F489105
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1052 | 458 | 2104 | 139 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8056681323|8056685557 |
| Length | 164 |
| Sequence | LILRMPWNDDGENEAPPNHKETPMRFMMLMIPLGYETAPPKIDLDPERVAAMMKYNQALKDAGVLIALDGLHPPSAGARVSFATGKPVVTDGPFTESKEVLGGYWMINVASRAEAIEWAKQCPASENEIIEIRQVQEMSDFSEEVQKAAAGFEDMQQGWGKALR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 126 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 127 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 211 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 229 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 230 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 242 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 253 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 254 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 255 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 256 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 262 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 263 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 264 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 265 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 266 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 267 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 268 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 271 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 274 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 275 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 364 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 365 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 366 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 378 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 379 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 380 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 381 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 382 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 383 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 384 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 385 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 386 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 394 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 395 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 396 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 397 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 399 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 412 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 413 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 414 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 415 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 416 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 417 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 418 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 419 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 420 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 421 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 422 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 423 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 424 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 425 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 426 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 427 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 428 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 429 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 430 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 431 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 432 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 433 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 435 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 436 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 437 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 438 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 439 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 440 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 441 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 442 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 443 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 444 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 445 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 446 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 447 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 448 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 449 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 450 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 451 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 452 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 453 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 454 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 455 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 456 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 457 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 458 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.33 |
| Metatranscriptomes | 0.1 |
| Isolates | 0.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.63 |
| Nodule | 0.95 |
| Rhizoplane | 7.79 |
| Rhizosphere | 68.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1029154 | 3300002070 | Bacteria | 803 |
| 2 | JGI25165J46597_1048384 | 3300003214 | Bacteria | 545 |
| 3 | JGI25153J46596_10002543 | 3300003215 | Bacteria | 10454 |
| 4 | JGI25153J46596_10010032 | 3300003215 | Bacteria | 4323 |
| 5 | JGI25404J52841_10077133 | 3300003659 | Bacteria | 696 |
| 6 | Ga0055539_1006053 | 3300003752 | Bacteria | 1555 |
| 7 | Ga0055526_1039847 | 3300003771 | Bacteria | 1192 |
| 8 | Ga0055524_1036995 | 3300003775 | Bacteria | 1301 |
| 9 | Ga0055531_10001939 | 3300003794 | Bacteria | 14453 |
| 10 | Ga0055543_1004643 | 3300004625 | Bacteria | 3684 |
| 11 | Ga0055543_1057955 | 3300004625 | Bacteria | 625 |
| 12 | Ga0065165_1001641 | 3300005262 | Bacteria | 22770 |
| 13 | Ga0065165_1003060 | 3300005262 | Bacteria | 12519 |
| 14 | Ga0065165_1006123 | 3300005262 | Bacteria | 6438 |
| 15 | Ga0065165_1060395 | 3300005262 | Bacteria | 1040 |
| 16 | Ga0070658_10012558 | 3300005327 | Bacteria | 6793 |
| 17 | Ga0070658_10023514 | 3300005327 | Bacteria | 4944 |
| 18 | Ga0070658_10102491 | 3300005327 | Bacteria | 2367 |
| 19 | Ga0070676_10179448 | 3300005328 | Bacteria | 1375 |
| 20 | Ga0070683_100650545 | 3300005329 | Bacteria | 1009 |
| 21 | Ga0070683_100983887 | 3300005329 | Bacteria | 810 |
| 22 | Ga0070690_100368152 | 3300005330 | Bacteria | 1047 |
| 23 | Ga0070670_100190496 | 3300005331 | Bacteria | 1781 |
| 24 | Ga0070670_100431462 | 3300005331 | Bacteria | 1166 |
| 25 | Ga0068869_100073753 | 3300005334 | Bacteria | 2531 |
| 26 | Ga0068869_100170574 | 3300005334 | Bacteria | 1699 |
| 27 | Ga0068869_100726511 | 3300005334 | Bacteria | 849 |
| 28 | Ga0068869_101009791 | 3300005334 | Bacteria | 725 |
| 29 | Ga0070666_10242701 | 3300005335 | Bacteria | 1274 |
| 30 | Ga0070682_100036436 | 3300005337 | Bacteria | 3007 |
| 31 | Ga0070682_101668905 | 3300005337 | Bacteria | 553 |
| 32 | Ga0068868_100061212 | 3300005338 | Bacteria | 2982 |
| 33 | Ga0068868_100149026 | 3300005338 | Bacteria | 1926 |
| 34 | Ga0068868_100487663 | 3300005338 | Bacteria | 1077 |
| 35 | Ga0068868_100645846 | 3300005338 | Bacteria | 942 |
| 36 | Ga0070660_100773748 | 3300005339 | Bacteria | 807 |
| 37 | Ga0070660_101235354 | 3300005339 | Bacteria | 634 |
| 38 | Ga0070689_100029472 | 3300005340 | Bacteria | 4155 |
| 39 | Ga0070661_100090117 | 3300005344 | Bacteria | 2271 |
| 40 | Ga0070668_100194020 | 3300005347 | Bacteria | 1664 |
| 41 | Ga0070668_101210569 | 3300005347 | Bacteria | 684 |
| 42 | Ga0070669_100077152 | 3300005353 | Bacteria | 2475 |
| 43 | Ga0070669_100647603 | 3300005353 | Bacteria | 889 |
| 44 | Ga0070675_100256096 | 3300005354 | Bacteria | 1533 |
| 45 | Ga0070675_100444799 | 3300005354 | Bacteria | 1162 |
| 46 | Ga0070675_100494369 | 3300005354 | Bacteria | 1102 |
| 47 | Ga0070675_100671313 | 3300005354 | Bacteria | 943 |
| 48 | Ga0070671_100300849 | 3300005355 | Bacteria | 1366 |
| 49 | Ga0070671_100385853 | 3300005355 | Bacteria | 1197 |
| 50 | Ga0070671_100593258 | 3300005355 | Bacteria | 957 |
| 51 | Ga0070674_100018587 | 3300005356 | Bacteria | 4398 |
| 52 | Ga0070673_100071969 | 3300005364 | Bacteria | 2779 |
| 53 | Ga0070673_100722271 | 3300005364 | Bacteria | 916 |
| 54 | Ga0070673_101609494 | 3300005364 | Bacteria | 614 |
| 55 | Ga0070688_100332304 | 3300005365 | Bacteria | 1107 |
| 56 | Ga0070688_100379429 | 3300005365 | Bacteria | 1042 |
| 57 | Ga0070659_100890205 | 3300005366 | Bacteria | 777 |
| 58 | Ga0070659_101699146 | 3300005366 | Bacteria | 564 |
| 59 | Ga0070667_100171236 | 3300005367 | Bacteria | 1917 |
| 60 | Ga0070667_101488193 | 3300005367 | Bacteria | 636 |
| 61 | Ga0070709_10001487 | 3300005434 | Bacteria | 12659 |
| 62 | Ga0070714_100228898 | 3300005435 | Bacteria | 1712 |
| 63 | Ga0070713_100375492 | 3300005436 | Bacteria | 1324 |
| 64 | Ga0070713_100634323 | 3300005436 | Bacteria | 1017 |
| 65 | Ga0070710_10648292 | 3300005437 | Bacteria | 740 |
| 66 | Ga0070701_10812765 | 3300005438 | Bacteria | 639 |
| 67 | Ga0070711_100004982 | 3300005439 | Bacteria | 7886 |
| 68 | Ga0070711_100009103 | 3300005439 | Bacteria | 6103 |
| 69 | Ga0070711_101810257 | 3300005439 | Bacteria | 536 |
| 70 | Ga0070700_100015418 | 3300005441 | Bacteria | 4332 |
| 71 | Ga0070708_100064842 | 3300005445 | Bacteria | 3274 |
| 72 | Ga0070708_100690600 | 3300005445 | Bacteria | 961 |
| 73 | Ga0070663_100004680 | 3300005455 | Bacteria | 8069 |
| 74 | Ga0070663_100073751 | 3300005455 | Bacteria | 2490 |
| 75 | Ga0070663_100089274 | 3300005455 | Bacteria | 2280 |
| 76 | Ga0070663_100173392 | 3300005455 | Bacteria | 1668 |
| 77 | Ga0070663_100320808 | 3300005455 | Bacteria | 1246 |
| 78 | Ga0070678_100045978 | 3300005456 | Bacteria | 3127 |
| 79 | Ga0070678_100160527 | 3300005456 | Bacteria | 1820 |
| 80 | Ga0070678_100345611 | 3300005456 | Bacteria | 1277 |
| 81 | Ga0070678_100700049 | 3300005456 | Bacteria | 913 |
| 82 | Ga0070662_100100370 | 3300005457 | Bacteria | 2189 |
| 83 | Ga0070662_100145701 | 3300005457 | Bacteria | 1839 |
| 84 | Ga0070662_101016872 | 3300005457 | Bacteria | 710 |
| 85 | Ga0070681_10012465 | 3300005458 | Bacteria | 8435 |
| 86 | Ga0068867_100077329 | 3300005459 | Bacteria | 2500 |
| 87 | Ga0070706_100473639 | 3300005467 | Bacteria | 1165 |
| 88 | Ga0070707_100067780 | 3300005468 | Bacteria | 3434 |
| 89 | Ga0070698_100028998 | 3300005471 | Bacteria | 5744 |
| 90 | Ga0070698_100901362 | 3300005471 | Bacteria | 830 |
| 91 | Ga0070699_100633627 | 3300005518 | Bacteria | 976 |
| 92 | Ga0070679_100018130 | 3300005530 | Bacteria | 6824 |
| 93 | Ga0070697_101292512 | 3300005536 | Bacteria | 651 |
| 94 | Ga0070697_101484915 | 3300005536 | Bacteria | 606 |
| 95 | Ga0068853_100432519 | 3300005539 | Bacteria | 1236 |
| 96 | Ga0068853_101321949 | 3300005539 | Bacteria | 697 |
| 97 | Ga0068853_101927947 | 3300005539 | Bacteria | 573 |
| 98 | Ga0070672_100036650 | 3300005543 | Bacteria | 3738 |
| 99 | Ga0070672_100719582 | 3300005543 | Bacteria | 875 |
| 100 | Ga0070686_100061402 | 3300005544 | Bacteria | 2428 |
| 101 | Ga0070696_101316213 | 3300005546 | Bacteria | 614 |
| 102 | Ga0070665_100013100 | 3300005548 | Bacteria | 8350 |
| 103 | Ga0070665_100030279 | 3300005548 | Bacteria | 5447 |
| 104 | Ga0070665_100062009 | 3300005548 | Bacteria | 3749 |
| 105 | Ga0070665_100142934 | 3300005548 | Bacteria | 2396 |
| 106 | Ga0070665_100154541 | 3300005548 | Bacteria | 2296 |
| 107 | Ga0070665_100176827 | 3300005548 | Bacteria | 2135 |
| 108 | Ga0070665_100475717 | 3300005548 | Bacteria | 1260 |
| 109 | Ga0070665_100602714 | 3300005548 | Bacteria | 1111 |
| 110 | Ga0070665_101278437 | 3300005548 | Bacteria | 744 |
| 111 | Ga0070665_101315473 | 3300005548 | Bacteria | 732 |
| 112 | Ga0068855_100007494 | 3300005563 | Bacteria | 13211 |
| 113 | Ga0068855_100157617 | 3300005563 | Bacteria | 2578 |
| 114 | Ga0068855_100173800 | 3300005563 | Bacteria | 2438 |
| 115 | Ga0070664_100451693 | 3300005564 | Bacteria | 1180 |
| 116 | Ga0070664_101292608 | 3300005564 | Bacteria | 689 |
| 117 | Ga0068854_100081574 | 3300005578 | Bacteria | 2389 |
| 118 | Ga0068854_100515802 | 3300005578 | Bacteria | 1009 |
| 119 | Ga0068854_100557659 | 3300005578 | Bacteria | 973 |
| 120 | Ga0068856_100225909 | 3300005614 | Bacteria | 1887 |
| 121 | Ga0068856_100252283 | 3300005614 | Bacteria | 1779 |
| 122 | Ga0068856_100257385 | 3300005614 | Bacteria | 1761 |
| 123 | Ga0068856_100446153 | 3300005614 | Bacteria | 1314 |
| 124 | Ga0070702_100030788 | 3300005615 | Bacteria | 2929 |
| 125 | Ga0070702_100256668 | 3300005615 | Bacteria | 1188 |
| 126 | Ga0070702_100504825 | 3300005615 | Bacteria | 889 |
| 127 | Ga0068852_100061105 | 3300005616 | Bacteria | 3273 |
| 128 | Ga0068852_100271608 | 3300005616 | Bacteria | 1632 |
| 129 | Ga0068852_100391056 | 3300005616 | Bacteria | 1366 |
