Ga0436363_1629915 Ga0436363_1629915_347_790 144
81 iso_pu_bacteria 2643221541 2643727878 144
82 iso_pu_bacteria 2643221606 2644043172 144
83 iso_pu_bacteria 2643221671 2644395396 144
84 3300005436 Ga0070713_100079220 Ga0070713_1000792202 145
85 3300005614 Ga0068856_100810795 Ga0068856_1008107953 145
86 3300005616 Ga0068852_100577971 Ga0068852_1005779712 145
87 3300005985 Ga0081539_10071277 Ga0081539_100712772 145
88 3300006028 Ga0070717_10142382 Ga0070717_101423822 145
89 3300010375 Ga0105239_10523147 Ga0105239_105231472 145
90 3300013100 Ga0157373_10142875 Ga0157373_101428752 145
91 3300013102 Ga0157371_10951705 Ga0157371_109517052 145
92 3300013105 Ga0157369_10016077 Ga0157369_100160777 145
93 3300025915 Ga0207693_10069429 Ga0207693_100694292 145
94 3300025928 Ga0207700_10021189 Ga0207700_100211895 145
95 3300026078 Ga0207702_11359256 Ga0207702_113592562 145
96 3300031251 Ga0265327_10054725 Ga0265327_100547251 145
97 3300037418 Ga0395900_0068337 Ga0395900_0068337_2156_2620 145
98 3300037418 Ga0395900_0412769 Ga0395900_0412769_854_1297 145
99 3300037471 Ga0395905_1632552 Ga0395905_1632552_72_536 145
100 3300038443 Ga0395901_0480585 Ga0395901_0480585_785_1249 145
101 3300044719 Ga0466971_0076361 Ga0466971_0076361_89_553 145
102 3300045976 Ga0466967_0404913 Ga0466967_0404913_295_738 145
103 3300048914 Ga0496111_1116105 Ga0496111_1116105_21_485 145
104 3300048926 Ga0496123_0064154 Ga0496123_0064154_1575_2030 145
105 3300048927 Ga0496124_0100265 Ga0496124_0100265_1544_1999 145
106 3300001904 JGI24736J21556_1000380 JGI24736J21556_10003808 146
107 3300001915 JGI24741J21665_1011686 JGI24741J21665_10116862 146
108 3300001915 JGI24741J21665_1025433 JGI24741J21665_10254332 146
109 3300001976 JGI24752J21851_1031004 JGI24752J21851_10310042 146
110 3300001979 JGI24740J21852_10004073 JGI24740J21852_100040734 146
111 3300001979 JGI24740J21852_10006068 JGI24740J21852_100060684 146
112 3300001979 JGI24740J21852_10020042 JGI24740J21852_100200422 146
113 3300001979 JGI24740J21852_10076214 JGI24740J21852_100762142 146
114 3300001989 JGI24739J22299_10006920 JGI24739J22299_100069203 146
115 3300001989 JGI24739J22299_10018997 JGI24739J22299_100189972 146
116 3300001990 JGI24737J22298_10004108 JGI24737J22298_100041084 146
117 3300001990 JGI24737J22298_10020537 JGI24737J22298_100205372 146
118 3300002067 JGI24735J21928_10002919 JGI24735J21928_100029195 146
119 3300002067 JGI24735J21928_10006830 JGI24735J21928_100068302 146
120 3300002075 JGI24738J21930_10019210 JGI24738J21930_100192103 146
121 3300002075 JGI24738J21930_10027575 JGI24738J21930_100275752 146
122 3300002075 JGI24738J21930_10059138 JGI24738J21930_100591382 146
123 3300005290 Ga0065712_10398292 Ga0065712_103982921 146
124 3300005293 Ga0065715_10157897 Ga0065715_101578972 146
125 3300005327 Ga0070658_10021373 Ga0070658_100213733 146
126 3300005327 Ga0070658_10068054 Ga0070658_100680542 146
127 3300005327 Ga0070658_10095345 Ga0070658_100953451 146
128 3300005327 Ga0070658_10097037 Ga0070658_100970374 146
129 3300005327 Ga0070658_10285681 Ga0070658_102856813 146
130 3300005327 Ga0070658_10306522 Ga0070658_103065221 146
131 3300005327 Ga0070658_10423728 Ga0070658_104237282 146
132 3300005327 Ga0070658_10689605 Ga0070658_106896052 146
133 3300005328 Ga0070676_10090890 Ga0070676_100908902 146
134 3300005328 Ga0070676_10157038 Ga0070676_101570382 146
135 3300005329 Ga0070683_100019869 Ga0070683_1000198692 146
136 3300005329 Ga0070683_100115603 Ga0070683_1001156032 146
137 3300005329 Ga0070683_100263397 Ga0070683_1002633971 146
138 3300005330 Ga0070690_100205593 Ga0070690_1002055932 146
139 3300005331 Ga0070670_100024585 Ga0070670_1000245855 146
140 3300005331 Ga0070670_100058924 Ga0070670_1000589244 146
141 3300005331 Ga0070670_100158438 Ga0070670_1001584382 146
142 3300005331 Ga0070670_100701594 Ga0070670_1007015942 146
143 3300005334 Ga0068869_100211770 Ga0068869_1002117702 146
144 3300005334 Ga0068869_100969869 Ga0068869_1009698692 146
145 3300005335 Ga0070666_10000630 Ga0070666_1000063024 146
146 3300005335 Ga0070666_10594498 Ga0070666_105944981 146
147 3300005337 Ga0070682_100117860 Ga0070682_1001178602 146
148 3300005337 Ga0070682_100208836 Ga0070682_1002088362 146
149 3300005338 Ga0068868_100223366 Ga0068868_1002233662 146
150 3300005338 Ga0068868_100407027 Ga0068868_1004070272 146
151 3300005338 Ga0068868_101146694 Ga0068868_1011466941 146
152 3300005339 Ga0070660_100001159 Ga0070660_10000115910 146
153 3300005339 Ga0070660_100199843 Ga0070660_1001998432 146
154 3300005339 Ga0070660_100220477 Ga0070660_1002204773 146
155 3300005339 Ga0070660_100284271 Ga0070660_1002842712 146
156 3300005339 Ga0070660_100554676 Ga0070660_1005546761 146
157 3300005339 Ga0070660_100673729 Ga0070660_1006737293 146
158 3300005339 Ga0070660_101305530 Ga0070660_1013055301 146
159 3300005340 Ga0070689_100431659 Ga0070689_1004316592 146
160 3300005341 Ga0070691_10770287 Ga0070691_107702871 146
161 3300005343 Ga0070687_100313353 Ga0070687_1003133532 146
162 3300005344 Ga0070661_100000001 Ga0070661_100000001133 146
163 3300005344 Ga0070661_100004337 Ga0070661_1000043372 146
164 3300005344 Ga0070661_100026908 Ga0070661_1000269083 146
165 3300005344 Ga0070661_100077870 Ga0070661_1000778703 146
166 3300005344 Ga0070661_100137949 Ga0070661_1001379492 146
167 3300005344 Ga0070661_100246747 Ga0070661_1002467472 146
168 3300005344 Ga0070661_100299978 Ga0070661_1002999782 146
169 3300005344 Ga0070661_100398411 Ga0070661_1003984113 146
170 3300005344 Ga0070661_100476548 Ga0070661_1004765481 146
171 3300005345 Ga0070692_10030185 Ga0070692_100301852 146
172 3300005347 Ga0070668_100105185 Ga0070668_1001051852 146
173 3300005347 Ga0070668_100124859 Ga0070668_1001248593 146
174 3300005347 Ga0070668_100403365 Ga0070668_1004033651 146
175 3300005355 Ga0070671_100022193 Ga0070671_1000221936 146
176 3300005355 Ga0070671_100029902 Ga0070671_1000299025 146
177 3300005355 Ga0070671_100555906 Ga0070671_1005559062 146
178 3300005364 Ga0070673_100000613 Ga0070673_10000061325 146
179 3300005364 Ga0070673_100030292 Ga0070673_1000302924 146
180 3300005364 Ga0070673_101000435 Ga0070673_1010004352 146
181 3300005366 Ga0070659_100001497 Ga0070659_10000149712 146
182 3300005366 Ga0070659_100004174 Ga0070659_10000417413 146
183 3300005366 Ga0070659_100035234 Ga0070659_1000352341 146
184 3300005366 Ga0070659_100039458 Ga0070659_1000394582 146
185 3300005366 Ga0070659_100066449 Ga0070659_1000664492 146
186 3300005366 Ga0070659_100201266 Ga0070659_1002012663 146
187 3300005366 Ga0070659_100218370 Ga0070659_1002183702 146
188 3300005366 Ga0070659_100424745 Ga0070659_1004247452 146
189 3300005366 Ga0070659_100458545 Ga0070659_1004585451 146
190 3300005366 Ga0070659_101299958 Ga0070659_1012999581 146
191 3300005367 Ga0070667_100003077 Ga0070667_1000030773 146
192 3300005367 Ga0070667_100380319 Ga0070667_1003803192 146
193 3300005367 Ga0070667_100404435 Ga0070667_1004044352 146
194 3300005367 Ga0070667_100834494 Ga0070667_1008344942 146
195 3300005435 Ga0070714_100263184 Ga0070714_1002631842 146
196 3300005455 Ga0070663_100002429 Ga0070663_10000242913 146
197 3300005455 Ga0070663_100005583 Ga0070663_1000055835 146
198 3300005455 Ga0070663_100028492 Ga0070663_1000284923 146
199 3300005455 Ga0070663_100212977 Ga0070663_1002129772 146
200 3300005455 Ga0070663_100444393 Ga0070663_1004443931 146
201 3300005455 Ga0070663_101225404 Ga0070663_1012254041 146
202 3300005456 Ga0070678_100001960 Ga0070678_10000196010 146
203 3300005456 Ga0070678_100254941 Ga0070678_1002549412 146
204 3300005457 Ga0070662_100001950 Ga0070662_10000195012 146
