F489105

General Info

Members Datasets Scaffolds Average Seq Length
1052 458 2104 139

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056681323|8056685557
Length 164
Sequence LILRMPWNDDGENEAPPNHKETPMRFMMLMIPLGYETAPPKIDLDPERVAAMMKYNQALKDAGVLIALDGLHPPSAGARVSFATGKPVVTDGPFTESKEVLGGYWMINVASRAEAIEWAKQCPASENEIIEIRQVQEMSDFSEEVQKAAAGFEDMQQGWGKALR

Samples

Sample ID Description Type Environment
1 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
126 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
127 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
207 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
208 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
209 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
210 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
211 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
212 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
231 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
253 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
254 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
255 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
256 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
257 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
258 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
259 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
260 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
261 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
262 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
263 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
264 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
265 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
266 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
267 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
268 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
269 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
270 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
271 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
287 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
288 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
289 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
290 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
291 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
292 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
293 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
294 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
295 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
296 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
297 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
298 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
301 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
302 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
305 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
306 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
309 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
310 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
313 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
314 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
315 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
316 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
317 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
318 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
319 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
320 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
321 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
322 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
323 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
326 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
327 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
328 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
329 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
330 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
331 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
332 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
333 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
334 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
335 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
336 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
337 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
338 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
339 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
340 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
341 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
342 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
343 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
344 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
345 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
346 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
347 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
348 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
349 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
350 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
351 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
352 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
353 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
354 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
355 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
356 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
357 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
358 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
359 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
360 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
380 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
381 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
382 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
383 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
384 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
385 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
386 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
387 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
391 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
392 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
393 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
394 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
395 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
396 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
397 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
398 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
399 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
400 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
401 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
402 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
405 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
406 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
407 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
408 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
409 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
410 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
411 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
412 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
413 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
414 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
415 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
416 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
417 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
418 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
419 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
420 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
421 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
422 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
423 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
424 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
425 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
426 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
427 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
428 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
429 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
430 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
431 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
432 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
433 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
434 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
435 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
436 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
437 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
438 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
439 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
440 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
441 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
442 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
443 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
444 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
445 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
446 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
447 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
448 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
449 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
450 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
451 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
452 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
453 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
454 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
455 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
456 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
457 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
458 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.1
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.63
Nodule 0.95
Rhizoplane 7.79
Rhizosphere 68.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1029154 3300002070 Bacteria 803
2 JGI25165J46597_1048384 3300003214 Bacteria 545
3 JGI25153J46596_10002543 3300003215 Bacteria 10454
4 JGI25153J46596_10010032 3300003215 Bacteria 4323
5 JGI25404J52841_10077133 3300003659 Bacteria 696
6 Ga0055539_1006053 3300003752 Bacteria 1555
7 Ga0055526_1039847 3300003771 Bacteria 1192
8 Ga0055524_1036995 3300003775 Bacteria 1301
9 Ga0055531_10001939 3300003794 Bacteria 14453
10 Ga0055543_1004643 3300004625 Bacteria 3684
11 Ga0055543_1057955 3300004625 Bacteria 625
12 Ga0065165_1001641 3300005262 Bacteria 22770