| 130 | Ga0068852_102611884 | 3300005616 | Bacteria | 525 |
| 131 | Ga0068859_100029233 | 3300005617 | Bacteria | 5530 |
| 132 | Ga0068859_100157976 | 3300005617 | Bacteria | 2346 |
| 133 | Ga0068864_100031862 | 3300005618 | Bacteria | 4475 |
| 134 | Ga0068864_100189671 | 3300005618 | Bacteria | 1884 |
| 135 | Ga0068864_101871951 | 3300005618 | Bacteria | 606 |
| 136 | Ga0068866_10037646 | 3300005718 | Bacteria | 2377 |
| 137 | Ga0068861_100258607 | 3300005719 | Bacteria | 1489 |
| 138 | Ga0068861_101750191 | 3300005719 | Bacteria | 615 |
| 139 | Ga0068870_10624676 | 3300005840 | Bacteria | 735 |
| 140 | Ga0068863_100276087 | 3300005841 | Bacteria | 1627 |
| 141 | Ga0068863_101101683 | 3300005841 | Bacteria | 799 |
| 142 | Ga0068863_101336523 | 3300005841 | Bacteria | 724 |
| 143 | Ga0068858_100060155 | 3300005842 | Bacteria | 3511 |
| 144 | Ga0068858_100266626 | 3300005842 | Bacteria | 1629 |
| 145 | Ga0068860_100247013 | 3300005843 | Bacteria | 1737 |
| 146 | Ga0068860_100270075 | 3300005843 | Bacteria | 1659 |
| 147 | Ga0068862_100085066 | 3300005844 | Bacteria | 2748 |
| 148 | Ga0068862_100170988 | 3300005844 | Bacteria | 1945 |
| 149 | Ga0068862_100228976 | 3300005844 | Bacteria | 1685 |
| 150 | Ga0068862_100315519 | 3300005844 | Bacteria | 1442 |
| 151 | Ga0081455_10029662 | 3300005937 | Bacteria | 4984 |
| 152 | Ga0081455_10109650 | 3300005937 | Bacteria | 2196 |
| 153 | Ga0081455_10265399 | 3300005937 | Bacteria | 1248 |
| 154 | Ga0081540_1001339 | 3300005983 | Bacteria | 21460 |
| 155 | Ga0081540_1007193 | 3300005983 | Bacteria | 7985 |
| 156 | Ga0081540_1007306 | 3300005983 | Bacteria | 7903 |
| 157 | Ga0081540_1007993 | 3300005983 | Bacteria | 7446 |
| 158 | Ga0081540_1016547 | 3300005983 | Bacteria | 4607 |
| 159 | Ga0081540_1026662 | 3300005983 | Bacteria | 3291 |
| 160 | Ga0081540_1076704 | 3300005983 | Bacteria | 1522 |
| 161 | Ga0081540_1101767 | 3300005983 | Bacteria | 1236 |
| 162 | Ga0081540_1116499 | 3300005983 | Bacteria | 1118 |
| 163 | Ga0081540_1233257 | 3300005983 | Bacteria | 649 |
| 164 | Ga0081539_10000848 | 3300005985 | Bacteria | 58499 |
| 165 | Ga0081539_10012348 | 3300005985 | Bacteria | 6599 |
| 166 | Ga0075365_10016437 | 3300006038 | Bacteria | 4501 |
| 167 | Ga0075365_10032321 | 3300006038 | Bacteria | 3362 |
| 168 | Ga0075365_10041163 | 3300006038 | Bacteria | 3017 |
| 169 | Ga0075365_10075675 | 3300006038 | Bacteria | 2272 |
| 170 | Ga0075365_10082863 | 3300006038 | Bacteria | 2175 |
| 171 | Ga0075365_10504620 | 3300006038 | Bacteria | 855 |
| 172 | Ga0075365_10728030 | 3300006038 | Bacteria | 701 |
| 173 | Ga0075365_10836182 | 3300006038 | Bacteria | 650 |
| 174 | Ga0075368_10003948 | 3300006042 | Bacteria | 4995 |
| 175 | Ga0075363_100014770 | 3300006048 | Bacteria | 3825 |
| 176 | Ga0075363_100122388 | 3300006048 | Bacteria | 1454 |
| 177 | Ga0075363_100155479 | 3300006048 | Bacteria | 1293 |
| 178 | Ga0075363_100418580 | 3300006048 | Bacteria | 789 |
| 179 | Ga0075363_100428285 | 3300006048 | Bacteria | 780 |
| 180 | Ga0075364_10058712 | 3300006051 | Bacteria | 2521 |
| 181 | Ga0075364_10319221 | 3300006051 | Bacteria | 1058 |
| 182 | Ga0075364_10339815 | 3300006051 | Bacteria | 1023 |
| 183 | Ga0070715_10503674 | 3300006163 | Bacteria | 694 |
| 184 | Ga0070716_100034174 | 3300006173 | Bacteria | 2786 |
| 185 | Ga0070716_100154821 | 3300006173 | Bacteria | 1478 |
| 186 | Ga0070716_100367307 | 3300006173 | Bacteria | 1024 |
| 187 | Ga0070712_100073635 | 3300006175 | Bacteria | 2451 |
| 188 | Ga0070712_100217090 | 3300006175 | Bacteria | 1512 |
| 189 | Ga0070712_100377683 | 3300006175 | Bacteria | 1166 |
| 190 | Ga0070712_100413189 | 3300006175 | Bacteria | 1117 |
| 191 | Ga0070712_100685446 | 3300006175 | Bacteria | 873 |
| 192 | Ga0075362_10086410 | 3300006177 | Bacteria | 1451 |
| 193 | Ga0075362_10136051 | 3300006177 | Bacteria | 1172 |
| 194 | Ga0075367_10040157 | 3300006178 | Bacteria | 2731 |
| 195 | Ga0075367_10075171 | 3300006178 | Bacteria | 2037 |
| 196 | Ga0075367_10136379 | 3300006178 | Bacteria | 1518 |
| 197 | Ga0075367_10192724 | 3300006178 | Bacteria | 1272 |
| 198 | Ga0075367_10388212 | 3300006178 | Bacteria | 882 |
| 199 | Ga0075369_10095939 | 3300006186 | Bacteria | 1327 |
| 200 | Ga0075369_10137108 | 3300006186 | Bacteria | 1114 |
| 201 | Ga0075369_10206152 | 3300006186 | Bacteria | 908 |
| 202 | Ga0075369_10239910 | 3300006186 | Bacteria | 841 |
| 203 | Ga0075366_10024888 | 3300006195 | Bacteria | 3492 |
| 204 | Ga0075366_10032034 | 3300006195 | Bacteria | 3094 |
| 205 | Ga0075366_10050422 | 3300006195 | Bacteria | 2471 |
| 206 | Ga0075366_10196605 | 3300006195 | Bacteria | 1226 |
| 207 | Ga0075366_10483993 | 3300006195 | Bacteria | 765 |
| 208 | Ga0075366_10551633 | 3300006195 | Bacteria | 714 |
| 209 | Ga0075366_10637687 | 3300006195 | Bacteria | 661 |
| 210 | Ga0097621_100647048 | 3300006237 | Bacteria | 970 |
| 211 | Ga0097621_100795721 | 3300006237 | Bacteria | 876 |
| 212 | Ga0075370_10005105 | 3300006353 | Bacteria | 6470 |
| 213 | Ga0075370_10020322 | 3300006353 | Bacteria | 3627 |
| 214 | Ga0075370_10094272 | 3300006353 | Bacteria | 1728 |
| 215 | Ga0075370_10138407 | 3300006353 | Bacteria | 1423 |
| 216 | Ga0075370_10201833 | 3300006353 | Bacteria | 1173 |
| 217 | Ga0068871_100031423 | 3300006358 | Bacteria | 4188 |
| 218 | Ga0068871_100104460 | 3300006358 | Bacteria | 2376 |
| 219 | Ga0068871_101681277 | 3300006358 | Bacteria | 602 |
| 220 | Ga0075428_100157112 | 3300006844 | Bacteria | 2469 |
| 221 | Ga0075434_100189929 | 3300006871 | Bacteria | 2074 |
| 222 | Ga0075434_100444533 | 3300006871 | Bacteria | 1318 |
| 223 | Ga0068865_100109505 | 3300006881 | Bacteria | 2035 |
| 224 | Ga0068865_100849440 | 3300006881 | Bacteria | 791 |
| 225 | Ga0068865_101658442 | 3300006881 | Bacteria | 576 |
| 226 | Ga0075436_100624736 | 3300006914 | Bacteria | 795 |
| 227 | Ga0097620_100029232 | 3300006931 | Bacteria | 5530 |
| 228 | Ga0097620_100157985 | 3300006931 | Bacteria | 2346 |
| 229 | Ga0075435_100341705 | 3300007076 | Bacteria | 1283 |
| 230 | Ga0099794_10044583 | 3300007265 | Bacteria | 2120 |
| 231 | Ga0099794_10102428 | 3300007265 | Bacteria | 1430 |
| 232 | Ga0099795_10002812 | 3300007788 | Bacteria | 4192 |
| 233 | Ga0099795_10043944 | 3300007788 | Bacteria | 1601 |
| 234 | Ga0099795_10142251 | 3300007788 | Bacteria | 976 |
| 235 | Ga0099795_10217289 | 3300007788 | Bacteria | 812 |
| 236 | Ga0105240_10309970 | 3300009093 | Bacteria | 1803 |
| 237 | Ga0105240_10502270 | 3300009093 | Bacteria | 1348 |
| 238 | Ga0111539_10071397 | 3300009094 | Bacteria | 4097 |
| 239 | Ga0111539_11000866 | 3300009094 | Bacteria | 972 |
| 240 | Ga0105245_10060551 | 3300009098 | Bacteria | 3410 |
| 241 | Ga0105245_11602772 | 3300009098 | Bacteria | 703 |
| 242 | Ga0105247_10406197 | 3300009101 | Bacteria | 972 |
| 243 | Ga0105243_10501348 | 3300009148 | Bacteria | 1150 |
| 244 | Ga0105243_10638961 | 3300009148 | Bacteria | 1030 |
| 245 | Ga0105243_10702884 | 3300009148 | Bacteria | 986 |
| 246 | Ga0105243_10737151 | 3300009148 | Bacteria | 965 |
| 247 | Ga0105241_10012915 | 3300009174 | Bacteria | 6127 |
| 248 | Ga0105241_10392659 | 3300009174 | Bacteria | 1215 |
| 249 | Ga0105241_10514380 | 3300009174 | Bacteria | 1070 |
| 250 | Ga0105242_10035582 | 3300009176 | Bacteria | 3993 |
| 251 | Ga0105242_10506722 | 3300009176 | Bacteria | 1149 |
| 252 | Ga0105242_11303406 | 3300009176 | Bacteria | 750 |
| 253 | Ga0105248_10172136 | 3300009177 | Bacteria | 2441 |
| 254 | Ga0105248_11181365 | 3300009177 | Bacteria | 865 |
| 255 | Ga0105237_10018023 | 3300009545 | Bacteria | 7315 |
| 256 | Ga0105237_10137184 | 3300009545 | Bacteria | 2441 |
| 257 | Ga0105237_10208119 | 3300009545 | Bacteria | 1956 |
| 258 | Ga0105237_10448755 | 3300009545 | Bacteria | 1296 |
| 259 | Ga0105237_11045357 | 3300009545 | Bacteria | 823 |
| 260 | Ga0105238_10202605 | 3300009551 | Bacteria | 1960 |
| 261 | Ga0105238_10572463 | 3300009551 | Bacteria | 1135 |
| 262 | Ga0105238_10575588 | 3300009551 | Bacteria | 1132 |
| 263 | Ga0105238_11314755 | 3300009551 | Bacteria | 749 |
| 264 | Ga0105249_10311426 | 3300009553 | Bacteria | 1583 |
| 265 | Ga0105249_10513667 | 3300009553 | Bacteria | 1245 |
| 266 | Ga0105249_10910747 | 3300009553 | Bacteria | 946 |
| 267 | Ga0099796_10009289 | 3300010159 | Bacteria | 2656 |
| 268 | Ga0099796_10151157 | 3300010159 | Bacteria | 914 |
| 269 | Ga0099796_10295163 | 3300010159 | Bacteria | 685 |
| 270 | Ga0099796_10520424 | 3300010159 | Bacteria | 534 |
| 271 | Ga0105239_10043909 | 3300010375 | Bacteria | 4901 |
| 272 | Ga0105239_10048229 | 3300010375 | Bacteria | 4670 |
| 273 | Ga0105239_10126823 | 3300010375 | Bacteria | 2837 |
| 274 | Ga0105239_10267474 | 3300010375 | Bacteria | 1922 |
| 275 | Ga0105239_10741915 | 3300010375 | Bacteria | 1124 |
| 276 | Ga0105239_10753928 | 3300010375 | Bacteria | 1114 |
| 277 | Ga0105239_10909995 | 3300010375 | Bacteria | 1010 |
| 278 | Ga0105239_11142778 | 3300010375 | Bacteria | 897 |
| 279 | Ga0105239_13432695 | 3300010375 | Bacteria | 515 |
| 280 | Ga0105246_10085714 | 3300011119 | Bacteria | 2256 |
| 281 | Ga0105246_10089670 | 3300011119 | Bacteria | 2213 |
| 282 | Ga0105246_10199271 | 3300011119 | Bacteria | 1555 |
| 283 | Ga0105246_10233447 | 3300011119 | Bacteria | 1450 |
| 284 | Ga0105246_10783537 | 3300011119 | Bacteria | 844 |
| 285 | Ga0105246_10839555 | 3300011119 | Bacteria | 818 |
| 286 | Ga0105246_11006436 | 3300011119 | Bacteria | 755 |
| 287 | Ga0157323_1011445 | 3300012495 | Bacteria | 715 |
| 288 | Ga0157323_1011788 | 3300012495 | Bacteria | 710 |
| 289 | Ga0157370_10026904 | 3300013104 | Bacteria | 5674 |
| 290 | Ga0157374_10019278 | 3300013296 | Bacteria | 6036 |
| 291 | Ga0157374_10066182 | 3300013296 | Bacteria | 3396 |
| 292 | Ga0157374_10110883 | 3300013296 | Bacteria | 2639 |
| 293 | Ga0157374_10388075 | 3300013296 | Bacteria | 1392 |
| 294 | Ga0157374_12404282 | 3300013296 | Bacteria | 554 |
| 295 | Ga0157378_10031236 | 3300013297 | Bacteria | 4704 |
| 296 | Ga0157378_10547367 | 3300013297 | Bacteria | 1162 |
| 297 | Ga0163162_10044547 | 3300013306 | Bacteria | 4444 |
| 298 | Ga0163162_10129391 | 3300013306 | Bacteria | 2633 |
| 299 | Ga0163162_10235980 | 3300013306 | Bacteria | 1959 |
| 300 | Ga0163162_11179575 | 3300013306 | Bacteria | 869 |
| 301 | Ga0157372_10494544 | 3300013307 | Bacteria | 1426 |
| 302 | Ga0157375_10154583 | 3300013308 | Bacteria | 2432 |
| 303 | Ga0157375_10174025 | 3300013308 | Bacteria | 2301 |
| 304 | Ga0157375_10174992 | 3300013308 | Bacteria | 2295 |
| 305 | Ga0157375_10227133 | 3300013308 | Bacteria | 2025 |
| 306 | Ga0157375_10836715 | 3300013308 | Bacteria | 1067 |
| 307 | Ga0163163_10057665 | 3300014325 | Bacteria | 3840 |
| 308 | Ga0163163_10073225 | 3300014325 | Bacteria | 3416 |
| 309 | Ga0163163_10203034 | 3300014325 | Bacteria | 2031 |
| 310 | Ga0157380_10109465 | 3300014326 | Bacteria | 2318 |
| 311 | Ga0157380_10157219 | 3300014326 | Bacteria | 1971 |
| 312 | Ga0182008_10227787 | 3300014497 | Bacteria | 955 |
| 313 | Ga0182008_10263072 | 3300014497 | Bacteria | 893 |
| 314 | Ga0157377_10149709 | 3300014745 | Bacteria | 1442 |
| 315 | Ga0157377_10686845 | 3300014745 | Bacteria | 741 |
| 316 | Ga0157379_10060147 | 3300014968 | Bacteria | 3396 |
| 317 | Ga0157379_10344996 | 3300014968 | Bacteria | 1362 |
| 318 | Ga0157379_11240093 | 3300014968 | Bacteria | 718 |
| 319 | Ga0157376_10046724 | 3300014969 | Bacteria | 3572 |
| 320 | Ga0157376_10555669 | 3300014969 | Bacteria | 1137 |
| 321 | Ga0157376_12963154 | 3300014969 | Bacteria | 514 |
| 322 | Ga0163161_10088848 | 3300017792 | Bacteria | 2284 |
| 323 | Ga0163161_11063447 | 3300017792 | Bacteria | 694 |
| 324 | Ga0163161_11198956 | 3300017792 | Bacteria | 656 |
| 325 | Ga0206356_10120399 | 3300020070 | Bacteria | 749 |
| 326 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 327 | Ga0214542_1037420 | 3300021321 | Bacteria | 1384 |
| 328 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 329 | Ga0214545_1035280 | 3300021324 | Bacteria | 1666 |
| 330 | Ga0214543_1000111 | 3300021327 | Bacteria | 106517 |
| 331 | Ga0214543_1033779 | 3300021327 | Bacteria | 1803 |
| 332 | Ga0213876_10295971 | 3300021384 | Bacteria | 860 |
| 333 | Ga0209563_102320 | 3300025230 | Bacteria | 4365 |
| 334 | Ga0209677_101639 | 3300025253 | Bacteria | 9408 |
| 335 | Ga0209677_102591 | 3300025253 | Bacteria | 6615 |
| 336 | Ga0209148_1006467 | 3300025254 | Bacteria | 2537 |
| 337 | Ga0209233_1004340 | 3300025261 | Bacteria | 4839 |
| 338 | Ga0209233_1008872 | 3300025261 | Bacteria | 3083 |
| 339 | Ga0209233_1027348 | 3300025261 | Bacteria | 1383 |
| 340 | Ga0209455_1001472 | 3300025272 | Bacteria | 10597 |
| 341 | Ga0209455_1001710 | 3300025272 | Bacteria | 9395 |
| 342 | Ga0209564_1006563 | 3300025295 | Bacteria | 6245 |
| 343 | Ga0209564_1031518 | 3300025295 | Bacteria | 1617 |
| 344 | Ga0209758_1000102 | 3300025297 | Bacteria | 224851 |
| 345 | Ga0209758_1003592 | 3300025297 | Bacteria | 13874 |
| 346 | Ga0209758_1003725 | 3300025297 | Bacteria | 13511 |
| 347 | Ga0209758_1005478 | 3300025297 | Bacteria | 9742 |
| 348 | Ga0209758_1046037 | 3300025297 | Bacteria | 1577 |