205 3300005457 Ga0070662_100033982 Ga0070662_1000339824 146
206 3300005457 Ga0070662_100063612 Ga0070662_1000636122 146
207 3300005457 Ga0070662_100183278 Ga0070662_1001832782 146
208 3300005457 Ga0070662_100525951 Ga0070662_1005259512 146
209 3300005457 Ga0070662_100550808 Ga0070662_1005508081 146
210 3300005457 Ga0070662_101087796 Ga0070662_1010877961 146
211 3300005457 Ga0070662_101265971 Ga0070662_1012659711 146
212 3300005458 Ga0070681_10001494 Ga0070681_100014945 146
213 3300005458 Ga0070681_10024034 Ga0070681_100240342 146
214 3300005458 Ga0070681_10025673 Ga0070681_100256734 146
215 3300005458 Ga0070681_10238297 Ga0070681_102382972 146
216 3300005459 Ga0068867_100969546 Ga0068867_1009695461 146
217 3300005530 Ga0070679_100019105 Ga0070679_1000191058 146
218 3300005530 Ga0070679_100072934 Ga0070679_1000729341 146
219 3300005530 Ga0070679_100816233 Ga0070679_1008162331 146
220 3300005530 Ga0070679_101117448 Ga0070679_1011174482 146
221 3300005535 Ga0070684_100101049 Ga0070684_1001010494 146
222 3300005539 Ga0068853_100010266 Ga0068853_1000102669 146
223 3300005539 Ga0068853_100015278 Ga0068853_1000152784 146
224 3300005539 Ga0068853_100020000 Ga0068853_1000200002 146
225 3300005539 Ga0068853_100094613 Ga0068853_1000946131 146
226 3300005539 Ga0068853_100198188 Ga0068853_1001981884 146
227 3300005539 Ga0068853_100221131 Ga0068853_1002211312 146
228 3300005539 Ga0068853_100796336 Ga0068853_1007963362 146
229 3300005539 Ga0068853_101741925 Ga0068853_1017419251 146
230 3300005543 Ga0070672_100001691 Ga0070672_10000169114 146
231 3300005543 Ga0070672_100791652 Ga0070672_1007916522 146
232 3300005546 Ga0070696_101329684 Ga0070696_1013296841 146
233 3300005547 Ga0070693_100030191 Ga0070693_1000301913 146
234 3300005547 Ga0070693_100603749 Ga0070693_1006037492 146
235 3300005548 Ga0070665_100020234 Ga0070665_1000202345 146
236 3300005548 Ga0070665_100178366 Ga0070665_1001783662 146
237 3300005563 Ga0068855_100003943 Ga0068855_1000039433 146
238 3300005563 Ga0068855_100026207 Ga0068855_1000262073 146
239 3300005563 Ga0068855_100112736 Ga0068855_1001127362 146
240 3300005563 Ga0068855_100170776 Ga0068855_1001707763 146
241 3300005563 Ga0068855_100688916 Ga0068855_1006889162 146
242 3300005563 Ga0068855_100852756 Ga0068855_1008527561 146
243 3300005563 Ga0068855_101769804 Ga0068855_1017698042 146
244 3300005564 Ga0070664_100006440 Ga0070664_10000644011 146
245 3300005564 Ga0070664_100028663 Ga0070664_1000286634 146
246 3300005564 Ga0070664_100047078 Ga0070664_1000470783 146
247 3300005564 Ga0070664_100068112 Ga0070664_1000681123 146
248 3300005564 Ga0070664_100068314 Ga0070664_1000683142 146
249 3300005564 Ga0070664_100157013 Ga0070664_1001570133 146
250 3300005564 Ga0070664_100168839 Ga0070664_1001688393 146
251 3300005564 Ga0070664_100812016 Ga0070664_1008120162 146
252 3300005577 Ga0068857_100012269 Ga0068857_1000122696 146
253 3300005577 Ga0068857_100016853 Ga0068857_1000168536 146
254 3300005577 Ga0068857_100437446 Ga0068857_1004374462 146
255 3300005577 Ga0068857_100584191 Ga0068857_1005841911 146
256 3300005577 Ga0068857_100995463 Ga0068857_1009954632 146
257 3300005578 Ga0068854_100017822 Ga0068854_1000178224 146
258 3300005578 Ga0068854_100213881 Ga0068854_1002138812 146
259 3300005578 Ga0068854_100391560 Ga0068854_1003915602 146
260 3300005578 Ga0068854_100488073 Ga0068854_1004880731 146
261 3300005614 Ga0068856_100017668 Ga0068856_1000176689 146
262 3300005614 Ga0068856_100071045 Ga0068856_1000710454 146
263 3300005614 Ga0068856_100435216 Ga0068856_1004352162 146
264 3300005614 Ga0068856_100460795 Ga0068856_1004607952 146
265 3300005614 Ga0068856_100504088 Ga0068856_1005040882 146
266 3300005616 Ga0068852_100000043 Ga0068852_10000004326 146
267 3300005616 Ga0068852_100003224 Ga0068852_1000032247 146
268 3300005616 Ga0068852_100087379 Ga0068852_1000873792 146
269 3300005616 Ga0068852_100105224 Ga0068852_1001052242 146
270 3300005616 Ga0068852_100134000 Ga0068852_1001340002 146
271 3300005616 Ga0068852_100186235 Ga0068852_1001862352 146
272 3300005616 Ga0068852_100247262 Ga0068852_1002472622 146
273 3300005616 Ga0068852_100263119 Ga0068852_1002631192 146
274 3300005616 Ga0068852_100327860 Ga0068852_1003278602 146
275 3300005616 Ga0068852_100447122 Ga0068852_1004471221 146
276 3300005616 Ga0068852_100509187 Ga0068852_1005091872 146
277 3300005616 Ga0068852_100652423 Ga0068852_1006524232 146
278 3300005616 Ga0068852_101301608 Ga0068852_1013016082 146
279 3300005618 Ga0068864_100011893 Ga0068864_1000118935 146
280 3300005834 Ga0068851_10005339 Ga0068851_100053394 146
281 3300005834 Ga0068851_10018748 Ga0068851_100187483 146
282 3300005834 Ga0068851_10035286 Ga0068851_100352863 146
283 3300005834 Ga0068851_10038966 Ga0068851_100389663 146
284 3300005834 Ga0068851_10045538 Ga0068851_100455382 146
285 3300005840 Ga0068870_10045636 Ga0068870_100456363 146
286 3300005841 Ga0068863_100030776 Ga0068863_1000307762 146
287 3300005841 Ga0068863_100132055 Ga0068863_1001320554 146
288 3300005842 Ga0068858_100327860 Ga0068858_1003278602 146
289 3300005843 Ga0068860_100111287 Ga0068860_1001112872 146
290 3300005843 Ga0068860_100388182 Ga0068860_1003881822 146
291 3300006173 Ga0070716_101269268 Ga0070716_1012692681 146
292 3300006177 Ga0075362_10036972 Ga0075362_100369722 146
293 3300006195 Ga0075366_10318872 Ga0075366_103188722 146
294 3300006237 Ga0097621_100538564 Ga0097621_1005385642 146
295 3300006353 Ga0075370_10046646 Ga0075370_100466462 146
296 3300006353 Ga0075370_10279050 Ga0075370_102790502 146
297 3300006358 Ga0068871_100005970 Ga0068871_1000059707 146
298 3300006931 Ga0097620_101631925 Ga0097620_1016319251 146
299 3300007076 Ga0075435_100566673 Ga0075435_1005666732 146
300 3300009093 Ga0105240_10023135 Ga0105240_100231354 146
301 3300009093 Ga0105240_10285810 Ga0105240_102858102 146
302 3300009093 Ga0105240_10296300 Ga0105240_102963002 146
303 3300009093 Ga0105240_10459837 Ga0105240_104598372 146
304 3300009148 Ga0105243_10265561 Ga0105243_102655612 146
305 3300009174 Ga0105241_10038432 Ga0105241_100384323 146
306 3300009174 Ga0105241_10144750 Ga0105241_101447503 146
307 3300009177 Ga0105248_10008019 Ga0105248_100080198 146
308 3300009177 Ga0105248_10013976 Ga0105248_100139768 146
309 3300009177 Ga0105248_10046063 Ga0105248_100460634 146
310 3300009545 Ga0105237_10013046 Ga0105237_100130464 146
311 3300009545 Ga0105237_10013830 Ga0105237_100138304 146
312 3300009551 Ga0105238_10014359 Ga0105238_100143595 146
313 3300009551 Ga0105238_10014766 Ga0105238_100147669 146
314 3300009551 Ga0105238_10027736 Ga0105238_100277367 146
315 3300009551 Ga0105238_10249556 Ga0105238_102495562 146
316 3300009551 Ga0105238_10738631 Ga0105238_107386312 146
317 3300009551 Ga0105238_12484118 Ga0105238_124841181 146
318 3300010375 Ga0105239_10473944 Ga0105239_104739442 146
319 3300013100 Ga0157373_10003505 Ga0157373_100035058 146
320 3300013100 Ga0157373_10023083 Ga0157373_100230834 146
321 3300013100 Ga0157373_10122033 Ga0157373_101220332 146
322 3300013100 Ga0157373_10204085 Ga0157373_102040852 146
323 3300013100 Ga0157373_10600654 Ga0157373_106006542 146
324 3300013102 Ga0157371_10009211 Ga0157371_100092117 146
325 3300013102 Ga0157371_10024590 Ga0157371_100245902 146
326 3300013102 Ga0157371_10031247 Ga0157371_100312472 146
327 3300013102 Ga0157371_10224176 Ga0157371_102241762 146
328 3300013102 Ga0157371_10230240 Ga0157371_102302402 146
329 3300013102 Ga0157371_10410021 Ga0157371_104100211 146
330 3300013104 Ga0157370_10002640 Ga0157370_100026407 146
331 3300013104 Ga0157370_10017787 Ga0157370_100177872 146