13 Ga0065165_1003060 3300005262 Bacteria 12519
14 Ga0065165_1006123 3300005262 Bacteria 6438
15 Ga0065165_1060395 3300005262 Bacteria 1040
16 Ga0070658_10012558 3300005327 Bacteria 6793
17 Ga0070658_10023514 3300005327 Bacteria 4944
18 Ga0070658_10102491 3300005327 Bacteria 2367
19 Ga0070676_10179448 3300005328 Bacteria 1375
20 Ga0070683_100650545 3300005329 Bacteria 1009
21 Ga0070683_100983887 3300005329 Bacteria 810
22 Ga0070690_100368152 3300005330 Bacteria 1047
23 Ga0070670_100190496 3300005331 Bacteria 1781
24 Ga0070670_100431462 3300005331 Bacteria 1166
25 Ga0068869_100073753 3300005334 Bacteria 2531
26 Ga0068869_100170574 3300005334 Bacteria 1699
27 Ga0068869_100726511 3300005334 Bacteria 849
28 Ga0068869_101009791 3300005334 Bacteria 725
29 Ga0070666_10242701 3300005335 Bacteria 1274
30 Ga0070682_100036436 3300005337 Bacteria 3007
31 Ga0070682_101668905 3300005337 Bacteria 553
32 Ga0068868_100061212 3300005338 Bacteria 2982
33 Ga0068868_100149026 3300005338 Bacteria 1926
34 Ga0068868_100487663 3300005338 Bacteria 1077
35 Ga0068868_100645846 3300005338 Bacteria 942
36 Ga0070660_100773748 3300005339 Bacteria 807
37 Ga0070660_101235354 3300005339 Bacteria 634
38 Ga0070689_100029472 3300005340 Bacteria 4155
39 Ga0070661_100090117 3300005344 Bacteria 2271
40 Ga0070668_100194020 3300005347 Bacteria 1664
41 Ga0070668_101210569 3300005347 Bacteria 684
42 Ga0070669_100077152 3300005353 Bacteria 2475
43 Ga0070669_100647603 3300005353 Bacteria 889
44 Ga0070675_100256096 3300005354 Bacteria 1533
45 Ga0070675_100444799 3300005354 Bacteria 1162
46 Ga0070675_100494369 3300005354 Bacteria 1102
47 Ga0070675_100671313 3300005354 Bacteria 943
48 Ga0070671_100300849 3300005355 Bacteria 1366
49 Ga0070671_100385853 3300005355 Bacteria 1197
50 Ga0070671_100593258 3300005355 Bacteria 957
51 Ga0070674_100018587 3300005356 Bacteria 4398
52 Ga0070673_100071969 3300005364 Bacteria 2779
53 Ga0070673_100722271 3300005364 Bacteria 916
54 Ga0070673_101609494 3300005364 Bacteria 614
55 Ga0070688_100332304 3300005365 Bacteria 1107
56 Ga0070688_100379429 3300005365 Bacteria 1042
57 Ga0070659_100890205 3300005366 Bacteria 777
58 Ga0070659_101699146 3300005366 Bacteria 564
59 Ga0070667_100171236 3300005367 Bacteria 1917
60 Ga0070667_101488193 3300005367 Bacteria 636
61 Ga0070709_10001487 3300005434 Bacteria 12659
62 Ga0070714_100228898 3300005435 Bacteria 1712
63 Ga0070713_100375492 3300005436 Bacteria 1324
64 Ga0070713_100634323 3300005436 Bacteria 1017
65 Ga0070710_10648292 3300005437 Bacteria 740
66 Ga0070701_10812765 3300005438 Bacteria 639
67 Ga0070711_100004982 3300005439 Bacteria 7886
68 Ga0070711_100009103 3300005439 Bacteria 6103
69 Ga0070711_101810257 3300005439 Bacteria 536
70 Ga0070700_100015418 3300005441 Bacteria 4332
71 Ga0070708_100064842 3300005445 Bacteria 3274
72 Ga0070708_100690600 3300005445 Bacteria 961
73 Ga0070663_100004680 3300005455 Bacteria 8069
74 Ga0070663_100073751 3300005455 Bacteria 2490
75 Ga0070663_100089274 3300005455 Bacteria 2280
76 Ga0070663_100173392 3300005455 Bacteria 1668
77 Ga0070663_100320808 3300005455 Bacteria 1246
78 Ga0070678_100045978 3300005456 Bacteria 3127
79 Ga0070678_100160527 3300005456 Bacteria 1820
80 Ga0070678_100345611 3300005456 Bacteria 1277
81 Ga0070678_100700049 3300005456 Bacteria 913
82 Ga0070662_100100370 3300005457 Bacteria 2189
83 Ga0070662_100145701 3300005457 Bacteria 1839
84 Ga0070662_101016872 3300005457 Bacteria 710
85 Ga0070681_10012465 3300005458 Bacteria 8435
86 Ga0068867_100077329 3300005459 Bacteria 2500
87 Ga0070706_100473639 3300005467 Bacteria 1165
88 Ga0070707_100067780 3300005468 Bacteria 3434
89 Ga0070698_100028998 3300005471 Bacteria 5744
90 Ga0070698_100901362 3300005471 Bacteria 830
91 Ga0070699_100633627 3300005518 Bacteria 976
92 Ga0070679_100018130 3300005530 Bacteria 6824
93 Ga0070697_101292512 3300005536 Bacteria 651
94 Ga0070697_101484915 3300005536 Bacteria 606
95 Ga0068853_100432519 3300005539 Bacteria 1236
96 Ga0068853_101321949 3300005539 Bacteria 697
97 Ga0068853_101927947 3300005539 Bacteria 573
98 Ga0070672_100036650 3300005543 Bacteria 3738
99 Ga0070672_100719582 3300005543 Bacteria 875
100 Ga0070686_100061402 3300005544 Bacteria 2428
101 Ga0070696_101316213 3300005546 Bacteria 614
102 Ga0070665_100013100 3300005548 Bacteria 8350
103 Ga0070665_100030279 3300005548 Bacteria 5447
104 Ga0070665_100062009 3300005548 Bacteria 3749
105 Ga0070665_100142934 3300005548 Bacteria 2396
106 Ga0070665_100154541 3300005548 Bacteria 2296
107 Ga0070665_100176827 3300005548 Bacteria 2135
108 Ga0070665_100475717 3300005548 Bacteria 1260
109 Ga0070665_100602714 3300005548 Bacteria 1111
110 Ga0070665_101278437 3300005548 Bacteria 744
111 Ga0070665_101315473 3300005548 Bacteria 732
112 Ga0068855_100007494 3300005563 Bacteria 13211
113 Ga0068855_100157617 3300005563 Bacteria 2578
114 Ga0068855_100173800 3300005563 Bacteria 2438
115 Ga0070664_100451693 3300005564 Bacteria 1180
116 Ga0070664_101292608 3300005564 Bacteria 689
117 Ga0068854_100081574 3300005578 Bacteria 2389
118 Ga0068854_100515802 3300005578 Bacteria 1009
119 Ga0068854_100557659 3300005578 Bacteria 973
120 Ga0068856_100225909 3300005614 Bacteria 1887
121 Ga0068856_100252283 3300005614 Bacteria 1779
122 Ga0068856_100257385 3300005614 Bacteria 1761
123 Ga0068856_100446153 3300005614 Bacteria 1314
124 Ga0070702_100030788 3300005615 Bacteria 2929
125 Ga0070702_100256668 3300005615 Bacteria 1188
126 Ga0070702_100504825 3300005615 Bacteria 889
127 Ga0068852_100061105 3300005616 Bacteria 3273
128 Ga0068852_100271608 3300005616 Bacteria 1632
129 Ga0068852_100391056 3300005616 Bacteria 1366
130 Ga0068852_102611884 3300005616 Bacteria 525
131 Ga0068859_100029233 3300005617 Bacteria 5530
132 Ga0068859_100157976 3300005617 Bacteria 2346
133 Ga0068864_100031862 3300005618 Bacteria 4475
134 Ga0068864_100189671 3300005618 Bacteria 1884
135 Ga0068864_101871951 3300005618 Bacteria 606
136 Ga0068866_10037646 3300005718 Bacteria 2377
137 Ga0068861_100258607 3300005719 Bacteria 1489
138 Ga0068861_101750191 3300005719 Bacteria 615
139 Ga0068870_10624676 3300005840 Bacteria 735
140 Ga0068863_100276087 3300005841 Bacteria 1627
141 Ga0068863_101101683 3300005841 Bacteria 799
142 Ga0068863_101336523 3300005841 Bacteria 724
143 Ga0068858_100060155 3300005842 Bacteria 3511
144 Ga0068858_100266626 3300005842 Bacteria 1629
145 Ga0068860_100247013 3300005843 Bacteria 1737
146 Ga0068860_100270075 3300005843 Bacteria 1659
147 Ga0068862_100085066 3300005844 Bacteria 2748
148 Ga0068862_100170988 3300005844 Bacteria 1945
149 Ga0068862_100228976 3300005844 Bacteria 1685
150 Ga0068862_100315519 3300005844 Bacteria 1442
151 Ga0081455_10029662 3300005937 Bacteria 4984
152 Ga0081455_10109650 3300005937 Bacteria 2196
153 Ga0081455_10265399 3300005937 Bacteria 1248
154 Ga0081540_1001339 3300005983 Bacteria 21460
155 Ga0081540_1007193 3300005983 Bacteria 7985
156 Ga0081540_1007306 3300005983 Bacteria 7903
157 Ga0081540_1007993 3300005983 Bacteria 7446
158 Ga0081540_1016547 3300005983 Bacteria 4607
159 Ga0081540_1026662 3300005983 Bacteria 3291
160 Ga0081540_1076704 3300005983 Bacteria 1522
161 Ga0081540_1101767 3300005983 Bacteria 1236
162 Ga0081540_1116499 3300005983 Bacteria 1118
163 Ga0081540_1233257 3300005983 Bacteria 649
164 Ga0081539_10000848 3300005985 Bacteria 58499
165 Ga0081539_10012348 3300005985 Bacteria 6599
166 Ga0075365_10016437 3300006038 Bacteria 4501
167 Ga0075365_10032321 3300006038 Bacteria 3362
168 Ga0075365_10041163 3300006038 Bacteria 3017
169 Ga0075365_10075675 3300006038 Bacteria 2272
170 Ga0075365_10082863 3300006038 Bacteria 2175
171 Ga0075365_10504620 3300006038 Bacteria 855
172 Ga0075365_10728030 3300006038 Bacteria 701
173 Ga0075365_10836182 3300006038 Bacteria 650
174 Ga0075368_10003948 3300006042 Bacteria 4995
175 Ga0075363_100014770 3300006048 Bacteria 3825
176 Ga0075363_100122388 3300006048 Bacteria 1454
177 Ga0075363_100155479 3300006048 Bacteria 1293
178 Ga0075363_100418580 3300006048 Bacteria 789
179 Ga0075363_100428285 3300006048 Bacteria 780
180 Ga0075364_10058712 3300006051 Bacteria 2521
181 Ga0075364_10319221 3300006051 Bacteria 1058
182 Ga0075364_10339815 3300006051 Bacteria 1023
183 Ga0070715_10503674 3300006163 Bacteria 694
184 Ga0070716_100034174 3300006173 Bacteria 2786
185 Ga0070716_100154821 3300006173 Bacteria 1478
186 Ga0070716_100367307 3300006173 Bacteria 1024
187 Ga0070712_100073635 3300006175 Bacteria 2451
188 Ga0070712_100217090 3300006175 Bacteria 1512
189 Ga0070712_100377683 3300006175 Bacteria 1166
190 Ga0070712_100413189 3300006175 Bacteria 1117
191 Ga0070712_100685446 3300006175 Bacteria 873
192 Ga0075362_10086410 3300006177 Bacteria 1451
193 Ga0075362_10136051 3300006177 Bacteria 1172
194 Ga0075367_10040157 3300006178 Bacteria 2731
195 Ga0075367_10075171 3300006178 Bacteria 2037
196 Ga0075367_10136379 3300006178 Bacteria 1518
197 Ga0075367_10192724 3300006178 Bacteria 1272
198 Ga0075367_10388212 3300006178 Bacteria 882
199 Ga0075369_10095939 3300006186 Bacteria 1327
200 Ga0075369_10137108 3300006186 Bacteria 1114
201 Ga0075369_10206152 3300006186 Bacteria 908
202 Ga0075369_10239910 3300006186 Bacteria 841
203 Ga0075366_10024888 3300006195 Bacteria 3492
204 Ga0075366_10032034 3300006195 Bacteria 3094
205 Ga0075366_10050422 3300006195 Bacteria 2471
206 Ga0075366_10196605 3300006195 Bacteria 1226
207 Ga0075366_10483993 3300006195 Bacteria 765
208 Ga0075366_10551633 3300006195 Bacteria 714
209 Ga0075366_10637687 3300006195 Bacteria 661
210 Ga0097621_100647048 3300006237 Bacteria 970
211 Ga0097621_100795721 3300006237 Bacteria 876
212 Ga0075370_10005105 3300006353 Bacteria 6470
213 Ga0075370_10020322 3300006353 Bacteria 3627
214 Ga0075370_10094272 3300006353 Bacteria 1728
215 Ga0075370_10138407 3300006353 Bacteria 1423
216 Ga0075370_10201833 3300006353 Bacteria 1173
217 Ga0068871_100031423 3300006358 Bacteria 4188
218 Ga0068871_100104460 3300006358 Bacteria 2376
219 Ga0068871_101681277 3300006358 Bacteria 602
220 Ga0075428_100157112 3300006844 Bacteria 2469
221 Ga0075434_100189929 3300006871 Bacteria 2074
222 Ga0075434_100444533 3300006871 Bacteria 1318
223 Ga0068865_100109505 3300006881 Bacteria 2035
224 Ga0068865_100849440 3300006881 Bacteria 791
225 Ga0068865_101658442 3300006881 Bacteria 576
226 Ga0075436_100624736 3300006914 Bacteria 795
227 Ga0097620_100029232 3300006931 Bacteria 5530
228 Ga0097620_100157985 3300006931 Bacteria 2346
229 Ga0075435_100341705 3300007076 Bacteria 1283
230 Ga0099794_10044583 3300007265 Bacteria 2120
231 Ga0099794_10102428 3300007265 Bacteria 1430
232 Ga0099795_10002812 3300007788 Bacteria 4192
233 Ga0099795_10043944 3300007788 Bacteria 1601
234 Ga0099795_10142251 3300007788 Bacteria 976
235 Ga0099795_10217289 3300007788 Bacteria 812
236 Ga0105240_10309970 3300009093 Bacteria 1803
237 Ga0105240_10502270 3300009093 Bacteria 1348
238 Ga0111539_10071397 3300009094 Bacteria 4097