| 349 | Ga0209256_1004953 | 3300025299 | Bacteria | 7982 |
| 350 | Ga0209256_1027989 | 3300025299 | Bacteria | 1598 |
| 351 | Ga0207426_1002013 | 3300025302 | Bacteria | 14342 |
| 352 | Ga0207426_1034873 | 3300025302 | Bacteria | 1611 |
| 353 | Ga0209257_1003378 | 3300025304 | Bacteria | 13780 |
| 354 | Ga0207697_10065223 | 3300025315 | Bacteria | 1519 |
| 355 | Ga0207697_10216603 | 3300025315 | Bacteria | 844 |
| 356 | Ga0207697_10443720 | 3300025315 | Bacteria | 575 |
| 357 | Ga0207692_10407209 | 3300025898 | Bacteria | 849 |
| 358 | Ga0207692_10450057 | 3300025898 | Bacteria | 810 |
| 359 | Ga0207692_10650649 | 3300025898 | Bacteria | 681 |
| 360 | Ga0207642_10020324 | 3300025899 | Bacteria | 2589 |
| 361 | Ga0207642_10396173 | 3300025899 | Bacteria | 825 |
| 362 | Ga0207642_10469724 | 3300025899 | Bacteria | 765 |
| 363 | Ga0207710_10164150 | 3300025900 | Bacteria | 1083 |
| 364 | Ga0207688_10019383 | 3300025901 | Bacteria | 3705 |
| 365 | Ga0207688_10088637 | 3300025901 | Bacteria | 1774 |
| 366 | Ga0207688_10089460 | 3300025901 | Bacteria | 1766 |
| 367 | Ga0207688_10344528 | 3300025901 | Bacteria | 917 |
| 368 | Ga0207680_10163305 | 3300025903 | Bacteria | 1495 |
| 369 | Ga0207680_10169761 | 3300025903 | Bacteria | 1468 |
| 370 | Ga0207647_10011423 | 3300025904 | Bacteria | 6230 |
| 371 | Ga0207685_10233027 | 3300025905 | Bacteria | 882 |
| 372 | Ga0207699_10129981 | 3300025906 | Bacteria | 1641 |
| 373 | Ga0207645_10092170 | 3300025907 | Bacteria | 1949 |
| 374 | Ga0207645_10184660 | 3300025907 | Bacteria | 1369 |
| 375 | Ga0207705_10061486 | 3300025909 | Bacteria | 2713 |
| 376 | Ga0207705_10216616 | 3300025909 | Bacteria | 1453 |
| 377 | Ga0207705_10234508 | 3300025909 | Bacteria | 1396 |
| 378 | Ga0207684_10186080 | 3300025910 | Bacteria | 1791 |
| 379 | Ga0207684_10639812 | 3300025910 | Bacteria | 907 |
| 380 | Ga0207654_10014746 | 3300025911 | Bacteria | 4042 |
| 381 | Ga0207654_10463892 | 3300025911 | Bacteria | 890 |
| 382 | Ga0207707_10011000 | 3300025912 | Bacteria | 7874 |
| 383 | Ga0207707_11354883 | 3300025912 | Bacteria | 569 |
| 384 | Ga0207695_10234230 | 3300025913 | Bacteria | 1739 |
| 385 | Ga0207671_10083323 | 3300025914 | Bacteria | 2401 |
| 386 | Ga0207671_10119378 | 3300025914 | Bacteria | 2014 |
| 387 | Ga0207671_10307417 | 3300025914 | Bacteria | 1253 |
| 388 | Ga0207671_10703069 | 3300025914 | Bacteria | 804 |
| 389 | Ga0207693_10009325 | 3300025915 | Bacteria | 8001 |
| 390 | Ga0207693_10017747 | 3300025915 | Bacteria | 5675 |
| 391 | Ga0207693_10122761 | 3300025915 | Bacteria | 2040 |
| 392 | Ga0207693_10244528 | 3300025915 | Bacteria | 1408 |
| 393 | Ga0207663_10025502 | 3300025916 | Bacteria | 3419 |
| 394 | Ga0207663_10100721 | 3300025916 | Bacteria | 1939 |
| 395 | Ga0207657_10166797 | 3300025919 | Bacteria | 1786 |
| 396 | Ga0207657_10556936 | 3300025919 | Bacteria | 896 |
| 397 | Ga0207657_11061567 | 3300025919 | Bacteria | 620 |
| 398 | Ga0207649_10066665 | 3300025920 | Bacteria | 2283 |
| 399 | Ga0207652_10158337 | 3300025921 | Bacteria | 2029 |
| 400 | Ga0207646_10261644 | 3300025922 | Bacteria | 1563 |
| 401 | Ga0207681_10214086 | 3300025923 | Bacteria | 1487 |
| 402 | Ga0207681_10901979 | 3300025923 | Bacteria | 740 |
| 403 | Ga0207681_11009395 | 3300025923 | Bacteria | 698 |
| 404 | Ga0207694_10122221 | 3300025924 | Bacteria | 2079 |
| 405 | Ga0207694_10572641 | 3300025924 | Bacteria | 949 |
| 406 | Ga0207694_10628845 | 3300025924 | Bacteria | 904 |
| 407 | Ga0207694_11328088 | 3300025924 | Bacteria | 608 |
| 408 | Ga0207650_10562013 | 3300025925 | Bacteria | 957 |
| 409 | Ga0207659_10220386 | 3300025926 | Bacteria | 1525 |
| 410 | Ga0207659_10550945 | 3300025926 | Bacteria | 980 |
| 411 | Ga0207687_10299895 | 3300025927 | Bacteria | 1294 |
| 412 | Ga0207687_10691934 | 3300025927 | Bacteria | 865 |
| 413 | Ga0207700_11115625 | 3300025928 | Bacteria | 705 |
| 414 | Ga0207700_11704156 | 3300025928 | Bacteria | 556 |
| 415 | Ga0207664_11208542 | 3300025929 | Bacteria | 674 |
| 416 | Ga0207644_10178384 | 3300025931 | Bacteria | 1663 |
| 417 | Ga0207644_10273138 | 3300025931 | Bacteria | 1355 |
| 418 | Ga0207644_10516522 | 3300025931 | Bacteria | 986 |
| 419 | Ga0207644_11006653 | 3300025931 | Bacteria | 699 |
| 420 | Ga0207690_10268274 | 3300025932 | Bacteria | 1325 |
| 421 | Ga0207690_11222132 | 3300025932 | Bacteria | 628 |
| 422 | Ga0207706_10020636 | 3300025933 | Bacteria | 5921 |
| 423 | Ga0207706_10218356 | 3300025933 | Bacteria | 1670 |
| 424 | Ga0207706_10465884 | 3300025933 | Bacteria | 1092 |
| 425 | Ga0207686_10170721 | 3300025934 | Bacteria | 1533 |
| 426 | Ga0207686_10256367 | 3300025934 | Bacteria | 1280 |
| 427 | Ga0207686_10445902 | 3300025934 | Bacteria | 995 |
| 428 | Ga0207686_10692655 | 3300025934 | Bacteria | 809 |
| 429 | Ga0207709_10041130 | 3300025935 | Bacteria | 2772 |
| 430 | Ga0207709_11248901 | 3300025935 | Bacteria | 613 |
| 431 | Ga0207709_11616757 | 3300025935 | Bacteria | 538 |
| 432 | Ga0207670_10039211 | 3300025936 | Bacteria | 3101 |
| 433 | Ga0207670_10925765 | 3300025936 | Bacteria | 731 |
| 434 | Ga0207669_10007035 | 3300025937 | Bacteria | 5176 |
| 435 | Ga0207704_10062027 | 3300025938 | Bacteria | 2322 |
| 436 | Ga0207704_10133658 | 3300025938 | Bacteria | 1723 |
| 437 | Ga0207665_10023296 | 3300025939 | Bacteria | 4078 |
| 438 | Ga0207665_10101928 | 3300025939 | Bacteria | 2005 |
| 439 | Ga0207665_10651826 | 3300025939 | Bacteria | 825 |
| 440 | Ga0207665_11424140 | 3300025939 | Bacteria | 551 |
| 441 | Ga0207691_10103322 | 3300025940 | Bacteria | 2541 |
| 442 | Ga0207691_10552016 | 3300025940 | Bacteria | 977 |
| 443 | Ga0207711_10316425 | 3300025941 | Bacteria | 1441 |
| 444 | Ga0207711_10334427 | 3300025941 | Bacteria | 1401 |
| 445 | Ga0207689_10391727 | 3300025942 | Bacteria | 1157 |
| 446 | Ga0207689_10443619 | 3300025942 | Bacteria | 1084 |
| 447 | Ga0207689_10627672 | 3300025942 | Bacteria | 905 |
| 448 | Ga0207689_11080396 | 3300025942 | Bacteria | 676 |
| 449 | Ga0207661_10570559 | 3300025944 | Bacteria | 1037 |
| 450 | Ga0207661_10576659 | 3300025944 | Bacteria | 1032 |
| 451 | Ga0207679_10318278 | 3300025945 | Bacteria | 1346 |
| 452 | Ga0207679_11130151 | 3300025945 | Bacteria | 719 |
| 453 | Ga0207667_10050380 | 3300025949 | Bacteria | 4394 |
| 454 | Ga0207667_12040882 | 3300025949 | Bacteria | 533 |
| 455 | Ga0207651_10064111 | 3300025960 | Bacteria | 2570 |
| 456 | Ga0207668_10008217 | 3300025972 | Bacteria | 6216 |
| 457 | Ga0207668_10173030 | 3300025972 | Bacteria | 1695 |
| 458 | Ga0207668_10262230 | 3300025972 | Bacteria | 1409 |
| 459 | Ga0207668_10683879 | 3300025972 | Bacteria | 900 |
| 460 | Ga0207668_10836322 | 3300025972 | Bacteria | 817 |
| 461 | Ga0207640_10048550 | 3300025981 | Bacteria | 2745 |
| 462 | Ga0207640_10123950 | 3300025981 | Bacteria | 1857 |
| 463 | Ga0207658_10075824 | 3300025986 | Bacteria | 2560 |
| 464 | Ga0207658_10180619 | 3300025986 | Bacteria | 1746 |
| 465 | Ga0207658_10554862 | 3300025986 | Bacteria | 1028 |
| 466 | Ga0207658_10837159 | 3300025986 | Bacteria | 836 |
| 467 | Ga0207658_11253074 | 3300025986 | Bacteria | 678 |
| 468 | Ga0207658_12090848 | 3300025986 | Bacteria | 515 |
| 469 | Ga0207677_10110732 | 3300026023 | Bacteria | 2044 |
| 470 | Ga0207677_10234842 | 3300026023 | Bacteria | 1480 |
| 471 | Ga0207677_10527442 | 3300026023 | Bacteria | 1025 |
| 472 | Ga0207677_10535789 | 3300026023 | Bacteria | 1018 |
| 473 | Ga0207677_11600840 | 3300026023 | Bacteria | 603 |
| 474 | Ga0207703_10193232 | 3300026035 | Bacteria | 1804 |
| 475 | Ga0207639_10098940 | 3300026041 | Bacteria | 2352 |
| 476 | Ga0207639_10164849 | 3300026041 | Bacteria | 1871 |
| 477 | Ga0207639_10167178 | 3300026041 | Bacteria | 1859 |
| 478 | Ga0207639_10249569 | 3300026041 | Bacteria | 1547 |
| 479 | Ga0207639_11186091 | 3300026041 | Bacteria | 716 |
| 480 | Ga0207678_10004216 | 3300026067 | Bacteria | 12904 |
| 481 | Ga0207678_10060134 | 3300026067 | Bacteria | 3268 |
| 482 | Ga0207678_10089469 | 3300026067 | Bacteria | 2631 |
| 483 | Ga0207678_10099974 | 3300026067 | Bacteria | 2478 |
| 484 | Ga0207678_10123758 | 3300026067 | Bacteria | 2207 |
| 485 | Ga0207678_10227790 | 3300026067 | Bacteria | 1596 |
| 486 | Ga0207678_10397726 | 3300026067 | Bacteria | 1193 |
| 487 | Ga0207678_10402078 | 3300026067 | Bacteria | 1186 |
| 488 | Ga0207708_10049842 | 3300026075 | Bacteria | 3189 |
| 489 | Ga0207702_10229418 | 3300026078 | Bacteria | 1734 |
| 490 | Ga0207702_10327935 | 3300026078 | Bacteria | 1459 |
| 491 | Ga0207641_10308005 | 3300026088 | Bacteria | 1498 |
| 492 | Ga0207641_10365347 | 3300026088 | Bacteria | 1379 |
| 493 | Ga0207641_10951971 | 3300026088 | Bacteria | 854 |
| 494 | Ga0207641_11255460 | 3300026088 | Bacteria | 741 |
| 495 | Ga0207648_10097170 | 3300026089 | Bacteria | 2578 |
| 496 | Ga0207648_10293405 | 3300026089 | Bacteria | 1456 |
| 497 | Ga0207676_10162342 | 3300026095 | Bacteria | 1937 |
| 498 | Ga0207676_10669756 | 3300026095 | Bacteria | 1003 |
| 499 | Ga0207676_10894876 | 3300026095 | Bacteria | 870 |
| 500 | Ga0207674_10091381 | 3300026116 | Bacteria | 3034 |
| 501 | Ga0207674_10309414 | 3300026116 | Bacteria | 1529 |
| 502 | Ga0207675_100049241 | 3300026118 | Bacteria | 3933 |
| 503 | Ga0207675_100126297 | 3300026118 | Bacteria | 2423 |
| 504 | Ga0207683_10029544 | 3300026121 | Bacteria | 4746 |
| 505 | Ga0207683_10051305 | 3300026121 | Bacteria | 3614 |
| 506 | Ga0207683_10060366 | 3300026121 | Bacteria | 3333 |
| 507 | Ga0207683_10212381 | 3300026121 | Bacteria | 1762 |
| 508 | Ga0207683_10972293 | 3300026121 | Bacteria | 788 |
| 509 | Ga0207683_11677118 | 3300026121 | Bacteria | 585 |
| 510 | Ga0207683_11865045 | 3300026121 | Bacteria | 550 |
| 511 | Ga0207698_10367021 | 3300026142 | Bacteria | 1365 |
| 512 | Ga0207698_10554453 | 3300026142 | Bacteria | 1127 |
| 513 | Ga0209179_1008779 | 3300027512 | Bacteria | 1714 |
| 514 | Ga0209588_1019784 | 3300027671 | Bacteria | 2105 |
| 515 | Ga0207428_10368040 | 3300027907 | Bacteria | 1056 |
| 516 | Ga0207428_10923875 | 3300027907 | Bacteria | 616 |
| 517 | Ga0268266_10001136 | 3300028379 | Bacteria | 33101 |
| 518 | Ga0268266_10003686 | 3300028379 | Bacteria | 15118 |
| 519 | Ga0268266_10094515 | 3300028379 | Bacteria | 2624 |
| 520 | Ga0268266_10190353 | 3300028379 | Bacteria | 1873 |
| 521 | Ga0268266_10388186 | 3300028379 | Bacteria | 1318 |
| 522 | Ga0268266_10654635 | 3300028379 | Bacteria | 1011 |
| 523 | Ga0268266_10731320 | 3300028379 | Bacteria | 954 |
| 524 | Ga0268266_10742093 | 3300028379 | Bacteria | 947 |
| 525 | Ga0268266_11265124 | 3300028379 | Bacteria | 713 |
| 526 | Ga0268265_10061941 | 3300028380 | Bacteria | 2873 |
| 527 | Ga0268265_10124640 | 3300028380 | Bacteria | 2129 |
| 528 | Ga0268265_10192550 | 3300028380 | Bacteria | 1762 |
| 529 | Ga0268265_10198444 | 3300028380 | Bacteria | 1738 |
| 530 | Ga0268265_10480048 | 3300028380 | Bacteria | 1167 |
| 531 | Ga0268265_10564923 | 3300028380 | Bacteria | 1082 |
| 532 | Ga0268264_10192667 | 3300028381 | Bacteria | 1859 |
| 533 | Ga0265318_10079770 | 3300028577 | Bacteria | 1209 |
| 534 | Ga0265323_10018266 | 3300028653 | Bacteria | 2715 |
| 535 | Ga0265322_10117807 | 3300028654 | Bacteria | 756 |
| 536 | Ga0265336_10000415 | 3300028666 | Bacteria | 26412 |
| 537 | Ga0307517_10000098 | 3300028786 | Bacteria | 126044 |
| 538 | Ga0307517_10111579 | 3300028786 | Bacteria | 2077 |
| 539 | Ga0265338_10010045 | 3300028800 | Bacteria | 11184 |
| 540 | Ga0265324_10017627 | 3300029957 | Bacteria | 2597 |
| 541 | Ga0307513_10418783 | 3300031456 | Bacteria | 1070 |
| 542 | Ga0307509_10128015 | 3300031507 | Bacteria | 2501 |
| 543 | Ga0307408_100232397 | 3300031548 | Bacteria | 1511 |
| 544 | Ga0307508_10127944 | 3300031616 | Bacteria | 2143 |
| 545 | Ga0307516_10046388 | 3300031730 | Bacteria | 4287 |
| 546 | Ga0307516_10053240 | 3300031730 | Bacteria | 3958 |
| 547 | Ga0307405_10315500 | 3300031731 | Bacteria | 1192 |
| 548 | Ga0307405_10505101 | 3300031731 | Bacteria | 970 |
| 549 | Ga0307413_10171007 | 3300031824 | Bacteria | 1538 |
| 550 | Ga0307413_11473637 | 3300031824 | Bacteria | 601 |
| 551 | Ga0307410_11425331 | 3300031852 | Bacteria | 609 |
| 552 | Ga0307407_10761295 | 3300031903 | Bacteria | 734 |
| 553 | Ga0307412_10401698 | 3300031911 | Bacteria | 1116 |
| 554 | Ga0307409_100546889 | 3300031995 | Bacteria | 1136 |
| 555 | Ga0307416_101218302 | 3300032002 | Bacteria | 858 |
| 556 | Ga0307414_11399194 | 3300032004 | Bacteria | 650 |
| 557 | Ga0307411_10076739 | 3300032005 | Bacteria | 2285 |
| 558 | Ga0307411_10843113 | 3300032005 | Bacteria | 810 |
| 559 | Ga0307411_11395977 | 3300032005 | Bacteria | 641 |
| 560 | Ga0307415_100297967 | 3300032126 | Bacteria | 1334 |
| 561 | Ga0307507_10560606 | 3300033179 | Bacteria | 600 |
| 562 | Ga0307510_10007562 | 3300033180 | Bacteria | 12946 |
| 563 | Ga0307510_10327889 | 3300033180 | Bacteria | 986 |
| 564 | Ga0373940_0200791 | 3300035088 | Bacteria | 655 |
| 565 | Ga0373940_0336714 | 3300035088 | Bacteria | 527 |
| 566 | Ga0373952_0095837 | 3300035092 | Bacteria | 777 |
| 567 | Ga0373936_0043384 | 3300035113 | Bacteria | 1807 |
| 568 | Ga0373945_0075784 | 3300035116 | Bacteria | 1281 |