332 3300013104 Ga0157370_10054118 Ga0157370_100541183 146
333 3300013104 Ga0157370_10154929 Ga0157370_101549294 146
334 3300013104 Ga0157370_10197659 Ga0157370_101976593 146
335 3300013104 Ga0157370_10260872 Ga0157370_102608722 146
336 3300013104 Ga0157370_10512166 Ga0157370_105121662 146
337 3300013104 Ga0157370_11065351 Ga0157370_110653512 146
338 3300013105 Ga0157369_10009565 Ga0157369_100095654 146
339 3300013105 Ga0157369_10011956 Ga0157369_100119565 146
340 3300013105 Ga0157369_10036687 Ga0157369_100366875 146
341 3300013105 Ga0157369_10148511 Ga0157369_101485112 146
342 3300013105 Ga0157369_10196462 Ga0157369_101964622 146
343 3300013105 Ga0157369_10297249 Ga0157369_102972493 146
344 3300013105 Ga0157369_10350719 Ga0157369_103507193 146
345 3300013105 Ga0157369_10580459 Ga0157369_105804592 146
346 3300013105 Ga0157369_11582134 Ga0157369_115821342 146
347 3300013105 Ga0157369_12418399 Ga0157369_124183991 146
348 3300013296 Ga0157374_10041303 Ga0157374_100413032 146
349 3300013296 Ga0157374_10524342 Ga0157374_105243422 146
350 3300013306 Ga0163162_10010085 Ga0163162_100100853 146
351 3300013306 Ga0163162_10424950 Ga0163162_104249502 146
352 3300013306 Ga0163162_13353548 Ga0163162_133535481 146
353 3300013307 Ga0157372_10005358 Ga0157372_1000535810 146
354 3300013307 Ga0157372_10091413 Ga0157372_100914132 146
355 3300013307 Ga0157372_10199311 Ga0157372_101993112 146
356 3300013307 Ga0157372_10306604 Ga0157372_103066043 146
357 3300013307 Ga0157372_10316168 Ga0157372_103161682 146
358 3300013308 Ga0157375_10016550 Ga0157375_100165505 146
359 3300013308 Ga0157375_10331699 Ga0157375_103316992 146
360 3300014325 Ga0163163_10003524 Ga0163163_1000352412 146
361 3300014497 Ga0182008_10102452 Ga0182008_101024522 146
362 3300014745 Ga0157377_10150530 Ga0157377_101505302 146
363 3300014968 Ga0157379_10122684 Ga0157379_101226843 146
364 3300021358 Ga0213873_10000009 Ga0213873_10000009136 146
365 3300021384 Ga0213876_10000004 Ga0213876_10000004181 146
366 3300021384 Ga0213876_10208719 Ga0213876_102087192 146
367 3300021388 Ga0213875_10008191 Ga0213875_100081916 146
368 3300025315 Ga0207697_10003593 Ga0207697_100035932 146
369 3300025315 Ga0207697_10054258 Ga0207697_100542582 146
370 3300025315 Ga0207697_10056296 Ga0207697_100562962 146
371 3300025321 Ga0207656_10003790 Ga0207656_100037904 146
372 3300025321 Ga0207656_10017463 Ga0207656_100174632 146
373 3300025321 Ga0207656_10020842 Ga0207656_100208423 146
374 3300025901 Ga0207688_10093367 Ga0207688_100933672 146
375 3300025901 Ga0207688_10310041 Ga0207688_103100412 146
376 3300025903 Ga0207680_10007697 Ga0207680_100076975 146
377 3300025903 Ga0207680_10156783 Ga0207680_101567832 146
378 3300025903 Ga0207680_10736518 Ga0207680_107365182 146
379 3300025904 Ga0207647_10000069 Ga0207647_1000006945 146
380 3300025904 Ga0207647_10006349 Ga0207647_100063498 146
381 3300025904 Ga0207647_10012008 Ga0207647_100120089 146
382 3300025904 Ga0207647_10028658 Ga0207647_100286582 146
383 3300025907 Ga0207645_10113335 Ga0207645_101133352 146
384 3300025907 Ga0207645_10282613 Ga0207645_102826132 146
385 3300025909 Ga0207705_10007878 Ga0207705_100078787 146
386 3300025909 Ga0207705_10009747 Ga0207705_100097472 146
387 3300025909 Ga0207705_10010868 Ga0207705_100108684 146
388 3300025909 Ga0207705_10051015 Ga0207705_100510152 146
389 3300025909 Ga0207705_10101632 Ga0207705_101016322 146
390 3300025909 Ga0207705_10131531 Ga0207705_101315311 146
391 3300025909 Ga0207705_10208598 Ga0207705_102085981 146
392 3300025909 Ga0207705_10529268 Ga0207705_105292682 146
393 3300025909 Ga0207705_10535133 Ga0207705_105351332 146
394 3300025911 Ga0207654_10013252 Ga0207654_100132522 146
395 3300025911 Ga0207654_10020008 Ga0207654_100200082 146
396 3300025912 Ga0207707_10015225 Ga0207707_100152254 146
397 3300025912 Ga0207707_10068256 Ga0207707_100682562 146
398 3300025912 Ga0207707_10587938 Ga0207707_105879382 146
399 3300025913 Ga0207695_10012923 Ga0207695_100129237 146
400 3300025913 Ga0207695_10019220 Ga0207695_100192202 146
401 3300025913 Ga0207695_10032866 Ga0207695_100328663 146
402 3300025913 Ga0207695_10124440 Ga0207695_101244403 146
403 3300025913 Ga0207695_10272782 Ga0207695_102727822 146
404 3300025914 Ga0207671_10002421 Ga0207671_100024214 146
405 3300025914 Ga0207671_10027417 Ga0207671_100274172 146
406 3300025914 Ga0207671_10028986 Ga0207671_100289865 146
407 3300025917 Ga0207660_10047117 Ga0207660_100471174 146
408 3300025917 Ga0207660_10608929 Ga0207660_106089292 146
409 3300025918 Ga0207662_10280200 Ga0207662_102802002 146
410 3300025919 Ga0207657_10000946 Ga0207657_1000094614 146
411 3300025919 Ga0207657_10006094 Ga0207657_100060943 146
412 3300025919 Ga0207657_10006293 Ga0207657_100062932 146
413 3300025919 Ga0207657_10023777 Ga0207657_100237776 146
414 3300025919 Ga0207657_10036194 Ga0207657_100361946 146
415 3300025919 Ga0207657_10043813 Ga0207657_100438131 146
416 3300025919 Ga0207657_10055514 Ga0207657_100555142 146
417 3300025919 Ga0207657_10083179 Ga0207657_100831792 146
418 3300025919 Ga0207657_10195700 Ga0207657_101957002 146
419 3300025919 Ga0207657_10464525 Ga0207657_104645251 146
420 3300025919 Ga0207657_10631780 Ga0207657_106317802 146
421 3300025920 Ga0207649_10000018 Ga0207649_10000018152 146
422 3300025920 Ga0207649_10009705 Ga0207649_100097057 146
423 3300025920 Ga0207649_10019643 Ga0207649_100196434 146
424 3300025920 Ga0207649_10030726 Ga0207649_100307262 146
425 3300025920 Ga0207649_10053426 Ga0207649_100534261 146
426 3300025920 Ga0207649_10137790 Ga0207649_101377901 146
427 3300025920 Ga0207649_10431728 Ga0207649_104317281 146
428 3300025920 Ga0207649_10667629 Ga0207649_106676291 146
429 3300025920 Ga0207649_10854057 Ga0207649_108540571 146
430 3300025921 Ga0207652_11129588 Ga0207652_111295881 146
431 3300025924 Ga0207694_10002217 Ga0207694_100022178 146
432 3300025924 Ga0207694_10003033 Ga0207694_100030338 146
433 3300025924 Ga0207694_10008340 Ga0207694_100083405 146
434 3300025924 Ga0207694_10030175 Ga0207694_100301753 146
435 3300025924 Ga0207694_10034936 Ga0207694_100349364 146
436 3300025924 Ga0207694_10289940 Ga0207694_102899402 146
437 3300025925 Ga0207650_10011935 Ga0207650_100119355 146
438 3300025925 Ga0207650_10036094 Ga0207650_100360944 146
439 3300025925 Ga0207650_10154698 Ga0207650_101546982 146
440 3300025925 Ga0207650_10220742 Ga0207650_102207422 146
441 3300025925 Ga0207650_10371331 Ga0207650_103713312 146
442 3300025925 Ga0207650_10599895 Ga0207650_105998952 146
443 3300025926 Ga0207659_10033609 Ga0207659_100336092 146
444 3300025926 Ga0207659_10192355 Ga0207659_101923552 146
445 3300025929 Ga0207664_10015933 Ga0207664_100159339 146
446 3300025929 Ga0207664_10162370 Ga0207664_101623702 146
447 3300025931 Ga0207644_10007787 Ga0207644_100077874 146
448 3300025931 Ga0207644_10009323 Ga0207644_100093235 146
449 3300025931 Ga0207644_10480352 Ga0207644_104803521 146
450 3300025932 Ga0207690_10005486 Ga0207690_1000548610 146
451 3300025932 Ga0207690_10097074 Ga0207690_100970742 146
452 3300025932 Ga0207690_10102515 Ga0207690_101025153 146
453 3300025932 Ga0207690_10227811 Ga0207690_102278112 146
454 3300025932 Ga0207690_10308614 Ga0207690_103086142 146
455 3300025932 Ga0207690_10615479 Ga0207690_106154792 146
456 3300025932 Ga0207690_10977762 Ga0207690_109777622 146
457 3300025933 Ga0207706_10002629 Ga0207706_100026298 146
458 3300025933 Ga0207706_10003424 Ga0207706_1000342410 146
459 3300025933 Ga0207706_10010762 Ga0207706_100107629 146
460 3300025933 Ga0207706_10025962 Ga0207706_100259624 146
461 3300025933 Ga0207706_10289439 Ga0207706_102894392 146