239 Ga0111539_11000866 3300009094 Bacteria 972
240 Ga0105245_10060551 3300009098 Bacteria 3410
241 Ga0105245_11602772 3300009098 Bacteria 703
242 Ga0105247_10406197 3300009101 Bacteria 972
243 Ga0105243_10501348 3300009148 Bacteria 1150
244 Ga0105243_10638961 3300009148 Bacteria 1030
245 Ga0105243_10702884 3300009148 Bacteria 986
246 Ga0105243_10737151 3300009148 Bacteria 965
247 Ga0105241_10012915 3300009174 Bacteria 6127
248 Ga0105241_10392659 3300009174 Bacteria 1215
249 Ga0105241_10514380 3300009174 Bacteria 1070
250 Ga0105242_10035582 3300009176 Bacteria 3993
251 Ga0105242_10506722 3300009176 Bacteria 1149
252 Ga0105242_11303406 3300009176 Bacteria 750
253 Ga0105248_10172136 3300009177 Bacteria 2441
254 Ga0105248_11181365 3300009177 Bacteria 865
255 Ga0105237_10018023 3300009545 Bacteria 7315
256 Ga0105237_10137184 3300009545 Bacteria 2441
257 Ga0105237_10208119 3300009545 Bacteria 1956
258 Ga0105237_10448755 3300009545 Bacteria 1296
259 Ga0105237_11045357 3300009545 Bacteria 823
260 Ga0105238_10202605 3300009551 Bacteria 1960
261 Ga0105238_10572463 3300009551 Bacteria 1135
262 Ga0105238_10575588 3300009551 Bacteria 1132
263 Ga0105238_11314755 3300009551 Bacteria 749
264 Ga0105249_10311426 3300009553 Bacteria 1583
265 Ga0105249_10513667 3300009553 Bacteria 1245
266 Ga0105249_10910747 3300009553 Bacteria 946
267 Ga0099796_10009289 3300010159 Bacteria 2656
268 Ga0099796_10151157 3300010159 Bacteria 914
269 Ga0099796_10295163 3300010159 Bacteria 685
270 Ga0099796_10520424 3300010159 Bacteria 534
271 Ga0105239_10043909 3300010375 Bacteria 4901
272 Ga0105239_10048229 3300010375 Bacteria 4670
273 Ga0105239_10126823 3300010375 Bacteria 2837
274 Ga0105239_10267474 3300010375 Bacteria 1922
275 Ga0105239_10741915 3300010375 Bacteria 1124
276 Ga0105239_10753928 3300010375 Bacteria 1114
277 Ga0105239_10909995 3300010375 Bacteria 1010
278 Ga0105239_11142778 3300010375 Bacteria 897
279 Ga0105239_13432695 3300010375 Bacteria 515
280 Ga0105246_10085714 3300011119 Bacteria 2256
281 Ga0105246_10089670 3300011119 Bacteria 2213
282 Ga0105246_10199271 3300011119 Bacteria 1555
283 Ga0105246_10233447 3300011119 Bacteria 1450
284 Ga0105246_10783537 3300011119 Bacteria 844
285 Ga0105246_10839555 3300011119 Bacteria 818
286 Ga0105246_11006436 3300011119 Bacteria 755
287 Ga0157323_1011445 3300012495 Bacteria 715
288 Ga0157323_1011788 3300012495 Bacteria 710
289 Ga0157370_10026904 3300013104 Bacteria 5674
290 Ga0157374_10019278 3300013296 Bacteria 6036
291 Ga0157374_10066182 3300013296 Bacteria 3396
292 Ga0157374_10110883 3300013296 Bacteria 2639
293 Ga0157374_10388075 3300013296 Bacteria 1392
294 Ga0157374_12404282 3300013296 Bacteria 554
295 Ga0157378_10031236 3300013297 Bacteria 4704
296 Ga0157378_10547367 3300013297 Bacteria 1162
297 Ga0163162_10044547 3300013306 Bacteria 4444
298 Ga0163162_10129391 3300013306 Bacteria 2633
299 Ga0163162_10235980 3300013306 Bacteria 1959
300 Ga0163162_11179575 3300013306 Bacteria 869
301 Ga0157372_10494544 3300013307 Bacteria 1426
302 Ga0157375_10154583 3300013308 Bacteria 2432
303 Ga0157375_10174025 3300013308 Bacteria 2301
304 Ga0157375_10174992 3300013308 Bacteria 2295
305 Ga0157375_10227133 3300013308 Bacteria 2025
306 Ga0157375_10836715 3300013308 Bacteria 1067
307 Ga0163163_10057665 3300014325 Bacteria 3840
308 Ga0163163_10073225 3300014325 Bacteria 3416
309 Ga0163163_10203034 3300014325 Bacteria 2031
310 Ga0157380_10109465 3300014326 Bacteria 2318
311 Ga0157380_10157219 3300014326 Bacteria 1971
312 Ga0182008_10227787 3300014497 Bacteria 955
313 Ga0182008_10263072 3300014497 Bacteria 893
314 Ga0157377_10149709 3300014745 Bacteria 1442
315 Ga0157377_10686845 3300014745 Bacteria 741
316 Ga0157379_10060147 3300014968 Bacteria 3396
317 Ga0157379_10344996 3300014968 Bacteria 1362
318 Ga0157379_11240093 3300014968 Bacteria 718
319 Ga0157376_10046724 3300014969 Bacteria 3572
320 Ga0157376_10555669 3300014969 Bacteria 1137
321 Ga0157376_12963154 3300014969 Bacteria 514
322 Ga0163161_10088848 3300017792 Bacteria 2284
323 Ga0163161_11063447 3300017792 Bacteria 694
324 Ga0163161_11198956 3300017792 Bacteria 656
325 Ga0206356_10120399 3300020070 Bacteria 749
326 Ga0214542_1000004 3300021321 Bacteria 415597
327 Ga0214542_1037420 3300021321 Bacteria 1384
328 Ga0214545_1000005 3300021324 Bacteria 415590
329 Ga0214545_1035280 3300021324 Bacteria 1666
330 Ga0214543_1000111 3300021327 Bacteria 106517
331 Ga0214543_1033779 3300021327 Bacteria 1803
332 Ga0213876_10295971 3300021384 Bacteria 860
333 Ga0209563_102320 3300025230 Bacteria 4365
334 Ga0209677_101639 3300025253 Bacteria 9408
335 Ga0209677_102591 3300025253 Bacteria 6615
336 Ga0209148_1006467 3300025254 Bacteria 2537
337 Ga0209233_1004340 3300025261 Bacteria 4839
338 Ga0209233_1008872 3300025261 Bacteria 3083
339 Ga0209233_1027348 3300025261 Bacteria 1383
340 Ga0209455_1001472 3300025272 Bacteria 10597
341 Ga0209455_1001710 3300025272 Bacteria 9395
342 Ga0209564_1006563 3300025295 Bacteria 6245
343 Ga0209564_1031518 3300025295 Bacteria 1617
344 Ga0209758_1000102 3300025297 Bacteria 224851
345 Ga0209758_1003592 3300025297 Bacteria 13874
346 Ga0209758_1003725 3300025297 Bacteria 13511
347 Ga0209758_1005478 3300025297 Bacteria 9742
348 Ga0209758_1046037 3300025297 Bacteria 1577
349 Ga0209256_1004953 3300025299 Bacteria 7982
350 Ga0209256_1027989 3300025299 Bacteria 1598
351 Ga0207426_1002013 3300025302 Bacteria 14342
352 Ga0207426_1034873 3300025302 Bacteria 1611
353 Ga0209257_1003378 3300025304 Bacteria 13780
354 Ga0207697_10065223 3300025315 Bacteria 1519
355 Ga0207697_10216603 3300025315 Bacteria 844
356 Ga0207697_10443720 3300025315 Bacteria 575
357 Ga0207692_10407209 3300025898 Bacteria 849
358 Ga0207692_10450057 3300025898 Bacteria 810
359 Ga0207692_10650649 3300025898 Bacteria 681
360 Ga0207642_10020324 3300025899 Bacteria 2589
361 Ga0207642_10396173 3300025899 Bacteria 825
362 Ga0207642_10469724 3300025899 Bacteria 765
363 Ga0207710_10164150 3300025900 Bacteria 1083
364 Ga0207688_10019383 3300025901 Bacteria 3705
365 Ga0207688_10088637 3300025901 Bacteria 1774
366 Ga0207688_10089460 3300025901 Bacteria 1766
367 Ga0207688_10344528 3300025901 Bacteria 917
368 Ga0207680_10163305 3300025903 Bacteria 1495
369 Ga0207680_10169761 3300025903 Bacteria 1468
370 Ga0207647_10011423 3300025904 Bacteria 6230
371 Ga0207685_10233027 3300025905 Bacteria 882
372 Ga0207699_10129981 3300025906 Bacteria 1641
373 Ga0207645_10092170 3300025907 Bacteria 1949
374 Ga0207645_10184660 3300025907 Bacteria 1369
375 Ga0207705_10061486 3300025909 Bacteria 2713
376 Ga0207705_10216616 3300025909 Bacteria 1453
377 Ga0207705_10234508 3300025909 Bacteria 1396
378 Ga0207684_10186080 3300025910 Bacteria 1791
379 Ga0207684_10639812 3300025910 Bacteria 907
380 Ga0207654_10014746 3300025911 Bacteria 4042
381 Ga0207654_10463892 3300025911 Bacteria 890
382 Ga0207707_10011000 3300025912 Bacteria 7874
383 Ga0207707_11354883 3300025912 Bacteria 569
384 Ga0207695_10234230 3300025913 Bacteria 1739
385 Ga0207671_10083323 3300025914 Bacteria 2401
386 Ga0207671_10119378 3300025914 Bacteria 2014
387 Ga0207671_10307417 3300025914 Bacteria 1253
388 Ga0207671_10703069 3300025914 Bacteria 804
389 Ga0207693_10009325 3300025915 Bacteria 8001
390 Ga0207693_10017747 3300025915 Bacteria 5675
391 Ga0207693_10122761 3300025915 Bacteria 2040
392 Ga0207693_10244528 3300025915 Bacteria 1408
393 Ga0207663_10025502 3300025916 Bacteria 3419
394 Ga0207663_10100721 3300025916 Bacteria 1939
395 Ga0207657_10166797 3300025919 Bacteria 1786
396 Ga0207657_10556936 3300025919 Bacteria 896
397 Ga0207657_11061567 3300025919 Bacteria 620
398 Ga0207649_10066665 3300025920 Bacteria 2283
399 Ga0207652_10158337 3300025921 Bacteria 2029
400 Ga0207646_10261644 3300025922 Bacteria 1563
401 Ga0207681_10214086 3300025923 Bacteria 1487
402 Ga0207681_10901979 3300025923 Bacteria 740
403 Ga0207681_11009395 3300025923 Bacteria 698
404 Ga0207694_10122221 3300025924 Bacteria 2079
405 Ga0207694_10572641 3300025924 Bacteria 949
406 Ga0207694_10628845 3300025924 Bacteria 904
407 Ga0207694_11328088 3300025924 Bacteria 608
408 Ga0207650_10562013 3300025925 Bacteria 957
409 Ga0207659_10220386 3300025926 Bacteria 1525
410 Ga0207659_10550945 3300025926 Bacteria 980
411 Ga0207687_10299895 3300025927 Bacteria 1294
412 Ga0207687_10691934 3300025927 Bacteria 865
413 Ga0207700_11115625 3300025928 Bacteria 705
414 Ga0207700_11704156 3300025928 Bacteria 556
415 Ga0207664_11208542 3300025929 Bacteria 674
416 Ga0207644_10178384 3300025931 Bacteria 1663
417 Ga0207644_10273138 3300025931 Bacteria 1355
418 Ga0207644_10516522 3300025931 Bacteria 986
419 Ga0207644_11006653 3300025931 Bacteria 699
420 Ga0207690_10268274 3300025932 Bacteria 1325
421 Ga0207690_11222132 3300025932 Bacteria 628
422 Ga0207706_10020636 3300025933 Bacteria 5921
423 Ga0207706_10218356 3300025933 Bacteria 1670
424 Ga0207706_10465884 3300025933 Bacteria 1092
425 Ga0207686_10170721 3300025934 Bacteria 1533
426 Ga0207686_10256367 3300025934 Bacteria 1280
427 Ga0207686_10445902 3300025934 Bacteria 995
428 Ga0207686_10692655 3300025934 Bacteria 809
429 Ga0207709_10041130 3300025935 Bacteria 2772
430 Ga0207709_11248901 3300025935 Bacteria 613
431 Ga0207709_11616757 3300025935 Bacteria 538
432 Ga0207670_10039211 3300025936 Bacteria 3101
433 Ga0207670_10925765 3300025936 Bacteria 731
434 Ga0207669_10007035 3300025937 Bacteria 5176
435 Ga0207704_10062027 3300025938 Bacteria 2322
436 Ga0207704_10133658 3300025938 Bacteria 1723
437 Ga0207665_10023296 3300025939 Bacteria 4078
438 Ga0207665_10101928 3300025939 Bacteria 2005
439 Ga0207665_10651826 3300025939 Bacteria 825
440 Ga0207665_11424140 3300025939 Bacteria 551
441 Ga0207691_10103322 3300025940 Bacteria 2541
442 Ga0207691_10552016 3300025940 Bacteria 977
443 Ga0207711_10316425 3300025941 Bacteria 1441
444 Ga0207711_10334427 3300025941 Bacteria 1401
445 Ga0207689_10391727 3300025942 Bacteria 1157
446 Ga0207689_10443619 3300025942 Bacteria 1084
447 Ga0207689_10627672 3300025942 Bacteria 905
448 Ga0207689_11080396 3300025942 Bacteria 676
449 Ga0207661_10570559 3300025944 Bacteria 1037
450 Ga0207661_10576659 3300025944 Bacteria 1032
451 Ga0207679_10318278 3300025945 Bacteria 1346
452 Ga0207679_11130151 3300025945 Bacteria 719
453 Ga0207667_10050380 3300025949 Bacteria 4394
454 Ga0207667_12040882 3300025949 Bacteria 533
455 Ga0207651_10064111 3300025960 Bacteria 2570
456 Ga0207668_10008217 3300025972 Bacteria 6216
457 Ga0207668_10173030 3300025972 Bacteria 1695
458 Ga0207668_10262230 3300025972 Bacteria 1409
459 Ga0207668_10683879 3300025972 Bacteria 900
460 Ga0207668_10836322 3300025972 Bacteria 817
461 Ga0207640_10048550 3300025981 Bacteria 2745
462 Ga0207640_10123950 3300025981 Bacteria 1857
463 Ga0207658_10075824 3300025986 Bacteria 2560
464 Ga0207658_10180619 3300025986 Bacteria 1746
465 Ga0207658_10554862 3300025986 Bacteria 1028