| 569 | Ga0373945_0101051 | 3300035116 | Bacteria | 1128 |
| 570 | Ga0373956_0259800 | 3300035119 | Bacteria | 826 |
| 571 | Ga0373943_0121755 | 3300035170 | Bacteria | 1387 |
| 572 | Ga0373943_0139389 | 3300035170 | Bacteria | 1305 |
| 573 | Ga0373943_0152823 | 3300035170 | Bacteria | 1251 |
| 574 | Ga0373946_0176394 | 3300035171 | Bacteria | 1012 |
| 575 | Ga0373946_0267866 | 3300035171 | Bacteria | 837 |
| 576 | Ga0373955_0071154 | 3300035172 | Bacteria | 1945 |
| 577 | Ga0373924_0048356 | 3300035410 | Bacteria | 1757 |
| 578 | Ga0373931_0020927 | 3300035691 | Bacteria | 3277 |
| 579 | Ga0373935_0000520 | 3300035692 | Bacteria | 20054 |
| 580 | Ga0373927_0000046 | 3300035695 | Bacteria | 88401 |
| 581 | Ga0373927_0009305 | 3300035695 | Bacteria | 6590 |
| 582 | Ga0373927_0039246 | 3300035695 | Bacteria | 3073 |
| 583 | Ga0373947_0001392 | 3300035725 | Bacteria | 14902 |
| 584 | Ga0373947_0038071 | 3300035725 | Bacteria | 2855 |
| 585 | Ga0373947_0165966 | 3300035725 | Bacteria | 1430 |
| 586 | Ga0373937_0048844 | 3300036401 | Bacteria | 3874 |
| 587 | Ga0373925_0009905 | 3300037068 | Bacteria | 6924 |
| 588 | Ga0373925_0013452 | 3300037068 | Bacteria | 5923 |
| 589 | Ga0373925_0023664 | 3300037068 | Bacteria | 4482 |
| 590 | Ga0373925_0390614 | 3300037068 | Bacteria | 1134 |
| 591 | Ga0395899_0154753 | 3300037312 | Bacteria | 1623 |
| 592 | Ga0395900_0016187 | 3300037418 | Bacteria | 7597 |
| 593 | Ga0395898_0475635 | 3300037466 | Bacteria | 1189 |
| 594 | Ga0395905_0081275 | 3300037471 | Bacteria | 3037 |
| 595 | Ga0395905_0147099 | 3300037471 | Bacteria | 2217 |
| 596 | Ga0395905_0344285 | 3300037471 | Bacteria | 1382 |
| 597 | Ga0395905_0860914 | 3300037471 | Bacteria | 809 |
| 598 | Ga0436364_0581979 | 3300037853 | Bacteria | 989 |
| 599 | Ga0395901_0097370 | 3300038443 | Bacteria | 3084 |
| 600 | Ga0395901_0733717 | 3300038443 | Bacteria | 982 |
| 601 | Ga0436365_0808674 | 3300039437 | Bacteria | 1431 |
| 602 | Ga0436365_0939911 | 3300039437 | Bacteria | 867 |
| 603 | Ga0436363_1563002 | 3300039450 | Bacteria | 508 |
| 604 | Ga0436362_1153757 | 3300039453 | Bacteria | 603 |
| 605 | Ga0439466_0205551 | 3300041411 | Bacteria | 599 |
| 606 | Ga0439465_0093118 | 3300041413 | Bacteria | 1033 |
| 607 | Ga0451787_184996 | 3300041441 | Bacteria | 635 |
| 608 | Ga0451787_288168 | 3300041441 | Bacteria | 801 |
| 609 | Ga0451793_0362601 | 3300041452 | Bacteria | 827 |
| 610 | Ga0451797_1560878 | 3300041453 | Bacteria | 544 |
| 611 | Ga0451800_1224866 | 3300041459 | Bacteria | 940 |
| 612 | Ga0451802_1494618 | 3300041460 | Bacteria | 619 |
| 613 | Ga0451833_0138182 | 3300041491 | Bacteria | 1056 |
| 614 | Ga0451841_0540834 | 3300041498 | Bacteria | 1072 |
| 615 | Ga0451849_0041184 | 3300041505 | Bacteria | 1084 |
| 616 | Ga0451849_0883225 | 3300041505 | Bacteria | 701 |
| 617 | Ga0451851_0496392 | 3300041507 | Bacteria | 914 |
| 618 | Ga0451851_0647873 | 3300041507 | Bacteria | 516 |
| 619 | Ga0451851_1102993 | 3300041507 | Bacteria | 532 |
| 620 | Ga0451853_1338784 | 3300041512 | Bacteria | 1004 |
| 621 | Ga0451853_3741495 | 3300041512 | Bacteria | 815 |
| 622 | Ga0439458_0159765 | 3300042157 | Bacteria | 606 |
| 623 | Ga0466972_0013988 | 3300044658 | Bacteria | 4024 |
| 624 | Ga0466965_0127668 | 3300044683 | Bacteria | 1317 |
| 625 | Ga0466964_0264110 | 3300044706 | Bacteria | 854 |
| 626 | Ga0466971_0157021 | 3300044719 | Bacteria | 1064 |
| 627 | Ga0466968_0003372 | 3300044735 | Bacteria | 5903 |
| 628 | Ga0466957_0105153 | 3300044842 | Bacteria | 1784 |
| 629 | Ga0466957_1093303 | 3300044842 | Bacteria | 575 |
| 630 | Ga0466960_0008649 | 3300044901 | Bacteria | 4174 |
| 631 | Ga0466960_0130216 | 3300044901 | Bacteria | 1327 |
| 632 | Ga0466959_0154824 | 3300045049 | Bacteria | 1614 |
| 633 | Ga0495617_231405 | 3300046452 | Bacteria | 572 |
| 634 | Ga0495592_0036407 | 3300046454 | Bacteria | 3707 |
| 635 | Ga0495603_0000051 | 3300046455 | Bacteria | 50402 |
| 636 | Ga0495603_0072096 | 3300046455 | Bacteria | 2029 |
| 637 | Ga0495603_0074766 | 3300046455 | Bacteria | 1989 |
| 638 | Ga0495603_0074854 | 3300046455 | Bacteria | 1988 |
| 639 | Ga0495590_0077288 | 3300046457 | Bacteria | 1171 |
| 640 | Ga0495629_0000182 | 3300046459 | Bacteria | 56655 |
| 641 | Ga0495629_0896585 | 3300046459 | Bacteria | 581 |
| 642 | Ga0495638_0021430 | 3300046460 | Bacteria | 4259 |
| 643 | Ga0495638_0139137 | 3300046460 | Bacteria | 1418 |
| 644 | Ga0495638_0266085 | 3300046460 | Bacteria | 938 |
| 645 | Ga0495638_0526218 | 3300046460 | Bacteria | 591 |
| 646 | Ga0495638_0526497 | 3300046460 | Bacteria | 591 |
| 647 | Ga0495641_0006374 | 3300046461 | Bacteria | 7658 |
| 648 | Ga0495653_0200693 | 3300046463 | Bacteria | 1354 |
| 649 | Ga0495650_0130564 | 3300046471 | Bacteria | 917 |
| 650 | Ga0495580_0004021 | 3300046472 | Bacteria | 12411 |
| 651 | Ga0495580_0291464 | 3300046472 | Bacteria | 1112 |
| 652 | Ga0495582_0000137 | 3300046473 | Bacteria | 39425 |
| 653 | Ga0495582_0229642 | 3300046473 | Bacteria | 1062 |
| 654 | Ga0495582_0482908 | 3300046473 | Bacteria | 716 |
| 655 | Ga0495605_0227921 | 3300046474 | Bacteria | 803 |
| 656 | Ga0495639_0002873 | 3300046475 | Bacteria | 7493 |
| 657 | Ga0495639_0254363 | 3300046475 | Bacteria | 869 |
| 658 | Ga0495639_0620166 | 3300046475 | Bacteria | 557 |
| 659 | Ga0495662_0000583 | 3300046476 | Bacteria | 16810 |
| 660 | Ga0495664_0009075 | 3300046477 | Bacteria | 5560 |
| 661 | Ga0495584_0104087 | 3300046491 | Bacteria | 1435 |
| 662 | Ga0495584_0181275 | 3300046491 | Bacteria | 1070 |
| 663 | Ga0495584_0403064 | 3300046491 | Bacteria | 695 |
| 664 | Ga0495584_0507590 | 3300046491 | Bacteria | 614 |
| 665 | Ga0495585_0029073 | 3300046492 | Bacteria | 3148 |
| 666 | Ga0495585_0275017 | 3300046492 | Bacteria | 834 |
| 667 | Ga0495594_0001833 | 3300046499 | Bacteria | 11057 |
| 668 | Ga0495594_0042613 | 3300046499 | Bacteria | 2486 |
| 669 | Ga0495594_0107854 | 3300046499 | Bacteria | 1569 |
| 670 | Ga0495596_0063639 | 3300046500 | Bacteria | 1435 |
| 671 | Ga0495596_0194477 | 3300046500 | Bacteria | 788 |
| 672 | Ga0495607_0393938 | 3300046501 | Bacteria | 631 |
| 673 | Ga0495583_0025223 | 3300046506 | Bacteria | 2974 |
| 674 | Ga0495606_0119588 | 3300046507 | Bacteria | 1578 |
| 675 | Ga0495606_0122562 | 3300046507 | Bacteria | 1554 |
| 676 | Ga0495606_0157047 | 3300046507 | Bacteria | 1330 |
| 677 | Ga0495606_0444146 | 3300046507 | Bacteria | 666 |
| 678 | Ga0495610_0100069 | 3300046512 | Bacteria | 1300 |
| 679 | Ga0495616_0162322 | 3300046513 | Bacteria | 1004 |
| 680 | Ga0495618_0523518 | 3300046514 | Bacteria | 713 |
| 681 | Ga0495620_0159318 | 3300046515 | Bacteria | 877 |
| 682 | Ga0495620_0169679 | 3300046515 | Bacteria | 846 |
| 683 | Ga0495628_0021321 | 3300046516 | Bacteria | 5332 |
| 684 | Ga0495630_0002625 | 3300046517 | Bacteria | 12446 |
| 685 | Ga0495630_0269329 | 3300046517 | Bacteria | 1301 |
| 686 | Ga0495630_1347834 | 3300046517 | Bacteria | 537 |
| 687 | Ga0495631_0015803 | 3300046518 | Bacteria | 3609 |
| 688 | Ga0495631_0089133 | 3300046518 | Bacteria | 1328 |
| 689 | Ga0495631_0197719 | 3300046518 | Bacteria | 860 |
| 690 | Ga0495631_0511994 | 3300046518 | Bacteria | 511 |
| 691 | Ga0495632_0055923 | 3300046519 | Bacteria | 1930 |
| 692 | Ga0495632_0138876 | 3300046519 | Bacteria | 1128 |
| 693 | Ga0495632_0148961 | 3300046519 | Bacteria | 1082 |
| 694 | Ga0495632_0294698 | 3300046519 | Bacteria | 720 |
| 695 | Ga0495643_0012291 | 3300046522 | Bacteria | 5170 |
| 696 | Ga0495643_0074090 | 3300046522 | Bacteria | 1784 |
| 697 | Ga0495643_0250555 | 3300046522 | Bacteria | 827 |
| 698 | Ga0495644_0091283 | 3300046523 | Bacteria | 1150 |
| 699 | Ga0495644_0220346 | 3300046523 | Bacteria | 733 |
| 700 | Ga0495648_0146427 | 3300046524 | Bacteria | 1237 |
| 701 | Ga0495648_0336875 | 3300046524 | Bacteria | 694 |
| 702 | Ga0495663_0064127 | 3300046525 | Bacteria | 1159 |
| 703 | Ga0495666_0386634 | 3300046526 | Bacteria | 629 |
| 704 | Ga0495666_0391769 | 3300046526 | Bacteria | 625 |
| 705 | Ga0495642_0166942 | 3300046528 | Bacteria | 956 |
| 706 | Ga0495652_0037670 | 3300046529 | Bacteria | 4194 |
| 707 | Ga0495654_0349189 | 3300046530 | Bacteria | 595 |
| 708 | Ga0495665_0001239 | 3300046531 | Bacteria | 13612 |
| 709 | Ga0495640_0004375 | 3300046533 | Bacteria | 11274 |
| 710 | Ga0495598_0046091 | 3300046537 | Bacteria | 1294 |
| 711 | Ga0495621_0018971 | 3300046539 | Bacteria | 2240 |
| 712 | Ga0495597_0033416 | 3300046542 | Bacteria | 2329 |
| 713 | Ga0495597_0051282 | 3300046542 | Bacteria | 1820 |
| 714 | Ga0495597_0344586 | 3300046542 | Bacteria | 572 |
| 715 | Ga0495622_0005490 | 3300046557 | Bacteria | 5879 |
| 716 | Ga0495622_0016785 | 3300046557 | Bacteria | 3410 |
| 717 | Ga0495622_0135417 | 3300046557 | Bacteria | 1120 |
| 718 | Ga0495622_0205157 | 3300046557 | Bacteria | 877 |
| 719 | Ga0495633_0109329 | 3300046558 | Bacteria | 1282 |
| 720 | Ga0495633_0242170 | 3300046558 | Bacteria | 824 |
| 721 | Ga0495667_0011352 | 3300046559 | Bacteria | 6031 |
| 722 | Ga0495656_0016955 | 3300046615 | Bacteria | 2772 |
| 723 | Ga0495656_0200527 | 3300046615 | Bacteria | 990 |
| 724 | Ga0495656_0214078 | 3300046615 | Bacteria | 961 |
| 725 | Ga0495668_0026683 | 3300046616 | Bacteria | 3276 |
| 726 | Ga0495668_0029504 | 3300046616 | Bacteria | 3099 |
| 727 | Ga0495668_0029734 | 3300046616 | Bacteria | 3086 |
| 728 | Ga0495668_0052320 | 3300046616 | Bacteria | 2260 |
| 729 | Ga0495668_0203406 | 3300046616 | Bacteria | 1084 |
| 730 | Ga0495668_0482000 | 3300046616 | Bacteria | 683 |
| 731 | Ga0495634_0002221 | 3300046642 | Bacteria | 16276 |
| 732 | Ga0495611_0126279 | 3300046648 | Bacteria | 1193 |
| 733 | Ga0495625_0058534 | 3300046660 | Bacteria | 2738 |
| 734 | Ga0495625_0094413 | 3300046660 | Bacteria | 2064 |
| 735 | Ga0495625_0140569 | 3300046660 | Bacteria | 1629 |
| 736 | Ga0495625_0185164 | 3300046660 | Bacteria | 1382 |
| 737 | Ga0495625_0391655 | 3300046660 | Bacteria | 870 |
| 738 | Ga0495625_0711609 | 3300046660 | Bacteria | 592 |
| 739 | Ga0495635_0001455 | 3300046663 | Bacteria | 15846 |
| 740 | Ga0495635_0978415 | 3300046663 | Bacteria | 539 |
| 741 | Ga0495659_0061547 | 3300046664 | Bacteria | 1387 |
| 742 | Ga0495661_0247668 | 3300046665 | Bacteria | 911 |
| 743 | Ga0495588_0046469 | 3300046674 | Bacteria | 2227 |
| 744 | Ga0495588_0082492 | 3300046674 | Bacteria | 1679 |
| 745 | Ga0495657_0147798 | 3300046675 | Bacteria | 1461 |
| 746 | Ga0495646_0048867 | 3300046680 | Bacteria | 2569 |
| 747 | Ga0495647_0032438 | 3300046681 | Bacteria | 1946 |
| 748 | Ga0495647_0223727 | 3300046681 | Bacteria | 831 |
| 749 | Ga0495658_0469737 | 3300046683 | Bacteria | 804 |
| 750 | Ga0495669_0007993 | 3300046684 | Bacteria | 4439 |
| 751 | Ga0495669_0255061 | 3300046684 | Bacteria | 842 |
| 752 | Ga0495669_0316823 | 3300046684 | Bacteria | 752 |
| 753 | Ga0495669_0470253 | 3300046684 | Bacteria | 611 |
| 754 | Ga0495613_0047965 | 3300046689 | Bacteria | 3154 |
| 755 | Ga0495624_0000898 | 3300046690 | Bacteria | 23624 |
| 756 | Ga0495624_0145609 | 3300046690 | Bacteria | 1450 |
| 757 | Ga0495624_0564993 | 3300046690 | Bacteria | 679 |
| 758 | Ga0495670_0250616 | 3300046691 | Bacteria | 944 |
| 759 | Ga0495670_0334925 | 3300046691 | Bacteria | 813 |
| 760 | Ga0495671_0084494 | 3300046692 | Bacteria | 1555 |
| 761 | Ga0495671_0089738 | 3300046692 | Bacteria | 1505 |
| 762 | Ga0495671_0101526 | 3300046692 | Bacteria | 1406 |
| 763 | Ga0495671_0165256 | 3300046692 | Bacteria | 1076 |
| 764 | Ga0495649_0097432 | 3300046694 | Bacteria | 1565 |
| 765 | Ga0495649_0157413 | 3300046694 | Bacteria | 1192 |
| 766 | Ga0495649_0193763 | 3300046694 | Bacteria | 1057 |
| 767 | Ga0495589_0103033 | 3300046794 | Bacteria | 1380 |
| 768 | Ga0495589_0111160 | 3300046794 | Bacteria | 1322 |
| 769 | Ga0495589_0129712 | 3300046794 | Bacteria | 1211 |
| 770 | Ga0495600_0113596 | 3300046809 | Bacteria | 1763 |
| 771 | Ga0495581_0007805 | 3300047315 | Bacteria | 6197 |
| 772 | Ga0495581_0081158 | 3300047315 | Bacteria | 1878 |
| 773 | Ga0495581_0425001 | 3300047315 | Bacteria | 774 |
| 774 | Ga0495636_0097970 | 3300047318 | Bacteria | 1279 |
| 775 | Ga0495636_0194356 | 3300047318 | Bacteria | 925 |
| 776 | Ga0495636_0656702 | 3300047318 | Bacteria | 515 |
| 777 | Ga0495674_0010092 | 3300047319 | Bacteria | 8948 |
| 778 | Ga0495672_0025981 | 3300047320 | Bacteria | 3742 |
| 779 | Ga0495672_0239678 | 3300047320 | Bacteria | 886 |
| 780 | Ga0495672_0474812 | 3300047320 | Bacteria | 560 |
| 781 | Ga0495676_0110086 | 3300047321 | Bacteria | 2023 |
| 782 | Ga0495676_0127701 | 3300047321 | Bacteria | 1840 |
| 783 | Ga0495680_0404157 | 3300047322 | Bacteria | 942 |
| 784 | Ga0495683_0064475 | 3300047323 | Bacteria | 1809 |
| 785 | Ga0495683_0478557 | 3300047323 | Bacteria | 508 |
| 786 | Ga0495687_027560 | 3300047443 | Bacteria | 2657 |
| 787 | Ga0495687_047752 | 3300047443 | Bacteria | 1841 |
| 788 | Ga0495677_0067538 | 3300047445 | Bacteria | 1330 |
| 789 | Ga0495677_0172629 | 3300047445 | Bacteria | 837 |
| 790 | Ga0495679_138495 | 3300047446 | Bacteria | 658 |
| 791 | Ga0495685_140734 | 3300047447 | Bacteria | 786 |