462 3300025933 Ga0207706_10324357 Ga0207706_103243572 146
463 3300025933 Ga0207706_10487335 Ga0207706_104873352 146
464 3300025933 Ga0207706_10500534 Ga0207706_105005342 146
465 3300025936 Ga0207670_10298458 Ga0207670_102984582 146
466 3300025937 Ga0207669_10246065 Ga0207669_102460652 146
467 3300025940 Ga0207691_10001147 Ga0207691_100011475 146
468 3300025940 Ga0207691_10280348 Ga0207691_102803482 146
469 3300025941 Ga0207711_10017482 Ga0207711_100174822 146
470 3300025941 Ga0207711_10028757 Ga0207711_100287572 146
471 3300025944 Ga0207661_10090118 Ga0207661_100901182 146
472 3300025944 Ga0207661_10198982 Ga0207661_101989822 146
473 3300025945 Ga0207679_10009073 Ga0207679_100090735 146
474 3300025945 Ga0207679_10081875 Ga0207679_100818752 146
475 3300025945 Ga0207679_10083379 Ga0207679_100833792 146
476 3300025945 Ga0207679_10175885 Ga0207679_101758853 146
477 3300025945 Ga0207679_10324444 Ga0207679_103244442 146
478 3300025945 Ga0207679_10735883 Ga0207679_107358832 146
479 3300025949 Ga0207667_10011976 Ga0207667_100119765 146
480 3300025949 Ga0207667_10012325 Ga0207667_100123258 146
481 3300025949 Ga0207667_10019585 Ga0207667_100195851 146
482 3300025949 Ga0207667_10038532 Ga0207667_100385328 146
483 3300025949 Ga0207667_10128228 Ga0207667_101282284 146
484 3300025949 Ga0207667_10395800 Ga0207667_103958001 146
485 3300025949 Ga0207667_10600544 Ga0207667_106005442 146
486 3300025960 Ga0207651_10014761 Ga0207651_100147615 146
487 3300025960 Ga0207651_10042885 Ga0207651_100428854 146
488 3300025960 Ga0207651_10191294 Ga0207651_101912943 146
489 3300025972 Ga0207668_10291889 Ga0207668_102918892 146
490 3300025981 Ga0207640_10045698 Ga0207640_100456984 146
491 3300025981 Ga0207640_10088868 Ga0207640_100888684 146
492 3300025981 Ga0207640_10091310 Ga0207640_100913102 146
493 3300025981 Ga0207640_10162576 Ga0207640_101625762 146
494 3300025981 Ga0207640_10309509 Ga0207640_103095092 146
495 3300025986 Ga0207658_10015187 Ga0207658_100151877 146
496 3300025986 Ga0207658_10281570 Ga0207658_102815702 146
497 3300025986 Ga0207658_10535266 Ga0207658_105352662 146
498 3300025986 Ga0207658_11011418 Ga0207658_110114182 146
499 3300026023 Ga0207677_10179727 Ga0207677_101797272 146
500 3300026023 Ga0207677_10447021 Ga0207677_104470212 146
501 3300026023 Ga0207677_10450546 Ga0207677_104505462 146
502 3300026035 Ga0207703_10320563 Ga0207703_103205632 146
503 3300026041 Ga0207639_10000199 Ga0207639_1000019940 146
504 3300026041 Ga0207639_10000798 Ga0207639_100007981 146
505 3300026041 Ga0207639_10003539 Ga0207639_100035394 146
506 3300026041 Ga0207639_10042910 Ga0207639_100429104 146
507 3300026041 Ga0207639_10062330 Ga0207639_100623302 146
508 3300026067 Ga0207678_10009190 Ga0207678_100091908 146
509 3300026067 Ga0207678_10014095 Ga0207678_100140955 146
510 3300026067 Ga0207678_10024372 Ga0207678_100243724 146
511 3300026067 Ga0207678_10024379 Ga0207678_100243797 146
512 3300026067 Ga0207678_10025444 Ga0207678_100254449 146
513 3300026067 Ga0207678_10074648 Ga0207678_100746482 146
514 3300026067 Ga0207678_11239915 Ga0207678_112399152 146
515 3300026078 Ga0207702_10007759 Ga0207702_100077594 146
516 3300026078 Ga0207702_10024793 Ga0207702_100247932 146
517 3300026078 Ga0207702_10024945 Ga0207702_100249453 146
518 3300026078 Ga0207702_10025873 Ga0207702_100258732 146
519 3300026078 Ga0207702_10033994 Ga0207702_100339943 146
520 3300026078 Ga0207702_10058354 Ga0207702_100583545 146
521 3300026078 Ga0207702_10898435 Ga0207702_108984352 146
522 3300026088 Ga0207641_10025359 Ga0207641_100253592 146
523 3300026088 Ga0207641_10115462 Ga0207641_101154622 146
524 3300026089 Ga0207648_10259389 Ga0207648_102593892 146
525 3300026095 Ga0207676_10003563 Ga0207676_1000356312 146
526 3300026095 Ga0207676_10619733 Ga0207676_106197332 146
527 3300026116 Ga0207674_10000580 Ga0207674_1000058027 146
528 3300026116 Ga0207674_10005390 Ga0207674_100053906 146
529 3300026116 Ga0207674_10011216 Ga0207674_100112167 146
530 3300026116 Ga0207674_10018837 Ga0207674_100188376 146
531 3300026116 Ga0207674_10038782 Ga0207674_100387822 146
532 3300026116 Ga0207674_10062694 Ga0207674_100626944 146
533 3300026116 Ga0207674_10194816 Ga0207674_101948162 146
534 3300026121 Ga0207683_10005822 Ga0207683_1000582210 146
535 3300026121 Ga0207683_10007206 Ga0207683_100072063 146
536 3300026121 Ga0207683_10196562 Ga0207683_101965623 146
537 3300026142 Ga0207698_10000388 Ga0207698_1000038810 146
538 3300026142 Ga0207698_10000449 Ga0207698_1000044924 146
539 3300026142 Ga0207698_10000703 Ga0207698_1000070319 146
540 3300026142 Ga0207698_10029780 Ga0207698_100297805 146
541 3300026142 Ga0207698_10091007 Ga0207698_100910072 146
542 3300026142 Ga0207698_10097135 Ga0207698_100971353 146
543 3300026142 Ga0207698_10119516 Ga0207698_101195162 146
544 3300026142 Ga0207698_10328013 Ga0207698_103280132 146
545 3300026142 Ga0207698_10456781 Ga0207698_104567811 146
546 3300028379 Ga0268266_10016834 Ga0268266_100168345 146
547 3300028379 Ga0268266_10138249 Ga0268266_101382492 146
548 3300028379 Ga0268266_10283725 Ga0268266_102837252 146
549 3300028380 Ga0268265_10102231 Ga0268265_101022311 146
550 3300028381 Ga0268264_10091232 Ga0268264_100912323 146
551 3300028381 Ga0268264_10362729 Ga0268264_103627292 146
552 3300031239 Ga0265328_10053498 Ga0265328_100534982 146
553 3300031548 Ga0307408_100011699 Ga0307408_1000116992 146
554 3300031548 Ga0307408_100012386 Ga0307408_1000123862 146
555 3300031548 Ga0307408_100073431 Ga0307408_1000734312 146
556 3300031548 Ga0307408_100130409 Ga0307408_1001304092 146
557 3300031691 Ga0316579_10031452 Ga0316579_100314522 146
558 3300031731 Ga0307405_10025543 Ga0307405_100255434 146
559 3300031731 Ga0307405_10117036 Ga0307405_101170362 146
560 3300031731 Ga0307405_10337372 Ga0307405_103373722 146
561 3300031731 Ga0307405_11079815 Ga0307405_110798151 146
562 3300031824 Ga0307413_10034421 Ga0307413_100344212 146
563 3300031824 Ga0307413_10715152 Ga0307413_107151522 146
564 3300031824 Ga0307413_10845977 Ga0307413_108459772 146
565 3300031852 Ga0307410_10005366 Ga0307410_100053664 146
566 3300031852 Ga0307410_10313018 Ga0307410_103130182 146
567 3300031901 Ga0307406_10012211 Ga0307406_100122113 146
568 3300031901 Ga0307406_10573673 Ga0307406_105736732 146
569 3300031901 Ga0307406_11706707 Ga0307406_117067071 146
570 3300031903 Ga0307407_10038169 Ga0307407_100381693 146
571 3300031911 Ga0307412_10070875 Ga0307412_100708752 146
572 3300031995 Ga0307409_100075243 Ga0307409_1000752432 146
573 3300031995 Ga0307409_100158881 Ga0307409_1001588812 146
574 3300031995 Ga0307409_100343378 Ga0307409_1003433782 146
575 3300032002 Ga0307416_100081790 Ga0307416_1000817902 146
576 3300032002 Ga0307416_100165055 Ga0307416_1001650552 146
577 3300032004 Ga0307414_10138487 Ga0307414_101384872 146
578 3300032004 Ga0307414_10231500 Ga0307414_102315002 146
579 3300032004 Ga0307414_11569106 Ga0307414_115691061 146
580 3300032005 Ga0307411_10336648 Ga0307411_103366482 146
581 3300032005 Ga0307411_10520594 Ga0307411_105205941 146
582 3300032005 Ga0307411_10826972 Ga0307411_108269722 146
583 3300032126 Ga0307415_100027644 Ga0307415_1000276443 146
584 3300032126 Ga0307415_100144897 Ga0307415_1001448973 146
585 3300032126 Ga0307415_100742262 Ga0307415_1007422622 146
586 3300032126 Ga0307415_100766050 Ga0307415_1007660502 146
587 3300035113 Ga0373936_0187459 Ga0373936_0187459_413_880 146
588 3300035170 Ga0373943_0013861 Ga0373943_0013861_1095_1562 146
589 3300035170 Ga0373943_0392543 Ga0373943_0392543_127_594 146
590 3300035695 Ga0373927_0255173 Ga0373927_0255173_278_745 146