466 Ga0207658_10837159 3300025986 Bacteria 836
467 Ga0207658_11253074 3300025986 Bacteria 678
468 Ga0207658_12090848 3300025986 Bacteria 515
469 Ga0207677_10110732 3300026023 Bacteria 2044
470 Ga0207677_10234842 3300026023 Bacteria 1480
471 Ga0207677_10527442 3300026023 Bacteria 1025
472 Ga0207677_10535789 3300026023 Bacteria 1018
473 Ga0207677_11600840 3300026023 Bacteria 603
474 Ga0207703_10193232 3300026035 Bacteria 1804
475 Ga0207639_10098940 3300026041 Bacteria 2352
476 Ga0207639_10164849 3300026041 Bacteria 1871
477 Ga0207639_10167178 3300026041 Bacteria 1859
478 Ga0207639_10249569 3300026041 Bacteria 1547
479 Ga0207639_11186091 3300026041 Bacteria 716
480 Ga0207678_10004216 3300026067 Bacteria 12904
481 Ga0207678_10060134 3300026067 Bacteria 3268
482 Ga0207678_10089469 3300026067 Bacteria 2631
483 Ga0207678_10099974 3300026067 Bacteria 2478
484 Ga0207678_10123758 3300026067 Bacteria 2207
485 Ga0207678_10227790 3300026067 Bacteria 1596
486 Ga0207678_10397726 3300026067 Bacteria 1193
487 Ga0207678_10402078 3300026067 Bacteria 1186
488 Ga0207708_10049842 3300026075 Bacteria 3189
489 Ga0207702_10229418 3300026078 Bacteria 1734
490 Ga0207702_10327935 3300026078 Bacteria 1459
491 Ga0207641_10308005 3300026088 Bacteria 1498
492 Ga0207641_10365347 3300026088 Bacteria 1379
493 Ga0207641_10951971 3300026088 Bacteria 854
494 Ga0207641_11255460 3300026088 Bacteria 741
495 Ga0207648_10097170 3300026089 Bacteria 2578
496 Ga0207648_10293405 3300026089 Bacteria 1456
497 Ga0207676_10162342 3300026095 Bacteria 1937
498 Ga0207676_10669756 3300026095 Bacteria 1003
499 Ga0207676_10894876 3300026095 Bacteria 870
500 Ga0207674_10091381 3300026116 Bacteria 3034
501 Ga0207674_10309414 3300026116 Bacteria 1529
502 Ga0207675_100049241 3300026118 Bacteria 3933
503 Ga0207675_100126297 3300026118 Bacteria 2423
504 Ga0207683_10029544 3300026121 Bacteria 4746
505 Ga0207683_10051305 3300026121 Bacteria 3614
506 Ga0207683_10060366 3300026121 Bacteria 3333
507 Ga0207683_10212381 3300026121 Bacteria 1762
508 Ga0207683_10972293 3300026121 Bacteria 788
509 Ga0207683_11677118 3300026121 Bacteria 585
510 Ga0207683_11865045 3300026121 Bacteria 550
511 Ga0207698_10367021 3300026142 Bacteria 1365
512 Ga0207698_10554453 3300026142 Bacteria 1127
513 Ga0209179_1008779 3300027512 Bacteria 1714
514 Ga0209588_1019784 3300027671 Bacteria 2105
515 Ga0207428_10368040 3300027907 Bacteria 1056
516 Ga0207428_10923875 3300027907 Bacteria 616
517 Ga0268266_10001136 3300028379 Bacteria 33101
518 Ga0268266_10003686 3300028379 Bacteria 15118
519 Ga0268266_10094515 3300028379 Bacteria 2624
520 Ga0268266_10190353 3300028379 Bacteria 1873
521 Ga0268266_10388186 3300028379 Bacteria 1318
522 Ga0268266_10654635 3300028379 Bacteria 1011
523 Ga0268266_10731320 3300028379 Bacteria 954
524 Ga0268266_10742093 3300028379 Bacteria 947
525 Ga0268266_11265124 3300028379 Bacteria 713
526 Ga0268265_10061941 3300028380 Bacteria 2873
527 Ga0268265_10124640 3300028380 Bacteria 2129
528 Ga0268265_10192550 3300028380 Bacteria 1762
529 Ga0268265_10198444 3300028380 Bacteria 1738
530 Ga0268265_10480048 3300028380 Bacteria 1167
531 Ga0268265_10564923 3300028380 Bacteria 1082
532 Ga0268264_10192667 3300028381 Bacteria 1859
533 Ga0265318_10079770 3300028577 Bacteria 1209
534 Ga0265323_10018266 3300028653 Bacteria 2715
535 Ga0265322_10117807 3300028654 Bacteria 756
536 Ga0265336_10000415 3300028666 Bacteria 26412
537 Ga0307517_10000098 3300028786 Bacteria 126044
538 Ga0307517_10111579 3300028786 Bacteria 2077
539 Ga0265338_10010045 3300028800 Bacteria 11184
540 Ga0265324_10017627 3300029957 Bacteria 2597
541 Ga0307513_10418783 3300031456 Bacteria 1070
542 Ga0307509_10128015 3300031507 Bacteria 2501
543 Ga0307408_100232397 3300031548 Bacteria 1511
544 Ga0307508_10127944 3300031616 Bacteria 2143
545 Ga0307516_10046388 3300031730 Bacteria 4287
546 Ga0307516_10053240 3300031730 Bacteria 3958
547 Ga0307405_10315500 3300031731 Bacteria 1192
548 Ga0307405_10505101 3300031731 Bacteria 970
549 Ga0307413_10171007 3300031824 Bacteria 1538
550 Ga0307413_11473637 3300031824 Bacteria 601
551 Ga0307410_11425331 3300031852 Bacteria 609
552 Ga0307407_10761295 3300031903 Bacteria 734
553 Ga0307412_10401698 3300031911 Bacteria 1116
554 Ga0307409_100546889 3300031995 Bacteria 1136
555 Ga0307416_101218302 3300032002 Bacteria 858
556 Ga0307414_11399194 3300032004 Bacteria 650
557 Ga0307411_10076739 3300032005 Bacteria 2285
558 Ga0307411_10843113 3300032005 Bacteria 810
559 Ga0307411_11395977 3300032005 Bacteria 641
560 Ga0307415_100297967 3300032126 Bacteria 1334
561 Ga0307507_10560606 3300033179 Bacteria 600
562 Ga0307510_10007562 3300033180 Bacteria 12946
563 Ga0307510_10327889 3300033180 Bacteria 986
564 Ga0373940_0200791 3300035088 Bacteria 655
565 Ga0373940_0336714 3300035088 Bacteria 527
566 Ga0373952_0095837 3300035092 Bacteria 777
567 Ga0373936_0043384 3300035113 Bacteria 1807
568 Ga0373945_0075784 3300035116 Bacteria 1281
569 Ga0373945_0101051 3300035116 Bacteria 1128
570 Ga0373956_0259800 3300035119 Bacteria 826
571 Ga0373943_0121755 3300035170 Bacteria 1387
572 Ga0373943_0139389 3300035170 Bacteria 1305
573 Ga0373943_0152823 3300035170 Bacteria 1251
574 Ga0373946_0176394 3300035171 Bacteria 1012
575 Ga0373946_0267866 3300035171 Bacteria 837
576 Ga0373955_0071154 3300035172 Bacteria 1945
577 Ga0373924_0048356 3300035410 Bacteria 1757
578 Ga0373931_0020927 3300035691 Bacteria 3277
579 Ga0373935_0000520 3300035692 Bacteria 20054
580 Ga0373927_0000046 3300035695 Bacteria 88401
581 Ga0373927_0009305 3300035695 Bacteria 6590
582 Ga0373927_0039246 3300035695 Bacteria 3073
583 Ga0373947_0001392 3300035725 Bacteria 14902
584 Ga0373947_0038071 3300035725 Bacteria 2855
585 Ga0373947_0165966 3300035725 Bacteria 1430
586 Ga0373937_0048844 3300036401 Bacteria 3874
587 Ga0373925_0009905 3300037068 Bacteria 6924
588 Ga0373925_0013452 3300037068 Bacteria 5923
589 Ga0373925_0023664 3300037068 Bacteria 4482
590 Ga0373925_0390614 3300037068 Bacteria 1134
591 Ga0395899_0154753 3300037312 Bacteria 1623
592 Ga0395900_0016187 3300037418 Bacteria 7597
593 Ga0395898_0475635 3300037466 Bacteria 1189
594 Ga0395905_0081275 3300037471 Bacteria 3037
595 Ga0395905_0147099 3300037471 Bacteria 2217
596 Ga0395905_0344285 3300037471 Bacteria 1382
597 Ga0395905_0860914 3300037471 Bacteria 809
598 Ga0436364_0581979 3300037853 Bacteria 989
599 Ga0395901_0097370 3300038443 Bacteria 3084
600 Ga0395901_0733717 3300038443 Bacteria 982
601 Ga0436365_0808674 3300039437 Bacteria 1431
602 Ga0436365_0939911 3300039437 Bacteria 867
603 Ga0436363_1563002 3300039450 Bacteria 508
604 Ga0436362_1153757 3300039453 Bacteria 603
605 Ga0439466_0205551 3300041411 Bacteria 599
606 Ga0439465_0093118 3300041413 Bacteria 1033
607 Ga0451787_184996 3300041441 Bacteria 635
608 Ga0451787_288168 3300041441 Bacteria 801
609 Ga0451793_0362601 3300041452 Bacteria 827
610 Ga0451797_1560878 3300041453 Bacteria 544
611 Ga0451800_1224866 3300041459 Bacteria 940
612 Ga0451802_1494618 3300041460 Bacteria 619
613 Ga0451833_0138182 3300041491 Bacteria 1056
614 Ga0451841_0540834 3300041498 Bacteria 1072
615 Ga0451849_0041184 3300041505 Bacteria 1084
616 Ga0451849_0883225 3300041505 Bacteria 701
617 Ga0451851_0496392 3300041507 Bacteria 914
618 Ga0451851_0647873 3300041507 Bacteria 516
619 Ga0451851_1102993 3300041507 Bacteria 532
620 Ga0451853_1338784 3300041512 Bacteria 1004
621 Ga0451853_3741495 3300041512 Bacteria 815
622 Ga0439458_0159765 3300042157 Bacteria 606
623 Ga0466972_0013988 3300044658 Bacteria 4024
624 Ga0466965_0127668 3300044683 Bacteria 1317
625 Ga0466964_0264110 3300044706 Bacteria 854
626 Ga0466971_0157021 3300044719 Bacteria 1064
627 Ga0466968_0003372 3300044735 Bacteria 5903
628 Ga0466957_0105153 3300044842 Bacteria 1784
629 Ga0466957_1093303 3300044842 Bacteria 575
630 Ga0466960_0008649 3300044901 Bacteria 4174
631 Ga0466960_0130216 3300044901 Bacteria 1327
632 Ga0466959_0154824 3300045049 Bacteria 1614
633 Ga0495617_231405 3300046452 Bacteria 572
634 Ga0495592_0036407 3300046454 Bacteria 3707
635 Ga0495603_0000051 3300046455 Bacteria 50402
636 Ga0495603_0072096 3300046455 Bacteria 2029
637 Ga0495603_0074766 3300046455 Bacteria 1989
638 Ga0495603_0074854 3300046455 Bacteria 1988
639 Ga0495590_0077288 3300046457 Bacteria 1171
640 Ga0495629_0000182 3300046459 Bacteria 56655
641 Ga0495629_0896585 3300046459 Bacteria 581
642 Ga0495638_0021430 3300046460 Bacteria 4259
643 Ga0495638_0139137 3300046460 Bacteria 1418
644 Ga0495638_0266085 3300046460 Bacteria 938
645 Ga0495638_0526218 3300046460 Bacteria 591
646 Ga0495638_0526497 3300046460 Bacteria 591
647 Ga0495641_0006374 3300046461 Bacteria 7658
648 Ga0495653_0200693 3300046463 Bacteria 1354
649 Ga0495650_0130564 3300046471 Bacteria 917
650 Ga0495580_0004021 3300046472 Bacteria 12411
651 Ga0495580_0291464 3300046472 Bacteria 1112
652 Ga0495582_0000137 3300046473 Bacteria 39425
653 Ga0495582_0229642 3300046473 Bacteria 1062
654 Ga0495582_0482908 3300046473 Bacteria 716
655 Ga0495605_0227921 3300046474 Bacteria 803
656 Ga0495639_0002873 3300046475 Bacteria 7493
657 Ga0495639_0254363 3300046475 Bacteria 869
658 Ga0495639_0620166 3300046475 Bacteria 557
659 Ga0495662_0000583 3300046476 Bacteria 16810
660 Ga0495664_0009075 3300046477 Bacteria 5560
661 Ga0495584_0104087 3300046491 Bacteria 1435
662 Ga0495584_0181275 3300046491 Bacteria 1070
663 Ga0495584_0403064 3300046491 Bacteria 695
664 Ga0495584_0507590 3300046491 Bacteria 614
665 Ga0495585_0029073 3300046492 Bacteria 3148
666 Ga0495585_0275017 3300046492 Bacteria 834
667 Ga0495594_0001833 3300046499 Bacteria 11057
668 Ga0495594_0042613 3300046499 Bacteria 2486
669 Ga0495594_0107854 3300046499 Bacteria 1569
670 Ga0495596_0063639 3300046500 Bacteria 1435
671 Ga0495596_0194477 3300046500 Bacteria 788
672 Ga0495607_0393938 3300046501 Bacteria 631
673 Ga0495583_0025223 3300046506 Bacteria 2974
674 Ga0495606_0119588 3300046507 Bacteria 1578
675 Ga0495606_0122562 3300046507 Bacteria 1554
676 Ga0495606_0157047 3300046507 Bacteria 1330
677 Ga0495606_0444146 3300046507 Bacteria 666
678 Ga0495610_0100069 3300046512 Bacteria 1300
679 Ga0495616_0162322 3300046513 Bacteria 1004
680 Ga0495618_0523518 3300046514 Bacteria 713
681 Ga0495620_0159318 3300046515 Bacteria 877
682 Ga0495620_0169679 3300046515 Bacteria 846
683 Ga0495628_0021321 3300046516 Bacteria 5332
684 Ga0495630_0002625 3300046517 Bacteria 12446
685 Ga0495630_0269329 3300046517 Bacteria 1301
686 Ga0495630_1347834 3300046517 Bacteria 537
687 Ga0495631_0015803 3300046518 Bacteria 3609
688 Ga0495631_0089133 3300046518 Bacteria 1328
689 Ga0495631_0197719 3300046518 Bacteria 860
690 Ga0495631_0511994 3300046518 Bacteria 511
691 Ga0495632_0055923 3300046519 Bacteria 1930
692 Ga0495632_0138876 3300046519 Bacteria 1128
693 Ga0495632_0148961 3300046519 Bacteria 1082
694 Ga0495632_0294698 3300046519 Bacteria 720