| 792 | Ga0495673_0022298 | 3300047469 | Bacteria | 3107 |
| 793 | Ga0495673_0103713 | 3300047469 | Bacteria | 1146 |
| 794 | Ga0495673_0160362 | 3300047469 | Bacteria | 864 |
| 795 | Ga0495673_0256112 | 3300047469 | Bacteria | 638 |
| 796 | Ga0495673_0293941 | 3300047469 | Bacteria | 584 |
| 797 | Ga0495684_0045864 | 3300047471 | Bacteria | 3344 |
| 798 | Ga0495686_0143402 | 3300047472 | Bacteria | 1408 |
| 799 | Ga0495686_0250754 | 3300047472 | Bacteria | 995 |
| 800 | Ga0495593_0000469 | 3300047673 | Bacteria | 22695 |
| 801 | Ga0495602_0385915 | 3300048088 | Bacteria | 1002 |
| 802 | Ga0495614_0001926 | 3300048089 | Bacteria | 9106 |
| 803 | Ga0495614_0409324 | 3300048089 | Bacteria | 638 |
| 804 | Ga0495615_0197116 | 3300048090 | Bacteria | 620 |
| 805 | Ga0495626_0275345 | 3300048091 | Bacteria | 670 |
| 806 | Ga0496100_0001098 | 3300048903 | Bacteria | 13078 |
| 807 | Ga0496100_0137249 | 3300048903 | Bacteria | 1729 |
| 808 | Ga0496100_0223380 | 3300048903 | Bacteria | 1383 |
| 809 | Ga0496101_0011608 | 3300048904 | Bacteria | 5851 |
| 810 | Ga0496101_0232477 | 3300048904 | Bacteria | 1433 |
| 811 | Ga0496101_0541375 | 3300048904 | Bacteria | 920 |
| 812 | Ga0496101_0546160 | 3300048904 | Bacteria | 916 |
| 813 | Ga0496101_0933369 | 3300048904 | Bacteria | 683 |
| 814 | Ga0496102_0008520 | 3300048905 | Bacteria | 8791 |
| 815 | Ga0496102_0153816 | 3300048905 | Bacteria | 2162 |
| 816 | Ga0496102_0199985 | 3300048905 | Bacteria | 1883 |
| 817 | Ga0496102_0380154 | 3300048905 | Bacteria | 1329 |
| 818 | Ga0496102_0381156 | 3300048905 | Bacteria | 1327 |
| 819 | Ga0496102_0410219 | 3300048905 | Bacteria | 1273 |
| 820 | Ga0496102_0438380 | 3300048905 | Bacteria | 1226 |
| 821 | Ga0496102_0476410 | 3300048905 | Bacteria | 1169 |
| 822 | Ga0496102_0861647 | 3300048905 | Bacteria | 828 |
| 823 | Ga0496103_0010717 | 3300048906 | Bacteria | 5424 |
| 824 | Ga0496103_0037555 | 3300048906 | Bacteria | 2968 |
| 825 | Ga0496103_0405205 | 3300048906 | Bacteria | 876 |
| 826 | Ga0496103_0424841 | 3300048906 | Bacteria | 853 |
| 827 | Ga0496103_1061774 | 3300048906 | Bacteria | 502 |
| 828 | Ga0496104_0021810 | 3300048907 | Bacteria | 5883 |
| 829 | Ga0496104_0026734 | 3300048907 | Bacteria | 5332 |
| 830 | Ga0496104_0037264 | 3300048907 | Bacteria | 4548 |
| 831 | Ga0496104_0116018 | 3300048907 | Bacteria | 2570 |
| 832 | Ga0496104_0208151 | 3300048907 | Bacteria | 1868 |
| 833 | Ga0496104_1671737 | 3300048907 | Bacteria | 539 |
| 834 | Ga0496104_1770519 | 3300048907 | Bacteria | 520 |
| 835 | Ga0496105_0030338 | 3300048908 | Bacteria | 4430 |
| 836 | Ga0496105_0120936 | 3300048908 | Bacteria | 2159 |
| 837 | Ga0496105_0207100 | 3300048908 | Bacteria | 1600 |
| 838 | Ga0496105_0286727 | 3300048908 | Bacteria | 1326 |
| 839 | Ga0496105_0345596 | 3300048908 | Bacteria | 1189 |
| 840 | Ga0496106_0026464 | 3300048909 | Bacteria | 4320 |
| 841 | Ga0496106_0123661 | 3300048909 | Bacteria | 2024 |
| 842 | Ga0496106_0396800 | 3300048909 | Bacteria | 1109 |
| 843 | Ga0496106_0500576 | 3300048909 | Bacteria | 976 |
| 844 | Ga0496106_0680497 | 3300048909 | Bacteria | 821 |
| 845 | Ga0496107_0021497 | 3300048910 | Bacteria | 4560 |
| 846 | Ga0496108_0042075 | 3300048911 | Bacteria | 3813 |
| 847 | Ga0496108_0196577 | 3300048911 | Bacteria | 1749 |
| 848 | Ga0496108_0208945 | 3300048911 | Bacteria | 1694 |
| 849 | Ga0496108_0256025 | 3300048911 | Bacteria | 1523 |
| 850 | Ga0496108_0540220 | 3300048911 | Bacteria | 1017 |
| 851 | Ga0496109_0049778 | 3300048912 | Bacteria | 3815 |
| 852 | Ga0496109_0293021 | 3300048912 | Bacteria | 1534 |
| 853 | Ga0496109_0365792 | 3300048912 | Bacteria | 1362 |
| 854 | Ga0496109_0380566 | 3300048912 | Bacteria | 1333 |
| 855 | Ga0496110_0066685 | 3300048913 | Bacteria | 3183 |
| 856 | Ga0496110_0091129 | 3300048913 | Bacteria | 2727 |
| 857 | Ga0496110_0288249 | 3300048913 | Bacteria | 1495 |
| 858 | Ga0496110_0515209 | 3300048913 | Bacteria | 1088 |
| 859 | Ga0496110_1657088 | 3300048913 | Bacteria | 550 |
| 860 | Ga0496111_0040302 | 3300048914 | Bacteria | 3350 |
| 861 | Ga0496111_0599596 | 3300048914 | Bacteria | 806 |
| 862 | Ga0496111_0678287 | 3300048914 | Bacteria | 751 |
| 863 | Ga0496112_0023844 | 3300048915 | Bacteria | 5852 |
| 864 | Ga0496112_0025634 | 3300048915 | Bacteria | 5663 |
| 865 | Ga0496112_0174342 | 3300048915 | Bacteria | 2116 |
| 866 | Ga0496112_0353164 | 3300048915 | Bacteria | 1412 |
| 867 | Ga0496112_0731438 | 3300048915 | Bacteria | 916 |
| 868 | Ga0496113_0015425 | 3300048916 | Bacteria | 5250 |
| 869 | Ga0496113_0054139 | 3300048916 | Bacteria | 3002 |
| 870 | Ga0496113_0716176 | 3300048916 | Bacteria | 798 |
| 871 | Ga0496113_1305035 | 3300048916 | Bacteria | 564 |
| 872 | Ga0496114_0033230 | 3300048917 | Bacteria | 4249 |
| 873 | Ga0496114_0345394 | 3300048917 | Bacteria | 1316 |
| 874 | Ga0496114_0400728 | 3300048917 | Bacteria | 1215 |
| 875 | Ga0496114_0793411 | 3300048917 | Bacteria | 825 |
| 876 | Ga0496114_1533587 | 3300048917 | Bacteria | 554 |
| 877 | Ga0496115_0017046 | 3300048918 | Bacteria | 5541 |
| 878 | Ga0496115_0159969 | 3300048918 | Bacteria | 1861 |
| 879 | Ga0496115_0288059 | 3300048918 | Bacteria | 1348 |
| 880 | Ga0496115_0468347 | 3300048918 | Bacteria | 1016 |
| 881 | Ga0496115_0868630 | 3300048918 | Bacteria | 697 |
| 882 | Ga0496116_0198582 | 3300048919 | Bacteria | 1053 |
| 883 | Ga0496118_0065065 | 3300048921 | Bacteria | 2670 |
| 884 | Ga0496118_0086044 | 3300048921 | Bacteria | 2186 |
| 885 | Ga0496118_0087129 | 3300048921 | Bacteria | 2167 |
| 886 | Ga0496118_0120126 | 3300048921 | Bacteria | 1716 |
| 887 | Ga0496118_0153875 | 3300048921 | Bacteria | 1434 |
| 888 | Ga0496118_0310668 | 3300048921 | Bacteria | 860 |
| 889 | Ga0496119_0043743 | 3300048922 | Bacteria | 2827 |
| 890 | Ga0496119_0044857 | 3300048922 | Bacteria | 2778 |
| 891 | Ga0496119_0046704 | 3300048922 | Bacteria | 2701 |
| 892 | Ga0496119_0189829 | 3300048922 | Bacteria | 1071 |
| 893 | Ga0496120_0012720 | 3300048923 | Bacteria | 5708 |
| 894 | Ga0496120_0220357 | 3300048923 | Bacteria | 907 |
| 895 | Ga0496121_0000265 | 3300048924 | Bacteria | 109251 |
| 896 | Ga0496121_0011669 | 3300048924 | Bacteria | 9712 |
| 897 | Ga0496121_0028222 | 3300048924 | Bacteria | 5229 |
| 898 | Ga0496121_0044559 | 3300048924 | Bacteria | 3824 |
| 899 | Ga0496121_0120593 | 3300048924 | Bacteria | 1981 |
| 900 | Ga0496121_0267964 | 3300048924 | Bacteria | 1175 |
| 901 | Ga0496121_0412556 | 3300048924 | Bacteria | 881 |
| 902 | Ga0496121_0479793 | 3300048924 | Bacteria | 794 |
| 903 | Ga0496121_0481239 | 3300048924 | Bacteria | 793 |
| 904 | Ga0496122_0090249 | 3300048925 | Bacteria | 2092 |
| 905 | Ga0496122_0093188 | 3300048925 | Bacteria | 2044 |
| 906 | Ga0496122_0298659 | 3300048925 | Bacteria | 870 |
| 907 | Ga0496124_0213718 | 3300048927 | Bacteria | 1457 |
| 908 | Ga0496124_0226852 | 3300048927 | Bacteria | 1400 |
| 909 | Ga0496124_0262119 | 3300048927 | Bacteria | 1271 |
| 910 | Ga0496124_0331448 | 3300048927 | Bacteria | 1085 |
| 911 | Ga0496125_0000176 | 3300048928 | Bacteria | 140746 |
| 912 | Ga0496125_0034884 | 3300048928 | Bacteria | 4426 |
| 913 | Ga0496125_0137109 | 3300048928 | Bacteria | 1709 |
| 914 | Ga0496125_0206435 | 3300048928 | Bacteria | 1281 |
| 915 | Ga0496126_0011852 | 3300048929 | Bacteria | 8969 |
| 916 | Ga0496126_0015449 | 3300048929 | Bacteria | 7677 |
| 917 | Ga0496126_0072217 | 3300048929 | Bacteria | 3070 |
| 918 | Ga0496126_0122354 | 3300048929 | Bacteria | 2255 |
| 919 | Ga0496126_0177512 | 3300048929 | Bacteria | 1811 |
| 920 | Ga0496126_0262004 | 3300048929 | Bacteria | 1437 |
| 921 | Ga0496126_0444729 | 3300048929 | Bacteria | 1044 |
| 922 | Ga0496126_1143757 | 3300048929 | Bacteria | 576 |
| 923 | Ga0495682_0018288 | 3300049460 | Bacteria | 2641 |
| 924 | Ga0495682_0053712 | 3300049460 | Bacteria | 1463 |
| 925 | Ga0495682_0066545 | 3300049460 | Bacteria | 1299 |
| 926 | Ga0495682_0213564 | 3300049460 | Bacteria | 684 |
| 927 | Ga0501038_0265551 | 3300049574 | Bacteria | 1355 |
| 928 | Ga0501040_0715101 | 3300049576 | Bacteria | 724 |
| 929 | Ga0501042_0374282 | 3300049578 | Bacteria | 1031 |
| 930 | Ga0501067_0604891 | 3300049583 | Bacteria | 615 |
| 931 | Ga0501074_0394278 | 3300049590 | Bacteria | 982 |
| 932 | nmdc:mga03683_107519_c1 | 3300050489 | Bacteria | 1230 |
| 933 | nmdc:mga03683_489268_c1 | 3300050489 | Bacteria | 595 |
| 934 | nmdc:mga03n38_12993_c1 | 3300050490 | Bacteria | 3150 |
| 935 | nmdc:mga03n38_483662_c1 | 3300050490 | Bacteria | 693 |
| 936 | nmdc:mga00v17_69660_c1 | 3300050491 | Bacteria | 2177 |
| 937 | nmdc:mga00v17_866497_c1 | 3300050491 | Bacteria | 573 |
| 938 | nmdc:mga00v17_86774_c1 | 3300050491 | Bacteria | 1961 |
| 939 | nmdc:mga0yw44_124038_c1 | 3300050492 | Bacteria | 1666 |
| 940 | nmdc:mga0yw44_187882_c1 | 3300050492 | Bacteria | 1362 |
| 941 | nmdc:mga0yw44_19763_c1 | 3300050492 | Bacteria | 3722 |
| 942 | nmdc:mga0yw44_31797_c1 | 3300050492 | Bacteria | 3071 |
| 943 | nmdc:mga0yw44_514125_c1 | 3300050492 | Bacteria | 813 |
| 944 | nmdc:mga0yw44_5454_c2 | 3300050492 | Bacteria | 5426 |
| 945 | nmdc:mga0yw44_638498_c1 | 3300050492 | Bacteria | 723 |
| 946 | nmdc:mga0k408_148173_c1 | 3300050493 | Bacteria | 1397 |
| 947 | nmdc:mga0k408_179196_c1 | 3300050493 | Bacteria | 1264 |
| 948 | nmdc:mga0k408_519503_c1 | 3300050493 | Bacteria | 705 |
| 949 | nmdc:mga0k408_571476_c1 | 3300050493 | Bacteria | 668 |
| 950 | nmdc:mga06z11_199789_c1 | 3300050494 | Bacteria | 1161 |
| 951 | nmdc:mga06z11_217349_c1 | 3300050494 | Bacteria | 1116 |
| 952 | nmdc:mga06z11_224365_c1 | 3300050494 | Bacteria | 1099 |
| 953 | nmdc:mga06z11_298090_c1 | 3300050494 | Bacteria | 958 |
| 954 | nmdc:mga06z11_8466_c1 | 3300050494 | Bacteria | 4291 |
| 955 | nmdc:mga06z11_93967_c1 | 3300050494 | Bacteria | 1633 |
| 956 | nmdc:mga04h51_252344_c1 | 3300050495 | Bacteria | 707 |
| 957 | nmdc:mga07m45_107497_c1 | 3300050496 | Bacteria | 1605 |
| 958 | nmdc:mga07m45_190315_c1 | 3300050496 | Bacteria | 1193 |
| 959 | nmdc:mga07m45_54052_c1 | 3300050496 | Bacteria | 2270 |
| 960 | nmdc:mga07m45_59524_c1 | 3300050496 | Bacteria | 2161 |
| 961 | nmdc:mga07m45_81713_c1 | 3300050496 | Bacteria | 1845 |
| 962 | nmdc:mga09592_265942_c1 | 3300050508 | Bacteria | 1487 |
| 963 | nmdc:mga06r32_893179_c1 | 3300050510 | Bacteria | 845 |
| 964 | nmdc:mga08y16_1146190_c1 | 3300050511 | Bacteria | 750 |
| 965 | nmdc:mga08y16_1285024_c1 | 3300050511 | Bacteria | 699 |
| 966 | nmdc:mga08y16_635192_c1 | 3300050511 | Bacteria | 1073 |
| 967 | nmdc:mga0n895_832353_c1 | 3300050512 | Bacteria | 912 |
| 968 | nmdc:mga0rr50_546422_c1 | 3300050513 | Bacteria | 986 |
| 969 | nmdc:mga0a205_695597_c1 | 3300050515 | Bacteria | 866 |
| 970 | Ga0495601_0301790 | 3300053077 | Bacteria | 1043 |
| 971 | Ga0495612_0157977 | 3300053078 | Bacteria | 989 |
| 972 | Ga0495655_0012324 | 3300053083 | Bacteria | 1740 |
| 973 | Ga0495655_0185941 | 3300053083 | Bacteria | 672 |
| 974 | Ga0495595_0031235 | 3300053084 | Bacteria | 2393 |
| 975 | Ga0495619_0187040 | 3300053085 | Bacteria | 1433 |
| 976 | Ga0500578_0070175 | 3300053086 | Bacteria | 2234 |
| 977 | Ga0500646_0389642 | 3300053090 | Bacteria | 513 |
| 978 | Ga0500647_0073432 | 3300053091 | Bacteria | 1642 |
| 979 | Ga0500647_0193872 | 3300053091 | Bacteria | 925 |
| 980 | Ga0500583_0098116 | 3300053092 | Bacteria | 1432 |
| 981 | Ga0500583_0108192 | 3300053092 | Bacteria | 1367 |
| 982 | Ga0500583_0314451 | 3300053092 | Bacteria | 764 |
| 983 | Ga0500566_0000078 | 3300053094 | Bacteria | 47558 |
| 984 | Ga0500566_0076330 | 3300053094 | Bacteria | 1873 |
| 985 | Ga0500640_000121 | 3300053095 | Bacteria | 14580 |
| 986 | Ga0500640_061554 | 3300053095 | Bacteria | 1626 |
| 987 | Ga0500641_0167005 | 3300053096 | Bacteria | 948 |
| 988 | Ga0500641_0341232 | 3300053096 | Bacteria | 604 |
| 989 | Ga0500554_118757 | 3300053102 | Bacteria | 891 |
| 990 | Ga0500555_031686 | 3300053103 | Bacteria | 1497 |
| 991 | Ga0500555_040212 | 3300053103 | Bacteria | 1304 |
| 992 | Ga0500556_0030267 | 3300053104 | Bacteria | 1833 |
| 993 | Ga0500557_000011 | 3300053105 | Bacteria | 117471 |
| 994 | Ga0500569_018952 | 3300053109 | Bacteria | 1785 |
| 995 | Ga0500569_084458 | 3300053109 | Bacteria | 1020 |
| 996 | Ga0500572_000170 | 3300053111 | Bacteria | 22863 |
| 997 | Ga0500572_110411 | 3300053111 | Bacteria | 884 |
| 998 | Ga0500580_261947 | 3300053113 | Bacteria | 503 |
| 999 | Ga0500591_077793 | 3300053115 | Bacteria | 1484 |
| 1000 | Ga0500592_023529 | 3300053116 | Bacteria | 993 |
| 1001 | Ga0500594_0047298 | 3300053118 | Bacteria | 1200 |
| 1002 | Ga0500595_002442 | 3300053119 | Bacteria | 9222 |
| 1003 | Ga0500595_002477 | 3300053119 | Bacteria | 9136 |
| 1004 | Ga0500595_004672 | 3300053119 | Bacteria | 6088 |
| 1005 | Ga0500595_026908 | 3300053119 | Bacteria | 1976 |
| 1006 | Ga0500597_339561 | 3300053120 | Bacteria | 588 |
| 1007 | Ga0500608_084601 | 3300053122 | Bacteria | 1492 |
| 1008 | Ga0500608_232489 | 3300053122 | Bacteria | 734 |
| 1009 | Ga0500614_004910 | 3300053123 | Bacteria | 2813 |
| 1010 | Ga0500642_0000090 | 3300053130 | Bacteria | 46849 |
| 1011 | Ga0500642_0008061 | 3300053130 | Bacteria | 3580 |