591 3300036401 Ga0373937_0598278 Ga0373937_0598278_223_690 146
592 3300036401 Ga0373937_1027458 Ga0373937_1027458_255_725 146
593 3300036647 Ga0316582_0002330 Ga0316582_0002330_2308_2775 146
594 3300037068 Ga0373925_0016074 Ga0373925_0016074_1096_1563 146
595 3300037068 Ga0373925_1022935 Ga0373925_1022935_84_551 146
596 3300037312 Ga0395899_0020496 Ga0395899_0020496_3479_3925 146
597 3300037312 Ga0395899_0026549 Ga0395899_0026549_546_1010 146
598 3300037312 Ga0395899_0054171 Ga0395899_0054171_1859_2323 146
599 3300037312 Ga0395899_0086819 Ga0395899_0086819_1790_2257 146
600 3300037312 Ga0395899_0157483 Ga0395899_0157483_735_1202 146
601 3300037312 Ga0395899_0250124 Ga0395899_0250124_300_764 146
602 3300037312 Ga0395899_0314434 Ga0395899_0314434_420_866 146
603 3300037312 Ga0395899_0324449 Ga0395899_0324449_192_659 146
604 3300037418 Ga0395900_0020351 Ga0395900_0020351_1180_1647 146
605 3300037418 Ga0395900_0021453 Ga0395900_0021453_1931_2377 146
606 3300037418 Ga0395900_0031110 Ga0395900_0031110_2989_3456 146
607 3300037418 Ga0395900_0046969 Ga0395900_0046969_2777_3244 146
608 3300037418 Ga0395900_0074177 Ga0395900_0074177_2658_3104 146
609 3300037418 Ga0395900_0091530 Ga0395900_0091530_2474_2938 146
610 3300037418 Ga0395900_0098104 Ga0395900_0098104_1434_1901 146
611 3300037418 Ga0395900_0162102 Ga0395900_0162102_500_964 146
612 3300037418 Ga0395900_0197842 Ga0395900_0197842_1123_1590 146
613 3300037418 Ga0395900_0734539 Ga0395900_0734539_113_580 146
614 3300037418 Ga0395900_0999385 Ga0395900_0999385_24_488 146
615 3300037466 Ga0395898_0003799 Ga0395898_0003799_12042_12488 146
616 3300037466 Ga0395898_0023568 Ga0395898_0023568_4133_4579 146
617 3300037466 Ga0395898_0032370 Ga0395898_0032370_2742_3209 146
618 3300037466 Ga0395898_0068940 Ga0395898_0068940_482_949 146
619 3300037466 Ga0395898_0184156 Ga0395898_0184156_152_616 146
620 3300037466 Ga0395898_0304766 Ga0395898_0304766_86_532 146
621 3300037466 Ga0395898_0788184 Ga0395898_0788184_407_874 146
622 3300037471 Ga0395905_0009030 Ga0395905_0009030_1376_1843 146
623 3300037471 Ga0395905_0012524 Ga0395905_0012524_5857_6318 146
624 3300037471 Ga0395905_0029223 Ga0395905_0029223_65_529 146
625 3300037471 Ga0395905_0029724 Ga0395905_0029724_3198_3665 146
626 3300037471 Ga0395905_0036985 Ga0395905_0036985_15_485 146
627 3300037471 Ga0395905_0076008 Ga0395905_0076008_1020_1487 146
628 3300037471 Ga0395905_0159977 Ga0395905_0159977_1394_1858 146
629 3300037471 Ga0395905_0170844 Ga0395905_0170844_259_726 146
630 3300037471 Ga0395905_0300859 Ga0395905_0300859_620_1087 146
631 3300037471 Ga0395905_0443257 Ga0395905_0443257_527_991 146
632 3300037471 Ga0395905_0527336 Ga0395905_0527336_15_479 146
633 3300037471 Ga0395905_0670129 Ga0395905_0670129_334_798 146
634 3300037471 Ga0395905_0876680 Ga0395905_0876680_292_738 146
635 3300037471 Ga0395905_1061240 Ga0395905_1061240_91_558 146
636 3300037853 Ga0436364_0996148 Ga0436364_0996148_10978_11436 146
637 3300038443 Ga0395901_0022979 Ga0395901_0022979_1715_2161 146
638 3300038443 Ga0395901_0072007 Ga0395901_0072007_1992_2459 146
639 3300038443 Ga0395901_0108065 Ga0395901_0108065_676_1143 146
640 3300038443 Ga0395901_0243027 Ga0395901_0243027_1085_1531 146
641 3300038443 Ga0395901_0423619 Ga0395901_0423619_405_872 146
642 3300038443 Ga0395901_0530851 Ga0395901_0530851_172_618 146
643 3300038443 Ga0395901_0640889 Ga0395901_0640889_119_586 146
644 3300038443 Ga0395901_0770463 Ga0395901_0770463_395_841 146
645 3300039437 Ga0436365_0183072 Ga0436365_0183072_13815_14279 146
646 3300039450 Ga0436363_1686935 Ga0436363_1686935_266_730 146
647 3300039453 Ga0436362_0383697 Ga0436362_0383697_70588_71058 146
648 3300041494 Ga0451837_1281924 Ga0451837_1281924_157_618 146
649 3300042439 Ga0439464_0154557 Ga0439464_0154557_68_535 146
650 3300044656 Ga0466969_0110114 Ga0466969_0110114_670_1116 146
651 3300044683 Ga0466965_0209903 Ga0466965_0209903_117_617 146
652 3300044683 Ga0466965_0387783 Ga0466965_0387783_217_678 146
653 3300044684 Ga0466966_0094752 Ga0466966_0094752_969_1433 146
654 3300044684 Ga0466966_0631426 Ga0466966_0631426_153_614 146
655 3300044693 Ga0466961_0009863 Ga0466961_0009863_2739_3200 146
656 3300044693 Ga0466961_0238205 Ga0466961_0238205_19_483 146
657 3300044694 Ga0466963_0000335 Ga0466963_0000335_9166_9612 146
658 3300044694 Ga0466963_0333256 Ga0466963_0333256_219_665 146
659 3300044765 Ga0466970_0037549 Ga0466970_0037549_607_1068 146
660 3300044901 Ga0466960_0011969 Ga0466960_0011969_641_1141 146
661 3300045049 Ga0466959_0012236 Ga0466959_0012236_1304_1768 146
662 3300045049 Ga0466959_0049179 Ga0466959_0049179_1107_1568 146
663 3300045049 Ga0466959_0158752 Ga0466959_0158752_584_1030 146
664 3300045836 Ga0466958_0183574 Ga0466958_0183574_132_596 146
665 3300045836 Ga0466958_0244048 Ga0466958_0244048_384_845 146
666 3300045976 Ga0466967_0020512 Ga0466967_0020512_4728_5174 146
667 3300045976 Ga0466967_0259495 Ga0466967_0259495_281_748 146
668 3300045976 Ga0466967_0489618 Ga0466967_0489618_284_748 146
669 3300045976 Ga0466967_1398101 Ga0466967_1398101_133_597 146
670 3300046472 Ga0495580_0631443 Ga0495580_0631443_114_578 146
671 3300046523 Ga0495644_0240472 Ga0495644_0240472_98_565 146
672 3300046539 Ga0495621_0000149 Ga0495621_0000149_6371_6838 146
673 3300046539 Ga0495621_0099692 Ga0495621_0099692_74_541 146
674 3300046684 Ga0495669_0031735 Ga0495669_0031735_653_1120 146
675 3300046684 Ga0495669_0280856 Ga0495669_0280856_30_497 146
676 3300046691 Ga0495670_0004834 Ga0495670_0004834_3295_3762 146
677 3300048904 Ga0496101_0067569 Ga0496101_0067569_844_1311 146
678 3300048904 Ga0496101_0556563 Ga0496101_0556563_255_722 146
679 3300048905 Ga0496102_0036646 Ga0496102_0036646_928_1401 146
680 3300048905 Ga0496102_0105107 Ga0496102_0105107_875_1342 146
681 3300048905 Ga0496102_0767589 Ga0496102_0767589_97_564 146
682 3300048906 Ga0496103_0007651 Ga0496103_0007651_2143_2616 146
683 3300048907 Ga0496104_0719517 Ga0496104_0719517_407_874 146
684 3300048907 Ga0496104_0740400 Ga0496104_0740400_75_542 146
685 3300048908 Ga0496105_0155111 Ga0496105_0155111_1056_1523 146
686 3300048908 Ga0496105_0292473 Ga0496105_0292473_549_1016 146
687 3300048910 Ga0496107_0132761 Ga0496107_0132761_1327_1794 146
688 3300048910 Ga0496107_0825241 Ga0496107_0825241_109_576 146
689 3300048911 Ga0496108_0001925 Ga0496108_0001925_2007_2474 146
690 3300048911 Ga0496108_0180117 Ga0496108_0180117_944_1390 146
691 3300048912 Ga0496109_0015923 Ga0496109_0015923_2549_3016 146
692 3300048912 Ga0496109_0321539 Ga0496109_0321539_478_924 146
693 3300048913 Ga0496110_0021431 Ga0496110_0021431_1556_2023 146
694 3300048914 Ga0496111_0007998 Ga0496111_0007998_3745_4212 146
695 3300048914 Ga0496111_0064928 Ga0496111_0064928_1210_1677 146
696 3300048915 Ga0496112_0002858 Ga0496112_0002858_2667_3134 146
697 3300048915 Ga0496112_0019601 Ga0496112_0019601_3000_3467 146
698 3300048915 Ga0496112_0151041 Ga0496112_0151041_497_964 146
699 3300048915 Ga0496112_0293726 Ga0496112_0293726_444_911 146
700 3300048915 Ga0496112_0690172 Ga0496112_0690172_286_750 146
701 3300048916 Ga0496113_0016617 Ga0496113_0016617_4158_4625 146
702 3300048916 Ga0496113_0022168 Ga0496113_0022168_1990_2457 146
703 3300048917 Ga0496114_1215607 Ga0496114_1215607_45_512 146
704 3300048920 Ga0496117_0007348 Ga0496117_0007348_1400_1873 146
705 3300048921 Ga0496118_0137078 Ga0496118_0137078_105_578 146
706 3300048929 Ga0496126_0249921 Ga0496126_0249921_461_922 146
707 3300049656 Ga0501209_016085 Ga0501209_016085_817_1263 146
708 3300049656 Ga0501209_211395 Ga0501209_211395_101_547 146
709 3300049661 Ga0501217_138341 Ga0501217_138341_54_500 146