695 Ga0495643_0012291 3300046522 Bacteria 5170
696 Ga0495643_0074090 3300046522 Bacteria 1784
697 Ga0495643_0250555 3300046522 Bacteria 827
698 Ga0495644_0091283 3300046523 Bacteria 1150
699 Ga0495644_0220346 3300046523 Bacteria 733
700 Ga0495648_0146427 3300046524 Bacteria 1237
701 Ga0495648_0336875 3300046524 Bacteria 694
702 Ga0495663_0064127 3300046525 Bacteria 1159
703 Ga0495666_0386634 3300046526 Bacteria 629
704 Ga0495666_0391769 3300046526 Bacteria 625
705 Ga0495642_0166942 3300046528 Bacteria 956
706 Ga0495652_0037670 3300046529 Bacteria 4194
707 Ga0495654_0349189 3300046530 Bacteria 595
708 Ga0495665_0001239 3300046531 Bacteria 13612
709 Ga0495640_0004375 3300046533 Bacteria 11274
710 Ga0495598_0046091 3300046537 Bacteria 1294
711 Ga0495621_0018971 3300046539 Bacteria 2240
712 Ga0495597_0033416 3300046542 Bacteria 2329
713 Ga0495597_0051282 3300046542 Bacteria 1820
714 Ga0495597_0344586 3300046542 Bacteria 572
715 Ga0495622_0005490 3300046557 Bacteria 5879
716 Ga0495622_0016785 3300046557 Bacteria 3410
717 Ga0495622_0135417 3300046557 Bacteria 1120
718 Ga0495622_0205157 3300046557 Bacteria 877
719 Ga0495633_0109329 3300046558 Bacteria 1282
720 Ga0495633_0242170 3300046558 Bacteria 824
721 Ga0495667_0011352 3300046559 Bacteria 6031
722 Ga0495656_0016955 3300046615 Bacteria 2772
723 Ga0495656_0200527 3300046615 Bacteria 990
724 Ga0495656_0214078 3300046615 Bacteria 961
725 Ga0495668_0026683 3300046616 Bacteria 3276
726 Ga0495668_0029504 3300046616 Bacteria 3099
727 Ga0495668_0029734 3300046616 Bacteria 3086
728 Ga0495668_0052320 3300046616 Bacteria 2260
729 Ga0495668_0203406 3300046616 Bacteria 1084
730 Ga0495668_0482000 3300046616 Bacteria 683
731 Ga0495634_0002221 3300046642 Bacteria 16276
732 Ga0495611_0126279 3300046648 Bacteria 1193
733 Ga0495625_0058534 3300046660 Bacteria 2738
734 Ga0495625_0094413 3300046660 Bacteria 2064
735 Ga0495625_0140569 3300046660 Bacteria 1629
736 Ga0495625_0185164 3300046660 Bacteria 1382
737 Ga0495625_0391655 3300046660 Bacteria 870
738 Ga0495625_0711609 3300046660 Bacteria 592
739 Ga0495635_0001455 3300046663 Bacteria 15846
740 Ga0495635_0978415 3300046663 Bacteria 539
741 Ga0495659_0061547 3300046664 Bacteria 1387
742 Ga0495661_0247668 3300046665 Bacteria 911
743 Ga0495588_0046469 3300046674 Bacteria 2227
744 Ga0495588_0082492 3300046674 Bacteria 1679
745 Ga0495657_0147798 3300046675 Bacteria 1461
746 Ga0495646_0048867 3300046680 Bacteria 2569
747 Ga0495647_0032438 3300046681 Bacteria 1946
748 Ga0495647_0223727 3300046681 Bacteria 831
749 Ga0495658_0469737 3300046683 Bacteria 804
750 Ga0495669_0007993 3300046684 Bacteria 4439
751 Ga0495669_0255061 3300046684 Bacteria 842
752 Ga0495669_0316823 3300046684 Bacteria 752
753 Ga0495669_0470253 3300046684 Bacteria 611
754 Ga0495613_0047965 3300046689 Bacteria 3154
755 Ga0495624_0000898 3300046690 Bacteria 23624
756 Ga0495624_0145609 3300046690 Bacteria 1450
757 Ga0495624_0564993 3300046690 Bacteria 679
758 Ga0495670_0250616 3300046691 Bacteria 944
759 Ga0495670_0334925 3300046691 Bacteria 813
760 Ga0495671_0084494 3300046692 Bacteria 1555
761 Ga0495671_0089738 3300046692 Bacteria 1505
762 Ga0495671_0101526 3300046692 Bacteria 1406
763 Ga0495671_0165256 3300046692 Bacteria 1076
764 Ga0495649_0097432 3300046694 Bacteria 1565
765 Ga0495649_0157413 3300046694 Bacteria 1192
766 Ga0495649_0193763 3300046694 Bacteria 1057
767 Ga0495589_0103033 3300046794 Bacteria 1380
768 Ga0495589_0111160 3300046794 Bacteria 1322
769 Ga0495589_0129712 3300046794 Bacteria 1211
770 Ga0495600_0113596 3300046809 Bacteria 1763
771 Ga0495581_0007805 3300047315 Bacteria 6197
772 Ga0495581_0081158 3300047315 Bacteria 1878
773 Ga0495581_0425001 3300047315 Bacteria 774
774 Ga0495636_0097970 3300047318 Bacteria 1279
775 Ga0495636_0194356 3300047318 Bacteria 925
776 Ga0495636_0656702 3300047318 Bacteria 515
777 Ga0495674_0010092 3300047319 Bacteria 8948
778 Ga0495672_0025981 3300047320 Bacteria 3742
779 Ga0495672_0239678 3300047320 Bacteria 886
780 Ga0495672_0474812 3300047320 Bacteria 560
781 Ga0495676_0110086 3300047321 Bacteria 2023
782 Ga0495676_0127701 3300047321 Bacteria 1840
783 Ga0495680_0404157 3300047322 Bacteria 942
784 Ga0495683_0064475 3300047323 Bacteria 1809
785 Ga0495683_0478557 3300047323 Bacteria 508
786 Ga0495687_027560 3300047443 Bacteria 2657
787 Ga0495687_047752 3300047443 Bacteria 1841
788 Ga0495677_0067538 3300047445 Bacteria 1330
789 Ga0495677_0172629 3300047445 Bacteria 837
790 Ga0495679_138495 3300047446 Bacteria 658
791 Ga0495685_140734 3300047447 Bacteria 786
792 Ga0495673_0022298 3300047469 Bacteria 3107
793 Ga0495673_0103713 3300047469 Bacteria 1146
794 Ga0495673_0160362 3300047469 Bacteria 864
795 Ga0495673_0256112 3300047469 Bacteria 638
796 Ga0495673_0293941 3300047469 Bacteria 584
797 Ga0495684_0045864 3300047471 Bacteria 3344
798 Ga0495686_0143402 3300047472 Bacteria 1408
799 Ga0495686_0250754 3300047472 Bacteria 995
800 Ga0495593_0000469 3300047673 Bacteria 22695
801 Ga0495602_0385915 3300048088 Bacteria 1002
802 Ga0495614_0001926 3300048089 Bacteria 9106
803 Ga0495614_0409324 3300048089 Bacteria 638
804 Ga0495615_0197116 3300048090 Bacteria 620
805 Ga0495626_0275345 3300048091 Bacteria 670
806 Ga0496100_0001098 3300048903 Bacteria 13078
807 Ga0496100_0137249 3300048903 Bacteria 1729
808 Ga0496100_0223380 3300048903 Bacteria 1383
809 Ga0496101_0011608 3300048904 Bacteria 5851
810 Ga0496101_0232477 3300048904 Bacteria 1433
811 Ga0496101_0541375 3300048904 Bacteria 920
812 Ga0496101_0546160 3300048904 Bacteria 916
813 Ga0496101_0933369 3300048904 Bacteria 683
814 Ga0496102_0008520 3300048905 Bacteria 8791
815 Ga0496102_0153816 3300048905 Bacteria 2162
816 Ga0496102_0199985 3300048905 Bacteria 1883
817 Ga0496102_0380154 3300048905 Bacteria 1329
818 Ga0496102_0381156 3300048905 Bacteria 1327
819 Ga0496102_0410219 3300048905 Bacteria 1273
820 Ga0496102_0438380 3300048905 Bacteria 1226
821 Ga0496102_0476410 3300048905 Bacteria 1169
822 Ga0496102_0861647 3300048905 Bacteria 828
823 Ga0496103_0010717 3300048906 Bacteria 5424
824 Ga0496103_0037555 3300048906 Bacteria 2968
825 Ga0496103_0405205 3300048906 Bacteria 876
826 Ga0496103_0424841 3300048906 Bacteria 853
827 Ga0496103_1061774 3300048906 Bacteria 502
828 Ga0496104_0021810 3300048907 Bacteria 5883
829 Ga0496104_0026734 3300048907 Bacteria 5332
830 Ga0496104_0037264 3300048907 Bacteria 4548
831 Ga0496104_0116018 3300048907 Bacteria 2570
832 Ga0496104_0208151 3300048907 Bacteria 1868
833 Ga0496104_1671737 3300048907 Bacteria 539
834 Ga0496104_1770519 3300048907 Bacteria 520
835 Ga0496105_0030338 3300048908 Bacteria 4430
836 Ga0496105_0120936 3300048908 Bacteria 2159
837 Ga0496105_0207100 3300048908 Bacteria 1600
838 Ga0496105_0286727 3300048908 Bacteria 1326
839 Ga0496105_0345596 3300048908 Bacteria 1189
840 Ga0496106_0026464 3300048909 Bacteria 4320
841 Ga0496106_0123661 3300048909 Bacteria 2024
842 Ga0496106_0396800 3300048909 Bacteria 1109
843 Ga0496106_0500576 3300048909 Bacteria 976
844 Ga0496106_0680497 3300048909 Bacteria 821
845 Ga0496107_0021497 3300048910 Bacteria 4560
846 Ga0496108_0042075 3300048911 Bacteria 3813
847 Ga0496108_0196577 3300048911 Bacteria 1749
848 Ga0496108_0208945 3300048911 Bacteria 1694
849 Ga0496108_0256025 3300048911 Bacteria 1523
850 Ga0496108_0540220 3300048911 Bacteria 1017
851 Ga0496109_0049778 3300048912 Bacteria 3815
852 Ga0496109_0293021 3300048912 Bacteria 1534
853 Ga0496109_0365792 3300048912 Bacteria 1362
854 Ga0496109_0380566 3300048912 Bacteria 1333
855 Ga0496110_0066685 3300048913 Bacteria 3183
856 Ga0496110_0091129 3300048913 Bacteria 2727
857 Ga0496110_0288249 3300048913 Bacteria 1495
858 Ga0496110_0515209 3300048913 Bacteria 1088
859 Ga0496110_1657088 3300048913 Bacteria 550
860 Ga0496111_0040302 3300048914 Bacteria 3350
861 Ga0496111_0599596 3300048914 Bacteria 806
862 Ga0496111_0678287 3300048914 Bacteria 751
863 Ga0496112_0023844 3300048915 Bacteria 5852
864 Ga0496112_0025634 3300048915 Bacteria 5663
865 Ga0496112_0174342 3300048915 Bacteria 2116
866 Ga0496112_0353164 3300048915 Bacteria 1412
867 Ga0496112_0731438 3300048915 Bacteria 916
868 Ga0496113_0015425 3300048916 Bacteria 5250
869 Ga0496113_0054139 3300048916 Bacteria 3002
870 Ga0496113_0716176 3300048916 Bacteria 798
871 Ga0496113_1305035 3300048916 Bacteria 564
872 Ga0496114_0033230 3300048917 Bacteria 4249
873 Ga0496114_0345394 3300048917 Bacteria 1316
874 Ga0496114_0400728 3300048917 Bacteria 1215
875 Ga0496114_0793411 3300048917 Bacteria 825
876 Ga0496114_1533587 3300048917 Bacteria 554
877 Ga0496115_0017046 3300048918 Bacteria 5541
878 Ga0496115_0159969 3300048918 Bacteria 1861
879 Ga0496115_0288059 3300048918 Bacteria 1348
880 Ga0496115_0468347 3300048918 Bacteria 1016
881 Ga0496115_0868630 3300048918 Bacteria 697
882 Ga0496116_0198582 3300048919 Bacteria 1053
883 Ga0496118_0065065 3300048921 Bacteria 2670
884 Ga0496118_0086044 3300048921 Bacteria 2186
885 Ga0496118_0087129 3300048921 Bacteria 2167
886 Ga0496118_0120126 3300048921 Bacteria 1716
887 Ga0496118_0153875 3300048921 Bacteria 1434
888 Ga0496118_0310668 3300048921 Bacteria 860
889 Ga0496119_0043743 3300048922 Bacteria 2827
890 Ga0496119_0044857 3300048922 Bacteria 2778
891 Ga0496119_0046704 3300048922 Bacteria 2701
892 Ga0496119_0189829 3300048922 Bacteria 1071
893 Ga0496120_0012720 3300048923 Bacteria 5708
894 Ga0496120_0220357 3300048923 Bacteria 907
895 Ga0496121_0000265 3300048924 Bacteria 109251
896 Ga0496121_0011669 3300048924 Bacteria 9712
897 Ga0496121_0028222 3300048924 Bacteria 5229
898 Ga0496121_0044559 3300048924 Bacteria 3824
899 Ga0496121_0120593 3300048924 Bacteria 1981
900 Ga0496121_0267964 3300048924 Bacteria 1175
901 Ga0496121_0412556 3300048924 Bacteria 881
902 Ga0496121_0479793 3300048924 Bacteria 794
903 Ga0496121_0481239 3300048924 Bacteria 793
904 Ga0496122_0090249 3300048925 Bacteria 2092
905 Ga0496122_0093188 3300048925 Bacteria 2044
906 Ga0496122_0298659 3300048925 Bacteria 870
907 Ga0496124_0213718 3300048927 Bacteria 1457
908 Ga0496124_0226852 3300048927 Bacteria 1400
909 Ga0496124_0262119 3300048927 Bacteria 1271
910 Ga0496124_0331448 3300048927 Bacteria 1085
911 Ga0496125_0000176 3300048928 Bacteria 140746
912 Ga0496125_0034884 3300048928 Bacteria 4426
913 Ga0496125_0137109 3300048928 Bacteria 1709
914 Ga0496125_0206435 3300048928 Bacteria 1281
915 Ga0496126_0011852 3300048929 Bacteria 8969
916 Ga0496126_0015449 3300048929 Bacteria 7677
917 Ga0496126_0072217 3300048929 Bacteria 3070
918 Ga0496126_0122354 3300048929 Bacteria 2255
919 Ga0496126_0177512 3300048929 Bacteria 1811
920 Ga0496126_0262004 3300048929 Bacteria 1437
921 Ga0496126_0444729 3300048929 Bacteria 1044
922 Ga0496126_1143757 3300048929 Bacteria 576
923 Ga0495682_0018288 3300049460 Bacteria 2641
924 Ga0495682_0053712 3300049460 Bacteria 1463
925 Ga0495682_0066545 3300049460 Bacteria 1299
926 Ga0495682_0213564 3300049460 Bacteria 684