| 1012 | Ga0500642_0199702 | 3300053130 | Bacteria | 931 |
| 1013 | Ga0500658_0072704 | 3300053134 | Bacteria | 1455 |
| 1014 | Ga0500658_0143484 | 3300053134 | Bacteria | 1072 |
| 1015 | Ga0500559_0009508 | 3300053136 | Bacteria | 4201 |
| 1016 | Ga0500559_0016864 | 3300053136 | Bacteria | 3085 |
| 1017 | Ga0500561_0058078 | 3300053137 | Bacteria | 1076 |
| 1018 | Ga0500568_0011274 | 3300053139 | Bacteria | 4161 |
| 1019 | Ga0500568_0037366 | 3300053139 | Bacteria | 1970 |
| 1020 | Ga0500590_085257 | 3300053148 | Bacteria | 1543 |
| 1021 | Ga0500590_096457 | 3300053148 | Bacteria | 1427 |
| 1022 | Ga0500603_000081 | 3300053150 | Bacteria | 22182 |
| 1023 | Ga0500603_001666 | 3300053150 | Bacteria | 5003 |
| 1024 | Ga0500620_100532 | 3300053155 | Bacteria | 1011 |
| 1025 | Ga0500627_0007990 | 3300053158 | Bacteria | 3728 |
| 1026 | Ga0500627_0078704 | 3300053158 | Bacteria | 1467 |
| 1027 | Ga0500627_0293144 | 3300053158 | Bacteria | 712 |
| 1028 | Ga0500627_0441489 | 3300053158 | Bacteria | 549 |
| 1029 | Ga0500630_004509 | 3300053159 | Bacteria | 6772 |
| 1030 | Ga0500634_0113939 | 3300053161 | Bacteria | 1328 |
| 1031 | Ga0500638_021427 | 3300053162 | Bacteria | 3054 |
| 1032 | Ga0500639_000028 | 3300053163 | Bacteria | 77951 |
| 1033 | Ga0500639_131622 | 3300053163 | Bacteria | 1184 |
| 1034 | Ga0500636_0049352 | 3300053177 | Bacteria | 2476 |
| 1035 | Ga0500636_0065953 | 3300053177 | Bacteria | 2106 |
| 1036 | Ga0500636_0200828 | 3300053177 | Bacteria | 1055 |
| 1037 | Ga0500636_0398985 | 3300053177 | Bacteria | 639 |
| 1038 | Ga0500637_0020909 | 3300053178 | Bacteria | 3551 |
| 1039 | Ga0500637_0039902 | 3300053178 | Bacteria | 2649 |
| 1040 | Ga0500637_0125685 | 3300053178 | Bacteria | 1487 |
| 1041 | Ga0500570_131027 | 3300053724 | Bacteria | 952 |
| 1042 | Ga0500625_002925 | 3300053729 | Bacteria | 6585 |
| 1043 | Ga0500645_161204 | 3300053730 | Bacteria | 615 |
| 1044 | Ga0500596_000324 | 3300053735 | Bacteria | 8556 |
| 1045 | Ga0500601_003418 | 3300053737 | Bacteria | 1721 |
| 1046 | Ga0500661_002428 | 3300055283 | Bacteria | 3509 |
| 1047 | 8056685557 | 8056681323 | Bacteria | 8472857 |
| 1048 | 2513673294 | 2513237098 | Bacteria | 9902361 |
| 1049 | 2524465862 | 2524023210 | Bacteria | 9029266 |
| 1050 | 2728751746 | 2728368998 | Bacteria | 8720350 |
| 1051 | 2885387305 | 2885383462 | Bacteria | 9473874 |
| 1052 | 2903774357 | 2903768456 | Bacteria | 9749579 |
| 1053 | JGI24750J21931_1029154 | |||
| 1054 | JGI25165J46597_1048384 | |||
| 1055 | JGI25153J46596_10002543 | |||
| 1056 | JGI25153J46596_10010032 | |||
| 1057 | JGI25404J52841_10077133 | |||
| 1058 | Ga0055539_1006053 | |||
| 1059 | Ga0055526_1039847 | |||
| 1060 | Ga0055524_1036995 | |||
| 1061 | Ga0055531_10001939 | |||
| 1062 | Ga0055543_1004643 | |||
| 1063 | Ga0055543_1057955 | |||
| 1064 | Ga0065165_1001641 | |||
| 1065 | Ga0065165_1003060 | |||
| 1066 | Ga0065165_1006123 | |||
| 1067 | Ga0065165_1060395 | |||
| 1068 | Ga0070658_10012558 | |||
| 1069 | Ga0070658_10023514 | |||
| 1070 | Ga0070658_10102491 | |||
| 1071 | Ga0070676_10179448 | |||
| 1072 | Ga0070683_100650545 | |||
| 1073 | Ga0070683_100983887 | |||
| 1074 | Ga0070690_100368152 | |||
| 1075 | Ga0070670_100190496 | |||
| 1076 | Ga0070670_100431462 | |||
| 1077 | Ga0068869_100073753 | |||
| 1078 | Ga0068869_100170574 | |||
| 1079 | Ga0068869_100726511 | |||
| 1080 | Ga0068869_101009791 | |||
| 1081 | Ga0070666_10242701 | |||
| 1082 | Ga0070682_100036436 | |||
| 1083 | Ga0070682_101668905 | |||
| 1084 | Ga0068868_100061212 | |||
| 1085 | Ga0068868_100149026 | |||
| 1086 | Ga0068868_100487663 | |||
| 1087 | Ga0068868_100645846 | |||
| 1088 | Ga0070660_100773748 | |||
| 1089 | Ga0070660_101235354 | |||
| 1090 | Ga0070689_100029472 | |||
| 1091 | Ga0070661_100090117 | |||
| 1092 | Ga0070668_100194020 | |||
| 1093 | Ga0070668_101210569 | |||
| 1094 | Ga0070669_100077152 | |||
| 1095 | Ga0070669_100647603 | |||
| 1096 | Ga0070675_100256096 | |||
| 1097 | Ga0070675_100444799 | |||
| 1098 | Ga0070675_100494369 | |||
| 1099 | Ga0070675_100671313 | |||
| 1100 | Ga0070671_100300849 | |||
| 1101 | Ga0070671_100385853 | |||
| 1102 | Ga0070671_100593258 | |||
| 1103 | Ga0070674_100018587 | |||
| 1104 | Ga0070673_100071969 | |||
| 1105 | Ga0070673_100722271 | |||
| 1106 | Ga0070673_101609494 | |||
| 1107 | Ga0070688_100332304 | |||
| 1108 | Ga0070688_100379429 | |||
| 1109 | Ga0070659_100890205 | |||
| 1110 | Ga0070659_101699146 | |||
| 1111 | Ga0070667_100171236 | |||
| 1112 | Ga0070667_101488193 | |||
| 1113 | Ga0070709_10001487 | |||
| 1114 | Ga0070714_100228898 | |||
| 1115 | Ga0070713_100375492 | |||
| 1116 | Ga0070713_100634323 | |||
| 1117 | Ga0070710_10648292 | |||
| 1118 | Ga0070701_10812765 | |||
| 1119 | Ga0070711_100004982 | |||
| 1120 | Ga0070711_100009103 | |||
| 1121 | Ga0070711_101810257 | |||
| 1122 | Ga0070700_100015418 | |||
| 1123 | Ga0070708_100064842 | |||
| 1124 | Ga0070708_100690600 | |||
| 1125 | Ga0070663_100004680 | |||
| 1126 | Ga0070663_100073751 | |||
| 1127 | Ga0070663_100089274 | |||
| 1128 | Ga0070663_100173392 | |||
| 1129 | Ga0070663_100320808 | |||
| 1130 | Ga0070678_100045978 | |||
| 1131 | Ga0070678_100160527 | |||
| 1132 | Ga0070678_100345611 | |||
| 1133 | Ga0070678_100700049 | |||
| 1134 | Ga0070662_100100370 | |||
| 1135 | Ga0070662_100145701 | |||
| 1136 | Ga0070662_101016872 | |||
| 1137 | Ga0070681_10012465 | |||
| 1138 | Ga0068867_100077329 | |||
| 1139 | Ga0070706_100473639 | |||
| 1140 | Ga0070707_100067780 | |||
| 1141 | Ga0070698_100028998 | |||
| 1142 | Ga0070698_100901362 | |||
| 1143 | Ga0070699_100633627 | |||
| 1144 | Ga0070679_100018130 | |||
| 1145 | Ga0070697_101292512 | |||
| 1146 | Ga0070697_101484915 | |||
| 1147 | Ga0068853_100432519 | |||
| 1148 | Ga0068853_101321949 | |||
| 1149 | Ga0068853_101927947 | |||
| 1150 | Ga0070672_100036650 | |||
| 1151 | Ga0070672_100719582 | |||
| 1152 | Ga0070686_100061402 | |||
| 1153 | Ga0070696_101316213 | |||
| 1154 | Ga0070665_100013100 | |||
| 1155 | Ga0070665_100030279 | |||
| 1156 | Ga0070665_100062009 | |||
| 1157 | Ga0070665_100142934 | |||
| 1158 | Ga0070665_100154541 | |||
| 1159 | Ga0070665_100176827 | |||
| 1160 | Ga0070665_100475717 | |||
| 1161 | Ga0070665_100602714 | |||
| 1162 | Ga0070665_101278437 | |||
| 1163 | Ga0070665_101315473 | |||
| 1164 | Ga0068855_100007494 | |||
| 1165 | Ga0068855_100157617 | |||
| 1166 | Ga0068855_100173800 | |||
| 1167 | Ga0070664_100451693 | |||
| 1168 | Ga0070664_101292608 | |||
| 1169 | Ga0068854_100081574 | |||
| 1170 | Ga0068854_100515802 | |||
| 1171 | Ga0068854_100557659 | |||
| 1172 | Ga0068856_100225909 | |||
| 1173 | Ga0068856_100252283 | |||
| 1174 | Ga0068856_100257385 | |||
| 1175 | Ga0068856_100446153 | |||
| 1176 | Ga0070702_100030788 | |||
| 1177 | Ga0070702_100256668 | |||
| 1178 | Ga0070702_100504825 | |||
| 1179 | Ga0068852_100061105 | |||
| 1180 | Ga0068852_100271608 | |||
| 1181 | Ga0068852_100391056 | |||
| 1182 | Ga0068852_102611884 | |||
| 1183 | Ga0068859_100029233 | |||
| 1184 | Ga0068859_100157976 | |||
| 1185 | Ga0068864_100031862 | |||
| 1186 | Ga0068864_100189671 | |||
| 1187 | Ga0068864_101871951 | |||
| 1188 | Ga0068866_10037646 | |||
| 1189 | Ga0068861_100258607 | |||
| 1190 | Ga0068861_101750191 | |||
| 1191 | Ga0068870_10624676 | |||
| 1192 | Ga0068863_100276087 | |||
| 1193 | Ga0068863_101101683 | |||
| 1194 | Ga0068863_101336523 | |||
| 1195 | Ga0068858_100060155 | |||
| 1196 | Ga0068858_100266626 | |||
| 1197 | Ga0068860_100247013 | |||
| 1198 | Ga0068860_100270075 | |||
| 1199 | Ga0068862_100085066 | |||
| 1200 | Ga0068862_100170988 | |||
| 1201 | Ga0068862_100228976 | |||
| 1202 | Ga0068862_100315519 | |||
| 1203 | Ga0081455_10029662 | |||
| 1204 | Ga0081455_10109650 | |||
| 1205 | Ga0081455_10265399 | |||
| 1206 | Ga0081540_1001339 | |||
| 1207 | Ga0081540_1007193 | |||
| 1208 | Ga0081540_1007306 | |||
| 1209 | Ga0081540_1007993 | |||
| 1210 | Ga0081540_1016547 | |||
| 1211 | Ga0081540_1026662 | |||
| 1212 | Ga0081540_1076704 | |||
| 1213 | Ga0081540_1101767 | |||
| 1214 | Ga0081540_1116499 | |||
| 1215 | Ga0081540_1233257 | |||
| 1216 | Ga0081539_10000848 | |||
| 1217 | Ga0081539_10012348 | |||
| 1218 | Ga0075365_10016437 | |||
| 1219 | Ga0075365_10032321 | |||
| 1220 | Ga0075365_10041163 | |||
| 1221 | Ga0075365_10075675 | |||
| 1222 | Ga0075365_10082863 | |||
| 1223 | Ga0075365_10504620 | |||
| 1224 | Ga0075365_10728030 | |||
| 1225 | Ga0075365_10836182 | |||
| 1226 | Ga0075368_10003948 | |||
| 1227 | Ga0075363_100014770 | |||
| 1228 | Ga0075363_100122388 | |||
| 1229 | Ga0075363_100155479 | |||
| 1230 | Ga0075363_100418580 | |||
| 1231 | Ga0075363_100428285 | |||
| 1232 | Ga0075364_10058712 | |||
| 1233 | Ga0075364_10319221 | |||
| 1234 | Ga0075364_10339815 | |||
| 1235 | Ga0070715_10503674 | |||
| 1236 | Ga0070716_100034174 | |||
| 1237 | Ga0070716_100154821 | |||
| 1238 | Ga0070716_100367307 | |||
| 1239 | Ga0070712_100073635 | |||
| 1240 | Ga0070712_100217090 | |||
| 1241 | Ga0070712_100377683 | |||
| 1242 | Ga0070712_100413189 | |||
| 1243 | Ga0070712_100685446 | |||
| 1244 | Ga0075362_10086410 | |||
| 1245 | Ga0075362_10136051 | |||
| 1246 | Ga0075367_10040157 | |||
| 1247 | Ga0075367_10075171 | |||
| 1248 | Ga0075367_10136379 | |||
| 1249 | Ga0075367_10192724 | |||
| 1250 | Ga0075367_10388212 | |||
| 1251 | Ga0075369_10095939 | |||
| 1252 | Ga0075369_10137108 | |||
| 1253 | Ga0075369_10206152 | |||
| 1254 | Ga0075369_10239910 | |||
| 1255 | Ga0075366_10024888 | |||
| 1256 | Ga0075366_10032034 | |||
| 1257 | Ga0075366_10050422 | |||
| 1258 | Ga0075366_10196605 | |||
| 1259 | Ga0075366_10483993 | |||
| 1260 | Ga0075366_10551633 | |||
| 1261 | Ga0075366_10637687 | |||
| 1262 | Ga0097621_100647048 | |||
| 1263 | Ga0097621_100795721 | |||
| 1264 | Ga0075370_10005105 | |||
| 1265 | Ga0075370_10020322 | |||
| 1266 | Ga0075370_10094272 | |||
| 1267 | Ga0075370_10138407 | |||
| 1268 | Ga0075370_10201833 | |||
| 1269 | Ga0068871_100031423 | |||
| 1270 | Ga0068871_100104460 | |||
| 1271 | Ga0068871_101681277 | |||
| 1272 | Ga0075428_100157112 | |||
| 1273 | Ga0075434_100189929 | |||
| 1274 | Ga0075434_100444533 | |||
| 1275 | Ga0068865_100109505 | |||
| 1276 | Ga0068865_100849440 | |||
| 1277 | Ga0068865_101658442 | |||
| 1278 | Ga0075436_100624736 | |||
| 1279 | Ga0097620_100029232 | |||
| 1280 | Ga0097620_100157985 | |||
| 1281 | Ga0075435_100341705 | |||
| 1282 | Ga0099794_10044583 | |||
| 1283 | Ga0099794_10102428 | |||
| 1284 | Ga0099795_10002812 | |||
| 1285 | Ga0099795_10043944 | |||
| 1286 | Ga0099795_10142251 | |||
| 1287 | Ga0099795_10217289 | |||
| 1288 | Ga0105240_10309970 | |||
| 1289 | Ga0105240_10502270 | |||
| 1290 | Ga0111539_10071397 | |||
| 1291 | Ga0111539_11000866 | |||
| 1292 | Ga0105245_10060551 | |||
| 1293 | Ga0105245_11602772 | |||
| 1294 | Ga0105247_10406197 | |||
| 1295 | Ga0105243_10501348 | |||
| 1296 | Ga0105243_10638961 | |||
| 1297 | Ga0105243_10702884 | |||
| 1298 | Ga0105243_10737151 | |||
| 1299 | Ga0105241_10012915 | |||
| 1300 | Ga0105241_10392659 | |||
| 1301 | Ga0105241_10514380 | |||
| 1302 | Ga0105242_10035582 | |||
| 1303 | Ga0105242_10506722 | |||
| 1304 | Ga0105242_11303406 | |||
| 1305 | Ga0105248_10172136 | |||
| 1306 | Ga0105248_11181365 | |||
| 1307 | Ga0105237_10018023 | |||
| 1308 | Ga0105237_10137184 | |||
| 1309 | Ga0105237_10208119 | |||
| 1310 | Ga0105237_10448755 | |||
| 1311 | Ga0105237_11045357 | |||
| 1312 | Ga0105238_10202605 | |||
| 1313 | Ga0105238_10572463 | |||
| 1314 | Ga0105238_10575588 | |||
| 1315 | Ga0105238_11314755 | |||
| 1316 | Ga0105249_10311426 | |||
| 1317 | Ga0105249_10513667 | |||
| 1318 | Ga0105249_10910747 | |||
| 1319 | Ga0099796_10009289 | |||
| 1320 | Ga0099796_10151157 | |||
| 1321 | Ga0099796_10295163 | |||
| 1322 | Ga0099796_10520424 | |||
| 1323 | Ga0105239_10043909 | |||
| 1324 | Ga0105239_10048229 | |||
| 1325 | Ga0105239_10126823 | |||
| 1326 | Ga0105239_10267474 | |||
| 1327 | Ga0105239_10741915 | |||
| 1328 | Ga0105239_10753928 | |||
| 1329 | Ga0105239_10909995 | |||
| 1330 | Ga0105239_11142778 | |||
| 1331 | Ga0105239_13432695 | |||
| 1332 | Ga0105246_10085714 | |||
| 1333 | Ga0105246_10089670 | |||
| 1334 | Ga0105246_10199271 | |||
| 1335 | Ga0105246_10233447 | |||
| 1336 | Ga0105246_10783537 | |||
| 1337 | Ga0105246_10839555 | |||
| 1338 | Ga0105246_11006436 | |||
| 1339 | Ga0157323_1011445 | |||
| 1340 | Ga0157323_1011788 | |||
| 1341 | Ga0157370_10026904 | |||
| 1342 | Ga0157374_10019278 | |||
| 1343 | Ga0157374_10066182 | |||
| 1344 | Ga0157374_10110883 | |||
| 1345 | Ga0157374_10388075 | |||
| 1346 | Ga0157374_12404282 | |||
| 1347 | Ga0157378_10031236 | |||
| 1348 | Ga0157378_10547367 | |||
| 1349 | Ga0163162_10044547 | |||
| 1350 | Ga0163162_10129391 | |||
| 1351 | Ga0163162_10235980 | |||
| 1352 | Ga0163162_11179575 | |||
| 1353 | Ga0157372_10494544 | |||
| 1354 | Ga0157375_10154583 | |||
| 1355 | Ga0157375_10174025 | |||
| 1356 | Ga0157375_10174992 | |||
| 1357 | Ga0157375_10227133 | |||
| 1358 | Ga0157375_10836715 | |||
| 1359 | Ga0163163_10057665 | |||
| 1360 | Ga0163163_10073225 | |||
| 1361 | Ga0163163_10203034 | |||
| 1362 | Ga0157380_10109465 | |||