710 3300049664 Ga0501224_004198 Ga0501224_004198_958_1404 146
711 3300049664 Ga0501224_016950 Ga0501224_016950_404_865 146
712 3300049665 Ga0501227_052572 Ga0501227_052572_191_637 146
713 3300049665 Ga0501227_240487 Ga0501227_240487_53_499 146
714 3300049668 Ga0501233_028065 Ga0501233_028065_381_827 146
715 3300049668 Ga0501233_139981 Ga0501233_139981_53_499 146
716 3300049669 Ga0501235_007990 Ga0501235_007990_1470_1916 146
717 3300049679 Ga0501249_070337 Ga0501249_070337_226_672 146
718 3300049686 Ga0501257_024804 Ga0501257_024804_564_1010 146
719 3300049686 Ga0501257_120176 Ga0501257_120176_246_692 146
720 3300049705 Ga0501225_0023711 Ga0501225_0023711_1013_1459 146
721 3300049706 Ga0501229_049571 Ga0501229_049571_150_596 146
722 3300049707 Ga0501234_003083 Ga0501234_003083_1176_1622 146
723 3300049759 Ga0501262_004084 Ga0501262_004084_243_689 146
724 3300049760 Ga0501263_028977 Ga0501263_028977_264_710 146
725 3300049764 Ga0501267_013378 Ga0501267_013378_352_798 146
726 3300049769 Ga0501272_024815 Ga0501272_024815_172_618 146
727 3300049775 Ga0501279_073034 Ga0501279_073034_54_500 146
728 3300049823 Ga0501044_1125944 Ga0501044_1125944_138_584 146
729 3300050493 nmdc:mga0k408_302908_c1 nmdc:mga0k408_302908_c1_141_623 146
730 3300050496 nmdc:mga07m45_1034_c1 nmdc:mga07m45_1034_c1_405_887 146
731 3300050496 nmdc:mga07m45_176878_c1 nmdc:mga07m45_176878_c1_497_958 146
732 3300050496 nmdc:mga07m45_51034_c1 nmdc:mga07m45_51034_c1_582_1049 146
733 3300050513 nmdc:mga0rr50_414273_c1 nmdc:mga0rr50_414273_c1_166_633 146
734 3300050516 nmdc:mga0sz30_20166_c1 nmdc:mga0sz30_20166_c1_1838_2302 146
735 3300053146 Ga0500588_0163466 Ga0500588_0163466_194_655 146
736 2162886012 MBSR1b_contig_4721503 MBSR1b_0235.00004320 147
737 3300003203 JGI25406J46586_10132469 JGI25406J46586_101324691 147
738 3300003215 JGI25153J46596_10001155 JGI25153J46596_100011557 147
739 3300003784 Ga0055534_1005827 Ga0055534_10058273 147
740 3300003791 Ga0055530_10000197 Ga0055530_100001977 147
741 3300003794 Ga0055531_10008524 Ga0055531_100085244 147
742 3300005327 Ga0070658_10003377 Ga0070658_100033774 147
743 3300005327 Ga0070658_10347241 Ga0070658_103472412 147
744 3300005329 Ga0070683_100071884 Ga0070683_1000718844 147
745 3300005330 Ga0070690_100591973 Ga0070690_1005919731 147
746 3300005336 Ga0070680_100758450 Ga0070680_1007584501 147
747 3300005337 Ga0070682_100141471 Ga0070682_1001414711 147
748 3300005339 Ga0070660_100001476 Ga0070660_10000147614 147
749 3300005339 Ga0070660_100746407 Ga0070660_1007464071 147
750 3300005340 Ga0070689_101334296 Ga0070689_1013342962 147
751 3300005341 Ga0070691_10071076 Ga0070691_100710762 147
752 3300005344 Ga0070661_100014609 Ga0070661_1000146097 147
753 3300005345 Ga0070692_10100480 Ga0070692_101004802 147
754 3300005366 Ga0070659_100002899 Ga0070659_1000028996 147
755 3300005366 Ga0070659_100141380 Ga0070659_1001413802 147
756 3300005366 Ga0070659_100527319 Ga0070659_1005273191 147
757 3300005444 Ga0070694_100024929 Ga0070694_1000249292 147
758 3300005455 Ga0070663_100028995 Ga0070663_1000289953 147
759 3300005455 Ga0070663_101203871 Ga0070663_1012038712 147
760 3300005457 Ga0070662_100000183 Ga0070662_10000018320 147
761 3300005457 Ga0070662_100077429 Ga0070662_1000774293 147
762 3300005457 Ga0070662_100733772 Ga0070662_1007337722 147
763 3300005458 Ga0070681_10004781 Ga0070681_100047813 147
764 3300005458 Ga0070681_10120408 Ga0070681_101204082 147
765 3300005467 Ga0070706_101056268 Ga0070706_1010562681 147
766 3300005518 Ga0070699_100994270 Ga0070699_1009942701 147
767 3300005530 Ga0070679_100001448 Ga0070679_10000144813 147
768 3300005530 Ga0070679_100372176 Ga0070679_1003721762 147
769 3300005530 Ga0070679_102005223 Ga0070679_1020052231 147
770 3300005535 Ga0070684_100202819 Ga0070684_1002028192 147
771 3300005539 Ga0068853_100002487 Ga0068853_1000024874 147
772 3300005539 Ga0068853_100120161 Ga0068853_1001201612 147
773 3300005544 Ga0070686_100377842 Ga0070686_1003778422 147
774 3300005545 Ga0070695_100008415 Ga0070695_1000084158 147
775 3300005546 Ga0070696_100077670 Ga0070696_1000776702 147
776 3300005547 Ga0070693_100439818 Ga0070693_1004398182 147
777 3300005547 Ga0070693_100739418 Ga0070693_1007394181 147
778 3300005549 Ga0070704_100521830 Ga0070704_1005218302 147
779 3300005563 Ga0068855_100004493 Ga0068855_10000449315 147
780 3300005563 Ga0068855_100111889 Ga0068855_1001118892 147
781 3300005563 Ga0068855_100387828 Ga0068855_1003878282 147
782 3300005564 Ga0070664_100002251 Ga0070664_10000225111 147
783 3300005564 Ga0070664_100070632 Ga0070664_1000706323 147
784 3300005577 Ga0068857_100012687 Ga0068857_10001268710 147
785 3300005577 Ga0068857_100208205 Ga0068857_1002082053 147
786 3300005578 Ga0068854_100006566 Ga0068854_1000065668 147
787 3300005614 Ga0068856_100025094 Ga0068856_1000250943 147
788 3300005614 Ga0068856_100282694 Ga0068856_1002826944 147
789 3300005615 Ga0070702_101221436 Ga0070702_1012214361 147
790 3300005616 Ga0068852_100371488 Ga0068852_1003714882 147
791 3300005617 Ga0068859_100664366 Ga0068859_1006643661 147
792 3300005981 Ga0081538_10002850 Ga0081538_100028505 147
793 3300006038 Ga0075365_10360716 Ga0075365_103607162 147
794 3300006038 Ga0075365_10698794 Ga0075365_106987942 147
795 3300006042 Ga0075368_10055219 Ga0075368_100552192 147
796 3300006048 Ga0075363_100043168 Ga0075363_1000431682 147
797 3300006048 Ga0075363_100090176 Ga0075363_1000901762 147
798 3300006048 Ga0075363_100293064 Ga0075363_1002930641 147
799 3300006051 Ga0075364_10264046 Ga0075364_102640462 147
800 3300006177 Ga0075362_10179504 Ga0075362_101795042 147
801 3300006177 Ga0075362_10262266 Ga0075362_102622661 147
802 3300006177 Ga0075362_10483872 Ga0075362_104838722 147
803 3300006178 Ga0075367_10133599 Ga0075367_101335992 147
804 3300006178 Ga0075367_10167143 Ga0075367_101671432 147
805 3300006178 Ga0075367_10221779 Ga0075367_102217792 147
806 3300006186 Ga0075369_10025662 Ga0075369_100256622 147
807 3300006195 Ga0075366_10020324 Ga0075366_100203242 147
808 3300006195 Ga0075366_10506399 Ga0075366_105063991 147
809 3300006195 Ga0075366_10531274 Ga0075366_105312742 147
810 3300006237 Ga0097621_100528173 Ga0097621_1005281732 147
811 3300006353 Ga0075370_10070416 Ga0075370_100704162 147
812 3300006846 Ga0075430_100231300 Ga0075430_1002313002 147
813 3300006847 Ga0075431_100175944 Ga0075431_1001759442 147
814 3300006852 Ga0075433_10412856 Ga0075433_104128562 147
815 3300006881 Ga0068865_100758238 Ga0068865_1007582382 147
816 3300006931 Ga0097620_100664429 Ga0097620_1006644291 147
817 3300009094 Ga0111539_10180978 Ga0111539_101809782 147
818 3300009147 Ga0114129_10380719 Ga0114129_103807192 147
819 3300009553 Ga0105249_11441446 Ga0105249_114414462 147
820 3300010159 Ga0099796_10283404 Ga0099796_102834042 147
821 3300011119 Ga0105246_10000234 Ga0105246_100002344 147
822 3300013100 Ga0157373_10019882 Ga0157373_100198823 147
823 3300013102 Ga0157371_10001424 Ga0157371_1000142423 147
824 3300013102 Ga0157371_10028143 Ga0157371_100281433 147
825 3300013102 Ga0157371_10187667 Ga0157371_101876672 147
826 3300013102 Ga0157371_10365775 Ga0157371_103657752 147
827 3300013102 Ga0157371_10850596 Ga0157371_108505962 147
828 3300013104 Ga0157370_10016740 Ga0157370_100167402 147
829 3300013105 Ga0157369_10005291 Ga0157369_100052916 147
830 3300013297 Ga0157378_10890919 Ga0157378_108909192 147
831 3300013306 Ga0163162_11678379 Ga0163162_116783791 147
832 3300013307 Ga0157372_10026427 Ga0157372_100264275 147
833 3300013308 Ga0157375_11392803 Ga0157375_113928032 147
834 3300014325 Ga0163163_12094545 Ga0163163_120945452 147