927 Ga0501038_0265551 3300049574 Bacteria 1355
928 Ga0501040_0715101 3300049576 Bacteria 724
929 Ga0501042_0374282 3300049578 Bacteria 1031
930 Ga0501067_0604891 3300049583 Bacteria 615
931 Ga0501074_0394278 3300049590 Bacteria 982
932 nmdc:mga03683_107519_c1 3300050489 Bacteria 1230
933 nmdc:mga03683_489268_c1 3300050489 Bacteria 595
934 nmdc:mga03n38_12993_c1 3300050490 Bacteria 3150
935 nmdc:mga03n38_483662_c1 3300050490 Bacteria 693
936 nmdc:mga00v17_69660_c1 3300050491 Bacteria 2177
937 nmdc:mga00v17_866497_c1 3300050491 Bacteria 573
938 nmdc:mga00v17_86774_c1 3300050491 Bacteria 1961
939 nmdc:mga0yw44_124038_c1 3300050492 Bacteria 1666
940 nmdc:mga0yw44_187882_c1 3300050492 Bacteria 1362
941 nmdc:mga0yw44_19763_c1 3300050492 Bacteria 3722
942 nmdc:mga0yw44_31797_c1 3300050492 Bacteria 3071
943 nmdc:mga0yw44_514125_c1 3300050492 Bacteria 813
944 nmdc:mga0yw44_5454_c2 3300050492 Bacteria 5426
945 nmdc:mga0yw44_638498_c1 3300050492 Bacteria 723
946 nmdc:mga0k408_148173_c1 3300050493 Bacteria 1397
947 nmdc:mga0k408_179196_c1 3300050493 Bacteria 1264
948 nmdc:mga0k408_519503_c1 3300050493 Bacteria 705
949 nmdc:mga0k408_571476_c1 3300050493 Bacteria 668
950 nmdc:mga06z11_199789_c1 3300050494 Bacteria 1161
951 nmdc:mga06z11_217349_c1 3300050494 Bacteria 1116
952 nmdc:mga06z11_224365_c1 3300050494 Bacteria 1099
953 nmdc:mga06z11_298090_c1 3300050494 Bacteria 958
954 nmdc:mga06z11_8466_c1 3300050494 Bacteria 4291
955 nmdc:mga06z11_93967_c1 3300050494 Bacteria 1633
956 nmdc:mga04h51_252344_c1 3300050495 Bacteria 707
957 nmdc:mga07m45_107497_c1 3300050496 Bacteria 1605
958 nmdc:mga07m45_190315_c1 3300050496 Bacteria 1193
959 nmdc:mga07m45_54052_c1 3300050496 Bacteria 2270
960 nmdc:mga07m45_59524_c1 3300050496 Bacteria 2161
961 nmdc:mga07m45_81713_c1 3300050496 Bacteria 1845
962 nmdc:mga09592_265942_c1 3300050508 Bacteria 1487
963 nmdc:mga06r32_893179_c1 3300050510 Bacteria 845
964 nmdc:mga08y16_1146190_c1 3300050511 Bacteria 750
965 nmdc:mga08y16_1285024_c1 3300050511 Bacteria 699
966 nmdc:mga08y16_635192_c1 3300050511 Bacteria 1073
967 nmdc:mga0n895_832353_c1 3300050512 Bacteria 912
968 nmdc:mga0rr50_546422_c1 3300050513 Bacteria 986
969 nmdc:mga0a205_695597_c1 3300050515 Bacteria 866
970 Ga0495601_0301790 3300053077 Bacteria 1043
971 Ga0495612_0157977 3300053078 Bacteria 989
972 Ga0495655_0012324 3300053083 Bacteria 1740
973 Ga0495655_0185941 3300053083 Bacteria 672
974 Ga0495595_0031235 3300053084 Bacteria 2393
975 Ga0495619_0187040 3300053085 Bacteria 1433
976 Ga0500578_0070175 3300053086 Bacteria 2234
977 Ga0500646_0389642 3300053090 Bacteria 513
978 Ga0500647_0073432 3300053091 Bacteria 1642
979 Ga0500647_0193872 3300053091 Bacteria 925
980 Ga0500583_0098116 3300053092 Bacteria 1432
981 Ga0500583_0108192 3300053092 Bacteria 1367
982 Ga0500583_0314451 3300053092 Bacteria 764
983 Ga0500566_0000078 3300053094 Bacteria 47558
984 Ga0500566_0076330 3300053094 Bacteria 1873
985 Ga0500640_000121 3300053095 Bacteria 14580
986 Ga0500640_061554 3300053095 Bacteria 1626
987 Ga0500641_0167005 3300053096 Bacteria 948
988 Ga0500641_0341232 3300053096 Bacteria 604
989 Ga0500554_118757 3300053102 Bacteria 891
990 Ga0500555_031686 3300053103 Bacteria 1497
991 Ga0500555_040212 3300053103 Bacteria 1304
992 Ga0500556_0030267 3300053104 Bacteria 1833
993 Ga0500557_000011 3300053105 Bacteria 117471
994 Ga0500569_018952 3300053109 Bacteria 1785
995 Ga0500569_084458 3300053109 Bacteria 1020
996 Ga0500572_000170 3300053111 Bacteria 22863
997 Ga0500572_110411 3300053111 Bacteria 884
998 Ga0500580_261947 3300053113 Bacteria 503
999 Ga0500591_077793 3300053115 Bacteria 1484
1000 Ga0500592_023529 3300053116 Bacteria 993
1001 Ga0500594_0047298 3300053118 Bacteria 1200
1002 Ga0500595_002442 3300053119 Bacteria 9222
1003 Ga0500595_002477 3300053119 Bacteria 9136
1004 Ga0500595_004672 3300053119 Bacteria 6088
1005 Ga0500595_026908 3300053119 Bacteria 1976
1006 Ga0500597_339561 3300053120 Bacteria 588
1007 Ga0500608_084601 3300053122 Bacteria 1492
1008 Ga0500608_232489 3300053122 Bacteria 734
1009 Ga0500614_004910 3300053123 Bacteria 2813
1010 Ga0500642_0000090 3300053130 Bacteria 46849
1011 Ga0500642_0008061 3300053130 Bacteria 3580
1012 Ga0500642_0199702 3300053130 Bacteria 931
1013 Ga0500658_0072704 3300053134 Bacteria 1455
1014 Ga0500658_0143484 3300053134 Bacteria 1072
1015 Ga0500559_0009508 3300053136 Bacteria 4201
1016 Ga0500559_0016864 3300053136 Bacteria 3085
1017 Ga0500561_0058078 3300053137 Bacteria 1076
1018 Ga0500568_0011274 3300053139 Bacteria 4161
1019 Ga0500568_0037366 3300053139 Bacteria 1970
1020 Ga0500590_085257 3300053148 Bacteria 1543
1021 Ga0500590_096457 3300053148 Bacteria 1427
1022 Ga0500603_000081 3300053150 Bacteria 22182
1023 Ga0500603_001666 3300053150 Bacteria 5003
1024 Ga0500620_100532 3300053155 Bacteria 1011
1025 Ga0500627_0007990 3300053158 Bacteria 3728
1026 Ga0500627_0078704 3300053158 Bacteria 1467
1027 Ga0500627_0293144 3300053158 Bacteria 712
1028 Ga0500627_0441489 3300053158 Bacteria 549
1029 Ga0500630_004509 3300053159 Bacteria 6772
1030 Ga0500634_0113939 3300053161 Bacteria 1328
1031 Ga0500638_021427 3300053162 Bacteria 3054
1032 Ga0500639_000028 3300053163 Bacteria 77951
1033 Ga0500639_131622 3300053163 Bacteria 1184
1034 Ga0500636_0049352 3300053177 Bacteria 2476
1035 Ga0500636_0065953 3300053177 Bacteria 2106
1036 Ga0500636_0200828 3300053177 Bacteria 1055
1037 Ga0500636_0398985 3300053177 Bacteria 639
1038 Ga0500637_0020909 3300053178 Bacteria 3551
1039 Ga0500637_0039902 3300053178 Bacteria 2649
1040 Ga0500637_0125685 3300053178 Bacteria 1487
1041 Ga0500570_131027 3300053724 Bacteria 952
1042 Ga0500625_002925 3300053729 Bacteria 6585
1043 Ga0500645_161204 3300053730 Bacteria 615
1044 Ga0500596_000324 3300053735 Bacteria 8556
1045 Ga0500601_003418 3300053737 Bacteria 1721
1046 Ga0500661_002428 3300055283 Bacteria 3509
1047 8056685557 8056681323 Bacteria 8472857
1048 2513673294 2513237098 Bacteria 9902361
1049 2524465862 2524023210 Bacteria 9029266
1050 2728751746 2728368998 Bacteria 8720350
1051 2885387305 2885383462 Bacteria 9473874
1052 2903774357 2903768456 Bacteria 9749579
1053 JGI24750J21931_1029154
1054 JGI25165J46597_1048384
1055 JGI25153J46596_10002543
1056 JGI25153J46596_10010032
1057 JGI25404J52841_10077133
1058 Ga0055539_1006053
1059 Ga0055526_1039847
1060 Ga0055524_1036995
1061 Ga0055531_10001939
1062 Ga0055543_1004643
1063 Ga0055543_1057955
1064 Ga0065165_1001641
1065 Ga0065165_1003060
1066 Ga0065165_1006123
1067 Ga0065165_1060395
1068 Ga0070658_10012558
1069 Ga0070658_10023514
1070 Ga0070658_10102491
1071 Ga0070676_10179448
1072 Ga0070683_100650545
1073 Ga0070683_100983887
1074 Ga0070690_100368152
1075 Ga0070670_100190496
1076 Ga0070670_100431462
1077 Ga0068869_100073753
1078 Ga0068869_100170574
1079 Ga0068869_100726511
1080 Ga0068869_101009791
1081 Ga0070666_10242701
1082 Ga0070682_100036436
1083 Ga0070682_101668905
1084 Ga0068868_100061212
1085 Ga0068868_100149026
1086 Ga0068868_100487663
1087 Ga0068868_100645846
1088 Ga0070660_100773748
1089 Ga0070660_101235354
1090 Ga0070689_100029472
1091 Ga0070661_100090117
1092 Ga0070668_100194020
1093 Ga0070668_101210569
1094 Ga0070669_100077152
1095 Ga0070669_100647603
1096 Ga0070675_100256096
1097 Ga0070675_100444799
1098 Ga0070675_100494369
1099 Ga0070675_100671313
1100 Ga0070671_100300849
1101 Ga0070671_100385853
1102 Ga0070671_100593258
1103 Ga0070674_100018587
1104 Ga0070673_100071969
1105 Ga0070673_100722271
1106 Ga0070673_101609494
1107 Ga0070688_100332304
1108 Ga0070688_100379429
1109 Ga0070659_100890205
1110 Ga0070659_101699146
1111 Ga0070667_100171236
1112 Ga0070667_101488193
1113 Ga0070709_10001487
1114 Ga0070714_100228898
1115 Ga0070713_100375492
1116 Ga0070713_100634323
1117 Ga0070710_10648292
1118 Ga0070701_10812765
1119 Ga0070711_100004982
1120 Ga0070711_100009103
1121 Ga0070711_101810257
1122 Ga0070700_100015418
1123 Ga0070708_100064842
1124 Ga0070708_100690600
1125 Ga0070663_100004680
1126 Ga0070663_100073751
1127 Ga0070663_100089274
1128 Ga0070663_100173392
1129 Ga0070663_100320808
1130 Ga0070678_100045978
1131 Ga0070678_100160527
1132 Ga0070678_100345611
1133 Ga0070678_100700049
1134 Ga0070662_100100370
1135 Ga0070662_100145701
1136 Ga0070662_101016872
1137 Ga0070681_10012465
1138 Ga0068867_100077329
1139 Ga0070706_100473639
1140 Ga0070707_100067780
1141 Ga0070698_100028998
1142 Ga0070698_100901362
1143 Ga0070699_100633627
1144 Ga0070679_100018130
1145 Ga0070697_101292512
1146 Ga0070697_101484915
1147 Ga0068853_100432519
1148 Ga0068853_101321949
1149 Ga0068853_101927947
1150 Ga0070672_100036650
1151 Ga0070672_100719582
1152 Ga0070686_100061402
1153 Ga0070696_101316213
1154 Ga0070665_100013100
1155 Ga0070665_100030279
1156 Ga0070665_100062009
1157 Ga0070665_100142934
1158 Ga0070665_100154541
1159 Ga0070665_100176827
1160 Ga0070665_100475717
1161 Ga0070665_100602714
1162 Ga0070665_101278437
1163 Ga0070665_101315473
1164 Ga0068855_100007494
1165 Ga0068855_100157617
1166 Ga0068855_100173800
1167 Ga0070664_100451693
1168 Ga0070664_101292608
1169 Ga0068854_100081574
1170 Ga0068854_100515802
1171 Ga0068854_100557659
1172 Ga0068856_100225909
1173 Ga0068856_100252283
1174 Ga0068856_100257385
1175 Ga0068856_100446153
1176 Ga0070702_100030788
1177 Ga0070702_100256668
1178 Ga0070702_100504825
1179 Ga0068852_100061105
1180 Ga0068852_100271608
1181 Ga0068852_100391056
1182 Ga0068852_102611884
1183 Ga0068859_100029233
1184 Ga0068859_100157976
1185 Ga0068864_100031862
1186 Ga0068864_100189671
1187 Ga0068864_101871951
1188 Ga0068866_10037646
1189 Ga0068861_100258607
1190 Ga0068861_101750191
1191 Ga0068870_10624676
1192 Ga0068863_100276087
1193 Ga0068863_101101683
1194 Ga0068863_101336523
1195 Ga0068858_100060155
1196 Ga0068858_100266626
1197 Ga0068860_100247013
1198 Ga0068860_100270075
1199 Ga0068862_100085066
1200 Ga0068862_100170988
1201 Ga0068862_100228976
1202 Ga0068862_100315519
1203 Ga0081455_10029662
1204 Ga0081455_10109650
1205 Ga0081455_10265399
1206 Ga0081540_1001339
1207 Ga0081540_1007193
1208 Ga0081540_1007306
1209 Ga0081540_1007993
1210 Ga0081540_1016547
1211 Ga0081540_1026662
1212 Ga0081540_1076704
1213 Ga0081540_1101767
1214 Ga0081540_1116499
1215 Ga0081540_1233257
1216 Ga0081539_10000848
1217 Ga0081539_10012348
1218 Ga0075365_10016437
1219 Ga0075365_10032321
1220 Ga0075365_10041163
1221 Ga0075365_10075675
1222 Ga0075365_10082863
1223 Ga0075365_10504620
1224 Ga0075365_10728030
1225 Ga0075365_10836182
1226 Ga0075368_10003948
1227 Ga0075363_100014770
1228 Ga0075363_100122388
1229 Ga0075363_100155479
1230 Ga0075363_100418580
1231 Ga0075363_100428285
1232 Ga0075364_10058712
1233 Ga0075364_10319221
1234 Ga0075364_10339815
1235 Ga0070715_10503674
1236 Ga0070716_100034174
1237 Ga0070716_100154821
1238 Ga0070716_100367307
1239 Ga0070712_100073635
1240 Ga0070712_100217090
1241 Ga0070712_100377683