| 1363 | Ga0157380_10157219 | |||
| 1364 | Ga0182008_10227787 | |||
| 1365 | Ga0182008_10263072 | |||
| 1366 | Ga0157377_10149709 | |||
| 1367 | Ga0157377_10686845 | |||
| 1368 | Ga0157379_10060147 | |||
| 1369 | Ga0157379_10344996 | |||
| 1370 | Ga0157379_11240093 | |||
| 1371 | Ga0157376_10046724 | |||
| 1372 | Ga0157376_10555669 | |||
| 1373 | Ga0157376_12963154 | |||
| 1374 | Ga0163161_10088848 | |||
| 1375 | Ga0163161_11063447 | |||
| 1376 | Ga0163161_11198956 | |||
| 1377 | Ga0206356_10120399 | |||
| 1378 | Ga0214542_1000004 | |||
| 1379 | Ga0214542_1037420 | |||
| 1380 | Ga0214545_1000005 | |||
| 1381 | Ga0214545_1035280 | |||
| 1382 | Ga0214543_1000111 | |||
| 1383 | Ga0214543_1033779 | |||
| 1384 | Ga0213876_10295971 | |||
| 1385 | Ga0209563_102320 | |||
| 1386 | Ga0209677_101639 | |||
| 1387 | Ga0209677_102591 | |||
| 1388 | Ga0209148_1006467 | |||
| 1389 | Ga0209233_1004340 | |||
| 1390 | Ga0209233_1008872 | |||
| 1391 | Ga0209233_1027348 | |||
| 1392 | Ga0209455_1001472 | |||
| 1393 | Ga0209455_1001710 | |||
| 1394 | Ga0209564_1006563 | |||
| 1395 | Ga0209564_1031518 | |||
| 1396 | Ga0209758_1000102 | |||
| 1397 | Ga0209758_1003592 | |||
| 1398 | Ga0209758_1003725 | |||
| 1399 | Ga0209758_1005478 | |||
| 1400 | Ga0209758_1046037 | |||
| 1401 | Ga0209256_1004953 | |||
| 1402 | Ga0209256_1027989 | |||
| 1403 | Ga0207426_1002013 | |||
| 1404 | Ga0207426_1034873 | |||
| 1405 | Ga0209257_1003378 | |||
| 1406 | Ga0207697_10065223 | |||
| 1407 | Ga0207697_10216603 | |||
| 1408 | Ga0207697_10443720 | |||
| 1409 | Ga0207692_10407209 | |||
| 1410 | Ga0207692_10450057 | |||
| 1411 | Ga0207692_10650649 | |||
| 1412 | Ga0207642_10020324 | |||
| 1413 | Ga0207642_10396173 | |||
| 1414 | Ga0207642_10469724 | |||
| 1415 | Ga0207710_10164150 | |||
| 1416 | Ga0207688_10019383 | |||
| 1417 | Ga0207688_10088637 | |||
| 1418 | Ga0207688_10089460 | |||
| 1419 | Ga0207688_10344528 | |||
| 1420 | Ga0207680_10163305 | |||
| 1421 | Ga0207680_10169761 | |||
| 1422 | Ga0207647_10011423 | |||
| 1423 | Ga0207685_10233027 | |||
| 1424 | Ga0207699_10129981 | |||
| 1425 | Ga0207645_10092170 | |||
| 1426 | Ga0207645_10184660 | |||
| 1427 | Ga0207705_10061486 | |||
| 1428 | Ga0207705_10216616 | |||
| 1429 | Ga0207705_10234508 | |||
| 1430 | Ga0207684_10186080 | |||
| 1431 | Ga0207684_10639812 | |||
| 1432 | Ga0207654_10014746 | |||
| 1433 | Ga0207654_10463892 | |||
| 1434 | Ga0207707_10011000 | |||
| 1435 | Ga0207707_11354883 | |||
| 1436 | Ga0207695_10234230 | |||
| 1437 | Ga0207671_10083323 | |||
| 1438 | Ga0207671_10119378 | |||
| 1439 | Ga0207671_10307417 | |||
| 1440 | Ga0207671_10703069 | |||
| 1441 | Ga0207693_10009325 | |||
| 1442 | Ga0207693_10017747 | |||
| 1443 | Ga0207693_10122761 | |||
| 1444 | Ga0207693_10244528 | |||
| 1445 | Ga0207663_10025502 | |||
| 1446 | Ga0207663_10100721 | |||
| 1447 | Ga0207657_10166797 | |||
| 1448 | Ga0207657_10556936 | |||
| 1449 | Ga0207657_11061567 | |||
| 1450 | Ga0207649_10066665 | |||
| 1451 | Ga0207652_10158337 | |||
| 1452 | Ga0207646_10261644 | |||
| 1453 | Ga0207681_10214086 | |||
| 1454 | Ga0207681_10901979 | |||
| 1455 | Ga0207681_11009395 | |||
| 1456 | Ga0207694_10122221 | |||
| 1457 | Ga0207694_10572641 | |||
| 1458 | Ga0207694_10628845 | |||
| 1459 | Ga0207694_11328088 | |||
| 1460 | Ga0207650_10562013 | |||
| 1461 | Ga0207659_10220386 | |||
| 1462 | Ga0207659_10550945 | |||
| 1463 | Ga0207687_10299895 | |||
| 1464 | Ga0207687_10691934 | |||
| 1465 | Ga0207700_11115625 | |||
| 1466 | Ga0207700_11704156 | |||
| 1467 | Ga0207664_11208542 | |||
| 1468 | Ga0207644_10178384 | |||
| 1469 | Ga0207644_10273138 | |||
| 1470 | Ga0207644_10516522 | |||
| 1471 | Ga0207644_11006653 | |||
| 1472 | Ga0207690_10268274 | |||
| 1473 | Ga0207690_11222132 | |||
| 1474 | Ga0207706_10020636 | |||
| 1475 | Ga0207706_10218356 | |||
| 1476 | Ga0207706_10465884 | |||
| 1477 | Ga0207686_10170721 | |||
| 1478 | Ga0207686_10256367 | |||
| 1479 | Ga0207686_10445902 | |||
| 1480 | Ga0207686_10692655 | |||
| 1481 | Ga0207709_10041130 | |||
| 1482 | Ga0207709_11248901 | |||
| 1483 | Ga0207709_11616757 | |||
| 1484 | Ga0207670_10039211 | |||
| 1485 | Ga0207670_10925765 | |||
| 1486 | Ga0207669_10007035 | |||
| 1487 | Ga0207704_10062027 | |||
| 1488 | Ga0207704_10133658 | |||
| 1489 | Ga0207665_10023296 | |||
| 1490 | Ga0207665_10101928 | |||
| 1491 | Ga0207665_10651826 | |||
| 1492 | Ga0207665_11424140 | |||
| 1493 | Ga0207691_10103322 | |||
| 1494 | Ga0207691_10552016 | |||
| 1495 | Ga0207711_10316425 | |||
| 1496 | Ga0207711_10334427 | |||
| 1497 | Ga0207689_10391727 | |||
| 1498 | Ga0207689_10443619 | |||
| 1499 | Ga0207689_10627672 | |||
| 1500 | Ga0207689_11080396 | |||
| 1501 | Ga0207661_10570559 | |||
| 1502 | Ga0207661_10576659 | |||
| 1503 | Ga0207679_10318278 | |||
| 1504 | Ga0207679_11130151 | |||
| 1505 | Ga0207667_10050380 | |||
| 1506 | Ga0207667_12040882 | |||
| 1507 | Ga0207651_10064111 | |||
| 1508 | Ga0207668_10008217 | |||
| 1509 | Ga0207668_10173030 | |||
| 1510 | Ga0207668_10262230 | |||
| 1511 | Ga0207668_10683879 | |||
| 1512 | Ga0207668_10836322 | |||
| 1513 | Ga0207640_10048550 | |||
| 1514 | Ga0207640_10123950 | |||
| 1515 | Ga0207658_10075824 | |||
| 1516 | Ga0207658_10180619 | |||
| 1517 | Ga0207658_10554862 | |||
| 1518 | Ga0207658_10837159 | |||
| 1519 | Ga0207658_11253074 | |||
| 1520 | Ga0207658_12090848 | |||
| 1521 | Ga0207677_10110732 | |||
| 1522 | Ga0207677_10234842 | |||
| 1523 | Ga0207677_10527442 | |||
| 1524 | Ga0207677_10535789 | |||
| 1525 | Ga0207677_11600840 | |||
| 1526 | Ga0207703_10193232 | |||
| 1527 | Ga0207639_10098940 | |||
| 1528 | Ga0207639_10164849 | |||
| 1529 | Ga0207639_10167178 | |||
| 1530 | Ga0207639_10249569 | |||
| 1531 | Ga0207639_11186091 | |||
| 1532 | Ga0207678_10004216 | |||
| 1533 | Ga0207678_10060134 | |||
| 1534 | Ga0207678_10089469 | |||
| 1535 | Ga0207678_10099974 | |||
| 1536 | Ga0207678_10123758 | |||
| 1537 | Ga0207678_10227790 | |||
| 1538 | Ga0207678_10397726 | |||
| 1539 | Ga0207678_10402078 | |||
| 1540 | Ga0207708_10049842 | |||
| 1541 | Ga0207702_10229418 | |||
| 1542 | Ga0207702_10327935 | |||
| 1543 | Ga0207641_10308005 | |||
| 1544 | Ga0207641_10365347 | |||
| 1545 | Ga0207641_10951971 | |||
| 1546 | Ga0207641_11255460 | |||
| 1547 | Ga0207648_10097170 | |||
| 1548 | Ga0207648_10293405 | |||
| 1549 | Ga0207676_10162342 | |||
| 1550 | Ga0207676_10669756 | |||
| 1551 | Ga0207676_10894876 | |||
| 1552 | Ga0207674_10091381 | |||
| 1553 | Ga0207674_10309414 | |||
| 1554 | Ga0207675_100049241 | |||
| 1555 | Ga0207675_100126297 | |||
| 1556 | Ga0207683_10029544 | |||
| 1557 | Ga0207683_10051305 | |||
| 1558 | Ga0207683_10060366 | |||
| 1559 | Ga0207683_10212381 | |||
| 1560 | Ga0207683_10972293 | |||
| 1561 | Ga0207683_11677118 | |||
| 1562 | Ga0207683_11865045 | |||
| 1563 | Ga0207698_10367021 | |||
| 1564 | Ga0207698_10554453 | |||
| 1565 | Ga0209179_1008779 | |||
| 1566 | Ga0209588_1019784 | |||
| 1567 | Ga0207428_10368040 | |||
| 1568 | Ga0207428_10923875 | |||
| 1569 | Ga0268266_10001136 | |||
| 1570 | Ga0268266_10003686 | |||
| 1571 | Ga0268266_10094515 | |||
| 1572 | Ga0268266_10190353 | |||
| 1573 | Ga0268266_10388186 | |||
| 1574 | Ga0268266_10654635 | |||
| 1575 | Ga0268266_10731320 | |||
| 1576 | Ga0268266_10742093 | |||
| 1577 | Ga0268266_11265124 | |||
| 1578 | Ga0268265_10061941 | |||
| 1579 | Ga0268265_10124640 | |||
| 1580 | Ga0268265_10192550 | |||
| 1581 | Ga0268265_10198444 | |||
| 1582 | Ga0268265_10480048 | |||
| 1583 | Ga0268265_10564923 | |||
| 1584 | Ga0268264_10192667 | |||
| 1585 | Ga0265318_10079770 | |||
| 1586 | Ga0265323_10018266 | |||
| 1587 | Ga0265322_10117807 | |||
| 1588 | Ga0265336_10000415 | |||
| 1589 | Ga0307517_10000098 | |||
| 1590 | Ga0307517_10111579 | |||
| 1591 | Ga0265338_10010045 | |||
| 1592 | Ga0265324_10017627 | |||
| 1593 | Ga0307513_10418783 | |||
| 1594 | Ga0307509_10128015 | |||
| 1595 | Ga0307408_100232397 | |||
| 1596 | Ga0307508_10127944 | |||
| 1597 | Ga0307516_10046388 | |||
| 1598 | Ga0307516_10053240 | |||
| 1599 | Ga0307405_10315500 | |||
| 1600 | Ga0307405_10505101 | |||
| 1601 | Ga0307413_10171007 | |||
| 1602 | Ga0307413_11473637 | |||
| 1603 | Ga0307410_11425331 | |||
| 1604 | Ga0307407_10761295 | |||
| 1605 | Ga0307412_10401698 | |||
| 1606 | Ga0307409_100546889 | |||
| 1607 | Ga0307416_101218302 | |||
| 1608 | Ga0307414_11399194 | |||
| 1609 | Ga0307411_10076739 | |||
| 1610 | Ga0307411_10843113 | |||
| 1611 | Ga0307411_11395977 | |||
| 1612 | Ga0307415_100297967 | |||
| 1613 | Ga0307507_10560606 | |||
| 1614 | Ga0307510_10007562 | |||
| 1615 | Ga0307510_10327889 | |||
| 1616 | Ga0373940_0200791 | |||
| 1617 | Ga0373940_0336714 | |||
| 1618 | Ga0373952_0095837 | |||
| 1619 | Ga0373936_0043384 | |||
| 1620 | Ga0373945_0075784 | |||
| 1621 | Ga0373945_0101051 | |||
| 1622 | Ga0373956_0259800 | |||
| 1623 | Ga0373943_0121755 | |||
| 1624 | Ga0373943_0139389 | |||
| 1625 | Ga0373943_0152823 | |||
| 1626 | Ga0373946_0176394 | |||
| 1627 | Ga0373946_0267866 | |||
| 1628 | Ga0373955_0071154 | |||
| 1629 | Ga0373924_0048356 | |||
| 1630 | Ga0373931_0020927 | |||
| 1631 | Ga0373935_0000520 | |||
| 1632 | Ga0373927_0000046 | |||
| 1633 | Ga0373927_0009305 | |||
| 1634 | Ga0373927_0039246 | |||
| 1635 | Ga0373947_0001392 | |||
| 1636 | Ga0373947_0038071 | |||
| 1637 | Ga0373947_0165966 | |||
| 1638 | Ga0373937_0048844 | |||
| 1639 | Ga0373925_0009905 | |||
| 1640 | Ga0373925_0013452 | |||
| 1641 | Ga0373925_0023664 | |||
| 1642 | Ga0373925_0390614 | |||
| 1643 | Ga0395899_0154753 | |||
| 1644 | Ga0395900_0016187 | |||
| 1645 | Ga0395898_0475635 | |||
| 1646 | Ga0395905_0081275 | |||
| 1647 | Ga0395905_0147099 | |||
| 1648 | Ga0395905_0344285 | |||
| 1649 | Ga0395905_0860914 | |||
| 1650 | Ga0436364_0581979 | |||
| 1651 | Ga0395901_0097370 | |||
| 1652 | Ga0395901_0733717 | |||
| 1653 | Ga0436365_0808674 | |||
| 1654 | Ga0436365_0939911 | |||
| 1655 | Ga0436363_1563002 | |||
| 1656 | Ga0436362_1153757 | |||
| 1657 | Ga0439466_0205551 | |||
| 1658 | Ga0439465_0093118 | |||
| 1659 | Ga0451787_184996 | |||
| 1660 | Ga0451787_288168 | |||
| 1661 | Ga0451793_0362601 | |||
| 1662 | Ga0451797_1560878 | |||
| 1663 | Ga0451800_1224866 | |||
| 1664 | Ga0451802_1494618 | |||
| 1665 | Ga0451833_0138182 | |||
| 1666 | Ga0451841_0540834 | |||
| 1667 | Ga0451849_0041184 | |||
| 1668 | Ga0451849_0883225 | |||
| 1669 | Ga0451851_0496392 | |||
| 1670 | Ga0451851_0647873 | |||
| 1671 | Ga0451851_1102993 | |||
| 1672 | Ga0451853_1338784 | |||
| 1673 | Ga0451853_3741495 | |||
| 1674 | Ga0439458_0159765 | |||
| 1675 | Ga0466972_0013988 | |||
| 1676 | Ga0466965_0127668 | |||
| 1677 | Ga0466964_0264110 | |||
| 1678 | Ga0466971_0157021 | |||
| 1679 | Ga0466968_0003372 | |||
| 1680 | Ga0466957_0105153 | |||
| 1681 | Ga0466957_1093303 | |||
| 1682 | Ga0466960_0008649 | |||
| 1683 | Ga0466960_0130216 | |||
| 1684 | Ga0466959_0154824 | |||
| 1685 | Ga0495617_231405 | |||
| 1686 | Ga0495592_0036407 | |||
| 1687 | Ga0495603_0000051 | |||
| 1688 | Ga0495603_0072096 | |||
| 1689 | Ga0495603_0074766 | |||
| 1690 | Ga0495603_0074854 | |||
| 1691 | Ga0495590_0077288 | |||
| 1692 | Ga0495629_0000182 | |||
| 1693 | Ga0495629_0896585 | |||
| 1694 | Ga0495638_0021430 | |||
| 1695 | Ga0495638_0139137 | |||
| 1696 | Ga0495638_0266085 | |||
| 1697 | Ga0495638_0526218 | |||
| 1698 | Ga0495638_0526497 | |||
| 1699 | Ga0495641_0006374 | |||
| 1700 | Ga0495653_0200693 | |||
| 1701 | Ga0495650_0130564 | |||
| 1702 | Ga0495580_0004021 | |||
| 1703 | Ga0495580_0291464 | |||
| 1704 | Ga0495582_0000137 | |||
| 1705 | Ga0495582_0229642 | |||
| 1706 | Ga0495582_0482908 | |||
| 1707 | Ga0495605_0227921 | |||
| 1708 | Ga0495639_0002873 | |||
| 1709 | Ga0495639_0254363 | |||
| 1710 | Ga0495639_0620166 | |||
| 1711 | Ga0495662_0000583 | |||
| 1712 | Ga0495664_0009075 | |||
| 1713 | Ga0495584_0104087 | |||
| 1714 | Ga0495584_0181275 | |||
| 1715 | Ga0495584_0403064 | |||
| 1716 | Ga0495584_0507590 | |||
| 1717 | Ga0495585_0029073 | |||
| 1718 | Ga0495585_0275017 | |||
| 1719 | Ga0495594_0001833 | |||
| 1720 | Ga0495594_0042613 | |||
| 1721 | Ga0495594_0107854 | |||
| 1722 | Ga0495596_0063639 | |||
| 1723 | Ga0495596_0194477 | |||
| 1724 | Ga0495607_0393938 | |||
| 1725 | Ga0495583_0025223 | |||
| 1726 | Ga0495606_0119588 | |||
| 1727 | Ga0495606_0122562 | |||
| 1728 | Ga0495606_0157047 | |||
| 1729 | Ga0495606_0444146 | |||
| 1730 | Ga0495610_0100069 | |||
| 1731 | Ga0495616_0162322 | |||
| 1732 | Ga0495618_0523518 | |||
| 1733 | Ga0495620_0159318 | |||
| 1734 | Ga0495620_0169679 | |||
| 1735 | Ga0495628_0021321 | |||
| 1736 | Ga0495630_0002625 | |||
| 1737 | Ga0495630_0269329 | |||
| 1738 | Ga0495630_1347834 | |||
| 1739 | Ga0495631_0015803 | |||
| 1740 | Ga0495631_0089133 | |||
| 1741 | Ga0495631_0197719 | |||
| 1742 | Ga0495631_0511994 | |||
| 1743 | Ga0495632_0055923 | |||
| 1744 | Ga0495632_0138876 | |||
| 1745 | Ga0495632_0148961 | |||
| 1746 | Ga0495632_0294698 | |||
| 1747 | Ga0495643_0012291 | |||
| 1748 | Ga0495643_0074090 | |||
| 1749 | Ga0495643_0250555 | |||
| 1750 | Ga0495644_0091283 | |||
| 1751 | Ga0495644_0220346 | |||
| 1752 | Ga0495648_0146427 | |||
| 1753 | Ga0495648_0336875 | |||