835 3300014326 Ga0157380_11061162 Ga0157380_110611622 147
836 3300014497 Ga0182008_10040430 Ga0182008_100404302 147
837 3300014969 Ga0157376_11916234 Ga0157376_119162342 147
838 3300015261 Ga0182006_1056708 Ga0182006_10567082 147
839 3300017792 Ga0163161_10405737 Ga0163161_104057372 147
840 3300025291 Ga0209675_1000162 Ga0209675_100016250 147
841 3300025292 Ga0209676_1000113 Ga0209676_1000113119 147
842 3300025292 Ga0209676_1000146 Ga0209676_1000146120 147
843 3300025292 Ga0209676_1002307 Ga0209676_100230710 147
844 3300025294 Ga0209025_1035622 Ga0209025_10356222 147
845 3300025297 Ga0209758_1063445 Ga0209758_10634452 147
846 3300025298 Ga0209050_1000126 Ga0209050_1000126119 147
847 3300025298 Ga0209050_1013537 Ga0209050_10135372 147
848 3300025304 Ga0209257_1000256 Ga0209257_1000256113 147
849 3300025304 Ga0209257_1002727 Ga0209257_100272716 147
850 3300025909 Ga0207705_10034493 Ga0207705_100344934 147
851 3300025909 Ga0207705_10185131 Ga0207705_101851312 147
852 3300025910 Ga0207684_10854359 Ga0207684_108543592 147
853 3300025912 Ga0207707_10013904 Ga0207707_100139045 147
854 3300025912 Ga0207707_10510449 Ga0207707_105104492 147
855 3300025912 Ga0207707_10670306 Ga0207707_106703062 147
856 3300025913 Ga0207695_11444970 Ga0207695_114449701 147
857 3300025917 Ga0207660_10287468 Ga0207660_102874682 147
858 3300025917 Ga0207660_10881821 Ga0207660_108818211 147
859 3300025919 Ga0207657_10000123 Ga0207657_1000012332 147
860 3300025919 Ga0207657_10401043 Ga0207657_104010432 147
861 3300025920 Ga0207649_10020903 Ga0207649_100209032 147
862 3300025921 Ga0207652_10060515 Ga0207652_100605155 147
863 3300025921 Ga0207652_10291484 Ga0207652_102914842 147
864 3300025921 Ga0207652_10415114 Ga0207652_104151142 147
865 3300025929 Ga0207664_10449906 Ga0207664_104499062 147
866 3300025932 Ga0207690_10035197 Ga0207690_100351972 147
867 3300025932 Ga0207690_10418816 Ga0207690_104188161 147
868 3300025932 Ga0207690_10826067 Ga0207690_108260672 147
869 3300025933 Ga0207706_10000193 Ga0207706_1000019352 147
870 3300025933 Ga0207706_10065052 Ga0207706_100650524 147
871 3300025933 Ga0207706_10089071 Ga0207706_100890711 147
872 3300025933 Ga0207706_11235848 Ga0207706_112358482 147
873 3300025936 Ga0207670_10718708 Ga0207670_107187082 147
874 3300025938 Ga0207704_10294652 Ga0207704_102946522 147
875 3300025941 Ga0207711_10959149 Ga0207711_109591492 147
876 3300025944 Ga0207661_12121440 Ga0207661_121214401 147
877 3300025945 Ga0207679_10089444 Ga0207679_100894443 147
878 3300025949 Ga0207667_10002490 Ga0207667_1000249010 147
879 3300025949 Ga0207667_10021844 Ga0207667_100218444 147
880 3300025949 Ga0207667_10247312 Ga0207667_102473122 147
881 3300025949 Ga0207667_10248859 Ga0207667_102488592 147
882 3300025961 Ga0207712_11022224 Ga0207712_110222241 147
883 3300025972 Ga0207668_11569134 Ga0207668_115691341 147
884 3300026041 Ga0207639_10023368 Ga0207639_100233685 147
885 3300026041 Ga0207639_10257821 Ga0207639_102578212 147
886 3300026067 Ga0207678_10017196 Ga0207678_100171967 147
887 3300026067 Ga0207678_10507140 Ga0207678_105071402 147
888 3300026078 Ga0207702_10072618 Ga0207702_100726183 147
889 3300026116 Ga0207674_10123899 Ga0207674_101238992 147
890 3300027617 Ga0210002_1014486 Ga0210002_10144862 147
891 3300027866 Ga0209813_10048030 Ga0209813_100480302 147
892 3300027907 Ga0207428_10228442 Ga0207428_102284422 147
893 3300028573 Ga0265334_10041533 Ga0265334_100415332 147
894 3300028800 Ga0265338_10439203 Ga0265338_104392032 147
895 3300031241 Ga0265325_10083207 Ga0265325_100832072 147
896 3300031241 Ga0265325_10222547 Ga0265325_102225472 147
897 3300031247 Ga0265340_10131183 Ga0265340_101311832 147
898 3300031249 Ga0265339_10036292 Ga0265339_100362922 147
899 3300031548 Ga0307408_101909264 Ga0307408_1019092641 147
900 3300031727 Ga0316576_10453383 Ga0316576_104533832 147
901 3300031731 Ga0307405_10000445 Ga0307405_1000044517 147
902 3300031731 Ga0307405_10146823 Ga0307405_101468232 147
903 3300031733 Ga0316577_10566263 Ga0316577_105662631 147
904 3300031824 Ga0307413_10074432 Ga0307413_100744322 147
905 3300031824 Ga0307413_10190906 Ga0307413_101909062 147
906 3300031911 Ga0307412_10001453 Ga0307412_1000145310 147
907 3300031911 Ga0307412_10027719 Ga0307412_100277196 147
908 3300031995 Ga0307409_100027415 Ga0307409_1000274154 147
909 3300032004 Ga0307414_10000607 Ga0307414_1000060724 147
910 3300032004 Ga0307414_10108606 Ga0307414_101086064 147
911 3300032004 Ga0307414_10109773 Ga0307414_101097732 147
912 3300032004 Ga0307414_10167786 Ga0307414_101677862 147
913 3300032004 Ga0307414_10212200 Ga0307414_102122002 147
914 3300032004 Ga0307414_10242360 Ga0307414_102423602 147
915 3300032004 Ga0307414_11108488 Ga0307414_111084881 147
916 3300032004 Ga0307414_11619868 Ga0307414_116198681 147
917 3300032005 Ga0307411_10130928 Ga0307411_101309283 147
918 3300032005 Ga0307411_10401674 Ga0307411_104016742 147
919 3300032126 Ga0307415_100507266 Ga0307415_1005072662 147
920 3300035691 Ga0373931_0443009 Ga0373931_0443009_254_727 147
921 3300035695 Ga0373927_0444093 Ga0373927_0444093_254_727 147
922 3300037068 Ga0373925_0014982 Ga0373925_0014982_2688_3161 147
923 3300037853 Ga0436364_0378593 Ga0436364_0378593_41_499 147
924 3300042005 Ga0439448_0266090 Ga0439448_0266090_83_544 147
925 3300042015 Ga0439462_0025131 Ga0439462_0025131_263_712 147
926 3300042144 Ga0450889_000044 Ga0450889_000044_9152_9631 147
927 3300042436 Ga0439435_0031179 Ga0439435_0031179_317_766 147
928 3300044712 Ga0453684_0001089 Ga0453684_0001089_63259_63726 147
929 3300044842 Ga0466957_0436810 Ga0466957_0436810_350_817 147
930 3300045051 Ga0451576_0000201 Ga0451576_0000201_127454_127921 147
931 3300046460 Ga0495638_0023692 Ga0495638_0023692_1796_2251 147
932 3300046522 Ga0495643_0010369 Ga0495643_0010369_1254_1721 147
933 3300046522 Ga0495643_0018963 Ga0495643_0018963_1126_1575 147
934 3300048905 Ga0496102_0380716 Ga0496102_0380716_239_709 147
935 3300048915 Ga0496112_0719359 Ga0496112_0719359_250_708 147
936 3300049569 Ga0501032_0062790 Ga0501032_0062790_396_863 147
937 3300049570 Ga0501033_0125664 Ga0501033_0125664_167_640 147
938 3300049571 Ga0501034_0103060 Ga0501034_0103060_823_1293 147
939 3300049571 Ga0501034_0149862 Ga0501034_0149862_724_1197 147
940 3300049571 Ga0501034_0192577 Ga0501034_0192577_1178_1651 147
941 3300049571 Ga0501034_0443868 Ga0501034_0443868_230_688 147
942 3300049574 Ga0501038_0051389 Ga0501038_0051389_2865_3338 147
943 3300049579 Ga0501043_1006371 Ga0501043_1006371_68_541 147
944 3300049581 Ga0501047_0080312 Ga0501047_0080312_2582_3049 147
945 3300049581 Ga0501047_0372880 Ga0501047_0372880_616_1089 147
946 3300049581 Ga0501047_0376042 Ga0501047_0376042_716_1174 147
947 3300049581 Ga0501047_0674553 Ga0501047_0674553_176_649 147
948 3300049586 Ga0501070_0029379 Ga0501070_0029379_1598_2056 147
949 3300049586 Ga0501070_0971658 Ga0501070_0971658_112_588 147
950 3300049588 Ga0501072_0856407 Ga0501072_0856407_88_561 147
951 3300049744 Ga0501083_0564025 Ga0501083_0564025_180_638 147
952 3300049822 Ga0501035_0995231 Ga0501035_0995231_52_519 147
953 3300049823 Ga0501044_0000243 Ga0501044_0000243_40338_40811 147
954 3300049823 Ga0501044_0012601 Ga0501044_0012601_3190_3648 147
955 3300049823 Ga0501044_1352373 Ga0501044_1352373_65_538 147
956 3300050489 nmdc:mga03683_106303_c1 nmdc:mga03683_106303_c1_390_863 147
957 3300050489 nmdc:mga03683_528783_c1 nmdc:mga03683_528783_c1_76_546 147
958 3300050490 nmdc:mga03n38_148726_c1 nmdc:mga03n38_148726_c1_533_1003 147
959 3300050490 nmdc:mga03n38_156244_c1 nmdc:mga03n38_156244_c1_394_861 147