1242 Ga0070712_100413189
1243 Ga0070712_100685446
1244 Ga0075362_10086410
1245 Ga0075362_10136051
1246 Ga0075367_10040157
1247 Ga0075367_10075171
1248 Ga0075367_10136379
1249 Ga0075367_10192724
1250 Ga0075367_10388212
1251 Ga0075369_10095939
1252 Ga0075369_10137108
1253 Ga0075369_10206152
1254 Ga0075369_10239910
1255 Ga0075366_10024888
1256 Ga0075366_10032034
1257 Ga0075366_10050422
1258 Ga0075366_10196605
1259 Ga0075366_10483993
1260 Ga0075366_10551633
1261 Ga0075366_10637687
1262 Ga0097621_100647048
1263 Ga0097621_100795721
1264 Ga0075370_10005105
1265 Ga0075370_10020322
1266 Ga0075370_10094272
1267 Ga0075370_10138407
1268 Ga0075370_10201833
1269 Ga0068871_100031423
1270 Ga0068871_100104460
1271 Ga0068871_101681277
1272 Ga0075428_100157112
1273 Ga0075434_100189929
1274 Ga0075434_100444533
1275 Ga0068865_100109505
1276 Ga0068865_100849440
1277 Ga0068865_101658442
1278 Ga0075436_100624736
1279 Ga0097620_100029232
1280 Ga0097620_100157985
1281 Ga0075435_100341705
1282 Ga0099794_10044583
1283 Ga0099794_10102428
1284 Ga0099795_10002812
1285 Ga0099795_10043944
1286 Ga0099795_10142251
1287 Ga0099795_10217289
1288 Ga0105240_10309970
1289 Ga0105240_10502270
1290 Ga0111539_10071397
1291 Ga0111539_11000866
1292 Ga0105245_10060551
1293 Ga0105245_11602772
1294 Ga0105247_10406197
1295 Ga0105243_10501348
1296 Ga0105243_10638961
1297 Ga0105243_10702884
1298 Ga0105243_10737151
1299 Ga0105241_10012915
1300 Ga0105241_10392659
1301 Ga0105241_10514380
1302 Ga0105242_10035582
1303 Ga0105242_10506722
1304 Ga0105242_11303406
1305 Ga0105248_10172136
1306 Ga0105248_11181365
1307 Ga0105237_10018023
1308 Ga0105237_10137184
1309 Ga0105237_10208119
1310 Ga0105237_10448755
1311 Ga0105237_11045357
1312 Ga0105238_10202605
1313 Ga0105238_10572463
1314 Ga0105238_10575588
1315 Ga0105238_11314755
1316 Ga0105249_10311426
1317 Ga0105249_10513667
1318 Ga0105249_10910747
1319 Ga0099796_10009289
1320 Ga0099796_10151157
1321 Ga0099796_10295163
1322 Ga0099796_10520424
1323 Ga0105239_10043909
1324 Ga0105239_10048229
1325 Ga0105239_10126823
1326 Ga0105239_10267474
1327 Ga0105239_10741915
1328 Ga0105239_10753928
1329 Ga0105239_10909995
1330 Ga0105239_11142778
1331 Ga0105239_13432695
1332 Ga0105246_10085714
1333 Ga0105246_10089670
1334 Ga0105246_10199271
1335 Ga0105246_10233447
1336 Ga0105246_10783537
1337 Ga0105246_10839555
1338 Ga0105246_11006436
1339 Ga0157323_1011445
1340 Ga0157323_1011788
1341 Ga0157370_10026904
1342 Ga0157374_10019278
1343 Ga0157374_10066182
1344 Ga0157374_10110883
1345 Ga0157374_10388075
1346 Ga0157374_12404282
1347 Ga0157378_10031236
1348 Ga0157378_10547367
1349 Ga0163162_10044547
1350 Ga0163162_10129391
1351 Ga0163162_10235980
1352 Ga0163162_11179575
1353 Ga0157372_10494544
1354 Ga0157375_10154583
1355 Ga0157375_10174025
1356 Ga0157375_10174992
1357 Ga0157375_10227133
1358 Ga0157375_10836715
1359 Ga0163163_10057665
1360 Ga0163163_10073225
1361 Ga0163163_10203034
1362 Ga0157380_10109465
1363 Ga0157380_10157219
1364 Ga0182008_10227787
1365 Ga0182008_10263072
1366 Ga0157377_10149709
1367 Ga0157377_10686845
1368 Ga0157379_10060147
1369 Ga0157379_10344996
1370 Ga0157379_11240093
1371 Ga0157376_10046724
1372 Ga0157376_10555669
1373 Ga0157376_12963154
1374 Ga0163161_10088848
1375 Ga0163161_11063447
1376 Ga0163161_11198956
1377 Ga0206356_10120399
1378 Ga0214542_1000004
1379 Ga0214542_1037420
1380 Ga0214545_1000005
1381 Ga0214545_1035280
1382 Ga0214543_1000111
1383 Ga0214543_1033779
1384 Ga0213876_10295971
1385 Ga0209563_102320
1386 Ga0209677_101639
1387 Ga0209677_102591
1388 Ga0209148_1006467
1389 Ga0209233_1004340
1390 Ga0209233_1008872
1391 Ga0209233_1027348
1392 Ga0209455_1001472
1393 Ga0209455_1001710
1394 Ga0209564_1006563
1395 Ga0209564_1031518
1396 Ga0209758_1000102
1397 Ga0209758_1003592
1398 Ga0209758_1003725
1399 Ga0209758_1005478
1400 Ga0209758_1046037
1401 Ga0209256_1004953
1402 Ga0209256_1027989
1403 Ga0207426_1002013
1404 Ga0207426_1034873
1405 Ga0209257_1003378
1406 Ga0207697_10065223
1407 Ga0207697_10216603
1408 Ga0207697_10443720
1409 Ga0207692_10407209
1410 Ga0207692_10450057
1411 Ga0207692_10650649
1412 Ga0207642_10020324
1413 Ga0207642_10396173
1414 Ga0207642_10469724
1415 Ga0207710_10164150
1416 Ga0207688_10019383
1417 Ga0207688_10088637
1418 Ga0207688_10089460
1419 Ga0207688_10344528
1420 Ga0207680_10163305
1421 Ga0207680_10169761
1422 Ga0207647_10011423
1423 Ga0207685_10233027
1424 Ga0207699_10129981
1425 Ga0207645_10092170
1426 Ga0207645_10184660
1427 Ga0207705_10061486
1428 Ga0207705_10216616
1429 Ga0207705_10234508
1430 Ga0207684_10186080
1431 Ga0207684_10639812
1432 Ga0207654_10014746
1433 Ga0207654_10463892
1434 Ga0207707_10011000
1435 Ga0207707_11354883
1436 Ga0207695_10234230
1437 Ga0207671_10083323
1438 Ga0207671_10119378
1439 Ga0207671_10307417
1440 Ga0207671_10703069
1441 Ga0207693_10009325
1442 Ga0207693_10017747
1443 Ga0207693_10122761
1444 Ga0207693_10244528
1445 Ga0207663_10025502
1446 Ga0207663_10100721
1447 Ga0207657_10166797
1448 Ga0207657_10556936
1449 Ga0207657_11061567
1450 Ga0207649_10066665
1451 Ga0207652_10158337
1452 Ga0207646_10261644
1453 Ga0207681_10214086
1454 Ga0207681_10901979
1455 Ga0207681_11009395
1456 Ga0207694_10122221
1457 Ga0207694_10572641
1458 Ga0207694_10628845
1459 Ga0207694_11328088
1460 Ga0207650_10562013
1461 Ga0207659_10220386
1462 Ga0207659_10550945
1463 Ga0207687_10299895
1464 Ga0207687_10691934
1465 Ga0207700_11115625
1466 Ga0207700_11704156
1467 Ga0207664_11208542
1468 Ga0207644_10178384
1469 Ga0207644_10273138
1470 Ga0207644_10516522
1471 Ga0207644_11006653
1472 Ga0207690_10268274
1473 Ga0207690_11222132
1474 Ga0207706_10020636
1475 Ga0207706_10218356
1476 Ga0207706_10465884
1477 Ga0207686_10170721
1478 Ga0207686_10256367
1479 Ga0207686_10445902
1480 Ga0207686_10692655
1481 Ga0207709_10041130
1482 Ga0207709_11248901
1483 Ga0207709_11616757
1484 Ga0207670_10039211
1485 Ga0207670_10925765
1486 Ga0207669_10007035
1487 Ga0207704_10062027
1488 Ga0207704_10133658
1489 Ga0207665_10023296
1490 Ga0207665_10101928
1491 Ga0207665_10651826
1492 Ga0207665_11424140
1493 Ga0207691_10103322
1494 Ga0207691_10552016
1495 Ga0207711_10316425
1496 Ga0207711_10334427
1497 Ga0207689_10391727
1498 Ga0207689_10443619
1499 Ga0207689_10627672
1500 Ga0207689_11080396
1501 Ga0207661_10570559
1502 Ga0207661_10576659
1503 Ga0207679_10318278
1504 Ga0207679_11130151
1505 Ga0207667_10050380
1506 Ga0207667_12040882
1507 Ga0207651_10064111
1508 Ga0207668_10008217
1509 Ga0207668_10173030
1510 Ga0207668_10262230
1511 Ga0207668_10683879
1512 Ga0207668_10836322
1513 Ga0207640_10048550
1514 Ga0207640_10123950
1515 Ga0207658_10075824
1516 Ga0207658_10180619
1517 Ga0207658_10554862
1518 Ga0207658_10837159
1519 Ga0207658_11253074
1520 Ga0207658_12090848
1521 Ga0207677_10110732
1522 Ga0207677_10234842
1523 Ga0207677_10527442
1524 Ga0207677_10535789
1525 Ga0207677_11600840
1526 Ga0207703_10193232
1527 Ga0207639_10098940
1528 Ga0207639_10164849
1529 Ga0207639_10167178
1530 Ga0207639_10249569
1531 Ga0207639_11186091
1532 Ga0207678_10004216
1533 Ga0207678_10060134
1534 Ga0207678_10089469
1535 Ga0207678_10099974
1536 Ga0207678_10123758
1537 Ga0207678_10227790
1538 Ga0207678_10397726
1539 Ga0207678_10402078
1540 Ga0207708_10049842
1541 Ga0207702_10229418
1542 Ga0207702_10327935
1543 Ga0207641_10308005
1544 Ga0207641_10365347
1545 Ga0207641_10951971
1546 Ga0207641_11255460
1547 Ga0207648_10097170
1548 Ga0207648_10293405
1549 Ga0207676_10162342
1550 Ga0207676_10669756
1551 Ga0207676_10894876
1552 Ga0207674_10091381
1553 Ga0207674_10309414
1554 Ga0207675_100049241
1555 Ga0207675_100126297
1556 Ga0207683_10029544
1557 Ga0207683_10051305
1558 Ga0207683_10060366
1559 Ga0207683_10212381
1560 Ga0207683_10972293
1561 Ga0207683_11677118
1562 Ga0207683_11865045
1563 Ga0207698_10367021
1564 Ga0207698_10554453
1565 Ga0209179_1008779
1566 Ga0209588_1019784
1567 Ga0207428_10368040
1568 Ga0207428_10923875
1569 Ga0268266_10001136
1570 Ga0268266_10003686
1571 Ga0268266_10094515
1572 Ga0268266_10190353
1573 Ga0268266_10388186
1574 Ga0268266_10654635
1575 Ga0268266_10731320
1576 Ga0268266_10742093
1577 Ga0268266_11265124
1578 Ga0268265_10061941
1579 Ga0268265_10124640
1580 Ga0268265_10192550
1581 Ga0268265_10198444
1582 Ga0268265_10480048
1583 Ga0268265_10564923
1584 Ga0268264_10192667
1585 Ga0265318_10079770
1586 Ga0265323_10018266
1587 Ga0265322_10117807
1588 Ga0265336_10000415
1589 Ga0307517_10000098
1590 Ga0307517_10111579
1591 Ga0265338_10010045
1592 Ga0265324_10017627
1593 Ga0307513_10418783
1594 Ga0307509_10128015
1595 Ga0307408_100232397
1596 Ga0307508_10127944
1597 Ga0307516_10046388
1598 Ga0307516_10053240
1599 Ga0307405_10315500
1600 Ga0307405_10505101
1601 Ga0307413_10171007
1602 Ga0307413_11473637
1603 Ga0307410_11425331
1604 Ga0307407_10761295
1605 Ga0307412_10401698
1606 Ga0307409_100546889
1607 Ga0307416_101218302
1608 Ga0307414_11399194
1609 Ga0307411_10076739
1610 Ga0307411_10843113
1611 Ga0307411_11395977
1612 Ga0307415_100297967
1613 Ga0307507_10560606
1614 Ga0307510_10007562
1615 Ga0307510_10327889
1616 Ga0373940_0200791
1617 Ga0373940_0336714
1618 Ga0373952_0095837
1619 Ga0373936_0043384
1620 Ga0373945_0075784
1621 Ga0373945_0101051
1622 Ga0373956_0259800
1623 Ga0373943_0121755
1624 Ga0373943_0139389
1625 Ga0373943_0152823
1626 Ga0373946_0176394
1627 Ga0373946_0267866
1628 Ga0373955_0071154
1629 Ga0373924_0048356
1630 Ga0373931_0020927
1631 Ga0373935_0000520
1632 Ga0373927_0000046
1633 Ga0373927_0009305
1634 Ga0373927_0039246
1635 Ga0373947_0001392
1636 Ga0373947_0038071
1637 Ga0373947_0165966
1638 Ga0373937_0048844
1639 Ga0373925_0009905
1640 Ga0373925_0013452
1641 Ga0373925_0023664
1642 Ga0373925_0390614
1643 Ga0395899_0154753
1644 Ga0395900_0016187
1645 Ga0395898_0475635
1646 Ga0395905_0081275
1647 Ga0395905_0147099
1648 Ga0395905_0344285
1649 Ga0395905_0860914
1650 Ga0436364_0581979
1651 Ga0395901_0097370
1652 Ga0395901_0733717
1653 Ga0436365_0808674
1654 Ga0436365_0939911
1655 Ga0436363_1563002
1656 Ga0436362_1153757
1657 Ga0439466_0205551
1658 Ga0439465_0093118
1659 Ga0451787_184996
1660 Ga0451787_288168
1661 Ga0451793_0362601
1662 Ga0451797_1560878
1663 Ga0451800_1224866
1664 Ga0451802_1494618
1665 Ga0451833_0138182
1666 Ga0451841_0540834
1667 Ga0451849_0041184
1668 Ga0451849_0883225
1669 Ga0451851_0496392
1670 Ga0451851_0647873
1671 Ga0451851_1102993
1672 Ga0451853_1338784
1673 Ga0451853_3741495
1674 Ga0439458_0159765
1675 Ga0466972_0013988
1676 Ga0466965_0127668
1677 Ga0466964_0264110
1678 Ga0466971_0157021
1679 Ga0466968_0003372
1680 Ga0466957_0105153
1681 Ga0466957_1093303
1682 Ga0466960_0008649
1683 Ga0466960_0130216
1684 Ga0466959_0154824
1685 Ga0495617_231405
1686 Ga0495592_0036407
1687 Ga0495603_0000051
1688 Ga0495603_0072096
1689 Ga0495603_0074766
1690 Ga0495603_0074854
1691 Ga0495590_0077288
1692 Ga0495629_0000182
1693 Ga0495629_0896585
1694 Ga0495638_0021430
1695 Ga0495638_0139137
1696 Ga0495638_0266085