| 1754 | Ga0495663_0064127 | |||
| 1755 | Ga0495666_0386634 | |||
| 1756 | Ga0495666_0391769 | |||
| 1757 | Ga0495642_0166942 | |||
| 1758 | Ga0495652_0037670 | |||
| 1759 | Ga0495654_0349189 | |||
| 1760 | Ga0495665_0001239 | |||
| 1761 | Ga0495640_0004375 | |||
| 1762 | Ga0495598_0046091 | |||
| 1763 | Ga0495621_0018971 | |||
| 1764 | Ga0495597_0033416 | |||
| 1765 | Ga0495597_0051282 | |||
| 1766 | Ga0495597_0344586 | |||
| 1767 | Ga0495622_0005490 | |||
| 1768 | Ga0495622_0016785 | |||
| 1769 | Ga0495622_0135417 | |||
| 1770 | Ga0495622_0205157 | |||
| 1771 | Ga0495633_0109329 | |||
| 1772 | Ga0495633_0242170 | |||
| 1773 | Ga0495667_0011352 | |||
| 1774 | Ga0495656_0016955 | |||
| 1775 | Ga0495656_0200527 | |||
| 1776 | Ga0495656_0214078 | |||
| 1777 | Ga0495668_0026683 | |||
| 1778 | Ga0495668_0029504 | |||
| 1779 | Ga0495668_0029734 | |||
| 1780 | Ga0495668_0052320 | |||
| 1781 | Ga0495668_0203406 | |||
| 1782 | Ga0495668_0482000 | |||
| 1783 | Ga0495634_0002221 | |||
| 1784 | Ga0495611_0126279 | |||
| 1785 | Ga0495625_0058534 | |||
| 1786 | Ga0495625_0094413 | |||
| 1787 | Ga0495625_0140569 | |||
| 1788 | Ga0495625_0185164 | |||
| 1789 | Ga0495625_0391655 | |||
| 1790 | Ga0495625_0711609 | |||
| 1791 | Ga0495635_0001455 | |||
| 1792 | Ga0495635_0978415 | |||
| 1793 | Ga0495659_0061547 | |||
| 1794 | Ga0495661_0247668 | |||
| 1795 | Ga0495588_0046469 | |||
| 1796 | Ga0495588_0082492 | |||
| 1797 | Ga0495657_0147798 | |||
| 1798 | Ga0495646_0048867 | |||
| 1799 | Ga0495647_0032438 | |||
| 1800 | Ga0495647_0223727 | |||
| 1801 | Ga0495658_0469737 | |||
| 1802 | Ga0495669_0007993 | |||
| 1803 | Ga0495669_0255061 | |||
| 1804 | Ga0495669_0316823 | |||
| 1805 | Ga0495669_0470253 | |||
| 1806 | Ga0495613_0047965 | |||
| 1807 | Ga0495624_0000898 | |||
| 1808 | Ga0495624_0145609 | |||
| 1809 | Ga0495624_0564993 | |||
| 1810 | Ga0495670_0250616 | |||
| 1811 | Ga0495670_0334925 | |||
| 1812 | Ga0495671_0084494 | |||
| 1813 | Ga0495671_0089738 | |||
| 1814 | Ga0495671_0101526 | |||
| 1815 | Ga0495671_0165256 | |||
| 1816 | Ga0495649_0097432 | |||
| 1817 | Ga0495649_0157413 | |||
| 1818 | Ga0495649_0193763 | |||
| 1819 | Ga0495589_0103033 | |||
| 1820 | Ga0495589_0111160 | |||
| 1821 | Ga0495589_0129712 | |||
| 1822 | Ga0495600_0113596 | |||
| 1823 | Ga0495581_0007805 | |||
| 1824 | Ga0495581_0081158 | |||
| 1825 | Ga0495581_0425001 | |||
| 1826 | Ga0495636_0097970 | |||
| 1827 | Ga0495636_0194356 | |||
| 1828 | Ga0495636_0656702 | |||
| 1829 | Ga0495674_0010092 | |||
| 1830 | Ga0495672_0025981 | |||
| 1831 | Ga0495672_0239678 | |||
| 1832 | Ga0495672_0474812 | |||
| 1833 | Ga0495676_0110086 | |||
| 1834 | Ga0495676_0127701 | |||
| 1835 | Ga0495680_0404157 | |||
| 1836 | Ga0495683_0064475 | |||
| 1837 | Ga0495683_0478557 | |||
| 1838 | Ga0495687_027560 | |||
| 1839 | Ga0495687_047752 | |||
| 1840 | Ga0495677_0067538 | |||
| 1841 | Ga0495677_0172629 | |||
| 1842 | Ga0495679_138495 | |||
| 1843 | Ga0495685_140734 | |||
| 1844 | Ga0495673_0022298 | |||
| 1845 | Ga0495673_0103713 | |||
| 1846 | Ga0495673_0160362 | |||
| 1847 | Ga0495673_0256112 | |||
| 1848 | Ga0495673_0293941 | |||
| 1849 | Ga0495684_0045864 | |||
| 1850 | Ga0495686_0143402 | |||
| 1851 | Ga0495686_0250754 | |||
| 1852 | Ga0495593_0000469 | |||
| 1853 | Ga0495602_0385915 | |||
| 1854 | Ga0495614_0001926 | |||
| 1855 | Ga0495614_0409324 | |||
| 1856 | Ga0495615_0197116 | |||
| 1857 | Ga0495626_0275345 | |||
| 1858 | Ga0496100_0001098 | |||
| 1859 | Ga0496100_0137249 | |||
| 1860 | Ga0496100_0223380 | |||
| 1861 | Ga0496101_0011608 | |||
| 1862 | Ga0496101_0232477 | |||
| 1863 | Ga0496101_0541375 | |||
| 1864 | Ga0496101_0546160 | |||
| 1865 | Ga0496101_0933369 | |||
| 1866 | Ga0496102_0008520 | |||
| 1867 | Ga0496102_0153816 | |||
| 1868 | Ga0496102_0199985 | |||
| 1869 | Ga0496102_0380154 | |||
| 1870 | Ga0496102_0381156 | |||
| 1871 | Ga0496102_0410219 | |||
| 1872 | Ga0496102_0438380 | |||
| 1873 | Ga0496102_0476410 | |||
| 1874 | Ga0496102_0861647 | |||
| 1875 | Ga0496103_0010717 | |||
| 1876 | Ga0496103_0037555 | |||
| 1877 | Ga0496103_0405205 | |||
| 1878 | Ga0496103_0424841 | |||
| 1879 | Ga0496103_1061774 | |||
| 1880 | Ga0496104_0021810 | |||
| 1881 | Ga0496104_0026734 | |||
| 1882 | Ga0496104_0037264 | |||
| 1883 | Ga0496104_0116018 | |||
| 1884 | Ga0496104_0208151 | |||
| 1885 | Ga0496104_1671737 | |||
| 1886 | Ga0496104_1770519 | |||
| 1887 | Ga0496105_0030338 | |||
| 1888 | Ga0496105_0120936 | |||
| 1889 | Ga0496105_0207100 | |||
| 1890 | Ga0496105_0286727 | |||
| 1891 | Ga0496105_0345596 | |||
| 1892 | Ga0496106_0026464 | |||
| 1893 | Ga0496106_0123661 | |||
| 1894 | Ga0496106_0396800 | |||
| 1895 | Ga0496106_0500576 | |||
| 1896 | Ga0496106_0680497 | |||
| 1897 | Ga0496107_0021497 | |||
| 1898 | Ga0496108_0042075 | |||
| 1899 | Ga0496108_0196577 | |||
| 1900 | Ga0496108_0208945 | |||
| 1901 | Ga0496108_0256025 | |||
| 1902 | Ga0496108_0540220 | |||
| 1903 | Ga0496109_0049778 | |||
| 1904 | Ga0496109_0293021 | |||
| 1905 | Ga0496109_0365792 | |||
| 1906 | Ga0496109_0380566 | |||
| 1907 | Ga0496110_0066685 | |||
| 1908 | Ga0496110_0091129 | |||
| 1909 | Ga0496110_0288249 | |||
| 1910 | Ga0496110_0515209 | |||
| 1911 | Ga0496110_1657088 | |||
| 1912 | Ga0496111_0040302 | |||
| 1913 | Ga0496111_0599596 | |||
| 1914 | Ga0496111_0678287 | |||
| 1915 | Ga0496112_0023844 | |||
| 1916 | Ga0496112_0025634 | |||
| 1917 | Ga0496112_0174342 | |||
| 1918 | Ga0496112_0353164 | |||
| 1919 | Ga0496112_0731438 | |||
| 1920 | Ga0496113_0015425 | |||
| 1921 | Ga0496113_0054139 | |||
| 1922 | Ga0496113_0716176 | |||
| 1923 | Ga0496113_1305035 | |||
| 1924 | Ga0496114_0033230 | |||
| 1925 | Ga0496114_0345394 | |||
| 1926 | Ga0496114_0400728 | |||
| 1927 | Ga0496114_0793411 | |||
| 1928 | Ga0496114_1533587 | |||
| 1929 | Ga0496115_0017046 | |||
| 1930 | Ga0496115_0159969 | |||
| 1931 | Ga0496115_0288059 | |||
| 1932 | Ga0496115_0468347 | |||
| 1933 | Ga0496115_0868630 | |||
| 1934 | Ga0496116_0198582 | |||
| 1935 | Ga0496118_0065065 | |||
| 1936 | Ga0496118_0086044 | |||
| 1937 | Ga0496118_0087129 | |||
| 1938 | Ga0496118_0120126 | |||
| 1939 | Ga0496118_0153875 | |||
| 1940 | Ga0496118_0310668 | |||
| 1941 | Ga0496119_0043743 | |||
| 1942 | Ga0496119_0044857 | |||
| 1943 | Ga0496119_0046704 | |||
| 1944 | Ga0496119_0189829 | |||
| 1945 | Ga0496120_0012720 | |||
| 1946 | Ga0496120_0220357 | |||
| 1947 | Ga0496121_0000265 | |||
| 1948 | Ga0496121_0011669 | |||
| 1949 | Ga0496121_0028222 | |||
| 1950 | Ga0496121_0044559 | |||
| 1951 | Ga0496121_0120593 | |||
| 1952 | Ga0496121_0267964 | |||
| 1953 | Ga0496121_0412556 | |||
| 1954 | Ga0496121_0479793 | |||
| 1955 | Ga0496121_0481239 | |||
| 1956 | Ga0496122_0090249 | |||
| 1957 | Ga0496122_0093188 | |||
| 1958 | Ga0496122_0298659 | |||
| 1959 | Ga0496124_0213718 | |||
| 1960 | Ga0496124_0226852 | |||
| 1961 | Ga0496124_0262119 | |||
| 1962 | Ga0496124_0331448 | |||
| 1963 | Ga0496125_0000176 | |||
| 1964 | Ga0496125_0034884 | |||
| 1965 | Ga0496125_0137109 | |||
| 1966 | Ga0496125_0206435 | |||
| 1967 | Ga0496126_0011852 | |||
| 1968 | Ga0496126_0015449 | |||
| 1969 | Ga0496126_0072217 | |||
| 1970 | Ga0496126_0122354 | |||
| 1971 | Ga0496126_0177512 | |||
| 1972 | Ga0496126_0262004 | |||
| 1973 | Ga0496126_0444729 | |||
| 1974 | Ga0496126_1143757 | |||
| 1975 | Ga0495682_0018288 | |||
| 1976 | Ga0495682_0053712 | |||
| 1977 | Ga0495682_0066545 | |||
| 1978 | Ga0495682_0213564 | |||
| 1979 | Ga0501038_0265551 | |||
| 1980 | Ga0501040_0715101 | |||
| 1981 | Ga0501042_0374282 | |||
| 1982 | Ga0501067_0604891 | |||
| 1983 | Ga0501074_0394278 | |||
| 1984 | nmdc:mga03683_107519_c1 | |||
| 1985 | nmdc:mga03683_489268_c1 | |||
| 1986 | nmdc:mga03n38_12993_c1 | |||
| 1987 | nmdc:mga03n38_483662_c1 | |||
| 1988 | nmdc:mga00v17_69660_c1 | |||
| 1989 | nmdc:mga00v17_866497_c1 | |||
| 1990 | nmdc:mga00v17_86774_c1 | |||
| 1991 | nmdc:mga0yw44_124038_c1 | |||
| 1992 | nmdc:mga0yw44_187882_c1 | |||
| 1993 | nmdc:mga0yw44_19763_c1 | |||
| 1994 | nmdc:mga0yw44_31797_c1 | |||
| 1995 | nmdc:mga0yw44_514125_c1 | |||
| 1996 | nmdc:mga0yw44_5454_c2 | |||
| 1997 | nmdc:mga0yw44_638498_c1 | |||
| 1998 | nmdc:mga0k408_148173_c1 | |||
| 1999 | nmdc:mga0k408_179196_c1 | |||
| 2000 | nmdc:mga0k408_519503_c1 | |||
| 2001 | nmdc:mga0k408_571476_c1 | |||
| 2002 | nmdc:mga06z11_199789_c1 | |||
| 2003 | nmdc:mga06z11_217349_c1 | |||
| 2004 | nmdc:mga06z11_224365_c1 | |||
| 2005 | nmdc:mga06z11_298090_c1 | |||
| 2006 | nmdc:mga06z11_8466_c1 | |||
| 2007 | nmdc:mga06z11_93967_c1 | |||
| 2008 | nmdc:mga04h51_252344_c1 | |||
| 2009 | nmdc:mga07m45_107497_c1 | |||
| 2010 | nmdc:mga07m45_190315_c1 | |||
| 2011 | nmdc:mga07m45_54052_c1 | |||
| 2012 | nmdc:mga07m45_59524_c1 | |||
| 2013 | nmdc:mga07m45_81713_c1 | |||
| 2014 | nmdc:mga09592_265942_c1 | |||
| 2015 | nmdc:mga06r32_893179_c1 | |||
| 2016 | nmdc:mga08y16_1146190_c1 | |||
| 2017 | nmdc:mga08y16_1285024_c1 | |||
| 2018 | nmdc:mga08y16_635192_c1 | |||
| 2019 | nmdc:mga0n895_832353_c1 | |||
| 2020 | nmdc:mga0rr50_546422_c1 | |||
| 2021 | nmdc:mga0a205_695597_c1 | |||
| 2022 | Ga0495601_0301790 | |||
| 2023 | Ga0495612_0157977 | |||
| 2024 | Ga0495655_0012324 | |||
| 2025 | Ga0495655_0185941 | |||
| 2026 | Ga0495595_0031235 | |||
| 2027 | Ga0495619_0187040 | |||
| 2028 | Ga0500578_0070175 | |||
| 2029 | Ga0500646_0389642 | |||
| 2030 | Ga0500647_0073432 | |||
| 2031 | Ga0500647_0193872 | |||
| 2032 | Ga0500583_0098116 | |||
| 2033 | Ga0500583_0108192 | |||
| 2034 | Ga0500583_0314451 | |||
| 2035 | Ga0500566_0000078 | |||
| 2036 | Ga0500566_0076330 | |||
| 2037 | Ga0500640_000121 | |||
| 2038 | Ga0500640_061554 | |||
| 2039 | Ga0500641_0167005 | |||
| 2040 | Ga0500641_0341232 | |||
| 2041 | Ga0500554_118757 | |||
| 2042 | Ga0500555_031686 | |||
| 2043 | Ga0500555_040212 | |||
| 2044 | Ga0500556_0030267 | |||
| 2045 | Ga0500557_000011 | |||
| 2046 | Ga0500569_018952 | |||
| 2047 | Ga0500569_084458 | |||
| 2048 | Ga0500572_000170 | |||
| 2049 | Ga0500572_110411 | |||
| 2050 | Ga0500580_261947 | |||
| 2051 | Ga0500591_077793 | |||
| 2052 | Ga0500592_023529 | |||
| 2053 | Ga0500594_0047298 | |||
| 2054 | Ga0500595_002442 | |||
| 2055 | Ga0500595_002477 | |||
| 2056 | Ga0500595_004672 | |||
| 2057 | Ga0500595_026908 | |||
| 2058 | Ga0500597_339561 | |||
| 2059 | Ga0500608_084601 | |||
| 2060 | Ga0500608_232489 | |||
| 2061 | Ga0500614_004910 | |||
| 2062 | Ga0500642_0000090 | |||
| 2063 | Ga0500642_0008061 | |||
| 2064 | Ga0500642_0199702 | |||
| 2065 | Ga0500658_0072704 | |||
| 2066 | Ga0500658_0143484 | |||
| 2067 | Ga0500559_0009508 | |||
| 2068 | Ga0500559_0016864 | |||
| 2069 | Ga0500561_0058078 | |||
| 2070 | Ga0500568_0011274 | |||
| 2071 | Ga0500568_0037366 | |||
| 2072 | Ga0500590_085257 | |||
| 2073 | Ga0500590_096457 | |||
| 2074 | Ga0500603_000081 | |||
| 2075 | Ga0500603_001666 | |||
| 2076 | Ga0500620_100532 | |||
| 2077 | Ga0500627_0007990 | |||
| 2078 | Ga0500627_0078704 | |||
| 2079 | Ga0500627_0293144 | |||
| 2080 | Ga0500627_0441489 | |||
| 2081 | Ga0500630_004509 | |||
| 2082 | Ga0500634_0113939 | |||
| 2083 | Ga0500638_021427 | |||
| 2084 | Ga0500639_000028 | |||
| 2085 | Ga0500639_131622 | |||
| 2086 | Ga0500636_0049352 | |||
| 2087 | Ga0500636_0065953 | |||
| 2088 | Ga0500636_0200828 | |||
| 2089 | Ga0500636_0398985 | |||
| 2090 | Ga0500637_0020909 | |||
| 2091 | Ga0500637_0039902 | |||
| 2092 | Ga0500637_0125685 | |||
| 2093 | Ga0500570_131027 | |||
| 2094 | Ga0500625_002925 | |||
| 2095 | Ga0500645_161204 | |||
| 2096 | Ga0500596_000324 | |||
| 2097 | Ga0500601_003418 | |||
| 2098 | Ga0500661_002428 | |||
| 2099 | 8056685557 | |||
| 2100 | 2513673294 | |||
| 2101 | 2524465862 | |||
| 2102 | 2728751746 | |||
| 2103 | 2885387305 | |||
| 2104 | 2903774357 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zyf-assembly2.cif.gz_C | crystal structure of streptococcus pyogenes type ii-a cas2 | 0.6766 | 2 | 117 |
| 3exc-assembly1.cif.gz_X-2 | structure of the rna'se sso8090 from sulfolobus solfataricus | 0.6616 | 1 | 113 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.6369 | 1 | 114 |
| 5zyf-assembly3.cif.gz_F | crystal structure of streptococcus pyogenes type ii-a cas2 | 0.6278 | 2 | 117 |
| 3zo7-assembly1.cif.gz_E | crystal structure of clcfe27a with substrate | 0.6131 | 1 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6369 | 1 | 114 | 3.30.70.1060 |
| 4tnoA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6346 | 1 | 113 | 3.30.70.240 |
| 4tnoA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6277 | 1 | 113 | 3.30.70.240 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.621 | 1 | 114 | 3.30.70.1060 |
| af_Q1LYG6_500_570_3.30.70.870 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 | 0.5972 | 1 | 112 | 3.30.70.870 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1B6H1-F1-model_v4 | YciI family protein | 0.7527 | 1 | 126 |
|
| AF-A0A503WCB3-F1-model_v4 | YciI family protein | 0.7526 | 1 | 129 |
|
| AF-X6EJ73-F1-model_v4 | deleted | 0.7492 | 1 | 132 |
|
| AF-A0A0F6YML2-F1-model_v4 | PhnB protein | 0.7471 | 1 | 125 |
|
| AF-A0A4Q1UNU8-F1-model_v4 | Transcription initiation protein | 0.7456 | 1 | 130 |
|