960 3300050490 nmdc:mga03n38_252515_c1 nmdc:mga03n38_252515_c1_411_881 147
961 3300050490 nmdc:mga03n38_412011_c1 nmdc:mga03n38_412011_c1_21_491 147
962 3300050491 nmdc:mga00v17_283525_c1 nmdc:mga00v17_283525_c1_258_728 147
963 3300050493 nmdc:mga0k408_279387_c1 nmdc:mga0k408_279387_c1_212_682 147
964 3300050493 nmdc:mga0k408_36021_c1 nmdc:mga0k408_36021_c1_92_565 147
965 3300050494 nmdc:mga06z11_100992_c1 nmdc:mga06z11_100992_c1_717_1187 147
966 3300050494 nmdc:mga06z11_125549_c1 nmdc:mga06z11_125549_c1_708_1178 147
967 3300050494 nmdc:mga06z11_69426_c1 nmdc:mga06z11_69426_c1_932_1405 147
968 3300050495 nmdc:mga04h51_141847_c1 nmdc:mga04h51_141847_c1_152_622 147
969 3300050495 nmdc:mga04h51_145313_c1 nmdc:mga04h51_145313_c1_259_729 147
970 3300050496 nmdc:mga07m45_65136_c2 nmdc:mga07m45_65136_c2_373_843 147
971 3300050507 nmdc:mga05p37_96648_c1 nmdc:mga05p37_96648_c1_969_1427 147
972 3300050509 nmdc:mga0qj67_65877_c1 nmdc:mga0qj67_65877_c1_1872_2333 147
973 3300050510 nmdc:mga06r32_105072_c1 nmdc:mga06r32_105072_c1_904_1365 147
974 3300050511 nmdc:mga08y16_210415_c1 nmdc:mga08y16_210415_c1_1007_1486 147
975 3300050511 nmdc:mga08y16_324484_c1 nmdc:mga08y16_324484_c1_510_983 147
976 3300050516 nmdc:mga0sz30_45515_c1 nmdc:mga0sz30_45515_c1_250_720 147
977 3300053077 Ga0495601_0363480 Ga0495601_0363480_357_830 147
978 3300053087 Ga0500643_005263 Ga0500643_005263_2256_2699 147
979 3300053094 Ga0500566_0124345 Ga0500566_0124345_487_960 147
980 3300053096 Ga0500641_0037147 Ga0500641_0037147_125_595 147
981 3300053116 Ga0500592_021396 Ga0500592_021396_30_497 147
982 3300053119 Ga0500595_067755 Ga0500595_067755_427_897 147
983 3300053134 Ga0500658_0175041 Ga0500658_0175041_256_726 147
984 3300053139 Ga0500568_0003398 Ga0500568_0003398_2255_2722 147
985 3300053151 Ga0500604_0083159 Ga0500604_0083159_420_869 147
986 3300053153 Ga0500616_0001475 Ga0500616_0001475_6563_7012 147
987 3300053153 Ga0500616_0182442 Ga0500616_0182442_342_815 147
988 3300053157 Ga0500624_000327 Ga0500624_000327_8273_8716 147
989 3300053177 Ga0500636_0001484 Ga0500636_0001484_9989_10432 147
990 3300060353 Ga0501082_0953906 Ga0501082_0953906_94_567 147
991 2162886006 SwRhRL3b_contig_2393116 SwRhRL3b_0432.00000360 148
992 2162886006 SwRhRL3b_contig_3059437 SwRhRL3b_0163.00001160 148
993 2162886006 SwRhRL3b_contig_457702 SwRhRL3b_0946.00000200 148
994 3300005289 Ga0065704_10113709 Ga0065704_101137093 148
995 3300005295 Ga0065707_10082019 Ga0065707_1008201924 148
996 3300005327 Ga0070658_10018766 Ga0070658_100187662 148
997 3300005327 Ga0070658_10548228 Ga0070658_105482281 148
998 3300005327 Ga0070658_10736682 Ga0070658_107366822 148
999 3300005329 Ga0070683_100263198 Ga0070683_1002631982 148
1000 3300005334 Ga0068869_100453908 Ga0068869_1004539082 148
1001 3300005336 Ga0070680_100092035 Ga0070680_1000920353 148
1002 3300005339 Ga0070660_100155021 Ga0070660_1001550212 148
1003 3300005455 Ga0070663_101247015 Ga0070663_1012470151 148
1004 3300005459 Ga0068867_101922976 Ga0068867_1019229761 148
1005 3300005530 Ga0070679_100040999 Ga0070679_1000409995 148
1006 3300005535 Ga0070684_100219514 Ga0070684_1002195141 148
1007 3300005563 Ga0068855_101729156 Ga0068855_1017291561 148
1008 3300005843 Ga0068860_100006788 Ga0068860_1000067889 148
1009 3300006880 Ga0075429_100104297 Ga0075429_1001042973 148
1010 3300009551 Ga0105238_10490104 Ga0105238_104901042 148
1011 3300009553 Ga0105249_10000103 Ga0105249_1000010321 148
1012 3300013297 Ga0157378_10497478 Ga0157378_104974782 148
1013 3300014326 Ga0157380_10013575 Ga0157380_100135752 148
1014 3300025909 Ga0207705_10000991 Ga0207705_100009917 148
1015 3300025909 Ga0207705_10090075 Ga0207705_100900753 148
1016 3300025917 Ga0207660_10291049 Ga0207660_102910492 148
1017 3300025919 Ga0207657_10018058 Ga0207657_100180588 148
1018 3300025921 Ga0207652_10001433 Ga0207652_100014336 148
1019 3300025924 Ga0207694_10066799 Ga0207694_100667993 148
1020 3300025942 Ga0207689_10447860 Ga0207689_104478602 148
1021 3300025949 Ga0207667_11530638 Ga0207667_115306381 148
1022 3300025961 Ga0207712_10000069 Ga0207712_1000006923 148
1023 3300026067 Ga0207678_11021494 Ga0207678_110214942 148
1024 3300026089 Ga0207648_11491449 Ga0207648_114914491 148
1025 3300026118 Ga0207675_100358828 Ga0207675_1003588282 148
1026 3300028379 Ga0268266_10000002 Ga0268266_100000022824 148
1027 3300028381 Ga0268264_10004758 Ga0268264_1000475810 148
1028 3300031995 Ga0307409_100058278 Ga0307409_1000582783 148
1029 3300037418 Ga0395900_0977814 Ga0395900_0977814_57_506 148
1030 3300037471 Ga0395905_0840034 Ga0395905_0840034_208_657 148
1031 3300038443 Ga0395901_0272451 Ga0395901_0272451_653_1102 148
1032 3300038705 Ga0237819_00303 Ga0237819_00303_14925_15377 148
1033 3300039145 Ga0237816_02191 Ga0237816_02191_540_992 148
1034 3300046457 Ga0495590_0116685 Ga0495590_0116685_298_762 148
1035 3300046460 Ga0495638_0001274 Ga0495638_0001274_20591_21049 148
1036 3300046506 Ga0495583_0018403 Ga0495583_0018403_926_1390 148
1037 3300046557 Ga0495622_0194605 Ga0495622_0194605_342_788 148
1038 3300046616 Ga0495668_0018443 Ga0495668_0018443_3505_3969 148
1039 3300046660 Ga0495625_0000231 Ga0495625_0000231_55281_55739 148
1040 3300046660 Ga0495625_0004912 Ga0495625_0004912_9282_9746 148
1041 3300046691 Ga0495670_0089862 Ga0495670_0089862_186_644 148
1042 3300048908 Ga0496105_0263900 Ga0496105_0263900_742_1215 148
1043 3300048917 Ga0496114_0042215 Ga0496114_0042215_69_542 148
1044 3300049571 Ga0501034_0597792 Ga0501034_0597792_172_645 148
1045 3300049581 Ga0501047_0317618 Ga0501047_0317618_797_1258 148
1046 3300049581 Ga0501047_0568342 Ga0501047_0568342_253_726 148
1047 3300049823 Ga0501044_0387363 Ga0501044_0387363_25_498 148
1048 3300049823 Ga0501044_1144261 Ga0501044_1144261_131_592 148
1049 3300053087 Ga0500643_000172 Ga0500643_000172_48776_49234 148
1050 3300053090 Ga0500646_0122008 Ga0500646_0122008_63_527 148
1051 3300053116 Ga0500592_000031 Ga0500592_000031_26017_26466 148
1052 3300053136 Ga0500559_0002598 Ga0500559_0002598_4171_4629 148
1053 3300053158 Ga0500627_0000090 Ga0500627_0000090_14385_14834 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

71

144

0.96

PF05899

Cupin_3

EutQ-like cupin domain

73

139

0.86

PF00190

Cupin_1

Cupin

56

152

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9376 3 148
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9193 3 148
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.9189 41 119
5wsf-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.9092 3 120
3l2h-assembly1.cif.gz_D crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution 0.9069 28 141
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9208 41 119 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9137 42 118 2.60.120.10
2pfwB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8972 41 118 2.60.120.10
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8964 28 141 2.60.120.10
3i7dB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8961 3 148 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q2YQ73-F1-model_v4 Cupin domain-containing protein 0.9941 1 119 GO:0005886
GO:0015171
AF-A0A2T6KQ38-F1-model_v4 Cupin domain-containing protein 0.9834 44 119 GO:0046872
AF-A0A4S3FP28-F1-model_v4 Transcriptional regulator 0.9744 3 148 GO:0046872
AF-A0A4U9HFH2-F1-model_v4 Uncharacterized conserved protein, contains double-stranded beta-helix domain 0.9723 38 117
AF-A0A7Z2VW27-F1-model_v4 Cupin domain-containing protein 0.9711 1 148 GO:0046872

Feature Viewer

pLDDT pTM Quality
95.75 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map