1697 Ga0495638_0526218
1698 Ga0495638_0526497
1699 Ga0495641_0006374
1700 Ga0495653_0200693
1701 Ga0495650_0130564
1702 Ga0495580_0004021
1703 Ga0495580_0291464
1704 Ga0495582_0000137
1705 Ga0495582_0229642
1706 Ga0495582_0482908
1707 Ga0495605_0227921
1708 Ga0495639_0002873
1709 Ga0495639_0254363
1710 Ga0495639_0620166
1711 Ga0495662_0000583
1712 Ga0495664_0009075
1713 Ga0495584_0104087
1714 Ga0495584_0181275
1715 Ga0495584_0403064
1716 Ga0495584_0507590
1717 Ga0495585_0029073
1718 Ga0495585_0275017
1719 Ga0495594_0001833
1720 Ga0495594_0042613
1721 Ga0495594_0107854
1722 Ga0495596_0063639
1723 Ga0495596_0194477
1724 Ga0495607_0393938
1725 Ga0495583_0025223
1726 Ga0495606_0119588
1727 Ga0495606_0122562
1728 Ga0495606_0157047
1729 Ga0495606_0444146
1730 Ga0495610_0100069
1731 Ga0495616_0162322
1732 Ga0495618_0523518
1733 Ga0495620_0159318
1734 Ga0495620_0169679
1735 Ga0495628_0021321
1736 Ga0495630_0002625
1737 Ga0495630_0269329
1738 Ga0495630_1347834
1739 Ga0495631_0015803
1740 Ga0495631_0089133
1741 Ga0495631_0197719
1742 Ga0495631_0511994
1743 Ga0495632_0055923
1744 Ga0495632_0138876
1745 Ga0495632_0148961
1746 Ga0495632_0294698
1747 Ga0495643_0012291
1748 Ga0495643_0074090
1749 Ga0495643_0250555
1750 Ga0495644_0091283
1751 Ga0495644_0220346
1752 Ga0495648_0146427
1753 Ga0495648_0336875
1754 Ga0495663_0064127
1755 Ga0495666_0386634
1756 Ga0495666_0391769
1757 Ga0495642_0166942
1758 Ga0495652_0037670
1759 Ga0495654_0349189
1760 Ga0495665_0001239
1761 Ga0495640_0004375
1762 Ga0495598_0046091
1763 Ga0495621_0018971
1764 Ga0495597_0033416
1765 Ga0495597_0051282
1766 Ga0495597_0344586
1767 Ga0495622_0005490
1768 Ga0495622_0016785
1769 Ga0495622_0135417
1770 Ga0495622_0205157
1771 Ga0495633_0109329
1772 Ga0495633_0242170
1773 Ga0495667_0011352
1774 Ga0495656_0016955
1775 Ga0495656_0200527
1776 Ga0495656_0214078
1777 Ga0495668_0026683
1778 Ga0495668_0029504
1779 Ga0495668_0029734
1780 Ga0495668_0052320
1781 Ga0495668_0203406
1782 Ga0495668_0482000
1783 Ga0495634_0002221
1784 Ga0495611_0126279
1785 Ga0495625_0058534
1786 Ga0495625_0094413
1787 Ga0495625_0140569
1788 Ga0495625_0185164
1789 Ga0495625_0391655
1790 Ga0495625_0711609
1791 Ga0495635_0001455
1792 Ga0495635_0978415
1793 Ga0495659_0061547
1794 Ga0495661_0247668
1795 Ga0495588_0046469
1796 Ga0495588_0082492
1797 Ga0495657_0147798
1798 Ga0495646_0048867
1799 Ga0495647_0032438
1800 Ga0495647_0223727
1801 Ga0495658_0469737
1802 Ga0495669_0007993
1803 Ga0495669_0255061
1804 Ga0495669_0316823
1805 Ga0495669_0470253
1806 Ga0495613_0047965
1807 Ga0495624_0000898
1808 Ga0495624_0145609
1809 Ga0495624_0564993
1810 Ga0495670_0250616
1811 Ga0495670_0334925
1812 Ga0495671_0084494
1813 Ga0495671_0089738
1814 Ga0495671_0101526
1815 Ga0495671_0165256
1816 Ga0495649_0097432
1817 Ga0495649_0157413
1818 Ga0495649_0193763
1819 Ga0495589_0103033
1820 Ga0495589_0111160
1821 Ga0495589_0129712
1822 Ga0495600_0113596
1823 Ga0495581_0007805
1824 Ga0495581_0081158
1825 Ga0495581_0425001
1826 Ga0495636_0097970
1827 Ga0495636_0194356
1828 Ga0495636_0656702
1829 Ga0495674_0010092
1830 Ga0495672_0025981
1831 Ga0495672_0239678
1832 Ga0495672_0474812
1833 Ga0495676_0110086
1834 Ga0495676_0127701
1835 Ga0495680_0404157
1836 Ga0495683_0064475
1837 Ga0495683_0478557
1838 Ga0495687_027560
1839 Ga0495687_047752
1840 Ga0495677_0067538
1841 Ga0495677_0172629
1842 Ga0495679_138495
1843 Ga0495685_140734
1844 Ga0495673_0022298
1845 Ga0495673_0103713
1846 Ga0495673_0160362
1847 Ga0495673_0256112
1848 Ga0495673_0293941
1849 Ga0495684_0045864
1850 Ga0495686_0143402
1851 Ga0495686_0250754
1852 Ga0495593_0000469
1853 Ga0495602_0385915
1854 Ga0495614_0001926
1855 Ga0495614_0409324
1856 Ga0495615_0197116
1857 Ga0495626_0275345
1858 Ga0496100_0001098
1859 Ga0496100_0137249
1860 Ga0496100_0223380
1861 Ga0496101_0011608
1862 Ga0496101_0232477
1863 Ga0496101_0541375
1864 Ga0496101_0546160
1865 Ga0496101_0933369
1866 Ga0496102_0008520
1867 Ga0496102_0153816
1868 Ga0496102_0199985
1869 Ga0496102_0380154
1870 Ga0496102_0381156
1871 Ga0496102_0410219
1872 Ga0496102_0438380
1873 Ga0496102_0476410
1874 Ga0496102_0861647
1875 Ga0496103_0010717
1876 Ga0496103_0037555
1877 Ga0496103_0405205
1878 Ga0496103_0424841
1879 Ga0496103_1061774
1880 Ga0496104_0021810
1881 Ga0496104_0026734
1882 Ga0496104_0037264
1883 Ga0496104_0116018
1884 Ga0496104_0208151
1885 Ga0496104_1671737
1886 Ga0496104_1770519
1887 Ga0496105_0030338
1888 Ga0496105_0120936
1889 Ga0496105_0207100
1890 Ga0496105_0286727
1891 Ga0496105_0345596
1892 Ga0496106_0026464
1893 Ga0496106_0123661
1894 Ga0496106_0396800
1895 Ga0496106_0500576
1896 Ga0496106_0680497
1897 Ga0496107_0021497
1898 Ga0496108_0042075
1899 Ga0496108_0196577
1900 Ga0496108_0208945
1901 Ga0496108_0256025
1902 Ga0496108_0540220
1903 Ga0496109_0049778
1904 Ga0496109_0293021
1905 Ga0496109_0365792
1906 Ga0496109_0380566
1907 Ga0496110_0066685
1908 Ga0496110_0091129
1909 Ga0496110_0288249
1910 Ga0496110_0515209
1911 Ga0496110_1657088
1912 Ga0496111_0040302
1913 Ga0496111_0599596
1914 Ga0496111_0678287
1915 Ga0496112_0023844
1916 Ga0496112_0025634
1917 Ga0496112_0174342
1918 Ga0496112_0353164
1919 Ga0496112_0731438
1920 Ga0496113_0015425
1921 Ga0496113_0054139
1922 Ga0496113_0716176
1923 Ga0496113_1305035
1924 Ga0496114_0033230
1925 Ga0496114_0345394
1926 Ga0496114_0400728
1927 Ga0496114_0793411
1928 Ga0496114_1533587
1929 Ga0496115_0017046
1930 Ga0496115_0159969
1931 Ga0496115_0288059
1932 Ga0496115_0468347
1933 Ga0496115_0868630
1934 Ga0496116_0198582
1935 Ga0496118_0065065
1936 Ga0496118_0086044
1937 Ga0496118_0087129
1938 Ga0496118_0120126
1939 Ga0496118_0153875
1940 Ga0496118_0310668
1941 Ga0496119_0043743
1942 Ga0496119_0044857
1943 Ga0496119_0046704
1944 Ga0496119_0189829
1945 Ga0496120_0012720
1946 Ga0496120_0220357
1947 Ga0496121_0000265
1948 Ga0496121_0011669
1949 Ga0496121_0028222
1950 Ga0496121_0044559
1951 Ga0496121_0120593
1952 Ga0496121_0267964
1953 Ga0496121_0412556
1954 Ga0496121_0479793
1955 Ga0496121_0481239
1956 Ga0496122_0090249
1957 Ga0496122_0093188
1958 Ga0496122_0298659
1959 Ga0496124_0213718
1960 Ga0496124_0226852
1961 Ga0496124_0262119
1962 Ga0496124_0331448
1963 Ga0496125_0000176
1964 Ga0496125_0034884
1965 Ga0496125_0137109
1966 Ga0496125_0206435
1967 Ga0496126_0011852
1968 Ga0496126_0015449
1969 Ga0496126_0072217
1970 Ga0496126_0122354
1971 Ga0496126_0177512
1972 Ga0496126_0262004
1973 Ga0496126_0444729
1974 Ga0496126_1143757
1975 Ga0495682_0018288
1976 Ga0495682_0053712
1977 Ga0495682_0066545
1978 Ga0495682_0213564
1979 Ga0501038_0265551
1980 Ga0501040_0715101
1981 Ga0501042_0374282
1982 Ga0501067_0604891
1983 Ga0501074_0394278
1984 nmdc:mga03683_107519_c1
1985 nmdc:mga03683_489268_c1
1986 nmdc:mga03n38_12993_c1
1987 nmdc:mga03n38_483662_c1
1988 nmdc:mga00v17_69660_c1
1989 nmdc:mga00v17_866497_c1
1990 nmdc:mga00v17_86774_c1
1991 nmdc:mga0yw44_124038_c1
1992 nmdc:mga0yw44_187882_c1
1993 nmdc:mga0yw44_19763_c1
1994 nmdc:mga0yw44_31797_c1
1995 nmdc:mga0yw44_514125_c1
1996 nmdc:mga0yw44_5454_c2
1997 nmdc:mga0yw44_638498_c1
1998 nmdc:mga0k408_148173_c1
1999 nmdc:mga0k408_179196_c1
2000 nmdc:mga0k408_519503_c1
2001 nmdc:mga0k408_571476_c1
2002 nmdc:mga06z11_199789_c1
2003 nmdc:mga06z11_217349_c1
2004 nmdc:mga06z11_224365_c1
2005 nmdc:mga06z11_298090_c1
2006 nmdc:mga06z11_8466_c1
2007 nmdc:mga06z11_93967_c1
2008 nmdc:mga04h51_252344_c1
2009 nmdc:mga07m45_107497_c1
2010 nmdc:mga07m45_190315_c1
2011 nmdc:mga07m45_54052_c1
2012 nmdc:mga07m45_59524_c1
2013 nmdc:mga07m45_81713_c1
2014 nmdc:mga09592_265942_c1
2015 nmdc:mga06r32_893179_c1
2016 nmdc:mga08y16_1146190_c1
2017 nmdc:mga08y16_1285024_c1
2018 nmdc:mga08y16_635192_c1
2019 nmdc:mga0n895_832353_c1
2020 nmdc:mga0rr50_546422_c1
2021 nmdc:mga0a205_695597_c1
2022 Ga0495601_0301790
2023 Ga0495612_0157977
2024 Ga0495655_0012324
2025 Ga0495655_0185941
2026 Ga0495595_0031235
2027 Ga0495619_0187040
2028 Ga0500578_0070175
2029 Ga0500646_0389642
2030 Ga0500647_0073432
2031 Ga0500647_0193872
2032 Ga0500583_0098116
2033 Ga0500583_0108192
2034 Ga0500583_0314451
2035 Ga0500566_0000078
2036 Ga0500566_0076330
2037 Ga0500640_000121
2038 Ga0500640_061554
2039 Ga0500641_0167005
2040 Ga0500641_0341232
2041 Ga0500554_118757
2042 Ga0500555_031686
2043 Ga0500555_040212
2044 Ga0500556_0030267
2045 Ga0500557_000011
2046 Ga0500569_018952
2047 Ga0500569_084458
2048 Ga0500572_000170
2049 Ga0500572_110411
2050 Ga0500580_261947
2051 Ga0500591_077793
2052 Ga0500592_023529
2053 Ga0500594_0047298
2054 Ga0500595_002442
2055 Ga0500595_002477
2056 Ga0500595_004672
2057 Ga0500595_026908
2058 Ga0500597_339561
2059 Ga0500608_084601
2060 Ga0500608_232489
2061 Ga0500614_004910
2062 Ga0500642_0000090
2063 Ga0500642_0008061
2064 Ga0500642_0199702
2065 Ga0500658_0072704
2066 Ga0500658_0143484
2067 Ga0500559_0009508
2068 Ga0500559_0016864
2069 Ga0500561_0058078
2070 Ga0500568_0011274
2071 Ga0500568_0037366
2072 Ga0500590_085257
2073 Ga0500590_096457
2074 Ga0500603_000081
2075 Ga0500603_001666
2076 Ga0500620_100532
2077 Ga0500627_0007990
2078 Ga0500627_0078704
2079 Ga0500627_0293144
2080 Ga0500627_0441489
2081 Ga0500630_004509
2082 Ga0500634_0113939
2083 Ga0500638_021427
2084 Ga0500639_000028
2085 Ga0500639_131622
2086 Ga0500636_0049352
2087 Ga0500636_0065953
2088 Ga0500636_0200828
2089 Ga0500636_0398985
2090 Ga0500637_0020909
2091 Ga0500637_0039902
2092 Ga0500637_0125685
2093 Ga0500570_131027
2094 Ga0500625_002925
2095 Ga0500645_161204
2096 Ga0500596_000324
2097 Ga0500601_003418
2098 Ga0500661_002428
2099 8056685557
2100 2513673294
2101 2524465862
2102 2728751746
2103 2885387305
2104 2903774357

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

24

139

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zyf-assembly2.cif.gz_C crystal structure of streptococcus pyogenes type ii-a cas2 0.6766 2 117
3exc-assembly1.cif.gz_X-2 structure of the rna'se sso8090 from sulfolobus solfataricus 0.6616 1 113
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6369 1 114
5zyf-assembly3.cif.gz_F crystal structure of streptococcus pyogenes type ii-a cas2 0.6278 2 117
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.6131 1 114
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6369 1 114 3.30.70.1060
4tnoA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6346 1 113 3.30.70.240
4tnoA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6277 1 113 3.30.70.240
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.621 1 114 3.30.70.1060
af_Q1LYG6_500_570_3.30.70.870 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 0.5972 1 112 3.30.70.870
ID Description Score Start End GO Terms
AF-A0A7W1B6H1-F1-model_v4 YciI family protein 0.7527 1 126
AF-A0A503WCB3-F1-model_v4 YciI family protein 0.7526 1 129
AF-X6EJ73-F1-model_v4 deleted 0.7492 1 132
AF-A0A0F6YML2-F1-model_v4 PhnB protein 0.7471 1 125
AF-A0A4Q1UNU8-F1-model_v4 Transcription initiation protein 0.7456 1 130

Map